3CKIB

Crystal structure of the tace-n-timp-3 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
b'CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAM 17
publication title Structural determinants of the ADAM inhibition by TIMP-3: crystal structure of the TACE-N-TIMP-3 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, hydrolase inhibitor
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ckiB00
5FO8B 4FXGC 5JPMC 2QKIC 2ICEC 1JC7A 3CKIB 2A74C 2A73B 1BQQT 5FOBB 1PXUA 2B39A 3G6JB 1GXDC 2E2DC 1JB3A 5FO7B 2XWJB 5FO9B 2WIIB 2J0TD 1UEAB 3I70A 1OO9B 1UAPA 3CU7A 3KLSA 3FRPB 3HRZC 2I07B 5JPNC 3L3OC 2WINB 3MA2B 4ILWA 3HS0C 3OHXC 1D2BA 3T4AC 3V96A 1XWEA 2XWBB 1BUVT 4FXKC 2TMPA 1BR9A
chains in the Genus database with same CATH superfamily
1MGSA 1ENFA 1L0XB 3SGIA 1VQHA 2LFNA 1PH1A 2NN6G 4IUUA 1GOZA 4FVMA 1DM0B 5FO7B 4J6HA 2KVMA 4NKLA 3P20A 3W5OA 1PDQA 1VMPA 2AQ1B 4IQZA 3GTMH 3IAYA 1O7IA 2WACA 3BU2A 3ER0A 1M1KC 2B2YC 3GTMB 1GKHA 2L12A 2WAQG 1VQOA 2Z6BA 1LTID 4B3TQ 3DUZA 3HKZB 1KC8C 1KAWA 2D2CC 1CI3M 1PHJA 4OWWB 3ZYYX 2QEXA 3ZJYC 2IL8A 3I4OA 5GQOA 4J15A 2OT2A 1VQEA 1YHQA 4JI0Q 5C4HA 4DV5Q 1K0RA 2EZVA 4JYAQ 4B08A 1G51A 1IL8A 1NMFA 5IP9G 1H9KA 2PZTA 2UXBQ 3KK7A 1AE3A 3MWYW 4X65L 3VYUA 1D6EC 3NXWA 3PF5A 1TY2A 1K8AC 1ZKOA 1IZ6A 3PUXA 3WDNA 3TZDA 4IJHA 2M9VA 3CCQA 1BBUA 1CFMA 4KY5A 2QCPX 2L0CA 2SNMA 3OTOL 1YEZA 2XIWA 2H5XA 2XSCA 1WJJA 4L5SA 2PNRC 3HOXH 4HAEA 2CH4W 2IT1A 4DK1A 4F7XA 3HOXB 1E22A 3E0JA 4LWCA 3PIP3 1H95A 4A3KH 2R7DA 2L9HA 4IUPA 4KHZA 2B3GA 4X66L 1KXLA 4A3KB 2IX1A 4A3FH 3OWEB 1V43A 1XX8A 4C2MH 3S1QH 4A3FB 4A93G 1VQCA 1Z9FA 3BDOA 3N6RA 4C2MB 1KDBA 3S1QB 4YHHL 1S5FD 1HH2P 2B2TC 1WTOA 4FNFA 3QG1A 1BOSA 2GN5A 3CCRA 3HOWG 5EKKA 4JI7Q 5ELOA 1XMOQ 1JICA 2QGQA 5D14A 4CGYB 5FO9B 4OIKA 4YCWA 2HHHQ 1S72A 1MIUA 4HSPA 2J7ZA 3SK5A 3EJIA 1SMYC 3IFDA 4JBWA 2O5IC 3GTPH 4YWKA 4IFDI 4JI2Q 2B63G 3GTPB 2R7FA 1A63A 1EIFA 2OWOA 4DNTB 1RTNA 2BOSA 1IBKL 1FL0A 5M3MH 1RKNA 4ZKBB 1PYSB 2A19A 4DK6C 5IGBA 2TSSA 4N9PA 4L63B 3PIOA 1E7ZA 1K28A 4GKKL 4BBSG 5M3MB 1I6VC 4LNQA 2MQHA 2AWOA 1HFNA 5IODA 1I4GA 1BCPD 4ZAIA 1N32Q 3EFXD 2JA8G 2UXDL 4GKJQ 2XGTA 3BZCA 1XPRA 2CKZB 3NQIA 1MI2A 4ZQ3A 4H13C 2K33A 4DNRB 3H94A 2QDLA 3KBGA 2JQOA 1U5KA 4BY7H 4O42A 2EY5A 5HGTA 4I7ZC 4UP9A 4KN4C 2EYHA 4X64Q 1CSPA 4BY7B 4CDCC 2Z1CA 2O5JC 2EDGA 4PNYA 2R61A 5D3DA 1PH5A 2DUDA 3T13A 3CCSA 1Q81C 1RCVD 1UAPA 2NN6H 3DWAA 4AQYQ 1II3A 3G48A 3JAME 3TSSA 1G6ZA 3TP5A 1T5XD 1KNEA 2JA7G 2XN9C 1KLGD 4UY8C 4TSSA 1M4VA 4RAUC 2WV6D 2PQEA 2A73B 3GV6A 3W2DA 3F2CA 3T56B 2QF7A 4JI5Q 4C1NK 2OEOA 5T1GA 1X65A 3KOJA 1K83H 1STYA 2JEAI 1HFGA 2HT1A 1A8VA 2EYPA 2K05A 1K83B 1XNQQ 2MHVA 1RD9D 3M3YH 3CMAA 1FJGQ 5IE8A 1PZJD 4DR1L 3MFGA 3HEJA 1K9MC 1RDPD 3M3YB 2RCFA 5IP9H 2C9OA 2F0PA 4A3EH 1P8LA 2K5QA 1S40A 2HCIA 3CCVA 4EGVA 1SNQA 4DF7A 4A3EB 4N8X1 2BE5D 2GA4B 2EVBA 4B3ML 1TVXA 3ULPA 3FRPB 1FVIA 2F0LA 3X3MA 1CUKA 3MA2B 2HUGA 2E2HH 1EY9A 5LMUQ 1JR0D 3I91A 2Z6KA 1F2ZA 3PGZA 2E2HB 1B9NA 1LT4D 1B50A 2K4KA 1ICWA 4DV0Q 1YJNA 3Q22A 4FYDA 2AQ3B 3CKIB 3F2DA 4RWSC 3HOYB 2E2DC 2RDHA 4RMFA 4FF1A 1X3QA 1T9HA 4DFAA 3KUPA 1M8AA 2NWGA 3RLOA 1GO3E 1ILQA 1O7ZA 1L1OA 3QR8A 2IHEA 1D2BA 5IT9c 3GDEA 4LF4Q 2AHOB 4G57A 4NMZA 4O2DA 2EYLA 4A3JG 2MO1A 4A93H 2VY3A 4RGTA 3U9OA 4DV3Q 4ALPA 3FKIG 1EY4A 4A93B 3G6JB 2WB1B 2OXPA 1PH3A 1E2VA 3PSIA 1EQTA 3AQQA 3HOWH 4JBMA 3TP7A 4PV1C 4BY1H 3J7ZC 1MSHA 3HOWB 3CAMA 5I2XA 4NP5A 5FJ8G 4IPCA 5A2QL 3AB9A 4RFBA 4BY1B 4NW2A 1RIPA 1GJXA 3I90A 3C1EA 4WFN3 4PZ7A 3ITPA 5KYIA 1XNRQ 3S17H 1PTOD 1Y1VG 3KF6A 3S17B 4LFBL 1YIJA 1UEBA 4NXNQ 1JJGA 1RTOA 4J8QA 2FMMA 5IYCH 2PO4A 2B63H 1QVGA 2J0TD 1LABA 2SOBA 5TSSA 2B63B 1P16A 4MTKA 1VQDA 2LKVA 3K81C 4C3JH 1QZHA 4PMCA 4BBSH 1N36L 4HJAA 2PPBC 3HP3A 4QF4A 1HZ9A 2LS01 4C3JB 1XWEA 2PMZE 3GTOH 2CW0D 4BBSB 3J80E 2JA8H 1VQ8A 2N88A 2RBMA 5ELBA 2JA8B 1YNND 1PH6A 1HZCA 1BQQT 3GTJH 5M3FG 1TKWB 1V1OA 1W6JA 4JI6L 2FJ2A 3GTJB 2F0VA 1E24A 3I4NH 1MBYA 3A74A 4DV1L 2R6GA 4NB3A 5DNFA 1MJCA 5AJ3L 3I4NB 4OO1G 5HURA 3CD6A 2KCCA 4K0KQ 2MUYA 4MTNA 3KYHC 2UXCQ 5ELFA 4DU9A 3R8BA 2QDBA 2IPKD 5C6AA 3HOUH 1G6PA 3PIO3 3ERSX 4JI8L 3HOUB 4JI4L 3DXJC 3MXNA 3E5SA 1CQFA 2JA7H 2UU9Q 3D0FA 3WOFA 2YYZA 5DM63 1V1PB 5JVG3 1I94L 2JA7B 4ZK9B 1AN8A 4QIWB 3JAMi 3RZDH 1JCKB 4WRDA 3UE1A 1SYEA 3RZDB 1EQQA 2PZWA 4DR7Q 3KLRA 2E8GA 1BCPC 4CBVA 4A3MH 4J1MA 1CM9A 4Y7NH 4BXXG 3NBHA 3J81j 4A3MB 3LX0A 1SXTA 4AYBB 1SYDA 2RHSB 1JB3A 3L9AX 3GO5A 3UDXA 4Y7NB 4DXFA 3PMFA 1O80A 4PMWA 4KTAA 2F0UA 4P72A 4R8IA 1UE1A 4JCVE 1PVOA 4Y52H 2DNCA 1GHJA 1HZBA 5J3BA 