3CKGA

The crystal structure of ospa deletion mutant
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
236
structure length
236
Chain Sequence
b'GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSNGSSTEERADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title The promiscuity of beta-strand pairing allows for rational design of beta-sheet face inversion
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 46
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2008-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 3ckgA01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 3ckgA02
1FJ1E 2OY1O 1P4PA 1OSPO 2FKGA 2OY5O 2HKDA 2OL7A 2I5VO 2OY8A 3EC5A 2OL6O 5B2AO 2AF5A 2OY7A 2I5ZO 2PI3O 2FKJA 5B3MO 5B11O 3CKGA 3AUMO 2OYBO 2G8CO 5B10O 2OL8O 3CKFA
chains in the Genus database with same CATH superfamily
2A8GA 2LFOA 4DQ3A 3RE5A 1GT3A 4ZGFA 1K73G 5HTEA 3U9PC 1UREA 1VWQB 1ZNEA 4O3ZA 1KC8G 2RCTA 2X8SA 4GJVA 1AVEA 3CMEE 3CCRE 4Y0QA 3T2XA 1OEKA 1SWFA 4CDEA 4EXZA 2HYSA 5LJGA 4EEJA 3WJDA 4YCEA 1I04A 4YBPA 2N93A 1S2PA 4I60A 3FW4A 4I95A 1VQ6E 1YHQE 1G85A 3WJGA 3HPEA 1DC9A 1SWLA 1UYOX 2Q39A 4XMHA 4QZUA 4I3CA 5D8JA 2IZDB 4Y0PA 3DSZA 3HWDA 4IO9E 3LV4A 1CRBA 1VWIB 3FEKA 4CV7A 1WBIA 2JU7A 1K24A 4Y0SA 2WEXA 3G4SE 4ZHCA 5LKEA 1SWCA 4QZTA 2BT9A 1SLEB 2LBAA 4QRLA 4NW4A 3UAQA 1OEJA 2JMBA 1HMSA 1SWJA 4U8UN 5HCDC 3DLLE 4TQ2A 5KIDA 2ZJPE 1N0SA 1YWAA 2G7BA 3AUMO 1N8RG 4CPHA 2OFMX 1EIOA 2IZCB 2R73A 1YJ9E 5F6BA 3WBGA 3STKA 3APWA 5AQ6A 2FKGA 3FR2A 1BSQA 3HOLA 1JYDA 1EUOA 1X8NA 1YP7A 4COTA 2Z4IA 3F8AA 1VQPE 5H1SI 1RBPA 3CCLE 1LIEA 4CDDA 1KGLA 1KL5A 1Q86G 1CBRA 3HTYA 2X45A 1SWBA 3ZW0A 4LZUA 3U03A 1KL3A 1YUPA 5FAZA 5D47A 1YWDA 3KZAA 3P6CA 4GK9A 2FRSA 2NP1A 2WR6A 4CDFA 1VWBB 3RDMA 4CPFA 1Y9LA 2L68A 4INNA 5GAEG 3F6ZB 3HWEA 4GRJA 1VQ8E 3PQSA 3VG3A 1SRFA 3N91A 3GE2A 4YFPA 3G6EE 1FDQA 3ZW1B 5KICA 1KOIA 1T0VA 4Z2OA 1VYGA 5EDCA 1YI2E 4BX7A 5DPQA 2I5VO 5B27A 2CAMA 3BY0A 3CF5E 2Y32A 3KFHA 1QG5A 2ZJRE 4WBKA 1KQWA 4Y5DA 1B4MA 1VWAB 1SLGB 5IO5A 1NC9A 1GM6A 4GU8A 2W2AA 1ZNGA 4IOAE 2NNDA 1B0OA 1SREA 4AYHA 4I3DA 1TOWA 3CCVE 1QQSA 2RTFB 3CMPA 1FENA 2OL8O 5JVHE 3AKMA 2OY1O 3PEDA 2LKKA 5H9KA 3RZYA 4R0BA 2L9CA 2ZJQE 4GETA 2OL7A 1RSTB 4OS3A 2O62A 2X32A 1SXUA 2XKLA 4BX5A 4I9SA 1W4TA 3B2IA 4LZVA 5HZ8A 5FQ7E 1PM1X 2KT4B 3RSWA 1AB0A 1KQXA 4YH0A 1SXXA 2Q9SA 2Y3FA 1VWLB 3T2WA 2RD7C 1VWNB 5IO7A 1X8OA 1SWTA 4ALOA 5LKFA 5HZQA 1E06A 3PP6A 3OBLA 2IZEB 4IRWA 2RTMA 4NP1A 2X55A 5HZ6A 5H8TA 2HZQA 3CPWE 1VWMB 1X8UA 3NQKA 3B2LA 1BM5A 3TGAA 4PJ2A 1E2TA 4JGLA 4BJ8A 1T8VA 2OVDA 4GH7A 1RL6A 4YFRA 2FS7A 3KVNA 3NP1A 5K67A 5HTDA 2DJGA 2OF8A 1L6MA 5C0NA 1SMPI 5GAHG 1NP1A 3H3IA 1JQPA 4TKBA 1SWOA 3QQ2A 3STNA 1STPA 4GUZA 3LTWA 