3CKIB

Crystal structure of the tace-n-timp-3 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAM 17
publication title Structural determinants of the ADAM inhibition by TIMP-3: crystal structure of the TACE-N-TIMP-3 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, hydrolase inhibitor
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ckiB00
1XWEA 5JPNC 2A74C 3KLSA 3HS0C 2XWBB 1JB3A 3L3OC 1D2BA 3OHXC 1BUVT 2QKIC 3CU7A 4FXGC 3FRPB 5FOBB 2WIIB 1JC7A 3CKIB 2J0TD 3HRZC 1UAPA 2E2DC 2I07B 2A73B 5FO8B 2XWJB 5JPMC 1PXUA 2TMPA 2B39A 1UEAB 3T4AC 3G6JB 3MA2B 4ILWA 1BQQT 2ICEC 5FO9B 5FO7B 1OO9B 4FXKC 3V96A 2WINB 3I70A 1GXDC 1BR9A
chains in the Genus database with same CATH superfamily
1BOSA 2D62A 3T1HL 5JPNC 1QNUA 5C0XG 5HY6A 3DEPA 4JBKA 2NZOA 1Q3LA 5CMDA 5DAUA 2ZXPA 5CORA 2LSSA 3CD6A 3AU7A 1I3QH 5C3EG 2V4DA 4HJ9A 1EFID 1B70B 4N9PA 1K8GA 4K0KL 2R7FA 1XMQL 4A3FG 1RHPA 2KBNA 4PG3A 2E2IH 2EQSA 1VQBA 2ICEC 1CSQA 1EIGA 2JK8A 4RCNA 4LF8Q 2PZUA 2PCFB 3BDLA 1K0RA 4KY7A 1CTMA 3A55A 4QF4A 2PNHA 2F0LA 2B2TA 5A2QE 1B9MA 3D31A 3C1EA 4PZ8A 1HZCA 3PUYA 5K5PA 4A3EG 3MXNA 2HIXA 5C3EB 4JI3L 2UXBQ 2O4XA 1H9JA 4LMQD 4A3DG 1M90C 3CC4A 1L0YB 3OIQA 2Y0SB 3A7LA 5DEHA 1WTHA 1E2VA 4GZYC 2RCNA 2OTLA 4E6IA 1HNXQ 4IALA 4DR6Q 4LFAQ 3PIO3 1NR2A 3NWSA 4KV6A 4UAIA 3LX0A 4POFA 4H7BA 4CGYB 1M8AA 3RNUA 4CDDC 3PUXA 4FDBA 3RN2A 4A3EB 3HEJA 5KRUA 3BU2A 3H3VI 1MBYA 1VF5C 3CCVA 3CC2A 4FXDA 2QILA 4IUNA 4A3DB 4O0AA 4BS9A 4FF4A 2A8VA 4LFBL 4QUFA 3MXNB 3I56A 1LM0A 4P74A 4EQPA 4V190 4JBMA 3VYTA 1JB7A 2I0QA 1Y8PB 4ZK9B 3P7JA 2HD3A 3EA6A 1PH9A 1Y8OB 1G2TA 3S1MH 3S16H 4PV1C 2NBFA 4KD4A 4POGA 3D0FA 2QCPX 3K57A 4OO1G 1JE4A 4DK6C 3CPWA 3GTJB 3CPFA 1YJNA 4LF6Q 4UY8C 5EKIA 1YVCA 1KTKA 3AQQA 3K0YA 3HOWB 2AHOB 3L9AX 3JAML 4XXEA 4YHHQ 4DUZL 3H94A 5IWAQ 3QR8A 1XXGA 2OT2A 4Z9CB 4Q5VA 1PVOA 2IX1A 4KN7C 2QF7A 3RZDH 1HNZQ 4IPGA 1XTDA 1S5BD 1YHQA 4IUVA 4QMGA 3S1NH 4NXMQ 3NPPA 3HOYG 2OF1A 2KVMA 1NBWA 1A0IA 1T5EA 1XMOQ 1GUWA 1HUNA 1F77A 4C3JH 2JSOA 2R61A 1T9HA 5M3MH 5M5XB 4O42A 1JMCA 3OMCA 1NUCA 1MKHA 5IP7G 2FMCA 5AFWA 2FHTA 2XTIA 3WOEA 2R93B 1F9SA 4DR4Q 2R7ZB 2KA7A 4G57A 3NBHA 1H9RA 1II3A 3PO3H 3GTLB 1IBLL 4PMBA 1DXMA 4UP8A 1GUTA 4KK7A 5M5WB 4A3IH 4LFCQ 3HOYB 1JT8A 4QIWE 4LWCA 4TVAB 1PMRA 5E4XA 4A3MG 1IW7D 1LO5D 5DNFA 4LF4L 2Z8LA 5LHY1 4A3LG 3K6OA 5C0XH 3S9WA 2RKSA 1BKBA 2K5WA 2WKDA 4C1NI 5GADC 2GA4B 2SEBD 4P73A 3STBC 1BXTA 3F2BA 2F0FA 1EWHA 1LACA 1A2UA 3A56A 1QG7A 3CP0A 5J3BA 2F3VA 2FJ2A 3CCUA 4QQBX 3G4SA 1F2ZA 4I7ZC 3M4PA 4TSSA 4BY1H 2NTSA 4ALPA 3U4VA 4A3MB 2O5IC 1K73C 3ITPA 2G9DA 2CQAA 2H1EA 3J7ZC 1BBWA 1STYA 2UXBL 4FP5D 5KNDA 1TS5A 4A3KG 2F0KA 3DLLA 1PA6A 1KRTA 1FGBD 5AJ3Q 1V1PA 1GHJA 1RD9D 3GTKB 1SNQA 3PUZA 3E9IA 4WJ3M 1QB5D 5IP9G 1PZID 4HN7A 1HNXL 4A3DH 1F9QA 4DR6L 4NMZA 2EYMA 2LXJA 2WKCA 1U4MA 3MTSA 1AE2A 4A3JH 2KECA 1Q12A 1C0AA 5GQOA 1D8LA 1WTXA 4X64Q 1VQIA 1OO9B 1Z9FA 2K6AA 3NELA 1N8RC 2ID0A 2GVBA 1ESRA 1ET9A 2B63B 3GD7A 3ERQA 1B4OA 1EFWA 4DAMA 4LJZC 1DYQA 1I4XA 2CQOA 1VQOA 3R93A 4YCUA 4R4OA 4L63B 4H13C 1MGSA 3MAQA 5JVG3 1EY6A 4JW0A 1YHAA 4LW1A 5J22A 3G6JB 3HOWH 3PUVA 2D0PA 1V1PB 3EJIA 4ZKBB 3K7AH 4QIWB 1KAAA 2OEOA 3LWEA 4X3KA 1BCPD 4ZKCB 1Q46A 1MSGA 1N36L 1GHKA 3BZCA 4C1NK 3K5NA 1CHQD 4LF6L 4HCEA 3J7AF 4GOPC 4OONA 5C4ZA 1TY2A 5JJKA 3RZOH 2EY2A 1Q7YC 1TWAB 2MHVA 4NW2A 3Q22A 1EIHA 3HKSA 2C5CA 2AMCB 3C3LA 4YHHL 2F4VQ 1NMFA 4MIUA 2JA8H 1QNKA 3R3OA 3J81c 2IW3A 1A62A 4IPHA 2F0EA 3GDEA 3SXHA 1HNZL 4ODGA 1V9PA 4K8IA 4DR7Q 4KKUA 4R4TA 2QKIC 5I9PA 2VZAA 2R93H 2EOTA 4NB3A 2K01A 4NXML 2R7ZH 1O7YA 3CCQA 1XMOL 4AQYL 4DPGA 1IYUA 3GTLH 4IFDI 1DONA 3ZJYC 4X65Q 2DN8A 2PZWA 5M5WH 2F0HA 4MHEA 1MJEA 2F0TA 4OWTB 1N9WA 5GAHC 3A74A 4GKKQ 2Q8IB 1QILA 2K14A 2B2WC 1SEBD 3A5UA 1IBMQ 1PDQA 1SNMA 1L2FA 5CC4A 4R4CA 1GM5A 3KFUA 2EDGA 5IP7H 1LTAD 1N32Q 2K52A 4WRDA 1S40A 4GLVB 4OEMB 3KUPA 5JJZA 1H95A 3RMHA 3ONAB 2QEXA 1HTLD 2F0JA 2A6HD 1K83B 3KLWA 4QGUA 3A5ZB 1U5KA 1SMYD 1SSOA 2WFWA 1SYBA 1B53A 3RD4A 3SK5A 4GOPA 5T1GA 5J39A 4X3SA 5D3DA 4K6LA 4HR7B 4A3MH 1Y1WH 2JA6B 1K8OA 3GTGB 4JI1Q 2NN6I 2VS1A 1WTQA 1QUQA 3ERSX 3R2TA 2F0QA 4GNXC 1SYEA 3HKZE 4HJ8A 3S1QB 4J15A 3GTKH 4XT1B 2YU9B 3J81j 3AFQA 5C0XI 2MUYA 4Y52H 3DHQA 2AUKA 4DV5Q 5C3WA 3B6YA 5EPKA 5IYDG 4C3HG 4R4IA 5FJ8H 1S5ED 3FRPB 3A8IE 4RAUC 2JA5G 2E2JH 4RKBA 2RQXA 4RKLA 1WTPA 1JOQA 5CV5A 3PIPA 1SE8A 4ABNA 5AJ3L 1A6XA 3GTOH 2IY5B 1KD1C 2B63H 5C5MA 3T1HQ 3CHBD 3I2ZA 1ML0D 1Y69U 1VQKA 1YNJC 1SNCA 2A68D 3JC66 1XJVA 3PCOB 4GOPB 3DMUA 2XN9C 3TS2A 3RLOA 1FYCA 1EIYB 5IT9c 2IHFA 1VQFA 4X64L 5EKLA 2XGTA 2B2WA 1UWVA 1QUQB 4K0KQ 1XMQQ 4JV5Q 1MI2A 3JAME 4PQXA 3QWNA 2MP1A 4C3HB 1WTOA 2NVTB 3E3XA 3D4DA 1JJGA 4I7AA 2MO1A 1I4HA 3KBGA 3FVQA 4NPSA 2EYOA 1I4PA 2EJFC 2NVYB 3KYHC 4BY7H 2ZM6L 3BYYB 2DUDA 1WOCA 2NTTA 4XTCS 2HQLA 3S2HB 1E24A 3HKZG 4TRDA 3ND9A 1VQMA 1X32A 2BCOA 1PH8A 1EU3A 1HXYD 1HR0Q 3I4NG 4C56C 4CDEC 3EN2A 1PH2A 4OXPA 1ENFA 1Q90A 4IUTA 2K1BA 3W1BA 2L0CA 2MPMA 4CJ1B 1FGUA 1QOHA 3H3VH 3VR3A 3T4AC 3MEHA 2OWOA 3UDIA 2M2LA 3PMFA 4R8NA 3V96A 2XVSA 3ULLA 1YEZA 4KN4C 4RA8A 1OXVA 1FR3A 3NUCA 2ZJRA 2DJFC 2F4VL 4HSVA 1KL9A 3PF5A 4DK0A 1K9MC 5FLXc 1EL0A 5KYLA 3F2DA 3CU7A 3HKZB 2PNRC 3PF4A 1CKMA 4DR5Q 1KABA 3WWVA 2RF4A 3BG3A 4O2DA 1SFOB 4MZ9A 4UP7A 3SHLA 3I55A 1N33L 1I50B 1V43A 2R7DA 1DGSA 2RCFA 2PO4A 2I5MX 2R6GA 2F0PA 3P1HA 5E4WC 4OO1I 4LFBQ 3I70A 1A3VA 4J6HA 3VYRA 4C3IB 1VQ8A 1C7YA 4KHZA 4X65L 4AYBG 5GAEC 4LNQA 1WJJA 3GTQB 1TWHB 3EROA 1JQYD 1B8AA 1X9NA 1DOMA 1UE7A 1K83H 2MFIA 2B2YC 1IBML 5E3FA 2IX0A 2SOBA 3UDGA 3I90A 1ICFB 2F0SA 1ZYRD 1PH1A 3U9SA 2KQ3A 5KYIA 4ZLTF 1PLFA 1DOLA 1XNQL 2RSOA 2JA6H 2BH2A 4DUZQ 3KK7A 1OTCA 1SJED 4B9XA 1HR0W 2D5DA 4EQOA 2C35B 2Q2UA 2CWPA 1H9SA 1Y1VH 2Q2HA 1SBBB 2F0WA 3CCRA 3R8BA 3HRZC 5ELCA 2YU9H 2K05A 1RTNA 1PTOB 3I73A 2B2VC 5IOCA 3F1ZA 1PYWD 3HOXG 4JI1L 4B9WA 4WJWA 2KUMA 4Y7NB 1PH3A 5C44G 1S3OA 2SDFA 4LUOA 1HJPA 1HHVA 4PNYA 4IOCA 2NVXB 5I2XA 4BXXG 3S17H 3HOUG 4DV5L 1PH7A 1QWYA 1VQAA 1AE3A 3GO5A 3A8JE 1MJCA 1CKNA 2B39A 1HA6A 1ESFA 2RHSB 3BVZA 3F2CA 4DV7Q 3W3AA 3BVGA 1H9SB 5IGGA 3HOXB 1PRTC 3MVVA 5KNBA 4WJ4A 1WI5A 3CCMA 5D14A 4A93B 1TY0A 1AEXA 2LS01 3PIP3 2NVYH 4LF4Q 4A4IA 4V0BA 3PSIA 5C4XG 2J4XA 4KHVA 4JV5L 1I4GA 2EYPA 5ELFA 5DM63 1DOKA 2KCNA 1SYDA 1KHIA 1SDFA 1GUNA 4K5WA 2E2HB 1BR9A 4ID6A 5GROA 1SJHD 3VA7A 1LTTD 4CDFC 1CSPA 1E0BA 1F2MA 4EQNA 2F0VA 1CKNB 4IFDJ 4RGMA 1YIJA 3NSWA 1RDPD 4P71A 4A3GH 3Q0AA 1UE6A 3DWQA 3MHBA 5C5LA 1QZGA 3H0GG 5EAYA 1HR0L 2CCZA 2VUMH 2L15A 1O78A 1LT6D 2HDLA 4YCVA 3ULPA 3JAMi 3NP8A 4A3FB 3VYUA 2K5NA 5DM73 5I6YA 4LF9L 3PO2G 4J1MA 1TKWB 2LMCB 3TZDA 2B8GA 2NUCA 1SE3A 5C4JB 3I72A 1RL2A 4ME3A 1YNNC 1ENCA 2E75C 1MIUA 4PZ7A 1VQ4A 4KTAA 1DZ1A 3BJUA 5M3FG 2N8NA 1HCZA 4C3IH 1GUOA 4DR5L 2CFMA 3GTPB 3L7ZC 3URYA 2EJMA 5FO9B 1V1QA 4JPBW 1I4QA 4RGNA 5CV9A 5EPLA 1IBKQ 3SR1A 2EZVA 1U4LA 3AMUA 3K0XA 1B1ZA 3P75A 3OMGA 3VR4A 1KRSA 3PO2B 2EPBA 4CKCA 4EQ5A 2ICIA 2A6EC 4A76A 2E2DC 4OIKA 4TQUS 1X3QA 5C0XJ 4CDCC 3FDTA 3MFGA 4RCOA 3T51B 4BBSG 4R9WA 4IUQA 1N36Q 1I6HH 3W5OA 4A3BG 3K81C 3U58A 2BA1A 1E2WA 5LL6X 3D6WA 2JEBI 3A8KE 1PTOH 4IJLA 1KNEA 2ZTEA 1TS4A 1HUMA 3S15B 4IFDH 2F0GA 1LT4D 1SAPA 2F0MA 3KBXA 2F0OA 2CW0D 1J9OA 2NZHA 1ILPA 4GS3A 4G4KA 5ELBA 2K5DA 3D8GA 2V1CC 2X6GA 4BBSB 2L55A 2EY1A 1B2TA 4H44C 4GN3B 3SDZA 4XT3B 1QVGA 2D2CC 5FLMG 4AQYQ 4Q0FA 2R3ZA 2XNAC 1PH5A 1JC7A 2L11A 5HGTA 2EY5A 2K33A 4PZ6A 3AEVA 1CKOA 2PI2A 2F4IA 4HMIA 3X3MA 4A93H 1RKNA 1KLGD 2L1BA 3DXJC 2XWBB 1SYCA 4DV7L 1VCIA 1Q81C 3TZUA 1RIPA 3OHXC 2BE5D 4FNFA 2EIFA 2OQ0A 4QJFA 4IUUA 2NN6H 2H5XA 1VQJA 2ZT9C 2KENA 1NNXA 2RHQB 5D65A 2JA9A 1KIXA 2CH4A 2WV6D 3HOZG 3M4OB 1Q1BA 1PYBA 4KLKA 2CWAA 3U9OA 2DNCA 4FO2A 3IKJA 4UDUC 4BWGB 3WDNA 3HOVG 1PFMA 2ASBA 3GV6A 3OPOA 5C3EH 4JI5Q 1PH4A 3NE5B 4DAVA 1IKLA 2I5LX 3PV0A 2BA0A 4A3FH 4HTHA 1EY9A 2Q2IA 3UE1A 3NBHB 1Q1EA 4DUYQ 3FPUB 5COYA 4HMJA 3FKIG 3EQLC 4OWXB 5C4JH 1LABA 2VQFL 1GO3E 4HEDA 3K59A 4DXFA 1PZJD 5I9OA 4HJAA 2L9HA 4FF3A 3HOVB 3G6EA 1MSHA 4IO9A 5M5YB 