5E4WC 1B53A 3BZKA 1OXUA 3A8IE 3BVZA 1VQ7A 2ZXRA 3BG3A 3K6OA 4DR6Q 1DONA 3D4WA 1H9MA 3BYTB 1EZ6A 2QW7A 4DK3C 1Y69U 4XT1B 4OWTB 3AMUA 5FOBB 4LF6Q 2B39A 4LUOA 4JI1Q 3OW7A 1IYUA 4DV7L 2MGSA 4HR7B 5GAHC 1AFPA 1OXXK 1AH9A 2E2JH 1EIYB 2IY5B 4CDFC 1EWHA 1QB5D 2E2JB 1DOKA 1E2WA 3F2UA 2RDGA 5EBDA 4DR3Q 1GVPA 4JV5Q 2VQFQ 1KTKA 3PUWA 3OW2A 4DV2Q 2OCEA 4H44C 1CZGA 3R3OA 2ICEC 2XVSA 3RD4A 3NHHA 2K5HA 5J39A 4M1UB 4F88A 3I2ZA 1QUQA 1OTCA 1PZKD 4M8AA 1VQBA 2HDMA 3VR5A 3FKIH 4OELB 5IIFA 1O78A 1G8ZD 3FKIB 2ZTDA 3EN2A 5NUCA 3PQIA 2BE5C 1T5EA 2F0FA 1S5CD 3T1YQ 2F4VQ 1L1OC 3CW2C 4DR2Q 3CQZH 2DGYA 4EQ5A 4R1JA 4LF7Q 1S4ZA 2X69A 3CQZB 1CKOA 1N33L 4ZUIA 2JJQA 2SNSA 1WTWA 2JA6G 4OX9Q 1G91A 2EE1A 5BN5A 1HR0Q 2I07B 1HNWL 4LFCL 2D0PA 1IBLQ 1C0AA 1SNPA 1VF5C 2B2TA 3A7LA 2LXJA 4UP8A 1GUOA 1SLJA 1VQ9A 1SE2A 3S9WA 4QJFA 3NTHA 1CKNB 1FNWA 3GQBA 3G71A 1IW7D 1HCZA 2BA0A 3STBD 3OYYA 4DNIA 3FEWX 4ZUJA 2NZHA 1J6QA 1NBWA 1EU4A 1GUSA 4Q5VA 2V1CC 1TWAH 1JOOA 3ULJA 1DYQA 1XPUA 2CFMA 2UUBQ 4OEMB 4HIKA 2RVLA 1YNJD 2G5DA 4KY7A 5C0XJ 4OO1H 4KKTA 1JMCA 3A8KE 1GHKA 5LL6X 5K36G 2FXQA 1N34Q 3QB3A 1AE2A 1UE6A 2KUMA 5KYLA 2KCMA 4KJOA 2PYKA 3WWVA 3KJPA 3CC2A 4OWXB 3K0YA 4XQQA 5LMNQ 1SFOH 1ENAA 2SEBD 2YTXA 2L4NA 4OONA 5GAEC 1SFOB 1PTOF 2F3IA 1EYGA 4IUVA 2DN8A 1AZPA 1JC7A 3KF6B 4ZYSA 2PQAB 4OHJA 4C56C 4EX5A 2CW0C 4CHTB 1A3VA 5D65A 5IWAL 3I70A 4BXXH 1HQMC 1HQRD 5AFWA 3BZDB 1YNNC 3GD7A 1SNDA 3O13A 1LTBD 4JBKA 3PF4A 1SMXA 5EBCA 2HDLA 4XYQA 3DMUA 1Y8NB 3S1NH 3RLFA 4YCUA 1STBA 4CDDC 1ET9A 4PZ8A 3S1NB 3GV3A 4B3SQ 1NY4A 4XT3B 1SN8A 4FF3A 2CQOA 2K5DA 4F8MA 1N8RC 4C3IH 3J81E 4EVOA 4DR4L 3VYSA 4C3IB 3UDGA 5C3WA 2RSNA 4GLAC 4QL5A 1CTMA 2YTYA 2FMCA 2JP1A 4GN3B 1HTLD 5FLXE 4WJ4A 1GM5A 2JA5G 1WCMG 1XMQQ 4KHPQ 3MXUA 3ERQA 1UWVA 3RMHA 1R9TH 1MD2D 4DAVA 2IX0A 2R7ZG 3D6WA 2B2UC 3ONAB 1EYAA 1R9TB 3T16A 4IPDA 4LF8L 3K8AA 4XQNA 4UAIA 1AP0A 2I5HA 2K1BA 3JAML 3K5LA 3OSOA 3FPUB 3V2TA 1CZWA 1PRTB 1HHVA 2VB2X 5C4XG 4RH6A 3NP8A 1LTTD 4X3UA 3K5MA 3I4MG 4YY3L 2RCNA 4WJWA 1NR4A 4NDXA 1YJWA 3I3CA 5COYA 5C4JH 2JA6H 2UUCQ 1DD2A 1YNXA 3KF8B 5C4JB 3PO2G 1XTCD 2JA6B 4GNXA 5FO8B 4QB4A 1MJEA 2OF1A 2A1AA 1Z47A 3DEOA 3EIVA 5M5WH 4V0BA 4UDUC 1GUGA 4NPSA 5M5WB 1I4RA 5C0XI 1LTGD 1X3GA 4A3IG 3Q8DA 2WB1E 2M00A 3G6EA 1O7LA 1IHZA 2HIXA 4DUZQ 4A3LH 2NYZD 4LF9L 1X3FA 2WINB 4DAYB 1A15A 2L55A 4GOPB 2A68D 1WTXA 3H3VH 4E6IA 4YWLA 1H9SB 1KDCA 2F0IA 5EAYA 2R93H 1CA5A 3TZUA 4P71A 4HN7A 1BF4A 3S15H 5CORA 2R93B 1QNUA 4DPGA 2BCOA 3S15B 2GVBA 2QEJC 3GTQH 2Z0SA 3J80c 5A35A 1LV9A 3GTQB 4XYOA 3CU7A 3N52A 4DXGA 3T1HL 5K36H 3RNUA 3H0GG 1Y8OB 3K5OA 4X62L 3S24A 3TEHB 1JWMD 2RHQB 2KCNA 2A69D 3NPPA 5JPMC 1Z7TA 3C2PA 1IXRA 3RUZA 5C3EG 3KDFB 4JI3L 4IUTA 4KKSA 4QCLA 3J7AF 1XXGA 1Q90A 3CF5A 1JJCB 3VA5A 2K75A 1WD1A 2BDNA 1IW7C 1Q1EA 3RN5A 1B7YB 2H4OA 1OXSC 4X3SA 1TWFH 1E1OA 3DHQA 3UE0A 1QVFA 2CVRA 1X6OA 2H1EA 3KBXA 3W3AA 2VQEQ 3BYYB 4X65Q 2KHIA 4DUYL 1ASZA 3K7UC 3SE0A 3CRLC 1PFNA 1NSNS 3RZOH 1STHA 1JWSD 1DGSA 1NJIC 1YNJC 4BBRG 1RJTA 3RZOB 1A62A 4MNOA 3A5ZB 4RG1A 2N78A 1I5FA 4A3CG 1CKMA 1F9PA 2NZOA 4BS9A 2B2VA 5JJKA 1A3TA 4QIWE 2K5NA 4A3BG 1X55A 5M5YH 4LMQD 4FXGC 1NE3A 2F0JA 4JPBW 5M5YB 3J80L 3S1RH 1Q12A 4ZLTF 2DY7A 3M7GA 2OQ0A 1WTHA 3S1RB 3IKJA 5DAUA 4X66Q 1ET6A 2WAQB 3J81i 3K80C 4AYBE 1PLFA 2IWHA 3DM3A 5E1FA 1O7YA 1KIXA 2E5LL 1FNVA 1KAAA 2AUKA 3SK4A 3KFUA 1Y8PB 2N8NA 1I4PA 3M4PA 4IZ8A 1F2MA 1PH4A 1SR3A 3HOZG 2WKDA 4YHHQ 5JOBA 1WCMH 1VS0A 2FFKB 4ILWA 3MFYA 2YTVA 1WCMB 3R2TA 2VB3X 2KBNA 1WYDA 2FINB 5C44G 1BO0A 4DV6L 1YZ6A 4RKLA 4KN7C 3I72A 1STEA 2ENBA 4IFDG 1PH8A 1WD0A 5C4XH 3VR2A 1F2LA 1E1TA 2Q2HA 3SEBA 4DAMA 4LFAL 1FGBD 1HA5A 2CWAA 5C4XB 3E6ZX 3HOVG 2JXMB 4N9TA 1Q8KA 3I7FA 4LW1A 2NVXH 2QKIC 2F0OA 1VCIA 1I3QH 1EIGA 2NVXB 1IBKQ 1SYCA 1I3QB 1TU2B 4GKKQ 5ELDA 1HNZL 4GS3A 1YBYA 1H9JA 1EFID 2PZUA 4CJ1B 3J7YW 5HGQA 2UXDQ 2D0OA 3H6MA 5LHY1 4A3IH 1WTQA 4XIGS 1RF2D 1IYVA 2CH4A 2R3ZA 4A3IB 2F0KA 3NK9A 5IGCA 5IYBG 1PA6A 4GNXC 3ICEA 1LM0A 3MTSA 1L0WA 1X56A 5CV6A 2D9UA 1E3PA 1KRTA 4YCVA 1G2SA 1SYBA 1JORA 5JEAJ 4KV6A 3NSWA 1U4PA 3UDIA 1W2BA 2ICIA 1D7QA 4C3HG 2AQ2B 3LWUA 4MZ9A 1C9OA 3L7ZC 4DR5L 4RKBA 1HR0W 2SDFA 4KD3A 1TQOA 1F2YA 4O0AA 1JOKA 3UI2A 1EY6A 2A6ED 4HCEA 4EQNA 3K5NA 4K6DA 3GTKH 4B3RL 1K3RA 1X3PA 3I56A 1D5MC 2F0SA 4GN5A 3GTKB 2UUAL 5M5XH 5EGTA 3FDTA 2ZTEA 2F0EA 1TS3A 2PCFB 1BXTA 5DEHA 3R93A 1FD7D 2JYOA 1X54A 3NUCA 5M5XB 2A8VA 3TBIB 1B2TA 2MNAA 3B6YA 1S5BD 2V4DA 1QILA 2EOTA 4DR1Q 5JJIA 2ASBA 3S1MH 4DK0A 3GTOB 3S1MB 1Q8IA 2ZM6L 1PYBA 4OGQC 4OIJA 3U58A 4HJ9A 3BDCA 3EA6A 5FLMG 3I4LA 3NWSA 1B4OA 