4QQ1A 2KW1A 2OVSA 1LDOA 1LF7A 4MIRA 2OFRX 3J7ZG 4O4SA 1KQSE 1H91A 1I05A 1LELA 4UU2A 1HMTA 5B5GA 1SWKA 1GKAB 2RA6A 4AZMA 2BHVA 5IO6A 2YG2A 3ZI8A 1NP4A 4QGWA 2X34A 1YIVA 4O49A 1N4JA 2A0AA 2QOMA 4OEMA 4YKMA 2GTLM 1PTSA 3P6HA 3AEHA 1LIFA 5B11O 3T6LA 4L3RA 4N7CA 1A2DA 1LIDA 4NNTA 4BGFA 3E3CA 1IFBA 3JSQA 1O1UA 2OL6O 4OMXA 2WQAE 2RTBB 3U0DA 3RKGA 1E02A 3WJEA 2FHLA 3CKGA 1BSYA 1VQ9E 1S44A 3D9WA 1GX9A 1JJUA 4CDCA 2HNXA 1TW4A 3WOVA 1EI5A 5B29A 1NDJA 5HWZA 3VG4A 4AZOA 2WWPA 4TKJA 3RY2A 5DG4A 4U8UO 4JO6A 2X4MA 4BQUA 1NBXA 2QM9A 2FLJA 2ZSCA 1OSPO 2RTDB 4GKCA 2NNQA 1VPRA 3VU1A 4WFUA 1QVGE 1Z24A 3KFFA 2VFCA 3WZQA 1VQME 5CSEA 5L8IA 1G74A 4A1YA 4YCHA 1T68X 3PDFA 3I0AA 4M6SA 2CQLA 2OTLE 4NV7A 4EDEA 2IZFB 2RN4A 2RTIB 1LNMA 1QWDA 2RTKA 3CC7E 4QGVA 3RDOA 4O3WA 1U0XA 1MOYA 2FHNX 1PBOA 5LJBA 2K62A 4ZH9A 2RTOB 1GXAA 1XKIA 3TF6A 3SAOA 1VQLE 3Q6LA 3D4RA 3TZSA 2G8CO 3HOEA 1SWNA 1LKEA 3TGBA 1UZ2X 1A3YA 3CCQE 5D45A 5GAGG 1M1KG 1VWRB 5EEEA 5DM6E 1N43A 4KH8A 4ZHHA 4O9SA 4BCSA 1S7DA 4YDBA 2RTPB 2CM4A 3O19A 4IB6A 5LJCA 1BLRA 4ORUA 3RDXA 3EM0A 2LA7A 3FEPA 5FQ8E 2NNEA 5BVTA 5LJEA 5H9NA 2FKJA 4WFNE 5B3MO 2RTCB 3P6FA 3BU9A 2WPUA 4XMEA 1OBPA 1MX8A 4U46A 4A60A 4DQ4A 1FJ1E 1FTPA 4AZRA 4IB9A 1RXJA 1IFCA 1NQMA 4N7DA 3RWXA 4GGZA 5CE4A 3RDUA 1IJ8A 2FGSA 1LCVA 1Q7YG 2M4LA 1NQNA 1X8QA 4KC8A 1LCWA 2MO5A 5FQ6E 4FBOA 1JYJA 4GZVA 2IZKA 3C77X 1Q82G 3C76X 1KT6A 1DZMA 1VWJB 3FA6A 3HK1A 4ORXA 4I6SA 3VG2A 4HPAA 1GX3A 1MX7A 1QVFE 3UEXA 4ODDA 3IG9A 4A8ZA 2FT9A 2GC9A 2BSZA 1EQDA 1EALA 3SOTA 1E5PA 4ZR2A 3P6EA 1KD1G 4O4XA 1AQBA 3OW2E 5MLCH 3WJBA 1QFVA 3CCSE 3FYFA 1VWKB 3CC4E 1QABE 4ES7A 3IA8A 4GGTA 1DZKA 3OJYC 2X56A 1G7NA 1RAVA 3EYCA 3EMMA 1GX8A 2G78A 4XMDA 1ACDA 3WVMA 1DFVA 2Q2PA 4AZQA 2HLVA 4MISA 3BLGA 1I4UA 2GTLN 3AKNA 2GTFX 3PIPE 3WZNA 3SLTA 2C1QA 1JMZA 3S26A 3CCUE 1G5WA 4WFAE 2LB6A 2Q2MA 3G7XA 1PBYA 4O3YA 1IKEA 2ACOA 4WFVA 1LICA 3FMZA 3T1DA 2L67A 2OY8A 4ZFXA 4TKHA 3MM0A 1FEMA 1GT5A 3STMX 2OZQA 4IB8A 1BEBA 2AT3X 4DNEA 4FBVA 1SWHA 4ARHA 4LQZA 2A5BA 1JV4A 2GJ5A 2IZJA 1DZJA 3NPOA 1SLFB 4HPBA 1ERXA 2JOZA 4CPHB 3RE6A 1LIBA 4XMFA 1SY3A 3S5XA 2CZUA 1DV9A 2PI3O 3F9DA 2RTNB 2IZHB 4GNYA 5BYPA 2PY1A 3ZUOA 1WUBA 3MVFA 1YITE 2FTBA 3RDQA 2AT6X 1BRPA 4XMGA 3T6FA 1TXLA 5F1EA 1ADLA 2FR2A 2HZRA 3ELXA 3WZPA 3SLJA 5BVQA 1MDCA 4BX6A 1KT5A 4U67E 1XCAA 3GAQA 4IABA 2QEXE 2CM9A 3KFGA 3ZW0B 1KL4A 3VG5A 5IRWA 2ASNX 3MBTA 1TVQA 4WFBE 1LUQA 1CBIA 2W2FA 5LJHA 2FWVA 1IW2A 1BRQA 3VG6A 2AT5X 3CBSA 2R74A 3BSZE 2A13A 3IFBA 4ORWA 1QY2A 5F7GA 2ZAGA 3DTQA 3VHHA 2IZAA 2HMBA 1EW3A 4ORSA 4FBRA 1BJ7A 5L3YA 3C78X 4GD9A 4BX7B 3BS2A 2YMSA 1MM9A 1P6PA 1HXLA 1PEEA 3RDSA 1VQNE 1HXZA 2DJFA 2BS6A 2MF6A 4U9CA 1RXKA 2POAA 4ORYA 3FLLA 4WHIA 2C4IA 4YGZA 4JHQA 