1JWUD 1VQEA 5EBDA 1X3GA 1EYAA 2SNSA 4A3EH 3I8ZA 1E2ZA 4ZUJA 4RH6A 5ELEA 2NVQB 3P20A 1CI3M 1EQTA 4J8QA 1IKMA 4UPAA 3TRZA 2EY6A 3K58A 3K5LA 3PO2H 5JAVA 3I3CA 5JOBA 3MXPA 1BDOA 4AH6A 1X6OA 1BBXC 1HQRD 2PMZE 3I4MG 1ZXTA 4OHJA 1LTLA 5J1ZA 4R8IA 1H9MA 3QIAA 1U4RA 1PH6A 3QOLA 1IBKL 3MEFA 4A3KB 1PTOD 1RF2D 3F8TA 1U9RA 4M1UB 4RHSA 1GD7A 2EVBA 2VQEQ 1Z6HA 1TQOA 3GTJH 2KEDA 1IL8A 1UAPA 4B3MQ 4DV2Q 2K5HA 3J80E 2ZM6Q 4HJ5A 1G2SA 1HPCA 2JEAI 4JI0L 4A3CG 3N6RA 2K75A 2Q8RE 4MTNA 4CBVA 1CM9A 1IYVA 1E1OA 3KLSX 2HIVA 3I4MB 2IL8A 1BVSA 2ZXOA 2IJ0A 1VMPA 4K8JA 1L0XB 1SXTA 4XQNA 4K6DA 3J81L 2ALYB 3FP9A 2B3GA 3PUWA 2BDOA 4JI2Q 3KDFA 3G48A 4OO1H 4KI0A 2BOSA 1STHA 2CVRA 1S5FD 2K03A 3KJPA 4N8FA 4DK1A 1NY4A 1WTWA 3FMCA 5M5XH 4XYOA 4KMUC 3AB9A 1N33Q 1VQGA 2HCCA 2B2UC 1ENAA 2CH4W 1UUPA 1C9OA 3T53B 4EGVA 3T16A 1LLRD 1VQ6A 3D6CA 4IUPA 2DGYA 1CT1D 4O1NA 1UEAB 3EIVA 4X66Q 4MN3A 1SE2A 1NJIC 2PW7A 2E8GA 3BZDB 3SEBA 2UUAQ 1XPUA 3HOYH 1KC8C 2JA7G 4F8MA 1F2LA 3I91A 2RSNA 3MXUA 5BN4A 4B08A 3KDFB 2PW5A 4L6TB 1W3SA 3M3YB 3IL8A 1LUZA 2Z6KC 2WP8J 1K3RA 2I07B 2PMZB 2WACA 1O80A 1DM0B 5I2YA 3S1RB 4JC0A 1PRTF 1QJOA 3EBEA 1XNQQ 2RA4A 2X6LA 1KAWA 4DKAC 1TWCB 1YI2A 4DV1L 1H9KA 5K36G 3TDQA 4DV3Q 4MNOA 2KEEA 1D2BA 3C1FA 1IW7C 1AW7A 4XYQA 4JG2A 3SE0A 4CHTB 1CUKA 4M8AA 2F0UA 2HHHQ 4CKBA 3BDCA 4F88A 3PGZA 1XNRL 3GTMB 4JI5L 1KLUD 4A3LH 3W1GA 4LF7Q 5CBEE 5G3LD 1EUJA 1M1KC 4DXGA 3OTOQ 5M5YH 1TXYA 3NK9A 4IPDA 1JR0D 1WCMG 4DUYL 1YBYA 2QDLA 1EEID 3MZ5A 2N55A 4K14A 1AZQA 4IQZA 5HGQA 4UP9A 4TKOB 2G5DA 2B2UA 1OXXK 4B3RQ 5IGBA 5IYBG 5IT9L 4KY5A 4BA2I 5JEAG 4ZCKA 4DF7A 2QA4A 4DN4M 1G8ZD 3DUZA 1Q82C 1LTRD 2AWOA 4LUVA 1VQ9A 1QVFA 4A3KH 3HGBA 1LYLA 4DV6L 1GUGA 2I5HA 1WCMB 2RBMA 2VY3A 1CA6A 3DWAA 4N9TA 3M7GA 1LT3D 5IP9H 1STGA 1JE5A 1I94L 4GLAC 5EGTA 2Z6KA 1TWGB 2VB2X 3M7NA 1R4QB 1K28A 3X3NA 2JA5B 4RWSC 4IN3A 1F2YA 1G291 1T5XD 2VQEL 3I4MH 4B3ML 1C48A 1XTCD 4DV2L 4AYBE 4RGTA 1AN8A 2RDFA 3GV3A 3KF8A 4JI7L 4IOAA 1G51A 1TWAH 5CV7A 2Z6BA 4GN5A 2EYLA 2C9OA 2N78A 3OIPA 1HQMC 3Q6SA 1FJGL 5HURA 4JBJA 5FLXL 1LT5D 2UUBL 5EBCA 4LF9Q 4GNXA 2JN4A 3L2PA 1I3QB 1HTPA 1RCVD 1K8MA 2AQ1B 2KCMA 4JI2L 1GXDC 3CCLA 3WOFA 2HT1A 3J80i 3Q8DA 3H15A 4G7HC 1BO0A 3E9HA 2MQHA 3OWEB 1EWCA 2H4OA 3QJYA 4PMCA 1SYFA 1FD7D 3PIOA 5NUCA 2UUCL 3I4NB 2F03A 3J7A5 4EVOA 3I4OA 1BBUA 1N34L 3A7AB 4H02A 4EX5A 3M9BA 1TWFB 2TSSA 3UE0A 3FPPA 5L37A 3NTHA 2E5LQ 2M9VA 4X66L 1KXLA 1STEA 3KLRA 2UUAL 2UXDL 3S1RH 3TS0A 1FVIA 1PYSB 4GNXB 2K50A 3DEOA 4AIMA 3CCJA 4HAEA 1B9NA 4FF2A 3H6MA 4XIGS 4P72A 5IGFA 5IY0A 4GKJQ 2K32A 1HFGA 1I5FA 3T1YQ 5JJLA 3GTGH 2FINB 3SK6A 3U50C 4WFN3 3G71A 4XQJA 1PZKD 1E1TA 1DD2A 4IURA 2X69A 2QW7A 3ULJA 4DV3L 4WORA 4AYBB 3S1QH 3GP7A 5CYUA 3NTKA 2LKVA 2DY7A 3J80L 3OWFA 5JPMC 2K4KA 1W6KA 2LY7A 1KNAA 4QY7A 2HHHL 5I6WA 1D1IA 1JJ2A 3S1MB 1ASYA 3LNNA 2B8FA 1ASZA 2JYOA 4LF7L 5FKAC 4DNIA 2EXDA 2Q8TA 4PMWA 3U4ZA 3OTOL 1VQHA 3A0JA 1B7YB 4HSPA 4C3JG 2PQAA 1SNOA 5TSSA 3T13A 5M3MG 2IPKD 2A69C 4H0LC 4B3RL 1X65A 4APVA 3TSSA 3HG9A 2MNAA 1STBA 4FXKC 1I6VC 3N52A 4JI4Q 2MO0A 4IJHA 4BBRG 3G7LA 3TMEA 3EFXD 5E7NA 2F0NA 1GJXA 5CV8A 5IYDH 4C3HH 2FMMA 3PO3G 2NVTH 1B50A 2JA5H 4R4QA 1CQVA 4LAAA 5C44B 1CA5A 4NXNQ 1VQCA 4A3IG 3NEMA 4JVZA 3J81E 4OX9L 3S1NB 2IT1A 2A68C 1YJ9A 2B2YA 1QVCA 3S2HH 1VQDA 1WYDA 4C3JB 3HOUB 5C4HA 4FVMA 2KCCA 5FO7B 2QEJC 1KDAA 3T56B 3V2TA 5DLQE 1NR4A 4K5VA 2MJ8A 1HH2P 3HS0C 4KY6A 2JE6I 2PQAB 4BBRB 2ES2A 1JORA 3AYHB 1AZPA 1CHPD 2JXMB 4HIMA 3PO3B 3K5OA 4OELB 5EQ0A 1EWIA 4JI8L 3S24A 2VQFQ 1D1KA 2ZXRA 4A3IB 3STBD 4NKLA 2KHJA 1B44D 2B2VA 2Y0SG 3VR2A 5C4XB 2Z1CA 4BY1G 3IAYA 1EY7A 1VDZA 1UEBA 3UI2A 1SFOH 4KKTA 3I4NH 2UU9Q 2I46A 1VQ7A 1I50H 2UXCQ 3H91A 1P16A 1WD1A 4FXGC 2CKZB 5CGKA 5FOBB 1TWFH 5C6AA 2OQKA 5GAGC 2KHSA 1L1OC 3E6ZX 4DR2Q 3H0GB 4A3JG 3CQZB 1UE1A 1JOKA 1A15A 2AQ3B 3GTQH 1TWHH 1TR5A 1R4PB 4BY1B 1J5EQ 1D5MC 4YCWA 2R92G 3LWUA 2E5LL 2P5ZX 3QOJA 2JP1A 3NXWA 1Y14B 3UDXA 4LF5L 1YNXA 3TBIB 4K5XA 1LTBD 4YWKA 4JI0Q 2DY8A 1NAPA 1C8CA 2CHBD 2DJGC 4B3TL 2N3SA 4KJOA 4ME5A 4HIDA 5M3FB 4L8JA 1HA5A 5ISRA 1VQNA 3HOWG 2PI2E 5BN3A 1RTOA 4A3JB 4OWWB 2EJGC 5EKKA 4S3SA 4GKJL 2F3IA 2O5JC 1HZ9A 1EU4A 2EXZA 4CKEA 3T1YL 2R92B 1M4VA 1ZYRC 1J8IA 1A2TA 5IT9E 3S14B 4FF1A 1EQRA 3PQIA 2RDHA 1Q8KA 1PRTB 1EQVA 5A35A 4Y7NH 1CFMA 1HFNA 2NYZD 1K0SA 1G91A 2NVXH 5LMNQ 1C4QA 3OW7A 2JA8G 1A3TA 1QCBD 4QL5A 1W6JA 3VYSA 4A3BB 1BUVT 3QB3A 3K7AB 1HZAA 1ICWA 2ZTDA 1EQQA 3TP6A 1SE4A 2N88A 1U4PA 1R9TB 3K8AA 2VL6A 3MXGA 2R93G 2K04A 4BA1I 1TT2A 3VDYA 2R7ZG 3HOXH 4JYAL 1L1OA 4K2LA 3TN2A 3QO2A 4HJ7A 3JAMc 5IGEA 3RZOB 5C44H 3J7AV 1A3UA 1JCKB 1V1OA 5LMUQ 5H1SE 2F0IA 3R2IA 1GUSA 1S5DD 3BZKA 2WB1E 4JI4L 1TIID 3NENA 2JA8B 4BXXH 1SMXA 1X3PA 3HOUH 1ZEQX 1NCVA 4X3TA 2WAQE 2AKWB 3D4WA 4ZRZA 5BR8Q 2LXKA 3ICEA 4ZYSA 2E2HH 3CW2C 4RG1A 5ELNA 4KD3A 5C3XA 4LUZA 5M9OA 5FLXE 2E74C 4NXNL 4DNTB 4BBRH 5LL6S 3OSOA 1EYCA 1E3PA 1S4ZA 4DV1Q 1OXUA 2KOLA 3BS1A 2K7VA 3TQYA 3SGIA 3CF5A 2A74C 3FEWX 4DGZA 1EYGA 1B3QA 1L1OB 1TU2B 1XNRQ 5KEEA 5IYCG 1W2BA 2LFNA 5C4XH 3H3VC 1RJTA 1Q8IA 4YIJA 5EPJA 1Y1WG 2A73B 1B3AA 1PTOF 1DJRD 2BH8A 2HDMA 4QUCA 1E7ZA 3Q23A 1STAA 3J81i 1MD2D 2XSCA 3HOZB 3RR5A 1FL0A 5LMNW 4G7ZC 4X3UA 1HNWQ 3D3RA 5CV6A 1WVLA 3F2UA 1P8LA 2VB3X 2ENBA 3TREA 4DR3Q 4LF8L 3GTPH 1S5CD 3H0GH 1BCPF 4JI6Q 3CQZH 1SNDA 3CKIB 5FJ8G 2UU9L 2WB1G 2UXCL 1X56A 5JJIA 4NDXA 2ATWA 2WAQG 4XQQA 4DV6Q 1Y1WB 1EY0A 2B63G 4X62Q 3NHHA 3DWPA 3FKIB 4CJ2C 4YY3Q 3QG1A 3VA5A 4DR2L 4U68A 1F9PA 2IX3A 2PPBC 1YNJD 2M00A 1I94Q 5IE8A 4GLXA 1KDBA 3NTIA 3E0JA 5M3FH 4B3SQ 2AUJD 1J5EL 1EZ8A 1KQSA 4DR1Q 4UHVA 4LFAL 3GQBA 3TP8A 3UDFA 1Z47A 3MA2B 2WB1B 5D3IB 1PHJA 2E2JB 1STNA 3CMAA 3OW2A 4JI7Q 4F87A 1VF7A 2K5VA 2WAQB 3GTOB 2R92H 2JQOA 4BY7G 3HFZB 4MTKA 3S14H 3S15H 2ZTCA 1G6PA 1EYDA 1FJGQ 3SVMA 1VS0A 2UUBQ 4P2CB 4U673 5JVH3 1RODA 1CZGA 3CMEA 4BBSH 3S2DB 2Z4IA 2D0OA 1GVPA 1BQQT 3SK8A 3L0OA 4A3BH 2HUGA 2YTYA 4HCSA 1PFNA 4LK1C 2K28A 3K7UC 5I4DA 4ZQ3A 1R9TH 5ELOA 3BYTB 5T1IA 1SROA 4BY7B 2UUCQ 2L5TA 2A1AA 2A5HA 4FYDA 5LMNL 1LTID 2CW0C 1N34Q 2WIIB 5E1FA 3CCEA 1GOZA 1EOTA 4X6AH 3BDOA 1L0WA 1K8AC 3AFPA 1XYIA 1XPRA 1SLJA 4ILWA 5IWAL 2L4NA 5FK9C 5IGDA 3IRBA 1D5XC 2Z9HA 2UXDQ 2F0DA 5G3LF 1FNUA 4OL7A 5CR3A 5FLMH 4KHPQ 1CQFA 5LMUL 1SNPA 4N8X1 3BVMA 5A2QL 4RHRA 2OXPA 2BDNA 3M4OH 2AWNA 2SNMA 2RVLA 4RFBA 3A54A 1EY5A 1NE3A 3C46A 4F7XA 3CCSA 5BR8L 3SK4A 4OIJA 3TEHB 2BE5C 1O7ZA 5ELDA 2KJXA 2PQEA 2F1MA 1XWEA 1YITA 2HQEA 1NTGA 1JB3A 1JICA 3K80C 4DR4L 2JA6G 3RLFA 2JA7B 2E76C 4DK3C 1XX8A 1K3BC 1EIFA 3O13A 3HOZH 1Y1VG 4LFCL 4L5RC 5KNCA 1PXUA 4CJ0B 1ET6A 4DV4Q 1GKHA 2AQ2B 1IHZA 1WD0A 3HOVH 2ZJPA 2YYZA 2D9UA 4DFAA 3C2PA 3RN5A 1UE5A 2EYFA 3M4QA 5IYCH 2Q2TA 2NB0A 2NVQH 4G7OC 3DM1A 4ZUIA 3KJOA 3TP7A 4I65A 4K2KA 1SYGA 3NWTA 1SN8A 3KF6A 5CV4A 4L5TA 1HNWL 4KJNA 4DR3L 1OXSC 1O7IA 3FKIH 5CBAE 4GN4B 3ZYYX 1ZKOA 1Y1VB 3H09A 4JI6L 1WTVA 3V05A 1YJWA 1I4RA 2A69D 4NP5A 3CRKC 1F9RA 3DM3A 3NQTA 1EOVA 3L3OC 1O7LA 1U0LA 3MC0B 1JWMD 4X62L 4DV0Q 2F52A 4OX9Q 1KDCA 2N49A 2GVAA 1WFQA 3IFDA 2FXQA 4YY3L 4C2MB 1ILQA 1PRTD 3I4LA 4KKSA 2NZ1D 1AFPA 2GN5A 1A8VA 1SR3A 1EEFD 4B3SL 3S17B 1ONLA 4DR1L 1PV4A 2RDGA 4DAYA 3HZXA 1PFSA 3KF6B 3VR6A 2XRQD 2G9HD 1PTOC 3KLSA 3LGJA 1LTSD 2IHEA 2B29A 3CRLC 4JI8Q 3S2DH 1PFBA 1J6QA 1SRUA 1D7QA 2YTXA 1JWSD 3M85A 1DCZA 2J7ZA 3CC7A 2OCEA 4A3GG 1MHWC 2NWGA 4HIOA 1TVXA 4A3CH 1EY4A 3OOCA 1QE6A 1X55A 4L5QA 1LTGD 4DAPA 1BCPC 1NSNS 2VUMG 3VR5A 3E0EA 3J7YW 2ZJQA 1HRJA 4DU9A 3HP3A 4OGQC 2L12A 2K5QA 5IODA 4L5SA 1QZHA 1VQLA 2E2IB 1HZBA 1TS3A 4IPCA 2HCIA 2KHIA 2F3WA 4JI3Q 1OXTA 2MGSA 1VMCA 4DAYB 5IGCA 1D6EC 1YZ6A 5FO8B 1IXRA 3KF8B 4R1JA 2VNUD 4JOIC 4DA2A 4A3GB 1YNND 1CZWA 4JCVE 4C3IG 1IYJB 1EY8A 2XIWA 2QGQA 2VUMB 3M4YA 2VXWA 3M3YH 2EYHA 2EE1A 4LF5Q 5KGUA 3MWYW 3MFYA 5JEAJ 4B3TQ 3IFTA 3E5SA 2PYKA 4DR7L 4KHPL 2VW9A 1TWCH 1JOOA 1V8QA 1D5ZC 3RLNA 5BN5A 3NQIA 1UNSA 1A63A 2JA7H 2A6ED 1TS2A 1IL2A 3ND8A 2FFKB 4JK1C 3FHWA 1JJCB 1BNZA 5F2DA 3GTMH 2O2LD 3D4RA 4GKKL 1IZ6A 2IWHA 1X3FA 1NMGA 3NBIA 3CXCA 2A6HC 4DNRB 3OYYA 4IFDG 1BF4A 1SMYC 5EJWA 2KCTA 1N32L 2QDBA 1S72A 4QB4A 5K36H 4YWLA 3CAMA 3KOJA 2OTJA 3S16B 3I7FA 2YV5A 4P75A 1FNVA 3ER0A 4JBWA 1XPOA 2EYJA 4YWMA 2A19A 4DV4L 1VQPA 3TP5A 1I6HB 5IIFA 1Q86C 4A75A 1CK1A 1Z7TA 4JYAQ 2DNEA 2B2TC 1G6ZA 2J0TD 2Y0SE 1WTRA 1AH9A 2XWJB 4JOIA 2TMPA 2XRSD 1WCMH 2Z4HA 1EZ6A 4RMFA 1E22A 4IZ8A 4C2MH 4RGOS 4XDXA 1Y8NB 3EVQA 4A93G 1AP0A 3J80c 1VQ5A 1X3EA 3RZDB 1TWGH 4HIKA 2YTVA 5IYBH 1FNWA 3K5MA 1BCPB 4QCLA 3RUZA 2JJQA 1LV9A 5KIXA 3W2DA 1YHBA 5JEAH 4DV0L 2Z0SA 2NN6G 1X54A 1IBLQ 2PZTA 5M3MB 4ULLA 2WINB 4ZAIA 3Q24A