2B8GA 1K8OA 4B3MQ 1A0IA 1VQMA 4BBRH 2OTLA 3CCLA 1SROA 1U4RA 1LT3D 1BNZA 4HCSA 4BBRB 4A3CH 3F2BA 5GROA 1LLRD 2Z9HA 4AIMA 3BVGA 1NTGA 2K5VA 5LMNW 1Q1BA 2A69C 3CCEA 1B8AA 2L11A 1YHBA 3CC7A 1JQYD 1Q86C 4L5RC 4RCNA 3A5UA 3MEHA 1PRTD 5IOCA 4KJNA 3MC0B 4FDBA 3TMEA 1FGUA 4R4OA 1WVLA 4K2LA 3HKSA 1QE6A 2B2VC 1G2TA 2J4XA 5L37A 2F0GA 3TP6A 2HIVA 4CKCA 1EUJA 1SYGA 1UE5A 5I9PA 5BR8L 2Q2TA 2XWJB 5EQ0A 4IPHA 5CMDA 3DM1A 3VR6A 2NZ1D 2Z8LA 1EYCA 2RA4A 5DLQE 5IYDG 5G3LF 2C5CA 2BA1A 1JWUD 3P75A 3ULLA 5GAGC 1J5EL 1EIHA 1E0BA 1EWCA 4IFDH 3KLSX 3AFPA 4UHVA 5CBEE 4DV4L 1BBWA 2ZJQA 4JG2A 1XJVA 3HKZE 3TDQA 3HOVH 2KCTA 3L0OA 4LFBQ 3VDYA 3HOVB 2WIIB 5EJWA 2K32A 3CHBD 5T1IA 1XPOA 5EKIA 5CYUA 2B2UA 4NXML 1HNXL 1N36Q 4IN3A 1VMCA 2XRQD 1B9MA 1Z6HA 4HJ5A 1YHAA 4A3DG 1KL9A 1BVSA 4F87A 2LXKA 4P75A 4CJ2C 1LUZA 4P73A 4JI6Q 1HXYD 2G9DA 4A3JH 1TT2A 1LT6D 3OWFA 3LNNA 4IALA 4DV1Q 4A3JB 5AJ3Q 1KD1C 1SNMA 4H02A 2Z4IA 1AW7A 3J81L 5CGKA 4FF4A 3V05A 3DEPA 3TQYA 1SSOA 2JEBI 4IURA 4QUCA 1EQRA 2AWNA 2CWPA 5FJ8H 2QA4A 4MIUA 3MXGA 1JOQA 2EYFA 5C3XA 1C48A 2A74C 4C3HH 2KENA 4KLKA 4JI8Q 4JI4Q 4C3HB 4KHVA 5ELCA 5ELEA 1Y1VH 3D31A 4LF5Q 1FR3A 2EJGC 1U4MA 1ZYRD 3HRZC 1FNUA 2EIFA 5FLXL 1I94Q 1Y1VB 3HS0C 2RKSA 1SE4A 3S14H 2KA7A 1QJOA 1DXMA 1EQVA 3M7NA 4TKOB 3S14B 1A2TA 1A3UA 2BDOA 4U673 2PNHA 2K52A 3EBEA 3JC66 2XNAC 2Y0SG 5IT9E 3CPFA 4L6TB 5BN4A 2OQKA 1D1KA 3MVVA 3HOXG 2NUCA 2NN6I 1C8CA 5M3FH 1TS4A 4A3KG 2F0WA 1TWAB 2RDFA 2K01A 3SXHA 5BN3A 5FLMH 4B3TL 5M3FB 1L1OB 2Z4HA 1NCVA 1VQ5A 3TN2A 5EPKA 1GUWA 4FXKC 4G7HC 3M4QA 1PH9A 2VW9A 5C4ZA 1KABA 4HEDA 4R9WA 5LL6S 2EJFC 2D62A 1LYLA 1IBMQ 5JEAG 4JI0L 2NVQH 4DV5L 4DV7Q 4JYAL 4AH6A 2MPMA 1CHQD 1PTOC 5IGFA 5M9OA 1Q7YC 1VQNA 2NVQB 4GN4B 1QVCA 2F0DA 2PMZB 1VDZA 2UXBL 1STAA 5CV5A 2A6EC 5IGDA 4HTHA 4FXDA 4HJ7A 4TVAB 1ZXTA 3OMGA 2HQLA 1K8MA 1GUNA 4LAAA 4WJ3M 2ES2A 1UNSA 4GZYC 4LJZC 5D3IB 3SDZA 1PFBA 1A6XA 1EYDA 2ZJRA 3JAMc 1RODA 1D5XC 1LTLA 2GVAA 3CC4A 1OXTA 4L5QA 2VUMG 2VS1A 3BS1A 3EVQA 5JJLA 5JJZA 2X6GA 3CXCA 2BH2A 2Q2IA 1KHIA 1LTRD 1AEXA 2NB0A 4L5TA 5IYDH 1VQ4A 2YU9H 2ZXPA 2HCCA 1TWCH 5I6YA 2YU9B 3C1FA 4U68A 2YV5A 1N33Q 4BY7G 1VQ6A 3VYRA 2WAQE 1B70B 3EQLC 4BWGB 1CT1D 4QMGA 3URYA 1HNWQ 3OMCA 3TRZA 5C5MA 4LFCQ 1TWHH 3GP7A 1BKBA 2XWBB 3D4DA 4L8JA 3A7AB 1TWHB 4JI7L 2TMPA 5EPJA 4IO9A 1WTRA 3PV0A 1XMOL 1PRTC 2RQXA 1TS2A 3FMCA 2B2WA 3FP9A 4RHRA 2K6AA 2MJ8A 2K04A 2HHHL 3P1HA 2N49A 1EEFD 3MXNB 4POFA 4A3DH 1SE3A 2KQ3A 1PRTF 4A3DB 1U0LA 1J9OA 2I5MX 1F77A 3CP0A 3NWTA 1ESRA 2E2IH 4JI2L 1EY5A 2WFWA 1DOLA 2K50A 2E2IB 4BA1I 4KY6A 4OL7A 3NBHB 2EY1A 2VL6A 4DN4M 1HRJA 1N32L 3K7AH 1RL2A 1VQGA 4GLVB 4GKJL 1JT8A 2IW3A 3K7AB 4A3EG 2Q2UA 4GOPC 1SE8A 2VQEL 4H0LC 3R2IA 4RGMA 1OXVA 1EZ8A 1LACA 2M2LA 4X64L 4JOIC 3H3VC 4XTCS 1J8IA 4WORA 2E74C 2IJ0A 3VR4A 1YJ9A 1ONLA 3SK8A 5IWAQ 5JAVA 4AQYL 2A6HD 4QUFA 5CR3A 3HOYG 2KECA 3M4OH 2DJGC 2Q8RE 2Y0SB 4G4KA 3AEVA 4DGZA 3LWEA 5I4DA 1Q46A 3M4OB 1I4QA 1R4PB 4R8NA 1I50H 3E9HA 1LTAD 4HIDA 2JE6I 1TR5A 1I50B 4ME3A 2C35B 5I2YA 1EY8A 4R4QA 4JI5L 3TP8A 3T53B 4R4IA 1SYFA 1CQVA 1B3QA 2JA9A 2KEEA 4LK1C 1QUQB 1QNKA 1X3EA 1XNQL 4DR4Q 3I55A 2WB1G 4BA2I 3IFTA 3CCUA 4HIOA 1L2FA 1FJGL 5JEAH 1GD7A 3QJYA 2ID0A 1CHPD 1F9RA 4CJ0B 1ZYRC 3W1BA 4IJLA 4BY1G 3MHBA 2D5DA 1AZQA 1PYWD 4K8IA 1EWIA 4JW0A 3BJUA 2DNEA 4N8FA 1DZ1A 2RF4A 1JE4A 1V1PA 2P5ZX 4A75A 1F9QA 4FP5D 4ME5A 3VR3A 1LO5D 1YITA 4Z9CB 3QWNA 4ABNA 3C3LA 3KJOA 4G7OC 1ILPA 4XQJA 4TRDA 4QY7A 3D4RA 3STBC 5LMUL 5G3LD 3VYTA 1I4HA 4KK7A 2F1MA 1I6HH 5IYCG 4LF8Q 2VUMH 1TWFB 4DV0L 1I6HB 2VUMB 2R92G 3OIPA 4C3JG 3J7A5 2XTIA 4XDXA 2F4IA 1U9RA 1NAPA 4YY3Q 2EY6A 3K57A 4IUNA 3PO3G 3G7LA 3IRBA 5F2DA 1Q82C 1HJPA 2F0NA 1UE7A 1QCBD 4LF4L 1TXYA 4YIJA 3SVMA 1ASYA 5C0XG 3H09A 3PUYA 3OTOQ 4A4IA 4K14A 2LY7A 3E0EA 3VA7A 4DAPA 3I4NG 1W3SA 4DV3L 1TY0A 2N3SA 3F8TA 3TREA 5IGEA 3NBIA 3NE5B 4RA8A 2K03A 5ELNA 1GUTA 1SAPA 1CSQA 2EPBA 1DOMA 1Y1WG 3HOUG 2O2LD 4P74A 3QOLA 4ULLA 1V9PA 2IHFA 4LF9Q 1BUVT 1IKMA 1XNRL 4B9XA 2JA5H 3LGJA 5EKLA 2L1BA 2JA5B 2IX3A 3OOCA 3NENA 5FK9C 2R7ZH 4RGNA 5IGGA 2JN4A 2L5TA 4NXNL 1IKLA 1TIID 3W1GA 2EY2A 1QZGA 2R7ZB 3PCOB 2B2WC 3EROA 1TS5A 1JJ2A 4KI0A 4MHEA 4JC0A 1F9SA 2Q8TA 1N9WA 2KOLA 3Q6SA 3MEFA 4A3MG 3T1HQ 4AYBG 3A55A 4X62Q 3I8ZA 2EYOA 3I4MH 3U4VA 1CA6A 3U50C 3QO2A 4PQXA 2E76C 3I4MB 2A5HA 4OXPA 4X3KA 3CMEA 1EU3A 4S3SA 1SJED 4JI3Q 2L15A 3AYHB 3PO2H 2ZJPA 1SNCA 1STNA 4PZ6A 2VNUD 3PO2B 4K2KA 3E9IA 4RHSA 1HUMA 2KJXA 1EOTA 3SHLA 5I9OA 3L2PA 1YI2A 4PMBA 1PH7A 4K0KL 4GLXA 1SJHD 1STGA 4XXEA 3G4SA 2UXCL 1CKNA 4I65A 3NQTA 1CK1A 3HOYH 4H7BA 4JK1C 