1SRGA 4BBOA 2CBSA 5K06A 2F01A 4KCAA 3APVA 1LFOA 3NX1A 5IXGA 1GGLA 3SLOA 3PQUA 3O2YA 4HPDA 3RBYA 1VQ7E 2AL0X 1N9MA 1B56A 4HPCA 2AT8X 4BX5B 1SRJA 4YMYA 4JNJA 1BSOA 4ORRA 1STSB 2JU8A 4RUNA 2FR3A 3FIDA 3ZWEA 3ZZVA 1NJIG 3D96A 4YBUA 3FA7A 2OFBA 1AELA 1JMXA 1ZNLA 3CKFA 1BWYA 3FW5A 1VWEB 3ZQ3A 4M7MA 3VHIA 2WEWA 3FA9A 2OVEA 3OD9A 1HQQA 2RTHB 4TNNA 1I78A 2ALLX 2CBRA 1SWRA 3MG5A 2IZGB 2G5LA 2VFBA 3FR5A 4CPEA 3B2HA 2OY5O 2JW1A 1W2BE 3JS1A 1EIIA 2AF5A 1JJ2E 4IBAA 1AVDA 1O8VA 3CCEE 1JJXA 3ELZA 1KT3A 3NQ3A 3L4RA 1YWBA 4FGIB 1UYNX 4YGGA 5L8NA 1Q81G 4Z28A 4IAWA 2QMIA 4OELA 1CJ5A 2Y3EA 1OEEA 1Y55X 1SWEA 2A2GA 1Y0GA 1LPJA 2GTLO 1SA8A 5B10O 1W6FA 4NYRA 1JIWI 1ZNHA 2QOSC 1OPBA 5F6ZA 3NR3A 4EQAC 1SWGA 2RQ0A 1CBSA 1HQPA 1IIUA 1YIJE 1GT4A 1YWCA 1KXOA 5GADG 1ZNKA 5H9LA 5CHKA 1SRIA 4QNIA 4ZJ0A 1OBUA 1ML7A 1JBHA 3FELA 3VE2A 1SXWA 4NYQA 4WF9E 3OE3A 2RTEB 4UY8G 3P6DA 3WYQA 2A5CA 3WXQA 2RTRB 4MVEA 4ZHGA 3B2JA 1KZWA 2R56A 4KIIA 2IZBA 3ZW1A 3VPJE 1LDQA 3WYPA 1HBQA 4HFOA 4I9RA 3D97A 4ZCBA 1K3BA 1OBQA 4MVLA 1RJLC 4WCEE 1MEPA 2UYWA 4YFQA 3SZIA 1I06A 1QFTA 4Y0RA 2OY7A 5AJBA 1VWOB 1R0UA 2G79A 2MJIA 1FELA 2JU3A 1A57A 5HAEA 2VDFA 5BVSA 3S60A 4NLIA 4U3QA 1HN2A 3KQ0A 1K9MG 3UEVA 3FA8A 1VWHB 1OPAA 2K23A 1B8EA 1SY1A 2QCBA 4ZHFA 4Y59A 4BVMA 1VWPB 2I5ZO 3BX7A 1KT7A 3BRNA 4ML7B 3MX7A 1IKJA 2Z4HA 5JR8A 2UZ2A 2QO5A 3CMAE 4GDAA 4BOEA 2MHDA 1STRB 4GDZA 2AVIA 2W2BA 1RLBE 3B2KA 4IB7A 4YKOA 2A3FX 1SWAA 5AN9B 1O1VA 3RY1A 4QYNA 5HL7E 3HWFA 1DF8A 2HKDA 1NGLA 3CXCE 3APUA 4C5PA 3TGCA 2QO4A 1Y52X 1SWDA 5EDBA 4Z2VA 1SY2A 5HA1A 1SY0A 4EFGA 1AVGI 1EPAA 3PPTA 2FS6A 2WSJA 3EC5A 1QY0A 2ANSA 5AEOA 1MUPA 3FENA 2MWHA 1GT1A 4QAEA 4ON1A 4EKVA 5FENA 4KT5A 4XMCA 3UEWA 3CR6A 4PSQA 4Z27A 4IOCE 1ICMA 1LCZA 4GJSA 4NNSA 2RTLA 3CQNA 5HA0A 3PECA 3CD6E 3HWGA 2X8TA 5F58A 5LJDA 4QYPA 1YJWE 2P8GA 4ZHDA 1ZNDA 4L1NA 4AZNA 1QY1A 1KFFA 4ID2A 2BLGA 4CK4A 1RXHA 3CQRA 1HMRA 1SLDB 1EPBA 2F09A 1GKAA 2RTQB 3PK2A 1KT4A 1SWQA 1KZXA 4OKAA 1VWGB 3NADA 4GE1A 5KHPA 3ZUIA 5EZ2A 1Y53X 4IMOA 1SWUA 4B55A 2RTJA 3G71E 3APXA 2GH7A 3PH5A 4HWMA 4A1HA 5HZ5A 5LJKA 2KTDA 1PMPA 3EBKA 1SRHA 3VHMA 1D3SA 5HCEC 3BU1A 2OYBO 3ZW2A 4KC7A 2EU7X 2AMMX 1SWPA 1Y9TA 1X89A 5H9AA 1VQ5E 3FR4A 2AH7X 1CBQA 5F2BA 1FE3A 5B2AO 3NX2A 1HBPA 2BS5A 1JZUA 4I3BA 2RTGB 5CYBA 1N7YA 3IGEA 1VWCB 1YP6A 3QKGA 4Z6JA 4MVKA 3P6GA 1VQ4E 4CSBA 2C1SA 2QA4E 2OFAA 1EXSA 5EPQA 1K8AG 2IFBA 3SZJA 2LBVA 3VGWA 4OS8A 3X00A 2KD2A 2AT0X 5IRAA 4U8UM 3V8UA 2AKQA 3NQ9A 4ZGUA 5D48A 1DZPA 1N9YA 2BC3A 2JGSA 1E00A 1VWFB 3P24A 5K68A 3CCJE 4OMWA 2L5PA 3WZOA 4Z2PA 2F73A 4IMNA 1A18A 3VG7A 1ICNA 3VE1A 5EEDA 2WQ9A 1S72E 2Q4NA 1MK5A 4NV8A 4RUUA 3NBXX 4YGHA 5HZ9A 1ALBA 3I56E 4CPIA 3LHNA 1VQOE 3EBWA 4LKTA 2OVAA 3WJCA 3BDRA 3CCME 