chains in the Genus database with same CATH topology
1BOSA 2D62A 5JPNC 1QNUA 5C0XG 3DEPA 1Q3LA 5CMDA 5DAUA 2ZXPA 5CORA 3AU7A 2V4DA 1EFID 4N9PA 1RHPA 2ICEC 1EIGA 4RCNA 2PZUA 2PCFB 3BDLA 4KY7A 1CTMA 3A55A 4QF4A 2F0LA 2B2TA 5A2QE 1B9MA 3D31A 3C1EA 3PUYA 5K5PA 3MXNA 5C3EB 2O4XA 1H9JA 4LMQD 1L0YB 3OIQA 2Y0SB 3A7LA 5DEHA 1E2VA 4GZYC 4E6IA 4IALA 3PIO3 1NR2A 3NWSA 4KV6A 4UAIA 3LX0A 4H7BA 4CGYB 1M8AA 3PUXA 4A3EB 3HEJA 5KRUA 1MBYA 1VF5C 4FXDA 2QILA 4IUNA 4A3DB 4BS9A 4FF4A 4QUFA 4EQPA 4V190 3VYTA 1Y8PB 4ZK9B 3P7JA 3EA6A 1Y8OB 1G2TA 4PV1C 2NBFA 4KD4A 2QCPX 3K57A 4OO1G 1JE4A 3GTJB 5EKIA 1KTKA 3K0YA 3HOWB 3L9AX 3JAML 4XXEA 3H94A 1XXGA 2OT2A 4Z9CB 4Q5VA 2IX1A 4KN7C 2QF7A 1S5BD 4IUVA 4QMGA 3NPPA 2OF1A 2KVMA 1T5EA 1GUWA 1HUNA 1F77A 2JSOA 2R61A 5M5XB 4O42A 3OMCA 1NUCA 2FMCA 5AFWA 2FHTA 3WOEA 2R93B 1F9SA 2R7ZB 2KA7A 4G57A 3NBHA 1H9RA 1II3A 3GTLB 4PMBA 1DXMA 1GUTA 4KK7A 5M5WB 3HOYB 1PMRA 5E4XA 1IW7D 1LO5D 5DNFA 2Z8LA 5LHY1 3K6OA 5C0XH 3S9WA 2RKSA 2K5WA 2WKDA 4C1NI 2GA4B 2SEBD 1BXTA 2F0FA 1EWHA 1LACA 1A2UA 3A56A 1QG7A 2F3VA 2FJ2A 1F2ZA 4I7ZC 4TSSA 2NTSA 4A3MB 2O5IC 3ITPA 2G9DA 2CQAA 2H1EA 1STYA 4FP5D 5KNDA 1TS5A 2F0KA 1FGBD 1V1PA 1GHJA 1RD9D 3GTKB 1SNQA 3PUZA 1QB5D 1PZID 4HN7A 1F9QA 4NMZA 2EYMA 2WKCA 1U4MA 3MTSA 2KECA 1Q12A 1WTXA 1OO9B 2K6AA 2ID0A 1ESRA 1ET9A 2B63B 3GD7A 3ERQA 1B4OA 4LJZC 1DYQA 1I4XA 3R93A 4L63B 4H13C 1MGSA 3MAQA 5JVG3 1EY6A 5J22A 3G6JB 3PUVA 1V1PB 3EJIA 4ZKBB 4QIWB 1KAAA 2OEOA 3LWEA 4X3KA 1BCPD 4ZKCB 1MSGA 1GHKA 4C1NK 3K5NA 1CHQD 4HCEA 3J7AF 5C4ZA 1TY2A 2EY2A 1TWAB 2MHVA 4NW2A 3Q22A 1EIHA 2C5CA 3C3LA 4MIUA 1QNKA 3R3OA 2IW3A 2F0EA 3SXHA 4ODGA 4K8IA 4KKUA 2QKIC 5I9PA 2EOTA 2K01A 1O7YA 1IYUA 4IFDI 1DONA 2DN8A 2PZWA 2F0HA 4MHEA 2F0TA 2Q8IB 1QILA 2B2WC 1SEBD 1PDQA 1SNMA 5CC4A 2EDGA 1LTAD 4WRDA 3KUPA 5JJZA 3RMHA 3ONAB 1HTLD 2F0JA 2A6HD 1K83B 1SMYD 1SSOA 1SYBA 1B53A 3RD4A 3SK5A 5T1GA 5J39A 4X3SA 5D3DA 4K6LA 4HR7B 2JA6B 1K8OA 3GTGB 2NN6I 1WTQA 3R2TA 2F0QA 1SYEA 3S1QB 4XT1B 2YU9B 5C0XI 2MUYA 3DHQA 2AUKA 5C3WA 5EPKA 4C3HG 1S5ED 3FRPB 3A8IE 4RAUC 4RKBA 2RQXA 4RKLA 1WTPA 1JOQA 5CV5A 4ABNA 1A6XA 5C5MA 3CHBD 1ML0D 1Y69U 1YNJC 1SNCA 2A68D 3DMUA 2XN9C 1FYCA 5EKLA 2B2WA 1MI2A 3JAME 4PQXA 3QWNA 2MP1A 4C3HB 1WTOA 2NVTB 3D4DA 1I4HA 3KBGA 3FVQA 2EYOA 1I4PA 2EJFC 2NVYB 3BYYB 2NTTA 4XTCS 3S2HB 4TRDA 3ND9A 1X32A 2BCOA 1EU3A 1HXYD 4C56C 1ENFA 1Q90A 4IUTA 2K1BA 2L0CA 2MPMA 4CJ1B 1QOHA 3VR3A 3T4AC 3MEHA 2M2LA 3PMFA 4R8NA 3V96A 2XVSA 4KN4C 4RA8A 1OXVA 1FR3A 3NUCA 4HSVA 4DK0A 1EL0A 5KYLA 3CU7A 3HKZB 2PNRC 1KABA 3BG3A 1SFOB 3SHLA 1I50B 1V43A 2PO4A 2R6GA 2F0PA 3P1HA 5E4WC 4OO1I 3I70A 1A3VA 4J6HA 3VYRA 4C3IB 4KHZA 3GTQB 1TWHB 3EROA 1JQYD 1DOMA 2B2YC 5E3FA 2IX0A 2SOBA 3I90A 2F0SA 1ZYRD 3U9SA 2KQ3A 5KYIA 4ZLTF 1PLFA 1DOLA 2RSOA 3KK7A 1SJED 4B9XA 2D5DA 4EQOA 1H9SA 1SBBB 2F0WA 3R8BA 3HRZC 5ELCA 2K05A 1RTNA 1PTOB 3I73A 2B2VC 5IOCA 1PYWD 4B9WA 4WJWA 2KUMA 4Y7NB 2SDFA 1HHVA 4PNYA 2NVXB 5I2XA 1QWYA 3GO5A 3A8JE 2B39A 1HA6A 1ESFA 3BVZA 3W3AA 3BVGA 1H9SB 5IGGA 3HOXB 1PRTC 3MVVA 5KNBA 5D14A 4A93B 1TY0A 1AEXA 2LS01 3PIP3 4V0BA 2J4XA 4KHVA 1I4GA 2EYPA 5ELFA 5DM63 1DOKA 2KCNA 1SYDA 1SDFA 4K5WA 1GUNA 2E2HB 1BR9A 4ID6A 1SJHD 3VA7A 1LTTD 1E0BA 1F2MA 4EQNA 2F0VA 4IFDJ 4RGMA 3NSWA 1RDPD 3Q0AA 3DWQA 5C5LA 3MHBA 1O78A 1LT6D 2HDLA 3NP8A 4A3FB 3VYUA 5DM73 5I6YA 4J1MA 1TKWB 2LMCB 3TZDA 2B8GA 2NUCA 1SE3A 5C4JB 3I72A 1YNNC 1ENCA 2E75C 4KTAA 1DZ1A 1HCZA 1GUOA 3GTPB 3L7ZC 3URYA 2EJMA 5FO9B 1I4QA 4RGNA 5CV9A 5EPLA 3SR1A 2EZVA 1U4LA 3AMUA 3P75A 1B1ZA 3VR4A 3OMGA 3PO2B 2EPBA 4CKCA 2ICIA 2A6EC 2E2DC 4OIKA 4TQUS 1X3QA 5C0XJ 3FDTA 3MFGA 4RCOA 3T51B 4R9WA 4IUQA 2BA1A 1E2WA 5LL6X 3D6WA 2JEBI 3A8KE 1PTOH 1KNEA 1TS4A 1HUMA 3S15B 4IFDH 2F0GA 1LT4D 1SAPA 2F0MA 3KBXA 2F0OA 2CW0D 1J9OA 1ILPA 4G4KA 5ELBA 2K5DA 3D8GA 2X6GA 4BBSB 2L55A 2EY1A 1B2TA 4H44C 3SDZA 4XT3B 2D2CC 4Q0FA 2R3ZA 2XNAC 1JC7A 2L11A 5HGTA 2EY5A 2K33A 2F4IA 4HMIA 3X3MA 1RKNA 1KLGD 2L1BA 3DXJC 2XWBB 1SYCA 1VCIA 3TZUA 3OHXC 2BE5D 4FNFA 4IUUA 2NN6H 2ZT9C 5D65A 2WV6D 3M4OB 1Q1BA 3U9OA 2DNCA 4FO2A 3IKJA 4UDUC 4BWGB 3WDNA 1PFMA 3GV6A 3OPOA 3NE5B 4DAVA 1IKLA 3PV0A 2BA0A 4HTHA 1EY9A 1Q1EA 3FPUB 5COYA 4HMJA 3EQLC 1LABA 4HEDA 3K59A 4DXFA 1PZJD 5I9OA 2L9HA 4FF3A 3HOVB 1MSHA 5M5YB 1JWUD 5EBDA 1EYAA 2SNSA 3I8ZA 1E2ZA 4ZUJA 4RH6A 5ELEA 2NVQB 3P20A 1CI3M 1EQTA 4J8QA 1IKMA 2EY6A 3K58A 3K5LA 5JAVA 3I3CA 5JOBA 3MXPA 1BDOA 1BBXC 1HQRD 1ZXTA 4OHJA 5J1ZA 4R8IA 1H9MA 3QIAA 1U4RA 3QOLA 4A3KB 1PTOD 1RF2D 1U9RA 4M1UB 4RHSA 2EVBA 1Z6HA 1TQOA 2KEDA 1IL8A 1UAPA 3J80E 1G2SA 1HPCA 2JEAI 3N6RA 2Q8RE 4CBVA 1CM9A 1IYVA 3KLSX 3I4MB 2IL8A 2ZXOA 2IJ0A 1VMPA 4K8JA 1L0XB 1SXTA 4XQNA 4K6DA 3J81L 3PUWA 2BDOA 4OO1H 4KI0A 2BOSA 1STHA 2CVRA 1S5FD 2K03A 4DK1A 1WTWA 3FMCA 4XYOA 4KMUC 3AB9A 2HCCA 2B2UC 1ENAA 1UUPA 3T53B 4EGVA 3T16A 1LLRD 3D6CA 4IUPA 1CT1D 4O1NA 1UEAB 4MN3A 1SE2A 2PW7A 3BZDB 3SEBA 4F8MA 1F2LA 3I91A 2RSNA 3MXUA 5BN4A 4B08A 2PW5A 4L6TB 3M3YB 3IL8A 2WP8J 2I07B 2PMZB 2WACA 1O80A 1DM0B 5I2YA 3S1RB 1PRTF 1QJOA 2RA4A 2X6LA 1TWCB 1H9KA 5K36G 3TDQA 2KEEA 1D2BA 3C1FA 1IW7C 1AW7A 4XYQA 3SE0A 4CHTB 4M8AA 2F0UA 4CKBA 3BDCA 4F88A 3GTMB 1KLUD 5CBEE 5G3LD 4DXGA 3NK9A 1JR0D 1EEID 3MZ5A 2N55A 4K14A 1AZQA 4IQZA 4TKOB 2B2UA 1OXXK 5IGBA 5IT9L 4KY5A 4BA2I 5JEAG 4DF7A 4DN4M 1G8ZD 3DUZA 1LTRD 2AWOA 3HGBA 1GUGA 1WCMB 2RBMA 1CA6A 3DWAA 4N9TA 3M7GA 1LT3D 1STGA 5EGTA 1TWGB 2VB2X 3M7NA 1R4QB 2JA5B 3X3NA 4RWSC 4IN3A 1F2YA 1G291 1T5XD 1C48A 1XTCD 4RGTA 1AN8A 2RDFA 3GV3A 3KF8A 5CV7A 2EYLA 2C9OA 3OIPA 1HQMC 3Q6SA 5HURA 5FLXL 1LT5D 5EBCA 1I3QB 1HTPA 1RCVD 1K8MA 2AQ1B 1GXDC 3WOFA 4G7HC 1BO0A 3OWEB 1EWCA 2H4OA 3QJYA 4PMCA 1SYFA 1FD7D 5NUCA 3I4NB 2F03A 4EVOA 3A7AB 1TWFB 2TSSA 3FPPA 3NTHA 2M9VA 1STEA 3KLRA 3DEOA 4HAEA 1B9NA 4FF2A 3H6MA 4XIGS 5IGFA 2K32A 1HFGA 2FINB 3SK6A 4WFN3 4XQJA 1PZKD 1DD2A 4IURA 2X69A 4WORA 4AYBB 3GP7A 5CYUA 3NTKA 2LKVA 2DY7A 3J80L 3OWFA 5JPMC 1W6KA 2LY7A 1KNAA 5I6WA 1D1IA 3S1MB 3LNNA 2B8FA 2JYOA 5FKAC 2Q8TA 4PMWA 4HSPA 4C3JG 1SNOA 5TSSA 3T13A 2IPKD 2A69C 4H0LC 3TSSA 3HG9A 1STBA 4FXKC 1I6VC 3N52A 3G7LA 3TMEA 3EFXD 2F0NA 1GJXA 5CV8A 2FMMA 1B50A 1CQVA 4LAAA 5C44B 1CA5A 3J81E 3S1NB 2IT1A 2A68C 2B2YA 4C3JB 3HOUB 5C4HA 4FVMA 2KCCA 5FO7B 2QEJC 1KDAA 3T56B 3V2TA 1NR4A 4K5VA 2MJ8A 3HS0C 4KY6A 2JE6I 4BBRB 1JORA 1AZPA 1CHPD 2JXMB 3PO3B 3K5OA 5EQ0A 1D1KA 2ZXRA 4A3IB 4NKLA 1B44D 2B2VA 3VR2A 5C4XB 2Z1CA 3IAYA 1EY7A 1VDZA 3UI2A 4KKTA 2I46A 3H91A 1WD1A 4FXGC 5CGKA 5FOBB 5C6AA 2KHSA 3E6ZX 3H0GB 3CQZB 1JOKA 1A15A 2AQ3B 1TR5A 1R4PB 4BY1B 1D5MC 3LWUA 3QOJA 2JP1A 3NXWA 3TBIB 4K5XA 1LTBD 2DY8A 1NAPA 1C8CA 2CHBD 4KJOA 4ME5A 5M3FB 4L8JA 1HA5A 5ISRA 5BN3A 1RTOA 4A3JB 2EJGC 5EKKA 4S3SA 2O5JC 1EU4A 2EXZA 4CKEA 2R92B 1M4VA 1ZYRC 1J8IA 1A2TA 5IT9E 3S14B 4FF1A 2RDHA 1PRTB 1EQVA 5A35A 1CFMA 1HFNA 2NYZD 1G91A 1C4QA 3OW7A 1A3TA 1QCBD 1W6JA 3VYSA 4A3BB 1BUVT 3QB3A 3K7AB 1ICWA 3TP6A 1SE4A 2N88A 1U4PA 1R9TB 3MXGA 2K04A 4BA1I 1TT2A 4K2LA 3TN2A 3QO2A 5IGEA 3RZOB 3J7AV 1JCKB 1A3UA 1V1OA 2F0IA 3R2IA 1GUSA 1S5DD 1TIID 2JA8B 1X3PA 1ZEQX 1NCVA 4X3TA 3D4WA 4ZRZA 4ZYSA 5C3XA 4KD3A 5M9OA 5FLXE 2E74C 4DNTB 5LL6S 3OSOA 1EYCA 1S4ZA 1OXUA 2KOLA 3BS1A 2K7VA 2A74C 3FEWX 4DGZA 1TU2B 5KEEA 2LFNA 3H3VC 1RJTA 1Q8IA 4YIJA 5EPJA 2A73B 1B3AA 1PTOF 1DJRD 2HDMA 4QUCA 3Q23A 1STAA 1MD2D 2XSCA 3HOZB 4G7ZC 4X3UA 3D3RA 5CV6A 1WVLA 3F2UA 2VB3X 2ENBA 1S5CD 1BCPF 1SNDA 3CKIB 4NDXA 4XQQA 1Y1WB 1EY0A 3NHHA 3DWPA 