3S2DH 1ENCA 4DUYQ 4ZRZA 1WTVA 1SEBD 4HJ8A 3FPPA 4OO1I 5H1SE 5C5LA 3S2DB 4JVZA 1VQPA 1TWGH 1PFSA 2UU9L 4IOAA 4QQBX 2B8FA 1K8GA 4K5XA 2BH8A 1QG7A 1TWGB 1ML0D 2ALYB 2I5LX 4CKEA 1JB7A 3M9BA 3TS0A 3GTLH 3PUVA 3NTIA 1E2ZA 5CV9A 1JE5A 3T51B 2AUJD 3GTLB 3SR1A 4YWMA 2MO0A 4DR7L 4IOCA 1PFMA 2QILA 4HMIA 1V1QA 3S2HH 3H0GH 5CBAE 2VXWA 3DLLA 1KQSA 3S2HB 3H0GB 4RGOS 1H9RA 5IY0A 1LTSD 1VQKA 3Q23A 1WFQA 4G7ZC 2E5LQ 5C3EH 3CPWA 2MP1A 4A76A 4ZCKA 5C3EB 4DR6L 4A3GG 5KGUA 4X6AH 1NMGA 4C1NI 3A54A 4FF2A 2A6HC 3A56A 2PQAA 5KNCA 1K0SA 2FHTA 4GNXB 3F1ZA 2B29A 2F03A 1VF7A 3MAQA 4LF6L 4JBJA 4JI1L 3RLNA 2A68C 1R4QB 1SBBB 4DV6Q 1MHWC 2XRSD 4K6LA 1OO9B 2R92H 4O1NA 4DR3L 5J1ZA 4JV5L 2R92B 2VQFL 4LFAQ 4ODGA 4DV2L 1SRUA 5ISRA 4HSVA 3U9SA 2HQEA 3PO3H 1HPCA 2ZXOA 2EXDA 4APVA 4K5VA 3PO3B 4V190 5CC4A 4DA2A 5DM73 5C0XH 2ZT9C 2K14A 3BVMA 3K0XA 2K28A 4A3BH 2KEDA 1KRSA 5I6WA 2KHJA 2CCZA 4A3BB 5IT9L 1HNZQ 4DKAC 4X3TA 3QIAA 2NTTA 3FVQA 3M4YA 4R4TA 2AKWB 2F4VL 5CV7A 3T1YL 1NNXA 1ESFA 3IL8A 4DR2L 2JK8A 4POGA 1HA6A 4EQOA 1KDAA 1Y1WH 3I73A 4FO2A 4LF7L 3SK6A 3J81c 1WOCA 5EPLA 5E3FA 4Q0FA 2ATWA 1Y1WB 5E7NA 3HOZH 3HZXA 2JSOA 1KNAA 1GXDC 4OX9L 3HOZB 4LF5L 3RN2A 1HR0L 1EY0A 5E4XA 1WI5A 1D8LA 4ZKCB 1IBLL 2VZAA 5C44H 3OHXC 2OTJA 3E3XA 3P7JA 5IP7G 5C44B 2LMCB 2F52A 5FLXc 3D6CA 2K7VA 2NTSA 2WKCA 1HTPA 4DR5Q 1S5DD 2F0QA 4EQPA 3S16H 1EFWA 3H15A 3S16B 4UP7A 1VQAA 1MKHA 3HG9A 5FKAC 4B3RQ 1MSGA 1UEAB 1BCPF 1PZID 4KD4A 2B2YA 3KLSA 2UUAQ 4HMJA 3D8GA 5CV8A 2UUBL 2PI2A 3KF8A 5KRUA 2K5WA 3T4AC 3OPOA 1VQLA 2WP8J 1IL2A 1BCPB 3H3VI 4C3IG 5KNBA 1N34L 2EYMA 4IUQA 1IBML 4KMUC 1B44D 2ZM6Q 3CCJA 2F3VA 3HKZG 5A2QE 3TS2A 1SNOA 2EQSA 1VQJA 2EJMA 1Y14B 3X3NA 5IYBH 4DAYA 1G291 5KIXA 1PMRA 1A2UA 3L3OC 4GOPA 3Q24A 3MZ5A 2AMCB 2I0QA 5LMNL 1H9SA 2PW7A 5CV4A 3M85A 4JOIA 3K59A 2MFIA 2Z6KC 3ND9A 2PI2E 1XTDA 2X6LA 3GTGH 5KNDA 3AFQA 5JVH3 3PIPA 1EY7A 2DJFC 3GTGB 4CDEC 1Q3LA 1C4QA 1HZAA 3PUZA 5HY6A 1ICFB 2O4XA 3J7AV 2RSOA 3K58A 1QOHA 2Y0SE 1LT5D 3V96A 5K5PA 3FHWA 4ID6A 4LUVA 4KKUA 3KDFA 1IYJB 1S3OA 2EYJA 2LSSA 1PXUA 1SMYD 4A3GH 3DWPA 4B3SL 5BR8Q 1EL0A 2I46A 4A3GB 1SDFA 1BBXC 1DJRD 2G9HD 4I7AA 3UDFA 4K5WA 3WOEA 1J5EQ 1X32A 1PV4A 3H91A 2Q8IB 1D1IA 4HIMA 4K8JA 3NEMA 4A3FG 3A8JE 1WTPA 3A0JA 4DV4Q 1NUCA 3ND8A 4RCOA 3U4ZA 4A3LG 3BDLA 1B3AA 1U4LA 3OIQA 1ZEQX 4P2CB 3NTKA 1I4XA 2NVTH 1XMQL 4KHPL 2R93G 4R4CA 4PG3A 2NVTB 2F0TA 3MXPA 1L0YB 5JPNC 2NVYH 3HGBA 3J80i 1C7YA 4NXMQ 1HNXQ 1EOVA 2ZTCA 2NVYB 3HFZB 3DWQA 1KLUD 1YVCA 2CQAA 5KEEA 2DY8A 1FYCA 2F0HA 1XYIA 5J22A 2EXZA 4B9WA 3C46A 4TQUS 1DCZA 4CKBA 3CCMA 1W6KA 3AU7A 2E75C 3D3RA 1NR2A 2UUCL 1B1ZA 5M3MG 1V8QA 1UUPA 1QWYA 4UPAA 1HUNA 4QGUA 1M90C 2CHBD 1EEID 1PH2A 4IPGA 3QOJA 1X9NA 5IP7H 1K3BC 2PW5A 1PTOH 3KLWA 3RR5A 3Q0AA 1TWCB 2F0MA 3NELA 1PTOB 4MN3A 3CRKC 4DUZL 1BDOA 2F3WA 4IFDJ 1K73C 1VQIA 2HD3A 4LUZA 1S5ED 1VQFA 2NBFA 1RHPA 5GADC 2KHSA 2N55A 1D5ZC 1BR9A
chains in the Genus database with same CATH topology
1MGSA 1ENFA 1L0XB 2LFNA 2NN6G 4IUUA 1GOZA 4FVMA 1DM0B 5FO7B 4J6HA 2KVMA 4NKLA 3P20A 1PDQA 1VMPA 2AQ1B 4IQZA 3IAYA 2WACA 2B2YC 3GTMB 2L12A 1LTID 3DUZA 3HKZB 2D2CC 1CI3M 3ZYYX 2IL8A 2OT2A 5C4HA 2EZVA 4B08A 1IL8A 1H9KA 2PZTA 3KK7A 3MWYW 3VYUA 1D6EC 3NXWA 1TY2A 1ZKOA 3PUXA 3WDNA 3TZDA 2M9VA 1CFMA 4KY5A 2QCPX 2L0CA 2SNMA 2XIWA 2XSCA 2PNRC 4HAEA 2IT1A 4DK1A 4F7XA 3HOXB 3E0JA 3PIP3 2L9HA 4IUPA 4KHZA 4A3KB 2IX1A 3OWEB 1V43A 1XX8A 4A3FB 3N6RA 3BDOA 4C2MB 1KDBA 3S1QB 1S5FD 2B2TC 1WTOA 4FNFA 3QG1A 1BOSA 5EKKA 1JICA 5D14A 4CGYB 5FO9B 4OIKA 4HSPA 2J7ZA 3SK5A 3EJIA 1SMYC 3IFDA 4JBWA 2O5IC 4IFDI 3GTPB 4DNTB 1RTNA 2BOSA 1RKNA 4ZKBB 5IGBA 2TSSA 4N9PA 4L63B 5M3MB 1I6VC 2AWOA 1HFNA 5IODA 1I4GA 1BCPD 4ZAIA 3EFXD 3NQIA 1MI2A 4ZQ3A 4H13C 2K33A 4DNRB 3H94A 3KBGA 4O42A 2EY5A 5HGTA 4I7ZC 4KN4C 2EYHA 4BY7B 2O5JC 2Z1CA 2EDGA 4PNYA 2R61A 5D3DA 3T13A 1RCVD 1UAPA 2NN6H 3DWAA 1II3A 3JAME 3TSSA 1G6ZA 3TP5A 1T5XD 1KNEA 2XN9C 1KLGD 4TSSA 1M4VA 4RAUC 2WV6D 2PQEA 2A73B 3GV6A 3W2DA 3T56B 2QF7A 4C1NK 2OEOA 5T1GA 1STYA 2JEAI 1HFGA 2EYPA 2K05A 1K83B 2MHVA 1RD9D 1PZJD 3MFGA 3HEJA 3M3YB 1RDPD 2C9OA 2F0PA 2K5QA 2HCIA 4EGVA 1SNQA 4DF7A 4A3EB 2BE5D 2GA4B 2EVBA 1TVXA 3FRPB 2F0LA 3X3MA 3MA2B 2HUGA 1EY9A 1JR0D 3I91A 1F2ZA 2E2HB 1B9NA 1LT4D 1B50A 1ICWA 3Q22A 4FYDA 2AQ3B 3CKIB 4RWSC 3HOYB 2E2DC 2RDHA 4FF1A 1X3QA 4DFAA 3KUPA 1M8AA 2NWGA 1ILQA 1O7ZA 1D2BA 4G57A 4NMZA 2EYLA 4RGTA 3U9OA 1EY4A 4A93B 3G6JB 2WB1B 2OXPA 1E2VA 1EQTA 3TP7A 4PV1C 1MSHA 3HOWB 5I2XA 4NP5A 5A2QL 3AB9A 4RFBA 4BY1B 4NW2A 1GJXA 3I90A 3C1EA 4WFN3 3ITPA 5KYIA 1PTOD 3S17B 1RTOA 4J8QA 