2ACPX 1VWDB 5FFHA 4K19A 2XSTA 4NLJA 3CC2E 1VYFA 4UU3A 1DF3A 3EW2A 3S5VA 3KFIA 1X8PA 3PIOE 3I55E 4YDAA 1RSUB 5B5FA 1P4PA 2OTJE 1MVGA 3O22A 4OS0A 5IRUA 4IAXA 2OF9A 3Q34A 2X46A 5AJCA 2JN3A 2A2UA 1VQKE 1SXYA 2CZTA 4GNWA 4FQBB 2IZIA 3P02A 1HY2A 3PH6A 1X71A 4AW8A 2DM5A 3CBCA 3UEUA 4O4OA 1I9HA 3I17A 2QO6A 4BX6B 1SWSA 1ZRYA 1W5RA 1U18A 3EW1A 4DCBA 4ALBA 3SZHA 5DM7E 2RCQA 1U17A 4AZPA 4QGXA 3FDCA 2KTSA 1M90G 4TLJA 2IZLB 1JJJA 4MVIA 3BX8A 2RTAA 1VYOA 4MEEA 1ERBA 1D2UA 5D4AA 4TJZA 4O4UA 1YJNE 4D6BA 4O3XB 2ZAIA 4D6AA 1TOUA 4LKPA 5JD2A 3K3LA 2X8FA 4YVBA 3D95A 2MM3A 2WUTA 5JVGE 1BBPA 2E4JA 5HCCC 4GGRA 3FIQA 5L8OA 3CWKA 5HBSA 3JQOA 3WJFA 4ZH6A
chains in the Genus database with same CATH topology
1FJ1E 2OY1O 1RJLC 1P4PA 1OSPO 2FKGA 2OY5O 2HKDA 2OL7A 2I5VO 2OY8A 3EC5A 2OL6O 5B2AO 2AF5A 2OY7A 3IG9A 2I5ZO 2PI3O 2FKJA 5B3MO 5B11O 3CKGA 3AUMO 2OYBO 2G8CO 5B10O 3IGEA 2OL8O 3CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJ1 E;  2OY1 O;  1P4P A;  1OSP O;  2FKG A;  2OY5 O;  2HKD A;  2OL7 A;  2I5V O;  2OY8 A;  3EC5 A;  2OL6 O;  5B2A O;  2AF5 A;  2OY7 A;  2I5Z O;  2PI3 O;  2FKJ A;  5B3M O;  5B11 O;  3CKG A;  3AUM O;  2OYB O;  2G8C O;  5B10 O;  2OL8 O;  3CKF A; 
#chains in the Genus database with same CATH topology
 2A8G A;  2LFO A;  4DQ3 A;  3RE5 A;  1GT3 A;  4ZGF A;  1K73 G;  5HTE A;  3U9P C;  1URE A;  1VWQ B;  1ZNE A;  4O3Z A;  1KC8 G;  2RCT A;  2X8S A;  4GJV A;  1AVE A;  3CME E;  3CCR E;  4Y0Q A;  3T2X A;  1OEK A;  1SWF A;  4CDE A;  4EXZ A;  2HYS A;  5LJG A;  4EEJ A;  3WJD A;  4YCE A;  1I04 A;  4YBP A;  2N93 A;  1S2P A;  4I60 A;  3FW4 A;  4I95 A;  1VQ6 E;  1YHQ E;  1G85 A;  3WJG A;  3HPE A;  1DC9 A;  1SWL A;  1UYO X;  2Q39 A;  4XMH A;  4QZU A;  4I3C A;  5D8J A;  2IZD B;  4Y0P A;  3DSZ A;  3HWD A;  4IO9 E;  3LV4 A;  1CRB A;  1VWI B;  3FEK A;  4CV7 A;  1WBI A;  2JU7 A;  1K24 A;  4Y0S A;  2WEX A;  3G4S E;  4ZHC A;  5LKE A;  1SWC A;  4QZT A;  2BT9 A;  1SLE B;  2LBA A;  4QRL A;  4NW4 A;  3UAQ A;  1OEJ A;  2JMB A;  1HMS A;  1SWJ A;  4U8U N;  5HCD C;  3DLL E;  4TQ2 A;  5KID A;  2ZJP E;  1N0S A;  1YWA A;  2G7B A;  3AUM O;  1N8R G;  4CPH A;  2OFM X;  1EIO A;  2IZC B;  2R73 A;  1YJ9 E;  5F6B A;  3WBG A;  3STK A;  3APW A;  5AQ6 A;  2FKG A;  3FR2 A;  1BSQ A;  3HOL A;  1JYD A;  1EUO A;  1X8N A;  1YP7 A;  4COT A;  2Z4I A;  3F8A A;  1VQP E;  5H1S I;  1RBP A;  3CCL E;  1LIE A;  4CDD A;  1KGL A;  1KL5 A;  1Q86 G;  1CBR A;  3HTY A;  2X45 A;  1SWB A;  3ZW0 A;  4LZU A;  3U03 A;  1KL3 A;  1YUP A;  5FAZ A;  5D47 A;  1YWD A;  3KZA A;  3P6C A;  4GK9 A;  2FRS A;  2NP1 A;  2WR6 A;  4CDF A;  1VWB B;  3RDM A;  4CPF A;  1Y9L A;  2L68 A;  4INN A;  5GAE G;  3F6Z B;  3HWE A;  4GRJ A;  1VQ8 E;  3PQS A;  3VG3 