3FKIB 4CJ2C 3QG1A 3VA5A 4U68A 1F9PA 2IX3A 2PPBC 1YNJD 2M00A 1KDBA 3NTIA 3E0JA 2AUJD 1EZ8A 3GQBA 3TP8A 1Z47A 3MA2B 2WB1B 5D3IB 2E2JB 1STNA 4F87A 1VF7A 2WAQB 3GTOB 1EYDA 3SVMA 4P2CB 4U673 5JVH3 1RODA 1CZGA 3S2DB 2Z4IA 1BQQT 3SK8A 2HUGA 4HCSA 1PFNA 4LK1C 2K28A 5I4DA 4ZQ3A 3BYTB 5T1IA 4BY7B 2L5TA 2A5HA 4FYDA 1LTID 2CW0C 2WIIB 5E1FA 1GOZA 1EOTA 3BDOA 1XYIA 4ILWA 2L4NA 5FK9C 5IGDA 1D5XC 2F0DA 5G3LF 1FNUA 4OL7A 5CR3A 1CQFA 1SNPA 3BVMA 5A2QL 4RHRA 2OXPA 2BDNA 2AWNA 2SNMA 2RVLA 4RFBA 3A54A 1EY5A 3C46A 4F7XA 3SK4A 4OIJA 2BE5C 1O7ZA 5ELDA 2KJXA 2PQEA 2F1MA 1XWEA 2HQEA 1JB3A 1JICA 3RLFA 2JA7B 2E76C 1XX8A 3O13A 5KNCA 1PXUA 4CJ0B 1ET6A 2AQ2B 1IHZA 1WD0A 2YYZA 2D9UA 4DFAA 3C2PA 2EYFA 2NB0A 4G7OC 3DM1A 4ZUIA 3TP7A 4I65A 4K2KA 1SYGA 3NWTA 5CV4A 4KJNA 1OXSC 5CBAE 3ZYYX 1ZKOA 1Y1VB 3H09A 1WTVA 3V05A 1I4RA 2A69D 4NP5A 3CRKC 1F9RA 3NQTA 3L3OC 1O7LA 3MC0B 1JWMD 1KDCA 3IFDA 4C2MB 1ILQA 1PRTD 3I4LA 4KKSA 2NZ1D 1AFPA 1EEFD 3S17B 1ONLA 4DAYA 2RDGA 3HZXA 3VR6A 2XRQD 2G9HD 1PTOC 3KLSA 1LTSD 3CRLC 1PFBA 1JWSD 3M85A 1DCZA 2J7ZA 2NWGA 1TVXA 1EY4A 3OOCA 1QE6A 1LTGD 4DAPA 1BCPC 1NSNS 3VR5A 3J7YW 1HRJA 4DU9A 3HP3A 4OGQC 2L12A 2K5QA 5IODA 2E2IB 1TS3A 2HCIA 2F3WA 1OXTA 2MGSA 1VMCA 5IGCA 1D6EC 5FO8B 2VNUD 4DA2A 4A3GB 1YNND 1CZWA 4C3IG 1EY8A 2XIWA 2VUMB 3M4YA 2VXWA 2EYHA 2EE1A 5KGUA 3MWYW 3MFYA 5JEAJ 3IFTA 3E5SA 2PYKA 1JOOA 1V8QA 1D5ZC 5BN5A 3NQIA 1UNSA 2A6ED 1TS2A 3ND8A 2FFKB 4JK1C 1BNZA 5F2DA 2O2LD 3D4RA 2IWHA 3NBIA 2A6HC 4DNRB 4IFDG 1BF4A 1SMYC 5EJWA 2QDBA 4QB4A 5K36H 3S16B 1FNVA 4JBWA 2EYJA 3TP5A 1I6HB 5IIFA 1CK1A 1Z7TA 2DNEA 2B2TC 1G6ZA 2J0TD 1WTRA 2XWJB 2TMPA 2XRSD 2Z4HA 1EZ6A 4IZ8A 4RGOS 4XDXA 1Y8NB 3EVQA 1AP0A 3RZDB 1FNWA 3K5MA 1BCPB 4QCLA 3RUZA 5KIXA 1LV9A 3W2DA 5JEAH 2NN6G 2PZTA 5M3MB 4ULLA 2WINB 4ZAIA 3Q24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWE A;  5JPN C;  2A74 C;  3KLS A;  3HS0 C;  2XWB B;  1JB3 A;  3L3O C;  1D2B A;  3OHX C;  1BUV T;  2QKI C;  3CU7 A;  4FXG C;  3FRP B;  5FOB B;  2WII B;  1JC7 A;  3CKI B;  2J0T D;  3HRZ C;  1UAP A;  2E2D C;  2I07 B;  2A73 B;  5FO8 B;  2XWJ B;  5JPM C;  1PXU A;  2TMP A;  2B39 A;  1UEA B;  3T4A C;  3G6J B;  3MA2 B;  4ILW A;  1BQQ T;  2ICE C;  5FO9 B;  5FO7 B;  1OO9 B;  4FXK C;  3V96 A;  2WIN B;  3I70 A;  1GXD C;  1BR9 A; 
#chains in the Genus database with same CATH topology
 1BOS A;  2D62 A;  3T1H L;  5JPN C;  1QNU A;  5C0X G;  5HY6 A;  3DEP A;  4JBK A;  2NZO A;  1Q3L A;  5CMD A;  5DAU A;  2ZXP A;  5COR A;  2LSS A;  3CD6 A;  3AU7 A;  1I3Q H;  5C3E G;  2V4D A;  4HJ9 A;  1EFI D;  1B70 B;  4N9P A;  1K8G A;  4K0K L;  2R7F A;  1XMQ L;  4A3F G;  1RHP A;  2KBN A;  4PG3 A;  2E2I H;  2EQS A;  1VQB A;  2ICE C;  1CSQ A;  1EIG A;  2JK8 A;  4RCN A;  4LF8 Q;  2PZU A;  2PCF B;  3BDL A;  1K0R A;  4KY7 A;  1CTM A;  3A55 A;  4QF4 A;  2PNH A;  2F0L A;  2B2T A;  5A2Q E;  1B9M A;  3D31 A;  3C1E A;  4PZ8 A;  1HZC A;  3PUY A;  5K5P A;  4A3E G;  3MXN A;  2HIX A;  5C3E B;  4JI3 L;  2UXB Q;  2O4X A;  1H9J A;  4LMQ D;  4A3D G;  1M90 C;  3CC4 A;  1L0Y B;  3OIQ A;  2Y0S B;  3A7L A;  5DEH A;  1WTH A;  1E2V A;  4GZY C;  2RCN A;  2OTL A;  4E6I A;  1HNX Q;  4IAL A;  4DR6 Q;  4LFA Q;  3PIO 3;  1NR2 A;  3NWS A;  4KV6 A;  4UAI A;  3LX0 A;  4POF A;  4H7B A;  4CGY B;  1M8A A;  3RNU A;  4CDD C;  3PUX A;  4FDB A;  3RN2 A;  4A3E B;  3HEJ A;  5KRU A;  3BU2 A;  3H3V I;  1MBY A;  1VF5 C;  3CCV A;  3CC2 A;  4FXD A;  2QIL A;  4IUN A;  4A3D B;  4O0A A;  4BS9 A;  4FF4 A;  2A8V A;  4LFB L;  4QUF A;  3MXN B;  3I56 A;  1LM0 A;  4P74 A;  4EQP A;  4V19 0;  4JBM A;  3VYT A;  1JB7 A;  2I0Q A;  1Y8P B;  4ZK9 B;  3P7J A;  2HD3 A;  3EA6 A;  1PH9 A;  1Y8O B;  1G2T A;  3S1M H;  3S16 H;  4PV1 C;  2NBF A;  4KD4 A;  4POG A;  3D0F A;  2QCP X;  3K57 A;  4OO1 G;  1JE4 A;  4DK6 C;  3CPW A;  3GTJ B;  3CPF A;  1YJN A;  4LF6 Q;  4UY8 C;  5EKI A;  1YVC A;  1KTK A;  3AQQ A;  3K0Y A;  3HOW B;  2AHO B;  3L9A X;  3JAM L;  4XXE A;  4YHH Q;  4DUZ L;  3H94 A;  5IWA Q;  3QR8 A;  1XXG A;  2OT2 A;  4Z9C B;  4Q5V A;  1PVO A;  2IX1 A;  4KN7 C;  2QF7 A;  3RZD H;  1HNZ Q;  4IPG A;  1XTD A;  1S5B D;  1YHQ A;  4IUV A;  4QMG A;  3S1N H;  4NXM Q;  3NPP A;  3HOY G;  2OF1 A;  2KVM A;  1NBW A;  1A0I A;  1T5E A;  1XMO Q;  1GUW A;  1HUN A;  1F77 A;  4C3J H;  2JSO A;  2R61 A;  1T9H A;  5M3M H;  5M5X B;  4O42 A;  1JMC A;  3OMC A;  1NUC A;  1MKH A;  5IP7 G;  2FMC A;  5AFW A;  2FHT A;  2XTI A;  3WOE A;  2R93 B;  1F9S A;  4DR4 Q;  2R7Z B;  2KA7 A;  4G57 A;  3NBH A;  1H9R A;  1II3 A;  3PO3 H;  3GTL B;  1IBL L;  4PMB A;  1DXM A;  4UP8 A;  1GUT A;  4KK7 A;  5M5W B;  4A3I H;  4LFC Q;  3HOY B;  1JT8 A;  4QIW E;  4LWC A;  4TVA B;  1PMR A;  5E4X A;  4A3M G;  1IW7 D;  1LO5 D;  5DNF A;  4LF4 L;  2Z8L A;  5LHY 1;  4A3L G;  3K6O A;  5C0X H;  3S9W A;  2RKS A;  1BKB A;  2K5W A;  2WKD A;  4C1N I;  5GAD C;  2GA4 B;  2SEB D;  4P73 A;  3STB C;  1BXT A;  3F2B A;  2F0F A;  1EWH A;  1LAC A;  1A2U A;  3A56 A;  1QG7 A;  3CP0 A;  5J3B A;  2F3V A;  2FJ2 A;  3CCU A;  4QQB X;  3G4S A;  1F2Z A;  4I7Z C;  3M4P A;  4TSS A;  4BY1 H;  2NTS A;  4ALP A;  3U4V A;  4A3M B;  2O5I C;  1K73 C;  3ITP A;  2G9D A;  2CQA A;  2H1E A;  3J7Z C;  1BBW A;  1STY A;  2UXB L;  4FP5 D;  5KND A;  1TS5 A;  4A3K G;  2F0K A;  3DLL A;  1PA6 A;  1KRT A;  1FGB D;  5AJ3 Q;  1V1P A;  1GHJ A;  1RD9 D;  3GTK B;  1SNQ A;  3PUZ A;  3E9I A;  4WJ3 M;  1QB5 D;  5IP9 G;  1PZI D;  4HN7 A;  1HNX L;  4A3D H;  1F9Q A;  4DR6 L;  4NMZ A;  2EYM A;  2LXJ A;  2WKC A;  1U4M A;  3MTS A;  1AE2 A;  4A3J H;  2KEC A;  1Q12 A;  1C0A A;  5GQO A;  1D8L A;  1WTX A;  4X64 Q;  1VQI A;  1OO9 B;  1Z9F A;  2K6A A;  3NEL A;  1N8R C;  2ID0 A;  2GVB A;  1ESR A;  1ET9 A;  2B63 B;  3GD7 A;  3ERQ A;  1B4O A;  1EFW A;  4DAM A;  4LJZ C;  1DYQ A;  1I4X A;  2CQO A;  1VQO A;  3R93 A;  4YCU A;  4R4O A;  4L63 B;  4H13 C;  1MGS A;  3MAQ A;  5JVG 3;  1EY6 A;  4JW0 A;  1YHA A;  4LW1 A;  5J22 A;  3G6J B;  3HOW H;  3PUV A;  2D0P A;  1V1P B;  3EJI A;  4ZKB B;  3K7A H;  4QIW B;  1KAA A;  2OEO A;  3LWE A;  4X3K A;  1BCP D;  4ZKC B;  1Q46 A;  1MSG A;  1N36 L;  1GHK A;  3BZC A;  4C1N K;  3K5N A;  1CHQ D;  4LF6 L;  4HCE A;  3J7A F;  4GOP C;  4OON A;  5C4Z A;  1TY2 A;  5JJK A;  3RZO H;  2EY2 A;  1Q7Y C;  1TWA B;  2MHV A;  4NW2 A;  3Q22 A;  1EIH A;  3HKS A;  2C5C A;  2AMC B;  3C3L A;  4YHH L;  2F4V Q;  1NMF A;  4MIU A;  2JA8 H;  1QNK A;  3R3O A;  3J81 c;  2IW3 A;  1A62 A;  4IPH A;  2F0E A;  3GDE A;  3SXH A;  1HNZ L;  4ODG A;  1V9P A;  4K8I A;  4DR7 Q;  4KKU A;  4R4T A;  2QKI C;  5I9P A;  2VZA A;  2R93 H;  2EOT A;  4NB3 A;  2K01 A;  4NXM L;  2R7Z H;  1O7Y A;  3CCQ A;  1XMO L;  4AQY L;  4DPG A;  1IYU A;  3GTL H;  4IFD I;  1DON A;  3ZJY C;  4X65 Q;  2DN8 A;  2PZW A;  5M5W H;  2F0H A;  4MHE A;  1MJE A;  2F0T A;  4OWT B;  1N9W A;  5GAH C;  3A74 A;  4GKK Q;  2Q8I B;  1QIL A;  2K14 A;  2B2W C;  1SEB D;  3A5U A;  1IBM Q;  1PDQ A;  1SNM A;  1L2F A;  5CC4 A;  4R4C A;  1GM5 A;  3KFU A;  2EDG A;  5IP7 H;  1LTA D;  1N32 Q;  2K52 A;  4WRD A;  1S40 A;  4GLV B;  4OEM B;  3KUP A;  5JJZ A;  1H95 A;  3RMH A;  3ONA B;  2QEX A;  1HTL D;  2F0J A;  2A6H D;  1K83 B;  3KLW A;  4QGU A;  3A5Z B;  1U5K A;  1SMY D;  1SSO A;  2WFW A;  1SYB A;  1B53 A;  3RD4 A;  3SK5 A;  4GOP A;  5T1G A;  5J39 A;  4X3S A;  5D3D A;  4K6L A;  4HR7 B;  4A3M H;  1Y1W H;  2JA6 B;  1K8O A;  3GTG B;  4JI1 Q;  2NN6 I;  2VS1 A;  1WTQ A;  1QUQ A;  3ERS X;  3R2T A;  2F0Q A;  4GNX C;  1SYE A;  3HKZ E;  4HJ8 A;  3S1Q B;  4J15 A;  3GTK H;  4XT1 B;  2YU9 B;  3J81 j;  3AFQ A;  5C0X I;  2MUY A;  4Y52 H;  3DHQ A;  2AUK A;  4DV5 Q;  5C3W A;  3B6Y A;  5EPK A;  5IYD G;  4C3H G;  4R4I A;  5FJ8 H;  1S5E D;  3FRP B;  3A8I E;  4RAU C;  2JA5 G;  2E2J H;  4RKB A;  2RQX A;  4RKL A;  1WTP A;  1JOQ A;  5CV5 A;  3PIP A;  1SE8 A;  4ABN A;  5AJ3 L;  1A6X A;  3GTO H;  2IY5 B;  1KD1 C;  2B63 H;  5C5M A;  3T1H Q;  3CHB D;  3I2Z A;  1ML0 D;  1Y69 U;  1VQK A;  1YNJ C;  1SNC A;  2A68 D;  3JC6 6;  1XJV A;  