2FMMA 2PO4A 2J0TD 1LABA 2SOBA 5TSSA 2B63B 2LKVA 4PMCA 2PPBC 3HP3A 4QF4A 2LS01 4C3JB 1XWEA 2CW0D 4BBSB 3J80E 2N88A 2RBMA 5ELBA 2JA8B 1YNND 1BQQT 1TKWB 1V1OA 1W6JA 2FJ2A 3GTJB 2F0VA 1MBYA 2R6GA 5DNFA 3I4NB 4OO1G 5HURA 2KCCA 2MUYA 5ELFA 4DU9A 3R8BA 2QDBA 2IPKD 5C6AA 3PIO3 3HOUB 3DXJC 3MXNA 3E5SA 1CQFA 3WOFA 2YYZA 5DM63 1V1PB 5JVG3 2JA7B 4ZK9B 1AN8A 4QIWB 1JCKB 4WRDA 1SYEA 3RZDB 2PZWA 3KLRA 1BCPC 4CBVA 4J1MA 1CM9A 3NBHA 4A3MB 3LX0A 1SXTA 4AYBB 1SYDA 3L9AX 1JB3A 4Y7NB 3GO5A 4DXFA 3PMFA 1O80A 4PMWA 4KTAA 2F0UA 4R8IA 2DNCA 1GHJA 5E4WC 1B53A 1OXUA 3A8IE 3BVZA 2ZXRA 3BG3A 3K6OA 1DONA 3D4WA 1H9MA 3BYTB 1EZ6A 1Y69U 4XT1B 3AMUA 5FOBB 2B39A 3OW7A 1IYUA 2MGSA 4HR7B 1AFPA 1OXXK 1EWHA 1QB5D 2E2JB 1DOKA 1E2WA 3F2UA 2RDGA 5EBDA 1KTKA 3PUWA 4H44C 1CZGA 3R3OA 2ICEC 2XVSA 3RD4A 3NHHA 5J39A 4M1UB 4F88A 1PZKD 4M8AA 2HDMA 3VR5A 5IIFA 1O78A 1G8ZD 3FKIB 5NUCA 2BE5C 1T5EA 2F0FA 1S5CD 1S4ZA 2X69A 3CQZB 4ZUIA 2SNSA 1WTWA 1G91A 2EE1A 5BN5A 2I07B 1SNPA 1VF5C 2B2TA 3A7LA 1GUOA 1SE2A 3S9WA 3NTHA 1FNWA 3GQBA 1IW7D 1HCZA 2BA0A 3FEWX 4ZUJA 1EU4A 1GUSA 4Q5VA 1JOOA 1DYQA 2RVLA 1YNJD 4KY7A 5C0XJ 4OO1H 4KKTA 3A8KE 1GHKA 5LL6X 5K36G 3QB3A 2KUMA 5KYLA 4KJOA 2PYKA 3K0YA 4XQQA 1ENAA 2SEBD 2L4NA 1SFOB 1PTOF 4IUVA 2DN8A 1AZPA 1JC7A 4ZYSA 4OHJA 4C56C 2CW0C 4CHTB 1A3VA 5D65A 3I70A 1HQMC 1HQRD 5AFWA 3BZDB 1YNNC 3GD7A 1SNDA 3O13A 1LTBD 5EBCA 2HDLA 4XYQA 3DMUA 1Y8NB 3RLFA 1STBA 1ET9A 3S1NB 3GV3A 4XT3B 4FF3A 4F8MA 2K5DA 3J81E 4EVOA 3VYSA 4C3IB 5C3WA 2RSNA 1CTMA 2FMCA 2JP1A 1HTLD 5FLXE 3MXUA 3ERQA 3RMHA 1MD2D 4DAVA 2IX0A 3D6WA 2B2UC 3ONAB 1EYAA 1R9TB 3T16A 4XQNA 4UAIA 1AP0A 2K1BA 3JAML 3K5LA 3OSOA 3FPUB 3V2TA 1CZWA 1PRTB 1HHVA 2VB2X 4RH6A 3NP8A 1LTTD 4X3UA 3K5MA 4WJWA 1NR4A 4NDXA 3I3CA 5COYA 1DD2A 5C4JB 1XTCD 2JA6B 5FO8B 4QB4A 2OF1A 1Z47A 3DEOA 4V0BA 4UDUC 1GUGA 5M5WB 1I4RA 5C0XI 1LTGD 2M00A 1O7LA 1IHZA 2NYZD 2WINB 1A15A 2L55A 2A68D 1WTXA 4E6IA 1H9SB 1KDCA 2F0IA 1CA5A 3TZUA 4HN7A 1BF4A 5CORA 2R93B 1QNUA 2BCOA 3S15B 2QEJC 5A35A 1LV9A 3GTQB 4XYOA 3CU7A 3N52A 4DXGA 5K36H 1Y8OB 3K5OA 1JWMD 2KCNA 2A69D 3NPPA 5JPMC 1Z7TA 3C2PA 3RUZA 4IUTA 4KKSA 4QCLA 3J7AF 1XXGA 1Q90A 3VA5A 1WD1A 2BDNA 1IW7C 1Q1EA 2H4OA 1OXSC 4X3SA 3DHQA 2CVRA 2H1EA 3KBXA 3W3AA 3BYYB 3SE0A 3CRLC 1PFNA 1NSNS 1STHA 1JWSD 1YNJC 1RJTA 3RZOB 1F9PA 4BS9A 2B2VA 1A3TA 4LMQD 4FXGC 2F0JA 5M5YB 3J80L 1Q12A 4ZLTF 2DY7A 3M7GA 3S1RB 3IKJA 5DAUA 1ET6A 2WAQB 1PLFA 2IWHA 5E1FA 1O7YA 1FNVA 1KAAA 2AUKA 3SK4A 1Y8PB 4IZ8A 1I4PA 1F2MA 2WKDA 5JOBA 2FFKB 4ILWA 3MFYA 1WCMB 3R2TA 2VB3X 2FINB 1BO0A 4RKLA 4KN7C 3I72A 1STEA 2ENBA 4IFDG 1WD0A 3VR2A 1F2LA 3SEBA 1FGBD 1HA5A 5C4XB 3E6ZX 2JXMB 4N9TA 2QKIC 2F0OA 1VCIA 1EIGA 2NVXB 1SYCA 1I3QB 1TU2B 5ELDA 1H9JA 1EFID 2PZUA 4CJ1B 3J7YW 3H6MA 5LHY1 1WTQA 4XIGS 1RF2D 1IYVA 2R3ZA 4A3IB 2F0KA 3NK9A 5IGCA 3MTSA 5CV6A 2D9UA 1G2SA 1SYBA 1JORA 5JEAJ 4KV6A 3NSWA 1U4PA 2ICIA 4C3HG 2AQ2B 3LWUA 3L7ZC 4RKBA 2SDFA 4KD3A 1TQOA 1F2YA 1JOKA 3UI2A 1EY6A 2A6ED 4HCEA 4EQNA 3K5NA 4K6DA 1X3PA 1D5MC 2F0SA 3GTKB 5EGTA 3FDTA 2F0EA 1TS3A 2PCFB 1BXTA 5DEHA 3R93A 1FD7D 2JYOA 3NUCA 5M5XB 3TBIB 1B2TA 1S5BD 2V4DA 1QILA 2EOTA 4DK0A 3GTOB 3S1MB 1Q8IA 4OGQC 4OIJA 3BDCA 3EA6A 3I4LA 3NWSA 1B4OA 2B8GA 1K8OA 1U4RA 1LT3D 1BNZA 4HCSA 4BBRB 1LLRD 3BVGA 1Q1BA 2A69C 2L11A 1JQYD 4RCNA 3MEHA 1PRTD 5IOCA 4KJNA 3MC0B 3TMEA 1WVLA 4K2LA 1QE6A 2B2VC 1G2TA 2J4XA 2F0GA 3TP6A 4CKCA 1SYGA 5I9PA 2XWJB 5EQ0A 5CMDA 3DM1A 3VR6A 2NZ1D 2Z8LA 1EYCA 2RA4A 5G3LF 2C5CA 2BA1A 1JWUD 3P75A 1EIHA 1E0BA 1EWCA 4IFDH 3KLSX 5CBEE 3TDQA 3HOVB 2WIIB 5EJWA 2K32A 3CHBD 5T1IA 5EKIA 5CYUA 2B2UA 4IN3A 1VMCA 2XRQD 1B9MA 1Z6HA 4F87A 4CJ2C 1HXYD 2G9DA 1TT2A 1LT6D 3OWFA 3LNNA 4IALA 4A3JB 1SNMA 2Z4IA 1AW7A 3J81L 5CGKA 4FF4A 3V05A 3DEPA 1SSOA 2JEBI 4IURA 4QUCA 2AWNA 4MIUA 3MXGA 1JOQA 2EYFA 5C3XA 1C48A 2A74C 4C3HB 4KHVA 5ELCA 5ELEA 3D31A 1FR3A 2EJGC 1U4MA 1ZYRD 3HRZC 1FNUA 5FLXL 1Y1VB 3HS0C 2RKSA 1SE4A 2KA7A 1QJOA 1DXMA 1EQVA 3M7NA 4TKOB 3S14B 1A2TA 1A3UA 2BDOA 4U673 2XNAC 5IT9E 4L6TB 5BN4A 1D1KA 3MVVA 2NUCA 2NN6I 1C8CA 1TS4A 2F0WA 1TWAB 2RDFA 2K01A 3SXHA 5BN3A 5M3FB 2Z4HA 1NCVA 3TN2A 5EPKA 1GUWA 4FXKC 4G7HC 5C4ZA 1KABA 4HEDA 4R9WA 5LL6S 2EJFC 2D62A 5JEAG 2MPMA 1CHQD 1PTOC 5IGFA 5M9OA 2NVQB 2F0DA 2PMZB 1VDZA 1STAA 5CV5A 2A6EC 5IGDA 4HTHA 4FXDA 1ZXTA 3OMGA 1K8MA 1GUNA 4LAAA 1UNSA 4GZYC 4LJZC 5D3IB 3SDZA 1PFBA 1A6XA 1EYDA 1RODA 1D5XC 1OXTA 3BS1A 3EVQA 5JJZA 2X6GA 1LTRD 1AEXA 2NB0A 2ZXPA 2HCCA 5I6YA 2YU9B 3C1FA 4U68A 3VYRA 3EQLC 4BWGB 1CT1D 4QMGA 3URYA 3OMCA 5C5MA 3GP7A 2XWBB 3D4DA 4L8JA 3A7AB 1TWHB 2TMPA 5EPJA 1WTRA 3PV0A 