A;  1SRF A;  3N91 A;  3GE2 A;  4YFP A;  3G6E E;  1FDQ A;  3ZW1 B;  5KIC A;  1KOI A;  1T0V A;  4Z2O A;  1VYG A;  5EDC A;  1YI2 E;  4BX7 A;  5DPQ A;  2I5V O;  5B27 A;  2CAM A;  3BY0 A;  3CF5 E;  2Y32 A;  3KFH A;  1QG5 A;  2ZJR E;  4WBK A;  1KQW A;  4Y5D A;  1B4M A;  1VWA B;  1SLG B;  5IO5 A;  1NC9 A;  1GM6 A;  4GU8 A;  2W2A A;  1ZNG A;  4IOA E;  2NND A;  1B0O A;  1SRE A;  4AYH A;  4I3D A;  1TOW A;  3CCV E;  1QQS A;  2RTF B;  3CMP A;  1FEN A;  2OL8 O;  5JVH E;  3AKM A;  2OY1 O;  3PED A;  2LKK A;  5H9K A;  3RZY A;  4R0B A;  2L9C A;  2ZJQ E;  4GET A;  2OL7 A;  1RST B;  4OS3 A;  2O62 A;  2X32 A;  1SXU A;  2XKL A;  4BX5 A;  4I9S A;  1W4T A;  3B2I A;  4LZV A;  5HZ8 A;  5FQ7 E;  1PM1 X;  2KT4 B;  3RSW A;  1AB0 A;  1KQX A;  4YH0 A;  1SXX A;  2Q9S A;  2Y3F A;  1VWL B;  3T2W A;  2RD7 C;  1VWN B;  5IO7 A;  1X8O A;  1SWT A;  4ALO A;  5LKF A;  5HZQ A;  1E06 A;  3PP6 A;  3OBL A;  2IZE B;  4IRW A;  2RTM A;  4NP1 A;  2X55 A;  5HZ6 A;  5H8T A;  2HZQ A;  3CPW E;  1VWM B;  1X8U A;  3NQK A;  3B2L A;  1BM5 A;  3TGA A;  4PJ2 A;  1E2T A;  4JGL A;  4BJ8 A;  1T8V A;  2OVD A;  4GH7 A;  1RL6 A;  4YFR A;  2FS7 A;  3KVN A;  3NP1 A;  5K67 A;  5HTD A;  2DJG A;  2OF8 A;  1L6M A;  5C0N A;  1SMP I;  5GAH G;  1NP1 A;  3H3I A;  1JQP A;  4TKB A;  1SWO A;  3QQ2 A;  3STN A;  1STP A;  4GUZ A;  3LTW A;  4QQ1 A;  2KW1 A;  2OVS A;  1LDO A;  1LF7 A;  4MIR A;  2OFR X;  3J7Z G;  4O4S A;  1KQS E;  1H91 A;  1I05 A;  1LEL A;  4UU2 A;  1HMT A;  5B5G A;  1SWK A;  1GKA B;  2RA6 A;  4AZM A;  2BHV A;  5IO6 A;  2YG2 A;  3ZI8 A;  1NP4 A;  4QGW A;  2X34 A;  1YIV A;  4O49 A;  1N4J A;  2A0A A;  2QOM A;  4OEM A;  4YKM A;  2GTL M;  1PTS A;  3P6H A;  3AEH A;  1LIF A;  5B11 O;  3T6L A;  4L3R A;  4N7C A;  1A2D A;  1LID A;  4NNT A;  4BGF A;  3E3C A;  1IFB A;  3JSQ A;  1O1U A;  2OL6 O;  4OMX A;  2WQA E;  2RTB B;  3U0D A;  3RKG A;  1E02 A;  3WJE A;  2FHL A;  3CKG A;  1BSY A;  1VQ9 E;  1S44 A;  3D9W A;  1GX9 A;  1JJU A;  4CDC A;  2HNX A;  1TW4 A;  3WOV A;  1EI5 A;  5B29 A;  1NDJ A;  5HWZ A;  3VG4 A;  4AZO A;  2WWP A;  4TKJ A;  3RY2 A;  5DG4 A;  4U8U O;  4JO6 A;  2X4M A;  4BQU A;  1NBX A;  2QM9 A;  2FLJ A;  2ZSC A;  1OSP O;  2RTD B;  4GKC A;  2NNQ A;  1VPR A;  3VU1 A;  4WFU A;  1QVG E;  1Z24 A;  3KFF A;  2VFC A;  3WZQ A;  1VQM E;  5CSE A;  5L8I A;  1G74 A;  4A1Y A;  4YCH A;  1T68 X;  3PDF A;  3I0A A;  4M6S A;  2CQL A;  2OTL E;  4NV7 A;  4EDE A;  2IZF B;  2RN4 A;  2RTI B;  1LNM A;  1QWD A;  2RTK A;  3CC7 E;  4QGV A;  3RDO A;  4O3W A;  1U0X A;  1MOY A;  2FHN X;  1PBO A;  5LJB A;  2K62 A;  4ZH9 A;  2RTO B;  1GXA A;  1XKI A;  3TF6 A;  3SAO A;  1VQL E;  3Q6L A;  3D4R A;  3TZS A;  2G8C O;  3HOE A;  1SWN A;  1LKE A;  3TGB A;  1UZ2 X;  