3PCO B;  4GOP B;  3DMU A;  2XN9 C;  3TS2 A;  3RLO A;  1FYC A;  1EIY B;  5IT9 c;  2IHF A;  1VQF A;  4X64 L;  5EKL A;  2XGT A;  2B2W A;  1UWV A;  1QUQ B;  4K0K Q;  1XMQ Q;  4JV5 Q;  1MI2 A;  3JAM E;  4PQX A;  3QWN A;  2MP1 A;  4C3H B;  1WTO A;  2NVT B;  3E3X A;  3D4D A;  1JJG A;  4I7A A;  2MO1 A;  1I4H A;  3KBG A;  3FVQ A;  4NPS A;  2EYO A;  1I4P A;  2EJF C;  2NVY B;  3KYH C;  4BY7 H;  2ZM6 L;  3BYY B;  2DUD A;  1WOC A;  2NTT A;  4XTC S;  2HQL A;  3S2H B;  1E24 A;  3HKZ G;  4TRD A;  3ND9 A;  1VQM A;  1X32 A;  2BCO A;  1PH8 A;  1EU3 A;  1HXY D;  1HR0 Q;  3I4N G;  4C56 C;  4CDE C;  3EN2 A;  1PH2 A;  4OXP A;  1ENF A;  1Q90 A;  4IUT A;  2K1B A;  3W1B A;  2L0C A;  2MPM A;  4CJ1 B;  1FGU A;  1QOH A;  3H3V H;  3VR3 A;  3T4A C;  3MEH A;  2OWO A;  3UDI A;  2M2L A;  3PMF A;  4R8N A;  3V96 A;  2XVS A;  3ULL A;  1YEZ A;  4KN4 C;  4RA8 A;  1OXV A;  1FR3 A;  3NUC A;  2ZJR A;  2DJF C;  2F4V L;  4HSV A;  1KL9 A;  3PF5 A;  4DK0 A;  1K9M C;  5FLX c;  1EL0 A;  5KYL A;  3F2D A;  3CU7 A;  3HKZ B;  2PNR C;  3PF4 A;  1CKM A;  4DR5 Q;  1KAB A;  3WWV A;  2RF4 A;  3BG3 A;  4O2D A;  1SFO B;  4MZ9 A;  4UP7 A;  3SHL A;  3I55 A;  1N33 L;  1I50 B;  1V43 A;  2R7D A;  1DGS A;  2RCF A;  2PO4 A;  2I5M X;  2R6G A;  2F0P A;  3P1H A;  5E4W C;  4OO1 I;  4LFB Q;  3I70 A;  1A3V A;  4J6H A;  3VYR A;  4C3I B;  1VQ8 A;  1C7Y A;  4KHZ A;  4X65 L;  4AYB G;  5GAE C;  4LNQ A;  1WJJ A;  3GTQ B;  1TWH B;  3ERO A;  1JQY D;  1B8A A;  1X9N A;  1DOM A;  1UE7 A;  1K83 H;  2MFI A;  2B2Y C;  1IBM L;  5E3F A;  2IX0 A;  2SOB A;  3UDG A;  3I90 A;  1ICF B;  2F0S A;  1ZYR D;  1PH1 A;  3U9S A;  2KQ3 A;  5KYI A;  4ZLT F;  1PLF A;  1DOL A;  1XNQ L;  2RSO A;  2JA6 H;  2BH2 A;  4DUZ Q;  3KK7 A;  1OTC A;  1SJE D;  4B9X A;  1HR0 W;  2D5D A;  4EQO A;  2C35 B;  2Q2U A;  2CWP A;  1H9S A;  1Y1V H;  2Q2H A;  1SBB B;  2F0W A;  3CCR A;  3R8B A;  3HRZ C;  5ELC A;  2YU9 H;  2K05 A;  1RTN A;  1PTO B;  3I73 A;  2B2V C;  5IOC A;  3F1Z A;  1PYW D;  3HOX G;  4JI1 L;  4B9W A;  4WJW A;  2KUM A;  4Y7N B;  1PH3 A;  5C44 G;  1S3O A;  2SDF A;  4LUO A;  1HJP A;  1HHV A;  4PNY A;  4IOC A;  2NVX B;  5I2X A;  4BXX G;  3S17 H;  3HOU G;  4DV5 L;  1PH7 A;  1QWY A;  1VQA A;  1AE3 A;  3GO5 A;  3A8J E;  1MJC A;  1CKN A;  2B39 A;  1HA6 A;  1ESF A;  2RHS B;  3BVZ A;  3F2C A;  4DV7 Q;  3W3A A;  3BVG A;  1H9S B;  5IGG A;  3HOX B;  1PRT C;  3MVV A;  5KNB A;  4WJ4 A;  1WI5 A;  3CCM A;  5D14 A;  4A93 B;  1TY0 A;  1AEX A;  2LS0 1;  3PIP 3;  2NVY H;  4LF4 Q;  4A4I A;  4V0B A;  3PSI A;  5C4X G;  2J4X A;  4KHV A;  4JV5 L;  1I4G A;  2EYP A;  5ELF A;  5DM6 3;  1DOK A;  2KCN A;  1SYD A;  1KHI A;  1SDF A;  1GUN A;  4K5W A;  2E2H B;  1BR9 A;  4ID6 A;  5GRO A;  1SJH D;  3VA7 A;  1LTT D;  4CDF C;  1CSP A;  1E0B A;  1F2M A;  4EQN A;  2F0V A;  1CKN B;  4IFD J;  4RGM A;  1YIJ A;  3NSW A;  1RDP D;  4P71 A;  4A3G H;  3Q0A A;  1UE6 A;  3DWQ A;  3MHB A;  5C5L A;  1QZG A;  3H0G G;  5EAY A;  1HR0 L;  2CCZ A;  2VUM H;  2L15 A;  1O78 A;  1LT6 D;  2HDL A;  4YCV A;  3ULP A;  3JAM i;  3NP8 A;  4A3F B;  3VYU A;  2K5N A;  5DM7 3;  5I6Y A;  4LF9 L;  3PO2 G;  4J1M A;  1TKW B;  2LMC B;  3TZD A;  2B8G A;  2NUC A;  1SE3 A;  5C4J B;  3I72 A;  1RL2 A;  4ME3 A;  1YNN C;  1ENC A;  2E75 C;  1MIU A;  4PZ7 A;  1VQ4 A;  4KTA A;  1DZ1 A;  3BJU A;  5M3F G;  2N8N A;  1HCZ A;  4C3I H;  1GUO A;  4DR5 L;  2CFM A;  3GTP B;  3L7Z C;  3URY A;  2EJM A;  5FO9 B;  1V1Q A;  4JPB W;  1I4Q A;  4RGN A;  5CV9 A;  5EPL A;  1IBK Q;  3SR1 A;  2EZV A;  1U4L A;  3AMU A;  3K0X A;  1B1Z A;  3P75 A;  3OMG A;  3VR4 A;  1KRS A;  3PO2 B;  2EPB A;  4CKC A;  4EQ5 A;  2ICI A;  2A6E C;  4A76 A;  2E2D C;  4OIK A;  4TQU S;  1X3Q A;  5C0X J;  4CDC C;  3FDT A;  3MFG A;  4RCO A;  3T51 B;  4BBS G;  4R9W A;  4IUQ A;  1N36 Q;  1I6H H;  3W5O A;  4A3B G;  3K81 C;  3U58 A;  2BA1 A;  1E2W A;  5LL6 X;  3D6W A;  2JEB I;  3A8K E;  1PTO H;  4IJL A;  1KNE A;  2ZTE A;  1TS4 A;  1HUM A;  3S15 B;  4IFD H;  2F0G A;  1LT4 D;  1SAP A;  2F0M A;  3KBX A;  2F0O A;  2CW0 D;  1J9O A;  2NZH A;  1ILP A;  4GS3 A;  4G4K A;  5ELB A;  2K5D A;  3D8G A;  2V1C C;  2X6G A;  4BBS B;  2L55 A;  2EY1 A;  1B2T A;  4H44 C;  4GN3 B;  3SDZ A;  4XT3 B;  1QVG A;  2D2C C;  5FLM G;  4AQY Q;  4Q0F A;  2R3Z A;  2XNA C;  1PH5 A;  1JC7 A;  2L11 A;  5HGT A;  2EY5 A;  2K33 A;  4PZ6 A;  3AEV A;  1CKO A;  2PI2 A;  2F4I A;  4HMI A;  3X3M A;  4A93 H;  1RKN A;  1KLG D;  2L1B A;  3DXJ C;  2XWB B;  1SYC A;  4DV7 L;  1VCI A;  1Q81 C;  3TZU A;  1RIP A;  3OHX C;  2BE5 D;  4FNF A;  2EIF A;  2OQ0 A;  4QJF A;  4IUU A;  2NN6 H;  2H5X A;  1VQJ A;  2ZT9 C;  2KEN A;  1NNX A;  2RHQ B;  5D65 A;  2JA9 A;  1KIX A;  2CH4 A;  2WV6 D;  3HOZ G;  3M4O B;  1Q1B A;  1PYB A;  4KLK A;  2CWA A;  3U9O A;  2DNC A;  4FO2 A;  3IKJ A;  4UDU C;  4BWG B;  3WDN A;  3HOV G;  1PFM A;  2ASB A;  3GV6 A;  3OPO A;  5C3E H;  4JI5 Q;  1PH4 A;  3NE5 B;  4DAV A;  1IKL A;  2I5L X;  3PV0 A;  2BA0 A;  4A3F H;  4HTH A;  1EY9 A;  2Q2I A;  3UE1 A;  3NBH B;  1Q1E A;  4DUY Q;  3FPU B;  5COY A;  4HMJ A;  3FKI G;  3EQL C;  4OWX B;  5C4J H;  1LAB A;  2VQF L;  1GO3 E;  4HED A;  3K59 A;  4DXF A;  1PZJ D;  5I9O A;  4HJA A;  2L9H A;  4FF3 A;  3HOV B;  3G6E A;  1MSH A;  4IO9 A;  5M5Y B;  1JWU D;  1VQE A;  5EBD A;  1X3G A;  1EYA A;  2SNS A;  4A3E H;  3I8Z A;  1E2Z A;  4ZUJ A;  4RH6 A;  5ELE A;  2NVQ B;  3P20 A;  1CI3 M;  1EQT A;  4J8Q A;  1IKM A;  4UPA A;  3TRZ A;  2EY6 A;  3K58 A;  3K5L A;  3PO2 H;  5JAV A;  3I3C A;  5JOB A;  3MXP A;  1BDO A;  4AH6 A;  1X6O A;  1BBX C;  1HQR D;  2PMZ E;  3I4M G;  1ZXT A;  4OHJ A;  1LTL A;  5J1Z A;  4R8I A;  1H9M A;  3QIA A;  1U4R A;  1PH6 A;  3QOL A;  1IBK L;  3MEF A;  4A3K B;  1PTO D;  1RF2 D;  3F8T A;  1U9R A;  4M1U B;  4RHS A;  1GD7 A;  2EVB A;  2VQE Q;  1Z6H A;  1TQO A;  3GTJ H;  2KED A;  1IL8 A;  1UAP A;  4B3M Q;  4DV2 Q;  2K5H A;  3J80 E;  2ZM6 Q;  4HJ5 A;  1G2S A;  1HPC A;  2JEA I;  4JI0 L;  4A3C G;  3N6R A;  2K75 A;  2Q8R E;  4MTN A;  4CBV A;  1CM9 A;  1IYV A;  1E1O A;  3KLS X;  2HIV A;  3I4M B;  2IL8 A;  1BVS A;  2ZXO A;  2IJ0 A;  1VMP A;  4K8J A;  1L0X B;  1SXT A;  4XQN A;  4K6D A;  3J81 L;  2ALY B;  3FP9 A;  2B3G A;  3PUW A;  2BDO A;  4JI2 Q;  3KDF A;  3G48 A;  4OO1 H;  4KI0 A;  2BOS A;  1STH A;  2CVR A;  1S5F D;  2K03 A;  3KJP A;  4N8F A;  4DK1 A;  1NY4 A;  1WTW A;  3FMC A;  5M5X H;  4XYO A;  4KMU C;  3AB9 A;  1N33 Q;  1VQG A;  2HCC A;  2B2U C;  1ENA A;  2CH4 W;  1UUP A;  1C9O A;  3T53 B;  4EGV A;  3T16 A;  1LLR D;  1VQ6 A;  3D6C A;  4IUP A;  2DGY A;  1CT1 D;  4O1N A;  1UEA B;  3EIV A;  4X66 Q;  4MN3 A;  1SE2 A;  1NJI C;  2PW7 A;  2E8G A;  3BZD B;  3SEB A;  2UUA Q;  1XPU A;  3HOY H;  1KC8 C;  2JA7 G;  4F8M A;  1F2L A;  3I91 A;  2RSN A;  3MXU A;  5BN4 A;  4B08 A;  3KDF B;  2PW5 A;  4L6T B;  1W3S A;  3M3Y B;  3IL8 A;  1LUZ A;  2Z6K C;  2WP8 J;  1K3R A;  2I07 B;  2PMZ B;  2WAC A;  1O80 A;  1DM0 B;  5I2Y A;  3S1R B;  4JC0 A;  1PRT F;  1QJO A;  3EBE A;  1XNQ Q;  2RA4 A;  2X6L A;  1KAW A;  4DKA C;  1TWC B;  1YI2 A;  4DV1 L;  1H9K A;  5K36 G;  3TDQ A;  4DV3 Q;  4MNO A;  2KEE A;  1D2B A;  3C1F A;  1IW7 C;  1AW7 A;  4XYQ A;  4JG2 A;  3SE0 A;  4CHT B;  1CUK A;  4M8A A;  2F0U A;  2HHH Q;  4CKB A;  3BDC A;  4F88 A;  3PGZ A;  1XNR L;  3GTM B;  4JI5 L;  1KLU D;  4A3L H;  3W1G A;  4LF7 Q;  5CBE E;  5G3L D;  1EUJ A;  1M1K C;  4DXG A;  3OTO Q;  5M5Y H;  1TXY A;  3NK9 A;  4IPD A;  1JR0 D;  1WCM G;  4DUY L;  1YBY A;  2QDL A;  1EEI D;  3MZ5 A;  2N55 A;  4K14 A;  1AZQ A;  4IQZ A;  5HGQ A;  4UP9 A;  4TKO B;  2G5D A;  2B2U A;  1OXX K;  4B3R Q;  5IGB A;  5IYB G;  5IT9 L;  4KY5 A;  4BA2 I;  5JEA G;  4ZCK A;  4DF7 A;  2QA4 A;  4DN4 M;  1G8Z D;  3DUZ A;  1Q82 C;  1LTR D;  2AWO A;  4LUV A;  1VQ9 A;  1QVF A;  4A3K H;  3HGB A;  1LYL A;  4DV6 L;  1GUG A;  2I5H A;  1WCM B;  2RBM A;  2VY3 A;  1CA6 A;  3DWA A;  4N9T A;  3M7G A;  1LT3 D;  5IP9 H;  1STG A;  1JE5 A;  1I94 L;  4GLA C;  5EGT A;  2Z6K A;  1TWG B;  2VB2 