1PRTC 2RQXA 1TS2A 3FMCA 2B2WA 4RHRA 2K6AA 2MJ8A 2K04A 3P1HA 1EEFD 1SE3A 2KQ3A 1PRTF 4A3DB 1J9OA 1F77A 3NWTA 1ESRA 1EY5A 1DOLA 2E2IB 4BA1I 4KY6A 4OL7A 2EY1A 4DN4M 1HRJA 2IW3A 3K7AB 4H0LC 3R2IA 4RGMA 1OXVA 1EZ8A 1LACA 2M2LA 3H3VC 4XTCS 1J8IA 4WORA 2E74C 2IJ0A 3VR4A 1ONLA 3SK8A 5JAVA 2A6HD 4QUFA 5CR3A 2KECA 2Q8RE 2Y0SB 4G4KA 4DGZA 3LWEA 5I4DA 3M4OB 1I4QA 1R4PB 4R8NA 1LTAD 2JE6I 1TR5A 1I50B 5I2YA 1EY8A 3TP8A 3T53B 1SYFA 1CQVA 2KEEA 4LK1C 1QNKA 4BA2I 3IFTA 5JEAH 3QJYA 2ID0A 1CHPD 1F9RA 4CJ0B 1ZYRC 3MHBA 2D5DA 1AZQA 1PYWD 4K8IA 2DNEA 1DZ1A 1JE4A 1V1PA 1F9QA 4FP5D 4ME5A 3VR3A 1LO5D 4Z9CB 3QWNA 4ABNA 3C3LA 4G7OC 1ILPA 4XQJA 4TRDA 3D4RA 5G3LD 3VYTA 1I4HA 4KK7A 2F1MA 1TWFB 1I6HB 2VUMB 3OIPA 4C3JG 4XDXA 2F4IA 1U9RA 1NAPA 2EY6A 3K57A 4IUNA 3G7LA 5F2DA 2F0NA 1QCBD 4YIJA 3SVMA 5C0XG 3H09A 3PUYA 4K14A 2LY7A 3VA7A 4DAPA 1TY0A 5IGEA 3NBIA 3NE5B 4RA8A 2K03A 1GUTA 1SAPA 2EPBA 1DOMA 2O2LD 4ULLA 3QOLA 1BUVT 1IKMA 4B9XA 5EKLA 2L1BA 2JA5B 2IX3A 3OOCA 5FK9C 4RGNA 5IGGA 2L5TA 1IKLA 1TIID 2EY2A 2R7ZB 2B2WC 3EROA 1TS5A 4KI0A 4MHEA 1F9SA 2Q8TA 2KOLA 3Q6SA 3A55A 3I8ZA 2EYOA 1CA6A 3QO2A 4PQXA 2E76C 3I4MB 2A5HA 4X3KA 1EU3A 4S3SA 1SJED 1SNCA 1STNA 2VNUD 3PO2B 4K2KA 4RHSA 1HUMA 2KJXA 1EOTA 3SHLA 5I9OA 4PMBA 1SJHD 1STGA 4XXEA 4I65A 3NQTA 1CK1A 4H7BA 4JK1C 1ENCA 4ZRZA 1WTVA 1SEBD 4OO1I 3FPPA 5C5LA 3S2DB 2B8FA 4K5XA 1QG7A 1TWGB 1ML0D 4CKEA 3PUVA 3NTIA 1E2ZA 5CV9A 3T51B 2AUJD 3GTLB 3SR1A 1PFMA 2QILA 4HMIA 5CBAE 2VXWA 3S2HB 3H0GB 4RGOS 1H9RA 1LTSD 3Q23A 4G7ZC 2MP1A 5C3EB 5KGUA 4C1NI 3A54A 4FF2A 2A6HC 3A56A 5KNCA 2FHTA 2F03A 1VF7A 3MAQA 2A68C 1R4QB 1SBBB 2XRSD 4K6LA 1OO9B 4O1NA 5J1ZA 2R92B 4ODGA 5ISRA 4HSVA 3U9SA 2HQEA 1HPCA 2ZXOA 4K5VA 3PO3B 4V190 5CC4A 4DA2A 5DM73 5C0XH 2ZT9C 3BVMA 2K28A 2KEDA 5I6WA 4A3BB 5IT9L 4X3TA 3QIAA 2NTTA 3FVQA 3M4YA 5CV7A 1ESFA 3IL8A 1HA6A 4EQOA 1KDAA 3I73A 4FO2A 3SK6A 5EPLA 5E3FA 4Q0FA 1Y1WB 3HZXA 2JSOA 1KNAA 1GXDC 3HOZB 1EY0A 5E4XA 4ZKCB 3OHXC 3P7JA 5C44B 2LMCB 3D6CA 2K7VA 2NTSA 2WKCA 1HTPA 1S5DD 2F0QA 4EQPA 3S16B 3HG9A 5FKAC 1MSGA 1UEAB 1BCPF 1PZID 4KD4A 2B2YA 3KLSA 4HMJA 3D8GA 5CV8A 3KF8A 5KRUA 2K5WA 3T4AC 3OPOA 2WP8J 1BCPB 4C3IG 5KNBA 2EYMA 4IUQA 4KMUC 1B44D 2F3VA 5A2QE 1SNOA 2EJMA 3X3NA 4DAYA 1G291 5KIXA 1PMRA 1A2UA 3L3OC 3Q24A 3MZ5A 1H9SA 2PW7A 5CV4A 3M85A 3K59A 3ND9A 2X6LA 5KNDA 5JVH3 1EY7A 3GTGB 1Q3LA 1C4QA 3PUZA 2O4XA 3J7AV 2RSOA 3K58A 1QOHA 1LT5D 3V96A 5K5PA 4ID6A 4KKUA 2EYJA 1PXUA 1SMYD 3DWPA 1EL0A 2I46A 4A3GB 1SDFA 1BBXC 1DJRD 2G9HD 4K5WA 3WOEA 1X32A 3H91A 2Q8IB 1D1IA 4K8JA 1WTPA 3A8JE 1NUCA 3ND8A 4RCOA 3BDLA 1B3AA 1U4LA 3OIQA 1ZEQX 4P2CB 3NTKA 1I4XA 2NVTB 2F0TA 3MXPA 5JPNC 1L0YB 3HGBA 2NVYB 3DWQA 1KLUD 2CQAA 5KEEA 2DY8A 1FYCA 2F0HA 1XYIA 5J22A 2EXZA 4B9WA 3C46A 4TQUS 1DCZA 4CKBA 1W6KA 3AU7A 2E75C 3D3RA 1NR2A 1B1ZA 1V8QA 1UUPA 1QWYA 1HUNA 2CHBD 1EEID 3QOJA 2PW5A 1PTOH 3Q0AA 1TWCB 2F0MA 1PTOB 4MN3A 3CRKC 1BDOA 2F3WA 4IFDJ 1S5ED 2NBFA 1RHPA 2KHSA 2N55A 1D5ZC 1BR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FO8 B;  4FXG C;  5JPM C;  2QKI C;  2ICE C;  1JC7 A;  3CKI B;  2A74 C;  2A73 B;  1BQQ T;  5FOB B;  1PXU A;  2B39 A;  3G6J B;  1GXD C;  2E2D C;  1JB3 A;  5FO7 B;  2XWJ B;  5FO9 B;  2WII B;  2J0T D;  1UEA B;  3I70 A;  1OO9 B;  1UAP A;  3CU7 A;  3KLS A;  3FRP B;  3HRZ C;  2I07 B;  5JPN C;  3L3O C;  2WIN B;  3MA2 B;  4ILW A;  3HS0 C;  3OHX C;  1D2B A;  3T4A C;  3V96 A;  1XWE A;  2XWB B;  1BUV T;  4FXK C;  2TMP A;  1BR9 A; 
#chains in the Genus database with same CATH topology
 1MGS A;  1ENF A;  1L0X B;  3SGI A;  1VQH A;  2LFN A;  1PH1 A;  2NN6 G;  4IUU A;  1GOZ A;  4FVM A;  1DM0 B;  5FO7 B;  4J6H A;  2KVM A;  4NKL A;  3P20 A;  3W5O A;  1PDQ A;  1VMP A;  2AQ1 B;  4IQZ A;  3GTM H;  3IAY A;  1O7I A;  2WAC A;  3BU2 A;  3ER0 A;  1M1K C;  2B2Y C;  3GTM B;  1GKH A;  2L12 A;  2WAQ G;  1VQO A;  2Z6B A;  1LTI D;  4B3T Q;  3DUZ A;  3HKZ B;  1KC8 C;  1KAW A;  2D2C C;  1CI3 M;  1PHJ A;  4OWW B;  3ZYY X;  2QEX A;  3ZJY C;  2IL8 A;  3I4O A;  5GQO A;  4J15 A;  2OT2 A;  1VQE A;  1YHQ A;  4JI0 Q;  5C4H A;  4DV5 Q;  1K0R A;  2EZV A;  4JYA Q;  4B08 A;  1G51 A;  1IL8 A;  1NMF A;  5IP9 G;  1H9K A;  2PZT A;  2UXB Q;  3KK7 A;  1AE3 A;  3MWY W;  4X65 L;  3VYU A;  1D6E C;  3NXW A;  3PF5 A;  1TY2 A;  1K8A C;  1ZKO A;  1IZ6 A;  3PUX A;  3WDN A;  3TZD A;  4IJH A;  2M9V A;  3CCQ A;  1BBU A;  1CFM A;  4KY5 A;  2QCP X;  2L0C A;  2SNM A;  3OTO L;  1YEZ A;  2XIW A;  2H5X A;  2XSC A;  1WJJ A;  4L5S A;  2PNR C;  3HOX H;  4HAE A;  2CH4 W;  2IT1 A;  4DK1 A;  4F7X A;  3HOX B;  1E22 A;  