1A3Y A;  3CCQ E;  5D45 A;  5GAG G;  1M1K G;  1VWR B;  5EEE A;  5DM6 E;  1N43 A;  4KH8 A;  4ZHH A;  4O9S A;  4BCS A;  1S7D A;  4YDB A;  2RTP B;  2CM4 A;  3O19 A;  4IB6 A;  5LJC A;  1BLR A;  4ORU A;  3RDX A;  3EM0 A;  2LA7 A;  3FEP A;  5FQ8 E;  2NNE A;  5BVT A;  5LJE A;  5H9N A;  2FKJ A;  4WFN E;  5B3M O;  2RTC B;  3P6F A;  3BU9 A;  2WPU A;  4XME A;  1OBP A;  1MX8 A;  4U46 A;  4A60 A;  4DQ4 A;  1FJ1 E;  1FTP A;  4AZR A;  4IB9 A;  1RXJ A;  1IFC A;  1NQM A;  4N7D A;  3RWX A;  4GGZ A;  5CE4 A;  3RDU A;  1IJ8 A;  2FGS A;  1LCV A;  1Q7Y G;  2M4L A;  1NQN A;  1X8Q A;  4KC8 A;  1LCW A;  2MO5 A;  5FQ6 E;  4FBO A;  1JYJ A;  4GZV A;  2IZK A;  3C77 X;  1Q82 G;  3C76 X;  1KT6 A;  1DZM A;  1VWJ B;  3FA6 A;  3HK1 A;  4ORX A;  4I6S A;  3VG2 A;  4HPA A;  1GX3 A;  1MX7 A;  1QVF E;  3UEX A;  4ODD A;  3IG9 A;  4A8Z A;  2FT9 A;  2GC9 A;  2BSZ A;  1EQD A;  1EAL A;  3SOT A;  1E5P A;  4ZR2 A;  3P6E A;  1KD1 G;  4O4X A;  1AQB A;  3OW2 E;  5MLC H;  3WJB A;  1QFV A;  3CCS E;  3FYF A;  1VWK B;  3CC4 E;  1QAB E;  4ES7 A;  3IA8 A;  4GGT A;  1DZK A;  3OJY C;  2X56 A;  1G7N A;  1RAV A;  3EYC A;  3EMM A;  1GX8 A;  2G78 A;  4XMD A;  1ACD A;  3WVM A;  1DFV A;  2Q2P A;  4AZQ A;  2HLV A;  4MIS A;  3BLG A;  1I4U A;  2GTL N;  3AKN A;  2GTF X;  3PIP E;  3WZN A;  3SLT A;  2C1Q A;  1JMZ A;  3S26 A;  3CCU E;  1G5W A;  4WFA E;  2LB6 A;  2Q2M A;  3G7X A;  1PBY A;  4O3Y A;  1IKE A;  2ACO A;  4WFV A;  1LIC A;  3FMZ A;  3T1D A;  2L67 A;  2OY8 A;  4ZFX A;  4TKH A;  3MM0 A;  1FEM A;  1GT5 A;  3STM X;  2OZQ A;  4IB8 A;  1BEB A;  2AT3 X;  4DNE A;  4FBV A;  1SWH A;  4ARH A;  4LQZ A;  2A5B A;  1JV4 A;  2GJ5 A;  2IZJ A;  1DZJ A;  3NPO A;  1SLF B;  4HPB A;  1ERX A;  2JOZ A;  4CPH B;  3RE6 A;  1LIB A;  4XMF A;  1SY3 A;  3S5X A;  2CZU A;  1DV9 A;  2PI3 O;  3F9D A;  2RTN B;  2IZH B;  4GNY A;  5BYP A;  2PY1 A;  3ZUO A;  1WUB A;  3MVF A;  1YIT E;  2FTB A;  3RDQ A;  2AT6 X;  1BRP A;  4XMG A;  3T6F A;  1TXL A;  5F1E A;  1ADL A;  2FR2 A;  2HZR A;  3ELX A;  3WZP A;  3SLJ A;  5BVQ A;  1MDC A;  4BX6 A;  1KT5 A;  4U67 E;  1XCA A;  3GAQ A;  4IAB A;  2QEX E;  2CM9 A;  3KFG A;  3ZW0 B;  1KL4 A;  3VG5 A;  5IRW A;  2ASN X;  3MBT A;  1TVQ A;  4WFB E;  1LUQ A;  1CBI A;  2W2F A;  5LJH A;  2FWV A;  1IW2 A;  1BRQ A;  3VG6 A;  2AT5 X;  3CBS A;  2R74 A;  3BSZ E;  2A13 A;  3IFB A;  4ORW A;  1QY2 A;  5F7G A;  2ZAG A;  3DTQ A;  3VHH A;  2IZA A;  2HMB A;  1EW3 A;  4ORS A;  4FBR A;  1BJ7 A;  5L3Y A;  3C78 X;  4GD9 A;  4BX7 B;  3BS2 A;  2YMS A;  1MM9 A;  1P6P A;  1HXL A;  1PEE A;  3RDS A;  1VQN E;  1HXZ A;  2DJF A;  2BS6 A;  2MF6 A;  4U9C A;  1RXK A;  2POA A;  4ORY A;  3FLL A;  4WHI A;  2C4I A;  4YGZ A;  4JHQ A;  1SRG A;  4BBO A;  2CBS A;  