X;  3M7N A;  1R4Q B;  1K28 A;  3X3N A;  2JA5 B;  4RWS C;  4IN3 A;  1F2Y A;  1G29 1;  1T5X D;  2VQE L;  3I4M H;  4B3M L;  1C48 A;  1XTC D;  4DV2 L;  4AYB E;  4RGT A;  1AN8 A;  2RDF A;  3GV3 A;  3KF8 A;  4JI7 L;  4IOA A;  1G51 A;  1TWA H;  5CV7 A;  2Z6B A;  4GN5 A;  2EYL A;  2C9O A;  2N78 A;  3OIP A;  1HQM C;  3Q6S A;  1FJG L;  5HUR A;  4JBJ A;  5FLX L;  1LT5 D;  2UUB L;  5EBC A;  4LF9 Q;  4GNX A;  2JN4 A;  3L2P A;  1I3Q B;  1HTP A;  1RCV D;  1K8M A;  2AQ1 B;  2KCM A;  4JI2 L;  1GXD C;  3CCL A;  3WOF A;  2HT1 A;  3J80 i;  3Q8D A;  3H15 A;  4G7H C;  1BO0 A;  3E9H A;  2MQH A;  3OWE B;  1EWC A;  2H4O A;  3QJY A;  4PMC A;  1SYF A;  1FD7 D;  3PIO A;  5NUC A;  2UUC L;  3I4N B;  2F03 A;  3J7A 5;  4EVO A;  3I4O A;  1BBU A;  1N34 L;  3A7A B;  4H02 A;  4EX5 A;  3M9B A;  1TWF B;  2TSS A;  3UE0 A;  3FPP A;  5L37 A;  3NTH A;  2E5L Q;  2M9V A;  4X66 L;  1KXL A;  1STE A;  3KLR A;  2UUA L;  2UXD L;  3S1R H;  3TS0 A;  1FVI A;  1PYS B;  4GNX B;  2K50 A;  3DEO A;  4AIM A;  3CCJ A;  4HAE A;  1B9N A;  4FF2 A;  3H6M A;  4XIG S;  4P72 A;  5IGF A;  5IY0 A;  4GKJ Q;  2K32 A;  1HFG A;  1I5F A;  3T1Y Q;  5JJL A;  3GTG H;  2FIN B;  3SK6 A;  3U50 C;  4WFN 3;  3G71 A;  4XQJ A;  1PZK D;  1E1T A;  1DD2 A;  4IUR A;  2X69 A;  2QW7 A;  3ULJ A;  4DV3 L;  4WOR A;  4AYB B;  3S1Q H;  3GP7 A;  5CYU A;  3NTK A;  2LKV A;  2DY7 A;  3J80 L;  3OWF A;  5JPM C;  2K4K A;  1W6K A;  2LY7 A;  1KNA A;  4QY7 A;  2HHH L;  5I6W A;  1D1I A;  1JJ2 A;  3S1M B;  1ASY A;  3LNN A;  2B8F A;  1ASZ A;  2JYO A;  4LF7 L;  5FKA C;  4DNI A;  2EXD A;  2Q8T A;  4PMW A;  3U4Z A;  3OTO L;  1VQH A;  3A0J A;  1B7Y B;  4HSP A;  4C3J G;  2PQA A;  1SNO A;  5TSS A;  3T13 A;  5M3M G;  2IPK D;  2A69 C;  4H0L C;  4B3R L;  1X65 A;  4APV A;  3TSS A;  3HG9 A;  2MNA A;  1STB A;  4FXK C;  1I6V C;  3N52 A;  4JI4 Q;  2MO0 A;  4IJH A;  4BBR G;  3G7L A;  3TME A;  3EFX D;  5E7N A;  2F0N A;  1GJX A;  5CV8 A;  5IYD H;  4C3H H;  2FMM A;  3PO3 G;  2NVT H;  1B50 A;  2JA5 H;  4R4Q A;  1CQV A;  4LAA A;  5C44 B;  1CA5 A;  4NXN Q;  1VQC A;  4A3I G;  3NEM A;  4JVZ A;  3J81 E;  4OX9 L;  3S1N B;  2IT1 A;  2A68 C;  1YJ9 A;  2B2Y A;  1QVC A;  3S2H H;  1VQD A;  1WYD A;  4C3J B;  3HOU B;  5C4H A;  4FVM A;  2KCC A;  5FO7 B;  2QEJ C;  1KDA A;  3T56 B;  3V2T A;  5DLQ E;  1NR4 A;  4K5V A;  2MJ8 A;  1HH2 P;  3HS0 C;  4KY6 A;  2JE6 I;  2PQA B;  4BBR B;  2ES2 A;  1JOR A;  3AYH B;  1AZP A;  1CHP D;  2JXM B;  4HIM A;  3PO3 B;  3K5O A;  4OEL B;  5EQ0 A;  1EWI A;  4JI8 L;  3S24 A;  2VQF Q;  1D1K A;  2ZXR A;  4A3I B;  3STB D;  4NKL A;  2KHJ A;  1B44 D;  2B2V A;  2Y0S G;  3VR2 A;  5C4X B;  2Z1C A;  4BY1 G;  3IAY A;  1EY7 A;  1VDZ A;  1UEB A;  3UI2 A;  1SFO H;  4KKT A;  3I4N H;  2UU9 Q;  2I46 A;  1VQ7 A;  1I50 H;  2UXC Q;  3H91 A;  1P16 A;  1WD1 A;  4FXG C;  2CKZ B;  5CGK A;  5FOB B;  1TWF H;  5C6A A;  2OQK A;  5GAG C;  2KHS A;  1L1O C;  3E6Z X;  4DR2 Q;  3H0G B;  4A3J G;  3CQZ B;  1UE1 A;  1JOK A;  1A15 A;  2AQ3 B;  3GTQ H;  1TWH H;  1TR5 A;  1R4P B;  4BY1 B;  1J5E Q;  1D5M C;  4YCW A;  2R92 G;  3LWU A;  2E5L L;  2P5Z X;  3QOJ A;  2JP1 A;  3NXW A;  1Y14 B;  3UDX A;  4LF5 L;  1YNX A;  3TBI B;  4K5X A;  1LTB D;  4YWK A;  4JI0 Q;  2DY8 A;  1NAP A;  1C8C A;  2CHB D;  2DJG C;  4B3T L;  2N3S A;  4KJO A;  4ME5 A;  4HID A;  5M3F B;  4L8J A;  1HA5 A;  5ISR A;  1VQN A;  3HOW G;  2PI2 E;  5BN3 A;  1RTO A;  4A3J B;  4OWW B;  2EJG C;  5EKK A;  4S3S A;  4GKJ L;  2F3I A;  2O5J C;  1HZ9 A;  1EU4 A;  2EXZ A;  4CKE A;  3T1Y L;  2R92 B;  1M4V A;  1ZYR C;  1J8I A;  1A2T A;  5IT9 E;  3S14 B;  4FF1 A;  1EQR A;  3PQI A;  2RDH A;  1Q8K A;  1PRT B;  1EQV A;  5A35 A;  4Y7N H;  1CFM A;  1HFN A;  2NYZ D;  1K0S A;  1G91 A;  2NVX H;  5LMN Q;  1C4Q A;  3OW7 A;  2JA8 G;  1A3T A;  1QCB D;  4QL5 A;  1W6J A;  3VYS A;  4A3B B;  1BUV T;  3QB3 A;  3K7A B;  1HZA A;  1ICW A;  2ZTD A;  1EQQ A;  3TP6 A;  1SE4 A;  2N88 A;  1U4P A;  1R9T B;  3K8A A;  2VL6 A;  3MXG A;  2R93 G;  2K04 A;  4BA1 I;  1TT2 A;  3VDY A;  2R7Z G;  3HOX H;  4JYA L;  1L1O A;  4K2L A;  3TN2 A;  3QO2 A;  4HJ7 A;  3JAM c;  5IGE A;  3RZO B;  5C44 H;  3J7A V;  1A3U A;  1JCK B;  1V1O A;  5LMU Q;  5H1S E;  2F0I A;  3R2I A;  1GUS A;  1S5D D;  3BZK A;  2WB1 E;  4JI4 L;  1TII D;  3NEN A;  2JA8 B;  4BXX H;  1SMX A;  1X3P A;  3HOU H;  1ZEQ X;  1NCV A;  4X3T A;  2WAQ E;  2AKW B;  3D4W A;  4ZRZ A;  5BR8 Q;  2LXK A;  3ICE A;  4ZYS A;  2E2H H;  3CW2 C;  4RG1 A;  5ELN A;  4KD3 A;  5C3X A;  4LUZ A;  5M9O A;  5FLX E;  2E74 C;  4NXN L;  4DNT B;  4BBR H;  5LL6 S;  3OSO A;  1EYC A;  1E3P A;  1S4Z A;  4DV1 Q;  1OXU A;  2KOL A;  3BS1 A;  2K7V A;  3TQY A;  3SGI A;  3CF5 A;  2A74 C;  3FEW X;  4DGZ A;  1EYG A;  1B3Q A;  1L1O B;  1TU2 B;  1XNR Q;  5KEE A;  5IYC G;  1W2B A;  2LFN A;  5C4X H;  3H3V C;  1RJT A;  1Q8I A;  4YIJ A;  5EPJ A;  1Y1W G;  2A73 B;  1B3A A;  1PTO F;  1DJR D;  2BH8 A;  2HDM A;  4QUC A;  1E7Z A;  3Q23 A;  1STA A;  3J81 i;  1MD2 D;  2XSC A;  3HOZ B;  3RR5 A;  1FL0 A;  5LMN W;  4G7Z C;  4X3U A;  1HNW Q;  3D3R A;  5CV6 A;  1WVL A;  3F2U A;  1P8L A;  2VB3 X;  2ENB A;  3TRE A;  4DR3 Q;  4LF8 L;  3GTP H;  1S5C D;  3H0G H;  1BCP F;  4JI6 Q;  3CQZ H;  1SND A;  3CKI B;  5FJ8 G;  2UU9 L;  2WB1 G;  2UXC L;  1X56 A;  5JJI A;  4NDX A;  2ATW A;  2WAQ G;  4XQQ A;  4DV6 Q;  1Y1W B;  1EY0 A;  2B63 G;  4X62 Q;  3NHH A;  3DWP A;  3FKI B;  4CJ2 C;  4YY3 Q;  3QG1 A;  3VA5 A;  4DR2 L;  4U68 A;  1F9P A;  2IX3 A;  2PPB C;  1YNJ D;  2M00 A;  1I94 Q;  5IE8 A;  4GLX A;  1KDB A;  3NTI A;  3E0J A;  5M3F H;  4B3S Q;  2AUJ D;  1J5E L;  1EZ8 A;  1KQS A;  4DR1 Q;  4UHV A;  4LFA L;  3GQB A;  3TP8 A;  3UDF A;  1Z47 A;  3MA2 B;  2WB1 B;  5D3I B;  1PHJ A;  2E2J B;  1STN A;  3CMA A;  3OW2 A;  4JI7 Q;  4F87 A;  1VF7 A;  2K5V A;  2WAQ B;  3GTO B;  2R92 H;  2JQO A;  4BY7 G;  3HFZ B;  4MTK A;  3S14 H;  3S15 H;  2ZTC A;  1G6P A;  1EYD A;  1FJG Q;  3SVM A;  1VS0 A;  2UUB Q;  4P2C B;  4U67 3;  5JVH 3;  1ROD A;  1CZG A;  3CME A;  4BBS H;  3S2D B;  2Z4I A;  2D0O A;  1GVP A;  1BQQ T;  3SK8 A;  3L0O A;  4A3B H;  2HUG A;  2YTY A;  4HCS A;  1PFN A;  4LK1 C;  2K28 A;  3K7U C;  5I4D A;  4ZQ3 A;  1R9T H;  5ELO A;  3BYT B;  5T1I A;  1SRO A;  4BY7 B;  2UUC Q;  2L5T A;  2A1A A;  2A5H A;  4FYD A;  5LMN L;  1LTI D;  2CW0 C;  1N34 Q;  2WII B;  5E1F A;  3CCE A;  1GOZ A;  1EOT A;  4X6A H;  3BDO A;  1L0W A;  1K8A C;  3AFP A;  1XYI A;  1XPR A;  1SLJ A;  4ILW A;  5IWA L;  2L4N A;  5FK9 C;  5IGD A;  3IRB A;  1D5X C;  2Z9H A;  2UXD Q;  2F0D A;  5G3L F;  1FNU A;  4OL7 A;  5CR3 A;  5FLM H;  4KHP Q;  1CQF A;  5LMU L;  1SNP A;  4N8X 1;  3BVM A;  5A2Q L;  4RHR A;  2OXP A;  2BDN A;  3M4O H;  2AWN A;  2SNM A;  2RVL A;  4RFB A;  3A54 A;  1EY5 A;  1NE3 A;  3C46 A;  4F7X A;  3CCS A;  5BR8 L;  3SK4 A;  4OIJ A;  3TEH B;  2BE5 C;  1O7Z A;  5ELD A;  2KJX A;  2PQE A;  2F1M A;  1XWE A;  1YIT A;  2HQE A;  1NTG A;  1JB3 A;  1JIC A;  3K80 C;  4DR4 L;  2JA6 G;  3RLF A;  2JA7 B;  2E76 C;  4DK3 C;  1XX8 A;  1K3B C;  1EIF A;  3O13 A;  3HOZ H;  1Y1V G;  4LFC L;  4L5R C;  5KNC A;  1PXU A;  4CJ0 B;  1ET6 A;  4DV4 Q;  1GKH A;  2AQ2 B;  1IHZ A;  1WD0 A;  3HOV H;  2ZJP A;  2YYZ A;  2D9U A;  4DFA A;  3C2P A;  3RN5 A;  1UE5 A;  2EYF A;  3M4Q A;  5IYC H;  2Q2T A;  2NB0 A;  2NVQ H;  4G7O C;  3DM1 A;  4ZUI A;  3KJO A;  3TP7 A;  4I65 A;  4K2K A;  1SYG A;  3NWT A;  1SN8 A;  3KF6 A;  5CV4 A;  4L5T A;  1HNW L;  4KJN A;  4DR3 L;  1OXS C;  1O7I A;  3FKI H;  5CBA E;  4GN4 B;  3ZYY X;  1ZKO A;  1Y1V B;  3H09 A;  4JI6 L;  1WTV A;  3V05 A;  1YJW A;  1I4R A;  2A69 D;  4NP5 A;  3CRK C;  1F9R A;  3DM3 A;  3NQT A;  1EOV A;  3L3O C;  1O7L A;  1U0L A;  3MC0 B;  1JWM D;  4X62 L;  4DV0 Q;  2F52 A;  4OX9 Q;  1KDC A;  2N49 A;  2GVA A;  1WFQ A;  3IFD A;  2FXQ A;  4YY3 L;  4C2M B;  1ILQ A;  1PRT D;  3I4L A;  4KKS A;  2NZ1 D;  1AFP A;  2GN5 A;  1A8V A;  1SR3 A;  1EEF D;  4B3S L;  3S17 B;  1ONL A;  4DR1 L;  1PV4 A;  2RDG A;  4DAY A;  3HZX A;  1PFS A;  