3E0J A;  4LWC A;  3PIP 3;  1H95 A;  4A3K H;  2R7D A;  2L9H A;  4IUP A;  4KHZ A;  2B3G A;  4X66 L;  1KXL A;  4A3K B;  2IX1 A;  4A3F H;  3OWE B;  1V43 A;  1XX8 A;  4C2M H;  3S1Q H;  4A3F B;  4A93 G;  1VQC A;  1Z9F A;  3BDO A;  3N6R A;  4C2M B;  1KDB A;  3S1Q B;  4YHH L;  1S5F D;  1HH2 P;  2B2T C;  1WTO A;  4FNF A;  3QG1 A;  1BOS A;  2GN5 A;  3CCR A;  3HOW G;  5EKK A;  4JI7 Q;  5ELO A;  1XMO Q;  1JIC A;  2QGQ A;  5D14 A;  4CGY B;  5FO9 B;  4OIK A;  4YCW A;  2HHH Q;  1S72 A;  1MIU A;  4HSP A;  2J7Z A;  3SK5 A;  3EJI A;  1SMY C;  3IFD A;  4JBW A;  2O5I C;  3GTP H;  4YWK A;  4IFD I;  4JI2 Q;  2B63 G;  3GTP B;  2R7F A;  1A63 A;  1EIF A;  2OWO A;  4DNT B;  1RTN A;  2BOS A;  1IBK L;  1FL0 A;  5M3M H;  1RKN A;  4ZKB B;  1PYS B;  2A19 A;  4DK6 C;  5IGB A;  2TSS A;  4N9P A;  4L63 B;  3PIO A;  1E7Z A;  1K28 A;  4GKK L;  4BBS G;  5M3M B;  1I6V C;  4LNQ A;  2MQH A;  2AWO A;  1HFN A;  5IOD A;  1I4G A;  1BCP D;  4ZAI A;  1N32 Q;  3EFX D;  2JA8 G;  2UXD L;  4GKJ Q;  2XGT A;  3BZC A;  1XPR A;  2CKZ B;  3NQI A;  1MI2 A;  4ZQ3 A;  4H13 C;  2K33 A;  4DNR B;  3H94 A;  2QDL A;  3KBG A;  2JQO A;  1U5K A;  4BY7 H;  4O42 A;  2EY5 A;  5HGT A;  4I7Z C;  4UP9 A;  4KN4 C;  2EYH A;  4X64 Q;  1CSP A;  4BY7 B;  4CDC C;  2Z1C A;  2O5J C;  2EDG A;  4PNY A;  2R61 A;  5D3D A;  1PH5 A;  2DUD A;  3T13 A;  3CCS A;  1Q81 C;  1RCV D;  1UAP A;  2NN6 H;  3DWA A;  4AQY Q;  1II3 A;  3G48 A;  3JAM E;  3TSS A;  1G6Z A;  3TP5 A;  1T5X D;  1KNE A;  2JA7 G;  2XN9 C;  1KLG D;  4UY8 C;  4TSS A;  1M4V A;  4RAU C;  2WV6 D;  2PQE A;  2A73 B;  3GV6 A;  3W2D A;  3F2C A;  3T56 B;  2QF7 A;  4JI5 Q;  4C1N K;  2OEO A;  5T1G A;  1X65 A;  3KOJ A;  1K83 H;  1STY A;  2JEA I;  1HFG A;  2HT1 A;  1A8V A;  2EYP A;  2K05 A;  1K83 B;  1XNQ Q;  2MHV A;  1RD9 D;  3M3Y H;  3CMA A;  1FJG Q;  5IE8 A;  1PZJ D;  4DR1 L;  3MFG A;  3HEJ A;  1K9M C;  1RDP D;  3M3Y B;  2RCF A;  5IP9 H;  2C9O A;  2F0P A;  4A3E H;  1P8L A;  2K5Q A;  1S40 A;  2HCI A;  3CCV A;  4EGV A;  1SNQ A;  4DF7 A;  4A3E B;  4N8X 1;  2BE5 D;  2GA4 B;  2EVB A;  4B3M L;  1TVX A;  3ULP A;  3FRP B;  1FVI A;  2F0L A;  3X3M A;  1CUK A;  3MA2 B;  2HUG A;  2E2H H;  1EY9 A;  5LMU Q;  1JR0 D;  3I91 A;  2Z6K A;  1F2Z A;  3PGZ A;  2E2H B;  1B9N A;  1LT4 D;  1B50 A;  2K4K A;  1ICW A;  4DV0 Q;  1YJN A;  3Q22 A;  4FYD A;  2AQ3 B;  3CKI B;  3F2D A;  4RWS C;  3HOY B;  2E2D C;  2RDH A;  4RMF A;  4FF1 A;  1X3Q A;  1T9H A;  4DFA A;  3KUP A;  1M8A A;  2NWG A;  3RLO A;  1GO3 E;  1ILQ A;  1O7Z A;  1L1O A;  3QR8 A;  2IHE A;  1D2B A;  5IT9 c;  3GDE A;  4LF4 Q;  2AHO B;  4G57 A;  4NMZ A;  4O2D A;  2EYL A;  4A3J G;  2MO1 A;  4A93 H;  2VY3 A;  4RGT A;  3U9O A;  4DV3 Q;  4ALP A;  3FKI G;  1EY4 A;  4A93 B;  3G6J B;  2WB1 B;  2OXP A;  1PH3 A;  1E2V A;  3PSI A;  1EQT A;  3AQQ A;  3HOW H;  4JBM A;  3TP7 A;  4PV1 C;  4BY1 H;  3J7Z C;  1MSH A;  3HOW B;  3CAM A;  5I2X A;  4NP5 A;  5FJ8 G;  4IPC A;  5A2Q L;  3AB9 A;  4RFB A;  4BY1 B;  4NW2 A;  1RIP A;  1GJX A;  3I90 A;  3C1E A;  4WFN 3;  4PZ7 A;  3ITP A;  5KYI A;  1XNR Q;  3S17 H;  1PTO D;  1Y1V G;  3KF6 A;  3S17 B;  4LFB L;  1YIJ A;  1UEB A;  4NXN Q;  1JJG A;  1RTO A;  4J8Q A;  2FMM A;  5IYC H;  2PO4 A;  2B63 H;  1QVG A;  2J0T D;  1LAB A;  2SOB A;  5TSS A;  2B63 B;  1P16 A;  4MTK A;  1VQD A;  2LKV A;  3K81 C;  4C3J H;  1QZH A;  4PMC A;  4BBS H;  1N36 L;  4HJA A;  2PPB C;  3HP3 A;  4QF4 A;  1HZ9 A;  2LS0 1;  4C3J B;  1XWE A;  2PMZ E;  3GTO H;  2CW0 D;  4BBS B;  3J80 E;  2JA8 H;  1VQ8 A;  2N88 A;  2RBM A;  5ELB A;  2JA8 B;  1YNN D;  1PH6 A;  1HZC A;  1BQQ T;  3GTJ H;  5M3F G;  1TKW B;  1V1O A;  1W6J A;  4JI6 L;  2FJ2 A;  3GTJ B;  2F0V A;  1E24 A;  3I4N H;  1MBY A;  3A74 A;  4DV1 L;  2R6G A;  4NB3 A;  5DNF A;  1MJC A;  5AJ3 L;  3I4N B;  4OO1 G;  5HUR A;  3CD6 A;  2KCC A;  4K0K Q;  2MUY A;  4MTN A;  3KYH C;  2UXC Q;  5ELF A;  4DU9 A;  3R8B A;  2QDB A;  2IPK D;  5C6A A;  3HOU H;  1G6P A;  3PIO 3;  3ERS X;  4JI8 L;  3HOU B;  4JI4 L;  3DXJ C;  3MXN A;  3E5S A;  1CQF A;  2JA7 H;  2UU9 Q;  3D0F A;  3WOF A;  2YYZ A;  5DM6 3;  1V1P B;  5JVG 3;  1I94 L;  2JA7 B;  4ZK9 B;  1AN8 A;  4QIW B;  3JAM i;  3RZD H;  1JCK B;  4WRD A;  3UE1 A;  1SYE A;  3RZD B;  1EQQ A;  2PZW A;  4DR7 Q;  3KLR A;  2E8G A;  1BCP C;  4CBV A;  4A3M H;  4J1M A;  1CM9 A;  4Y7N H;  4BXX G;  3NBH A;  3J81 j;  4A3M B;  3LX0 A;  1SXT A;  4AYB B;  1SYD A;  2RHS B;  1JB3 A;  3L9A X;  3GO5 A;  3UDX A;  4Y7N B;  4DXF A;  3PMF A;  1O80 A;  4PMW A;  4KTA A;  2F0U A;  4P72 A;  4R8I A;  1UE1 A;  4JCV E;  1PVO