5K06 A;  2F01 A;  4KCA A;  3APV A;  1LFO A;  3NX1 A;  5IXG A;  1GGL A;  3SLO A;  3PQU A;  3O2Y A;  4HPD A;  3RBY A;  1VQ7 E;  2AL0 X;  1N9M A;  1B56 A;  4HPC A;  2AT8 X;  4BX5 B;  1SRJ A;  4YMY A;  4JNJ A;  1BSO A;  4ORR A;  1STS B;  2JU8 A;  4RUN A;  2FR3 A;  3FID A;  3ZWE A;  3ZZV A;  1NJI G;  3D96 A;  4YBU A;  3FA7 A;  2OFB A;  1AEL A;  1JMX A;  1ZNL A;  3CKF A;  1BWY A;  3FW5 A;  1VWE B;  3ZQ3 A;  4M7M A;  3VHI A;  2WEW A;  3FA9 A;  2OVE A;  3OD9 A;  1HQQ A;  2RTH B;  4TNN A;  1I78 A;  2ALL X;  2CBR A;  1SWR A;  3MG5 A;  2IZG B;  2G5L A;  2VFB A;  3FR5 A;  4CPE A;  3B2H A;  2OY5 O;  2JW1 A;  1W2B E;  3JS1 A;  1EII A;  2AF5 A;  1JJ2 E;  4IBA A;  1AVD A;  1O8V A;  3CCE E;  1JJX A;  3ELZ A;  1KT3 A;  3NQ3 A;  3L4R A;  1YWB A;  4FGI B;  1UYN X;  4YGG A;  5L8N A;  1Q81 G;  4Z28 A;  4IAW A;  2QMI A;  4OEL A;  1CJ5 A;  2Y3E A;  1OEE A;  1Y55 X;  1SWE A;  2A2G A;  1Y0G A;  1LPJ A;  2GTL O;  1SA8 A;  5B10 O;  1W6F A;  4NYR A;  1JIW I;  1ZNH A;  2QOS C;  1OPB A;  5F6Z A;  3NR3 A;  4EQA C;  1SWG A;  2RQ0 A;  1CBS A;  1HQP A;  1IIU A;  1YIJ E;  1GT4 A;  1YWC A;  1KXO A;  5GAD G;  1ZNK A;  5H9L A;  5CHK A;  1SRI A;  4QNI A;  4ZJ0 A;  1OBU A;  1ML7 A;  1JBH A;  3FEL A;  3VE2 A;  1SXW A;  4NYQ A;  4WF9 E;  3OE3 A;  2RTE B;  4UY8 G;  3P6D A;  3WYQ A;  2A5C A;  3WXQ A;  2RTR B;  4MVE A;  4ZHG A;  3B2J A;  1KZW A;  2R56 A;  4KII A;  2IZB A;  3ZW1 A;  3VPJ E;  1LDQ A;  3WYP A;  1HBQ A;  4HFO A;  4I9R A;  3D97 A;  4ZCB A;  1K3B A;  1OBQ A;  4MVL A;  1RJL C;  4WCE E;  1MEP A;  2UYW A;  4YFQ A;  3SZI A;  1I06 A;  1QFT A;  4Y0R A;  2OY7 A;  5AJB A;  1VWO B;  1R0U A;  2G79 A;  2MJI A;  1FEL A;  2JU3 A;  1A57 A;  5HAE A;  2VDF A;  5BVS A;  3S60 A;  4NLI A;  4U3Q A;  1HN2 A;  3KQ0 A;  1K9M G;  3UEV A;  3FA8 A;  1VWH B;  1OPA A;  2K23 A;  1B8E A;  1SY1 A;  2QCB A;  4ZHF A;  4Y59 A;  4BVM A;  1VWP B;  2I5Z O;  3BX7 A;  1KT7 A;  3BRN A;  4ML7 B;  3MX7 A;  1IKJ A;  2Z4H A;  5JR8 A;  2UZ2 A;  2QO5 A;  3CMA E;  4GDA A;  4BOE A;  2MHD A;  1STR B;  4GDZ A;  2AVI A;  2W2B A;  1RLB E;  3B2K A;  4IB7 A;  4YKO A;  2A3F X;  1SWA A;  5AN9 B;  1O1V A;  3RY1 A;  4QYN A;  5HL7 E;  3HWF A;  1DF8 A;  2HKD A;  1NGL A;  3CXC E;  3APU A;  4C5P A;  3TGC A;  2QO4 A;  1Y52 X;  1SWD A;  5EDB A;  4Z2V A;  1SY2 A;  5HA1 A;  1SY0 A;  4EFG A;  1AVG I;  1EPA A;  3PPT A;  2FS6 A;  2WSJ A;  3EC5 A;  1QY0 A;  2ANS A;  5AEO A;  1MUP A;  3FEN A;  2MWH A;  1GT1 A;  4QAE A;  4ON1 A;  4EKV A;  5FEN A;  4KT5 A;  4XMC A;  3UEW A;  3CR6 A;  4PSQ A;  4Z27 A;  4IOC E;  1ICM A;  1LCZ A;  4GJS A;  4NNS A;  2RTL A;  3CQN A;  5HA0 A;  3PEC A;  3CD6 E;  3HWG A;  2X8T A;  5F58 A;  5LJD A;  4QYP A;  1YJW E;  2P8G A;  4ZHD A;  1ZND