3KF6 B;  3VR6 A;  2XRQ D;  2G9H D;  1PTO C;  3KLS A;  3LGJ A;  1LTS D;  2IHE A;  2B29 A;  3CRL C;  4JI8 Q;  3S2D H;  1PFB A;  1J6Q A;  1SRU A;  1D7Q A;  2YTX A;  1JWS D;  3M85 A;  1DCZ A;  2J7Z A;  3CC7 A;  2OCE A;  4A3G G;  1MHW C;  2NWG A;  4HIO A;  1TVX A;  4A3C H;  1EY4 A;  3OOC A;  1QE6 A;  1X55 A;  4L5Q A;  1LTG D;  4DAP A;  1BCP C;  1NSN S;  2VUM G;  3VR5 A;  3E0E A;  3J7Y W;  2ZJQ A;  1HRJ A;  4DU9 A;  3HP3 A;  4OGQ C;  2L12 A;  2K5Q A;  5IOD A;  4L5S A;  1QZH A;  1VQL A;  2E2I B;  1HZB A;  1TS3 A;  4IPC A;  2HCI A;  2KHI A;  2F3W A;  4JI3 Q;  1OXT A;  2MGS A;  1VMC A;  4DAY B;  5IGC A;  1D6E C;  1YZ6 A;  5FO8 B;  1IXR A;  3KF8 B;  4R1J A;  2VNU D;  4JOI C;  4DA2 A;  4A3G B;  1YNN D;  1CZW A;  4JCV E;  4C3I G;  1IYJ B;  1EY8 A;  2XIW A;  2QGQ A;  2VUM B;  3M4Y A;  2VXW A;  3M3Y H;  2EYH A;  2EE1 A;  4LF5 Q;  5KGU A;  3MWY W;  3MFY A;  5JEA J;  4B3T Q;  3IFT A;  3E5S A;  2PYK A;  4DR7 L;  4KHP L;  2VW9 A;  1TWC H;  1JOO A;  1V8Q A;  1D5Z C;  3RLN A;  5BN5 A;  3NQI A;  1UNS A;  1A63 A;  2JA7 H;  2A6E D;  1TS2 A;  1IL2 A;  3ND8 A;  2FFK B;  4JK1 C;  3FHW A;  1JJC B;  1BNZ A;  5F2D A;  3GTM H;  2O2L D;  3D4R A;  4GKK L;  1IZ6 A;  2IWH A;  1X3F A;  1NMG A;  3NBI A;  3CXC A;  2A6H C;  4DNR B;  3OYY A;  4IFD G;  1BF4 A;  1SMY C;  5EJW A;  2KCT A;  1N32 L;  2QDB A;  1S72 A;  4QB4 A;  5K36 H;  4YWL A;  3CAM A;  3KOJ A;  2OTJ A;  3S16 B;  3I7F A;  2YV5 A;  4P75 A;  1FNV A;  3ER0 A;  4JBW A;  1XPO A;  2EYJ A;  4YWM A;  2A19 A;  4DV4 L;  1VQP A;  3TP5 A;  1I6H B;  5IIF A;  1Q86 C;  4A75 A;  1CK1 A;  1Z7T A;  4JYA Q;  2DNE A;  2B2T C;  1G6Z A;  2J0T D;  2Y0S E;  1WTR A;  1AH9 A;  2XWJ B;  4JOI A;  2TMP A;  2XRS D;  1WCM H;  2Z4H A;  1EZ6 A;  4RMF A;  1E22 A;  4IZ8 A;  4C2M H;  4RGO S;  4XDX A;  1Y8N B;  3EVQ A;  4A93 G;  1AP0 A;  3J80 c;  1VQ5 A;  1X3E A;  3RZD B;  1TWG H;  4HIK A;  2YTV A;  5IYB H;  1FNW A;  3K5M A;  1BCP B;  4QCL A;  3RUZ A;  2JJQ A;  1LV9 A;  5KIX A;  3W2D A;  1YHB A;  5JEA H;  4DV0 L;  2Z0S A;  2NN6 G;  1X54 A;  1IBL Q;  2PZT A;  5M3M B;  4ULL A;  2WIN B;  4ZAI A;  3Q24 A; 
#chains in the Genus database with same CATH homology
 1BOS A;  2D62 A;  5JPN C;  1QNU A;  5C0X G;  3DEP A;  1Q3L A;  5CMD A;  5DAU A;  2ZXP A;  5COR A;  3AU7 A;  2V4D A;  1EFI D;  4N9P A;  1RHP A;  2ICE C;  1EIG A;  4RCN A;  2PZU A;  2PCF B;  3BDL A;  4KY7 A;  1CTM A;  3A55 A;  4QF4 A;  2F0L A;  2B2T A;  5A2Q E;  1B9M A;  3D31 A;  3C1E A;  3PUY A;  5K5P A;  3MXN A;  5C3E B;  2O4X A;  1H9J A;  4LMQ D;  1L0Y B;  3OIQ A;  2Y0S B;  3A7L A;  5DEH A;  1E2V A;  4GZY C;  4E6I A;  4IAL A;  3PIO 3;  1NR2 A;  3NWS A;  4KV6 A;  4UAI A;  3LX0 A;  4H7B A;  4CGY B;  1M8A A;  3PUX A;  4A3E B;  3HEJ A;  5KRU A;  1MBY A;  1VF5 C;  4FXD A;  2QIL A;  4IUN A;  4A3D B;  4BS9 A;  4FF4 A;  4QUF A;  4EQP A;  4V19 0;  3VYT A;  1Y8P B;  4ZK9 B;  3P7J A;  3EA6 A;  1Y8O B;  1G2T A;  4PV1 C;  2NBF A;  4KD4 A;  2QCP X;  3K57 A;  4OO1 G;  1JE4 A;  3GTJ B;  5EKI A;  1KTK A;  3K0Y A;  3HOW B;  3L9A X;  3JAM L;  4XXE A;  3H94 A;  1XXG A;  2OT2 A;  4Z9C B;  4Q5V A;  2IX1 A;  4KN7 C;  2QF7 A;  1S5B D;  4IUV A;  4QMG A;  3NPP A;  2OF1 A;  2KVM A;  1T5E A;  1GUW A;  1HUN A;  1F77 A;  2JSO A;  2R61 A;  5M5X B;  4O42 A;  3OMC A;  1NUC A;  2FMC A;  5AFW A;  2FHT A;  3WOE A;  2R93 B;  1F9S A;  2R7Z B;  2KA7 A;  4G57 A;  3NBH A;  1H9R A;  1II3 A;  3GTL B;  4PMB A;  1DXM A;  1GUT A;  4KK7 A;  5M5W B;  3HOY B;  1PMR A;  5E4X A;  1IW7 D;  1LO5 D;  5DNF A;  2Z8L A;  5LHY 1;  3K6O A;  5C0X H;  3S9W A;  2RKS A;  2K5W A;  2WKD A;  4C1N I;  2GA4 B;  2SEB D;  1BXT A;  2F0F A;  1EWH A;  1LAC A;  1A2U A;  3A56 A;  1QG7 A;  2F3V A;  2FJ2 A;  1F2Z A;  4I7Z C;  4TSS A;  2NTS A;  4A3M B;  2O5I C;  3ITP A;  2G9D A;  2CQA A;  2H1E A;  1STY A;  4FP5 D;  5KND A;  1TS5 A;  2F0K A;  1FGB D;  1V1P A;  1GHJ A;  1RD9 D;  3GTK B;  1SNQ A;  3PUZ A;  1QB5 D;  1PZI D;  4HN7 A;  1F9Q A;  4NMZ A;  2EYM A;  2WKC A;  1U4M A;  3MTS A;  2KEC A;  1Q12 A;  1WTX A;  1OO9 B;  2K6A A;  2ID0 A;  1ESR A;  1ET9 A;  2B63 B;  3GD7 A;  3ERQ A;  1B4O A;  4LJZ C;  1DYQ A;  1I4X A;  3R93 A;  4L63 B;  4H13 C;  1MGS A;  3MAQ A;  5JVG 3;  1EY6 A;  5J22 A;  3G6J B;  3PUV A;  1V1P B;  3EJI A;  4ZKB B;  4QIW B;  1KAA A;  2OEO A;  3LWE A;  4X3K A;  1BCP D;  4ZKC B;  1MSG A;  1GHK A;  4C1N K;  3K5N A;  1CHQ D;  4HCE A;  3J7A F;  5C4Z A;  1TY2 A;  2EY2 A;  1TWA B;  2MHV A;  4NW2 A;  3Q22 A;  1EIH A;  2C5C A;  3C3L A;  4MIU A;  1QNK A;  3R3O A;  2IW3 A;  2F0E A;  3SXH A;  4ODG A;  4K8I A;  4KKU A;  2QKI C;  5I9P A;  2EOT A;  2K01 A;  1O7Y A;  1IYU A;  4IFD I;  1DON A;  2DN8 A;  2PZW A;  2F0H A;  4MHE A;  2F0T A;  2Q8I B;  1QIL A;  2B2W C;  1SEB D;  1PDQ A;  1SNM A;  5CC4 A;  2EDG A;  1LTA D;  4WRD A;  3KUP A;  5JJZ A;  3RMH A;  3ONA B;  1HTL D;  2F0J A;  2A6H D;  1K83 B;  1SMY D;  1SSO A;  1SYB A;  1B53 A;  3RD4 A;  3SK5 A;  5T1G A;  5J39 A;  4X3S A;  5D3D A;  4K6L A;  4HR7 B;  2JA6 B;  1K8O A;  3GTG B;  2NN6 I;  1WTQ A;  3R2T A;  2F0Q A;  1SYE A;  3S1Q B;  4XT1 B;  2YU9 B;  5C0X I;  2MUY A;  3DHQ A;  2AUK A;  5C3W A;  5EPK A;  4C3H G;  1S5E D;  3FRP B;  3A8I E;  4RAU C;  4RKB A;  2RQX A;  4RKL A;  1WTP A;  1JOQ A;  5CV5 A;  4ABN A;  1A6X A;  5C5M A;  3CHB D;  1ML0 D;  1Y69 U;  1YNJ C;  1SNC A;  2A68 D;  3DMU A;  2XN9 C;  1FYC A;  5EKL A;  2B2W A;  1MI2 A;  3JAM E;  4PQX A;  3QWN A;  2MP1 A;  4C3H B;  1WTO A;  2NVT B;  3D4D A;  1I4H A;  3KBG A;  3FVQ A;  2EYO A;  1I4P A;  2EJF C;  2NVY B;  3BYY B;  2NTT A;  4XTC S;  3S2H B;  4TRD A;  3ND9 A;  1X32 A;  2BCO A;  1EU3 A;  1HXY D;  4C56 C;  1ENF A;  1Q90 A;  4IUT A;  2K1B A;  2L0C A;  2MPM A;  4CJ1 B;  1QOH A;  3VR3 A;  3T4A C;  3MEH A;  2M2L A;  3PMF A;  4R8N A;  3V96 A;  2XVS A;  4KN4 C;  4RA8 A;  1OXV A;  1FR3 A;  3NUC A;  4HSV A;  4DK0 A;  1EL0 A;  5KYL A;  3CU7 A;  3HKZ B;  2PNR C;  1KAB A;  3BG3 A;  1SFO B;  3SHL A;  1I50 B;  1V43 A;  2PO4 A;  2R6G A;  2F0P A;  3P1H A;  5E4W C;  4OO1 I;  3I70 A;  1A3V A;  4J6H A;  3VYR A;  4C3I B;  4KHZ A;  3GTQ B;  1TWH B;  3ERO A;  1JQY D;  1DOM A;  2B2Y C;  5E3F A;  2IX0 A;  2SOB A;  3I90 A;  2F0S A;  1ZYR D;  3U9S A;  2KQ3 A;  5KYI A;  4ZLT F;  1PLF A;  1DOL A;  2RSO A;  3KK7 A;  1SJE D;  4B9X A;  2D5D A;  4EQO A;  1H9S A;  1SBB B;  2F0W A;  3R8B A;  3HRZ C;  5ELC A;  2K05 A;  1RTN A;  1PTO B;  3I73 A;  2B2V C;  5IOC A;  1PYW D;  4B9W A;  4WJW A;  2KUM A;  4Y7N B;  2SDF A;  1HHV A;  4PNY A;  2NVX B;  5I2X A;  1QWY A;  3GO5 A;  3A8J E;  2B39 A;  1HA6 A;  1ESF A;  3BVZ A;  3W3A A;  3BVG A;  1H9S B;  5IGG A;  3HOX B;  1PRT C;  3MVV A;  5KNB A;  5D14 A;  4A93 B;  1TY0 A;  1AEX A;  2LS0 1;  3PIP 3;  4V0B A;  2J4X A;  4KHV A;  1I4G A;  2EYP A;  5ELF A;  5DM6 3;  1DOK A;  2KCN A;  1SYD A;  1SDF A;  4K5W A;  1GUN A;  2E2H B;  1BR9 A;  4ID6 A;  1SJH D;  3VA7 A;  1LTT D;  1E0B A;  1F2M A;  4EQN A;  2F0V A;  4IFD J;  4RGM A;  3NSW A;  1RDP D;  3Q0A A;  3DWQ A;  5C5L A;  3MHB A;  1O78 A;  1LT6 D;  2HDL A;  3NP8 A;  4A3F B;  3VYU A;  5DM7 3;  5I6Y A;  4J1M A;  1TKW B;  2LMC B;  3TZD A;  2B8G A;  2NUC A;  1SE3 A;  5C4J B;  3I72 A;  1YNN C;  1ENC A;  2E75 C;  4KTA A;  1DZ1 A;  1HCZ A;  1GUO A;  3GTP B;  3L7Z C;  3URY A;  2EJM A;  5FO9 B;  1I4Q A;  4RGN A;  5CV9 A;  5EPL A;  3SR1 A;  2EZV A;  1U4L A;  3AMU A;  3P75 A;  1B1Z A;  3VR4 A;  3OMG A;  3PO2 B;  2EPB A;  4CKC A;  2ICI A;  2A6E C;  2E2D C;  4OIK A;  4TQU S;  1X3Q A;  5C0X J;  3FDT A;  3MFG A;  4RCO A;  3T51 B;  4R9W A;  4IUQ A;  2BA1 A;  1E2W A;  5LL6 X;  3D6W A;  2JEB I;  3A8K E;  1PTO H;  1KNE A;  1TS4 A;  1HUM A;  3S15 B;  4IFD H;  2F0G A;  1LT4 D;  1SAP A;  2F0M A;  3KBX A;  2F0O A;  2CW0 D;  1J9O A;  1ILP A;  4G4K A;  5ELB A;  2K5D A;  3D8G A;  2X6G A;  4BBS B;  2L55 A;  2EY1 A;  1B2T A;  4H44 C;  3SDZ A;  4XT3 B;  2D2C C;  4Q0F A;  2R3Z A;  2XNA C;  1JC7 A;  2L11 A;  5HGT A;  2EY5 A;  2K33 A;  2F4I A;  4HMI A;  3X3M A;  1RKN A;  1KLG D;  2L1B A;  3DXJ C;  2XWB B;  1SYC A;  1VCI A;  3TZU A;  3OHX C;  2BE5 D;  4FNF A;  4IUU A;  2NN6 H;  2ZT9 C;  5D65 A;  2WV6 D;  3M4O B;  1Q1B A;  3U9O A;  2DNC A;  4FO2 A;  3IKJ A;  4UDU C;  4BWG B;  3WDN A;  1PFM A;  3GV6 A;  3OPO A;  3NE5 B;  4DAV A;  1IKL A;  3PV0 A;  2BA0 A;  4HTH A;  1EY9 A;  1Q1E A;  3FPU B;  5COY A;  4HMJ A;  3EQL C;  1LAB A;  4HED A;  3K59 A;  4DXF A;  1PZJ D;  5I9O A;  2L9H A;  4FF3 A;  3HOV B;  1MSH A;  5M5Y B;  1JWU D;  5EBD A;  1EYA A;  2SNS A;  3I8Z A;  1E2Z A;  4ZUJ A;  4RH6 A;  5ELE A;  2NVQ B;  3P20 A;  1CI3 M;  1EQT A;  4J8Q A;  1IKM A;  2EY6 A;  3K58 A;  3K5L A;  5JAV A;  3I3C A;  5JOB A;  3MXP A;  1BDO A;  1BBX C;  1HQR D;  1ZXT A;  4OHJ A;  5J1Z A;  4R8I A;  1H9M A;  3QIA A;  1U4R A;  3QOL A;  4A3K B;  1PTO D;  1RF2 D;  1U9R A;  4M1U B;  4RHS A;  2EVB A;  1Z6H A;  1TQO A;  2KED A;  1IL8 A;  1UAP A;  3J80 E;  1G2S A;  1HPC A;  2JEA I;  3N6R A;  2Q8R E;  4CBV A;  1CM9 A;  1IYV A;  3KLS X;  3I4M B;  2IL8 A;  2ZXO A;  2IJ0 A;  1VMP A;  4K8J A;  1L0X B;  1SXT A;  4XQN A;  4K6D A;  3J81 L;  3PUW A;  2BDO A;  4OO1 H;  4KI0 A;  2BOS A;  1STH A;  2CVR A;  1S5F D;  2K03 A;  4DK1 A;  1WTW A;  3FMC A;  4XYO A;  4KMU C;  3AB9 A;  2HCC A;  2B2U C;  1ENA A;  1UUP A;  3T53 B;  4EGV A;  3T16 A;  1LLR D;  3D6C A;  4IUP A;  1CT1 D;  4O1N A;  1UEA B;  4MN3 A;  1SE2 A;  2PW7 A;  3BZD B;  3SEB A;  4F8M A;  1F2L A;  3I91 A;  2RSN A;  3MXU A;  5BN4 A;  4B08 A;  2PW5 A;  4L6T B;  3M3Y B;  3IL8 A;  2WP8 J;  2I07 B;  2PMZ B;  2WAC A;  1O80 A;  1DM0 B;  5I2Y A;  3S1R B;  1PRT F;  1QJO A;  2RA4 A;  2X6L A;  1TWC B;  1H9K A;  5K36 G;  3TDQ A;  2KEE A;  1D2B A;  3C1F A;  1IW7 C;  1AW7 A;  4XYQ A;  3SE0 A;  4CHT B;  4M8A A;  2F0U A;  4CKB A;  3BDC A;  4F88 A;  3GTM B;  1KLU D;  5CBE E;  5G3L D;  4DXG A;  3NK9 A;  1JR0 D;  1EEI D;  3MZ5 A;  2N55 A;  4K14 A;  1AZQ A;  4IQZ A;  4TKO B;  2B2U A;  1OXX K;  5IGB A;  5IT9 L;  4KY5 A;  4BA2 I;  5JEA G;  4DF7 A;  4DN4 M;  1G8Z D;  3DUZ A;  1LTR D;  2AWO A;  3HGB A;  1GUG A;  1WCM B;  2RBM A;  1CA6 A;  3DWA A;  4N9T A;  3M7G A;  1LT3 D;  1STG A;  5EGT A;  1TWG B;  2VB2 X;  3M7N A;  1R4Q B;  2JA5 B;  3X3N A;  4RWS C;  4IN3 A;  1F2Y A;  1G29 1;  1T5X D;  1C48 A;  1XTC D;  4RGT A;  1AN8 A;  2RDF A;  3GV3 A;  3KF8 A;  5CV7 A;  2EYL A;  2C9O A;  3OIP A;  1HQM C;  3Q6S A;  5HUR A;  5FLX L;  1LT5 D;  5EBC A;  1I3Q B;  1HTP A;  1RCV D;  1K8M A;  2AQ1 B;  1GXD C;  3WOF A;  4G7H C;  1BO0 A;  3OWE B;  1EWC A;  2H4O A;  3QJY A;  4PMC A;  1SYF A;  1FD7 D;  5NUC A;  3I4N B;  2F03 A;  4EVO A;  3A7A B;  1TWF B;  2TSS A;  3FPP A;  3NTH A;  2M9V A;  1STE A;  3KLR A;  3DEO A;  4HAE A;  1B9N A;  4FF2 A;  3H6M A;  4XIG S;  5IGF A;  2K32 A;  1HFG A;  2FIN B;  3SK6 A;  4WFN 3;  4XQJ A;  1PZK D;  1DD2 A;  4IUR A;  2X69 A;  4WOR A;  4AYB B;  3GP7 A;  5CYU A;  3NTK A;  2LKV A;  2DY7 A;  3J80 L;  3OWF A;  5JPM C;  1W6K A;  2LY7 A;  1KNA A;  5I6W A;  1D1I A;  3S1M B;  3LNN A;  2B8F A;  2JYO A;  5FKA C;  2Q8T A;  4PMW A;  4HSP A;  4C3J G;  1SNO A;  5TSS A;  3T13 A;  2IPK D;  2A69 C;  4H0L C;  3TSS A;  3HG9 A;  1STB A;  4FXK C;  1I6V C;  3N52 A;  3G7L A;  3TME A;  3EFX D;  2F0N A;  1GJX A;  5CV8 A;  2FMM A;  1B50 A;  1CQV A;  4LAA A;  5C44 B;  1CA5 A;  3J81 E;  3S1N B;  2IT1 A;  2A68 C;  2B2Y A;  4C3J B;  3HOU B;  5C4H A;  4FVM A;  2KCC A;  5FO7 B;  2QEJ C;  1KDA A;  3T56 B;  3V2T A;  1NR4 A;  4K5V A;  2MJ8 A;  3HS0 C;  4KY6 A;  2JE6 I;  4BBR B;  1JOR A;  1AZP A;  1CHP D;  2JXM B;  3PO3 B;  3K5O A;  5EQ0 A;  1D1K A;  2ZXR A;  4A3I B;  4NKL A;  1B44 D;  2B2V A;  3VR2 A;  5C4X B;  2Z1C A;  3IAY A;  1EY7 A;  1VDZ A;  3UI2 A;  4KKT A;  2I46 A;  3H91 A;  1WD1 A;  4FXG C;  5CGK A;  5FOB B;  5C6A A;  2KHS A;  3E6Z X;  3H0G B;  3CQZ B;  1JOK A;  1A15 A;  2AQ3 B;  1TR5 A;  1R4P B;  4BY1 B;  1D5M C;  3LWU A;  3QOJ A;  2JP1 A;  3NXW A;  3TBI B;  4K5X A;  1LTB D;  2DY8 A;  1NAP A;  1C8C A;  2CHB D;  4KJO A;  4ME5 A;  5M3F B;  4L8J A;  1HA5 A;  5ISR A;  5BN3 A;  1RTO A;  4A3J B;  2EJG C;  5EKK A;  4S3S A;  2O5J C;  1EU4 A;  2EXZ A;  4CKE A;  2R92 B;  1M4V A;  1ZYR C;  1J8I A;  1A2T A;  5IT9 E;  3S14 B;  4FF1 A;  2RDH A;  1PRT B;  1EQV A;  5A35 A;  1CFM A;  1HFN A;  2NYZ D;  1G91 A;  1C4Q A;  3OW7 A;  1A3T A;  1QCB D;  1W6J A;  3VYS A;  4A3B B;  1BUV T;  3QB3 A;  3K7A B;  1ICW A;  3TP6 A;  1SE4 A;  2N88 A;  1U4P A;  1R9T B;  3MXG A;  2K04 A;  4BA1 I;  1TT2 A;  4K2L A;  3TN2 A;  3QO2 A;  5IGE A;  3RZO B;  3J7A V;  1JCK B;  1A3U A;  1V1O A;  2F0I A;  3R2I A;  1GUS A;  1S5D D;  1TII D;  2JA8 B;  1X3P A;  1ZEQ X;  1NCV A;  4X3T A;  3D4W A;  4ZRZ A;  4ZYS A;  5C3X A;  4KD3 A;  5M9O A;  5FLX E;  2E74 C;  4DNT B;  5LL6 S;  3OSO A;  1EYC A;  1S4Z A;  1OXU A;  2KOL A;  3BS1 A;  2K7V A;  2A74 C;  3FEW X;  4DGZ A;  1TU2 B;  5KEE A;  2LFN A;  3H3V C;  1RJT A;  1Q8I A;  4YIJ A;  5EPJ A;  2A73 B;  1B3A A;  1PTO F;  1DJR D;  2HDM A;  4QUC A;  3Q23 A;  1STA A;  1MD2 D;  2XSC A;  3HOZ B;  4G7Z C;  4X3U A;  3D3R A;  5CV6 A;  1WVL A;  3F2U A;  2VB3 X;  2ENB A;  1S5C D;  1BCP F;  1SND A;  3CKI B;  4NDX A;  4XQQ A;  1Y1W B;  1EY0 A;  3NHH A;  3DWP A;  3FKI B;  4CJ2 C;  3QG1 A;  3VA5 A;  4U68 A;  1F9P A;  2IX3 A;  2PPB C;  1YNJ D;  2M00 A;  1KDB A;  3NTI A;  3E0J A;  2AUJ D;  1EZ8 A;  3GQB A;  3TP8 A;  1Z47 A;  3MA2 B;  2WB1 B;  5D3I B;  2E2J B;  1STN A;  4F87 A;  1VF7 A;  2WAQ B;  3GTO B;  1EYD A;  3SVM A;  4P2C B;  4U67 3;  5JVH 3;  1ROD A;  1CZG A;  3S2D B;  2Z4I A;  1BQQ T;  3SK8 A;  2HUG A;  4HCS A;  1PFN A;  4LK1 C;  2K28 A;  5I4D A;  4ZQ3 A;  3BYT B;  5T1I A;  4BY7 B;  2L5T A;  2A5H A;  4FYD A;  1LTI D;  2CW0 C;  2WII B;  5E1F A;  1GOZ A;  1EOT A;  3BDO A;  1XYI A;  4ILW A;  2L4N A;  5FK9 C;  5IGD A;  1D5X C;  2F0D A;  5G3L F;  1FNU A;  4OL7 A;  5CR3 A;  1CQF A;  1SNP A;  3BVM A;  5A2Q L;  4RHR A;  2OXP A;  2BDN A;  2AWN A;  2SNM A;  2RVL A;  4RFB A;  3A54 A;  1EY5 A;  3C46 A;  4F7X A;  3SK4 A;  4OIJ A;  2BE5 C;  1O7Z A;  5ELD A;  2KJX A;  2PQE A;  2F1M A;  1XWE A;  2HQE A;  1JB3 A;  1JIC A;  3RLF A;  2JA7 B;  2E76 C;  1XX8 A;  3O13 A;  5KNC A;  1PXU A;  4CJ0 B;  1ET6 A;  2AQ2 B;  1IHZ A;  1WD0 A;  2YYZ A;  2D9U A;  4DFA A;  3C2P A;  2EYF A;  2NB0 A;  4G7O C;  3DM1 A;  4ZUI A;  3TP7 A;  4I65 A;  4K2K A;  1SYG A;  3NWT A;  5CV4 A;  4KJN A;  1OXS C;  5CBA E;  3ZYY X;  1ZKO A;  1Y1V B;  3H09 A;  1WTV A;  3V05 A;  1I4R A;  2A69 D;  4NP5 A;  3CRK C;  1F9R A;  3NQT A;  3L3O C;  1O7L A;  3MC0 B;  1JWM D;  1KDC A;  3IFD A;  4C2M B;  1ILQ A;  1PRT D;  3I4L A;  4KKS A;  2NZ1 D;  1AFP A;  1EEF D;  3S17 B;  1ONL A;  4DAY A;  2RDG A;  3HZX A;  3VR6 A;  2XRQ D;  2G9H D;  1PTO C;  3KLS A;  1LTS D;  3CRL C;  1PFB A;  1JWS D;  3M85 A;  1DCZ A;  2J7Z A;  2NWG A;  1TVX A;  1EY4 A;  3OOC A;  1QE6 A;  1LTG D;  4DAP A;  1BCP C;  1NSN S;  3VR5 A;  3J7Y W;  1HRJ A;  4DU9 A;  3HP3 A;  4OGQ C;  2L12 A;  2K5Q A;  5IOD A;  2E2I B;  1TS3 A;  2HCI A;  2F3W A;  1OXT A;  2MGS A;  1VMC A;  5IGC A;  1D6E C;  5FO8 B;  2VNU D;  4DA2 A;  4A3G B;  1YNN D;  1CZW A;  4C3I G;  1EY8 A;  2XIW A;  2VUM B;  3M4Y A;  2VXW A;  2EYH A;  2EE1 A;  5KGU A;  3MWY W;  3MFY A;  5JEA J;  3IFT A;  3E5S A;  2PYK A;  1JOO A;  1V8Q A;  1D5Z C;  5BN5 A;  3NQI A;  1UNS A;  2A6E D;  1TS2 A;  3ND8 A;  2FFK B;  4JK1 C;  1BNZ A;  5F2D A;  2O2L D;  3D4R A;  2IWH A;  3NBI A;  2A6H C;  4DNR B;  4IFD G;  1BF4 A;  1SMY C;  5EJW A;  2QDB A;  4QB4 A;  5K36 H;  3S16 B;  1FNV A;  4JBW A;  2EYJ A;  3TP5 A;  1I6H B;  5IIF A;  1CK1 A;  1Z7T A;  2DNE A;  2B2T C;  1G6Z A;  2J0T D;  1WTR A;  2XWJ B;  2TMP A;  2XRS D;  2Z4H A;  1EZ6 A;  4IZ8 A;  4RGO S;  4XDX A;  1Y8N B;  3EVQ A;  1AP0 A;  3RZD B;  1FNW A;  3K5M A;  1BCP B;  4QCL A;  3RUZ A;  5KIX A;  1LV9 A;  3W2D A;  5JEA H;  2NN6 G;  2PZT A;  5M3M B;  4ULL A;  2WIN B;  4ZAI A;  3Q24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...