A;  4L1N A;  4AZN A;  1QY1 A;  1KFF A;  4ID2 A;  2BLG A;  4CK4 A;  1RXH A;  3CQR A;  1HMR A;  1SLD B;  1EPB A;  2F09 A;  1GKA A;  2RTQ B;  3PK2 A;  1KT4 A;  1SWQ A;  1KZX A;  4OKA A;  1VWG B;  3NAD A;  4GE1 A;  5KHP A;  3ZUI A;  5EZ2 A;  1Y53 X;  4IMO A;  1SWU A;  4B55 A;  2RTJ A;  3G71 E;  3APX A;  2GH7 A;  3PH5 A;  4HWM A;  4A1H A;  5HZ5 A;  5LJK A;  2KTD A;  1PMP A;  3EBK A;  1SRH A;  3VHM A;  1D3S A;  5HCE C;  3BU1 A;  2OYB O;  3ZW2 A;  4KC7 A;  2EU7 X;  2AMM X;  1SWP A;  1Y9T A;  1X89 A;  5H9A A;  1VQ5 E;  3FR4 A;  2AH7 X;  1CBQ A;  5F2B A;  1FE3 A;  5B2A O;  3NX2 A;  1HBP A;  2BS5 A;  1JZU A;  4I3B A;  2RTG B;  5CYB A;  1N7Y A;  3IGE A;  1VWC B;  1YP6 A;  3QKG A;  4Z6J A;  4MVK A;  3P6G A;  1VQ4 E;  4CSB A;  2C1S A;  2QA4 E;  2OFA A;  1EXS A;  5EPQ A;  1K8A G;  2IFB A;  3SZJ A;  2LBV A;  3VGW A;  4OS8 A;  3X00 A;  2KD2 A;  2AT0 X;  5IRA A;  4U8U M;  3V8U A;  2AKQ A;  3NQ9 A;  4ZGU A;  5D48 A;  1DZP A;  1N9Y A;  2BC3 A;  2JGS A;  1E00 A;  1VWF B;  3P24 A;  5K68 A;  3CCJ E;  4OMW A;  2L5P A;  3WZO A;  4Z2P A;  2F73 A;  4IMN A;  1A18 A;  3VG7 A;  1ICN A;  3VE1 A;  5EED A;  2WQ9 A;  1S72 E;  2Q4N A;  1MK5 A;  4NV8 A;  4RUU A;  3NBX X;  4YGH A;  5HZ9 A;  1ALB A;  3I56 E;  4CPI A;  3LHN A;  1VQO E;  3EBW A;  4LKT A;  2OVA A;  3WJC A;  3BDR A;  3CCM E;  2ACP X;  1VWD B;  5FFH A;  4K19 A;  2XST A;  4NLJ A;  3CC2 E;  1VYF A;  4UU3 A;  1DF3 A;  3EW2 A;  3S5V A;  3KFI A;  1X8P A;  3PIO E;  3I55 E;  4YDA A;  1RSU B;  5B5F A;  1P4P A;  2OTJ E;  1MVG A;  3O22 A;  4OS0 A;  5IRU A;  4IAX A;  2OF9 A;  3Q34 A;  2X46 A;  5AJC A;  2JN3 A;  2A2U A;  1VQK E;  1SXY A;  2CZT A;  4GNW A;  4FQB B;  2IZI A;  3P02 A;  1HY2 A;  3PH6 A;  1X71 A;  4AW8 A;  2DM5 A;  3CBC A;  3UEU A;  4O4O A;  1I9H A;  3I17 A;  2QO6 A;  4BX6 B;  1SWS A;  1ZRY A;  1W5R A;  1U18 A;  3EW1 A;  4DCB A;  4ALB A;  3SZH A;  5DM7 E;  2RCQ A;  1U17 A;  4AZP A;  4QGX A;  3FDC A;  2KTS A;  1M90 G;  4TLJ A;  2IZL B;  1JJJ A;  4MVI A;  3BX8 A;  2RTA A;  1VYO A;  4MEE A;  1ERB A;  1D2U A;  5D4A A;  4TJZ A;  4O4U A;  1YJN E;  4D6B A;  4O3X B;  2ZAI A;  4D6A A;  1TOU A;  4LKP A;  5JD2 A;  3K3L A;  2X8F A;  4YVB A;  3D95 A;  2MM3 A;  2WUT A;  5JVG E;  1BBP A;  2E4J A;  5HCC C;  4GGR A;  3FIQ A;  5L8O A;  3CWK A;  5HBS A;  3JQO A;  3WJF A;  4ZH6 A; 
#chains in the Genus database with same CATH homology
 1FJ1 E;  2OY1 O;  1RJL C;  1P4P A;  1OSP O;  2FKG A;  2OY5 O;  2HKD A;  2OL7 A;  2I5V O;  2OY8 A;  3EC5 A;  2OL6 O;  5B2A O;  2AF5 A;  2OY7 A;  3IG9 A;  2I5Z O;  2PI3 O;  2FKJ A;  5B3M O;  5B11 O;  3CKG A;  3AUM O;  2OYB O;  2G8C O;  5B10 O;  3IGE A;  2OL8 O;  3CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...