A;  4Y52 H;  2DNC A;  1GHJ A;  1HZB A;  5J3B A;  5E4W C;  1B53 A;  3BZK A;  1OXU A;  3A8I E;  3BVZ A;  1VQ7 A;  2ZXR A;  3BG3 A;  3K6O A;  4DR6 Q;  1DON A;  3D4W A;  1H9M A;  3BYT B;  1EZ6 A;  2QW7 A;  4DK3 C;  1Y69 U;  4XT1 B;  4OWT B;  3AMU A;  5FOB B;  4LF6 Q;  2B39 A;  4LUO A;  4JI1 Q;  3OW7 A;  1IYU A;  4DV7 L;  2MGS A;  4HR7 B;  5GAH C;  1AFP A;  1OXX K;  1AH9 A;  2E2J H;  1EIY B;  2IY5 B;  4CDF C;  1EWH A;  1QB5 D;  2E2J B;  1DOK A;  1E2W A;  3F2U A;  2RDG A;  5EBD A;  4DR3 Q;  1GVP A;  4JV5 Q;  2VQF Q;  1KTK A;  3PUW A;  3OW2 A;  4DV2 Q;  2OCE A;  4H44 C;  1CZG A;  3R3O A;  2ICE C;  2XVS A;  3RD4 A;  3NHH A;  2K5H A;  5J39 A;  4M1U B;  4F88 A;  3I2Z A;  1QUQ A;  1OTC A;  1PZK D;  4M8A A;  1VQB A;  2HDM A;  3VR5 A;  3FKI H;  4OEL B;  5IIF A;  1O78 A;  1G8Z D;  3FKI B;  2ZTD A;  3EN2 A;  5NUC A;  3PQI A;  2BE5 C;  1T5E A;  2F0F A;  1S5C D;  3T1Y Q;  2F4V Q;  1L1O C;  3CW2 C;  4DR2 Q;  3CQZ H;  2DGY A;  4EQ5 A;  4R1J A;  4LF7 Q;  1S4Z A;  2X69 A;  3CQZ B;  1CKO A;  1N33 L;  4ZUI A;  2JJQ A;  2SNS A;  1WTW A;  2JA6 G;  4OX9 Q;  1G91 A;  2EE1 A;  5BN5 A;  1HR0 Q;  2I07 B;  1HNW L;  4LFC L;  2D0P A;  1IBL Q;  1C0A A;  1SNP A;  1VF5 C;  2B2T A;  3A7L A;  2LXJ A;  4UP8 A;  1GUO A;  1SLJ A;  1VQ9 A;  1SE2 A;  3S9W A;  4QJF A;  3NTH A;  1CKN B;  1FNW A;  3GQB A;  3G71 A;  1IW7 D;  1HCZ A;  2BA0 A;  3STB D;  3OYY A;  4DNI A;  3FEW X;  4ZUJ A;  2NZH A;  1J6Q A;  1NBW A;  1EU4 A;  1GUS A;  4Q5V A;  2V1C C;  1TWA H;  1JOO A;  3ULJ A;  1DYQ A;  1XPU A;  2CFM A;  2UUB Q;  4OEM B;  4HIK A;  2RVL A;  1YNJ D;  2G5D A;  4KY7 A;  5C0X J;  4OO1 H;  4KKT A;  1JMC A;  3A8K E;  1GHK A;  5LL6 X;  5K36 G;  2FXQ A;  1N34 Q;  3QB3 A;  1AE2 A;  1UE6 A;  2KUM A;  5KYL A;  2KCM A;  4KJO A;  2PYK A;  3WWV A;  3KJP A;  3CC2 A;  4OWX B;  3K0Y A;  4XQQ A;  5LMN Q;  1SFO H;  1ENA A;  2SEB D;  2YTX A;  2L4N A;  4OON A;  5GAE C;  1SFO B;  1PTO F;  2F3I A;  1EYG A;  4IUV A;  2DN8 A;  1AZP A;  1JC7 A;  3KF6 B;  4ZYS A;  2PQA B;  4OHJ A;  4C56 C;  4EX5 A;  2CW0 C;  4CHT B;  1A3V A;  5D65 A;  5IWA L;  3I70 A;  4BXX H;  1HQM C;  1HQR D;  5AFW A;  3BZD B;  1YNN C;  3GD7 A;  1SND A;  3O13 A;  1LTB D;  4JBK A;  3PF4 A;  1SMX A;  5EBC A;  2HDL A;  4XYQ A;  3DMU A;  1Y8N B;  3S1N H;  3RLF A;  4YCU A;  1STB A;  4CDD C;  1ET9 A;  4PZ8 A;  3S1N B;  3GV3 A;  4B3S Q;  1NY4 A;  4XT3 B;  1SN8 A;  4FF3 A;  2CQO A;  2K5D A;  4F8M A;  1N8R C;  4C3I H;  3J81 E;  4EVO A;  4DR4 L;  3VYS A;  4C3I B;  3UDG A;  5C3W A;  2RSN A;  4GLA C;  4QL5 A;  1CTM A;  2YTY A;  2FMC A;  2JP1 A;  4GN3 B;  1HTL D;  5FLX E;  4WJ4 A;  1GM5 A;  2JA5 G;  1WCM G;  1XMQ Q;  4KHP Q;  3MXU A;  3ERQ A;  1UWV A;  3RMH A;  1R9T H;  1MD2 D;  4DAV A;  2IX0 A;  2R7Z G;  3D6W A;  2B2U C;  3ONA B;  1EYA A;  1R9T B;  3T16 A;  4IPD A;  4LF8 L;  3K8A A;  4XQN A;  4UAI A;  1AP0 A;  2I5H A;  2K1B A;  3JAM L;  3K5L A;  3OSO A;  3FPU B;  3V2T A;  1CZW A;  1PRT B;  1HHV A;  2VB2 X;  5C4X G;  4RH6 A;  3NP8 A;  1LTT D;  4X3U A;  3K5M A;  3I4M G;  4YY3 L;  2RCN A;  4WJW A;  1NR4 A;  4NDX A;  1YJW A;  3I3C A;  5COY A;  5C4J H;  2JA6 H;  2UUC Q;  1DD2 A;  1YNX A;  3KF8 B;  5C4J B;  3PO2 G;  1XTC D;  2JA6 B;  4GNX A;  5FO8 B;  4QB4 A;  1MJE A;  2OF1 A;  2A1A A;  1Z47 A;  3DEO A;  3EIV A;  5M5W H;  4V0B A;  4UDU C;  1GUG A;  4NPS A;  5M5W B;  1I4R A;  5C0X I;  1LTG D;  1X3G A;  4A3I G;  3Q8D A;  2WB1 E;  2M00 A;  3G6E A;  1O7L A;  1IHZ A;  2HIX A;  4DUZ Q;  4A3L H;  2NYZ D;  4LF9 L;  1X3F A;  2WIN B;  4DAY B;  1A15 A;  2L55 A;  4GOP B;  2A68 D;  1WTX A;  3H3V H;  4E6I A;  4YWL A;  1H9S B;  1KDC A;  2F0I A;  5EAY A;  2R93 H;  1CA5 A;  3TZU A;  4P71 A;  4HN7 A;  1BF4 A;  3S15 H;  5COR A;  2R93 B;  1QNU A;  4DPG A;  2BCO A;  3S15 B;  2GVB A;  2QEJ C;  3GTQ H;  2Z0S A;  3J80 c;  5A35 A;  1LV9 A;  3GTQ B;  4XYO A;  3CU7 A;  3N52 A;  4DXG A;  3T1H L;  5K36 H;  3RNU A;  3H0G G;  1Y8O B;  3K5O A;  4X62 L;  3S24 A;  3TEH B;  1JWM D;  2RHQ B;  2KCN A;  2A69 D;  3NPP A;  5JPM C;  1Z7T A;  3C2P A;  1IXR A;  3RUZ A;  5C3E G;  3KDF B;  4JI3 L;  4IUT A;  4KKS A;  4QCL A;  3J7A F;  1XXG A;  1Q90 A;  3CF5 A;  1JJC B;  3VA5 A;  2K75 A;  1WD1 A;  2BDN A;  1IW7 C;  1Q1E A;  3RN5 A;  1B7Y B;  2H4O A;  1OXS C;  4X3S A;  1TWF H;  1E1O A;  3DHQ A;  3UE0 A;  1QVF A;  2CVR A;  1X6O A;  2H1E A;  3KBX A;  3W3A A;  2VQE Q;  3BYY B;  4X65 Q;  2KHI A;  4DUY L;  1ASZ A;  3K7U C;  3SE0 A;  3CRL C;  1PFN A;  1NSN S;  3RZO H;  1STH A;  1JWS D;  1DGS A;  1NJI C;  1YNJ C;  4BBR G;  1RJT A;  3RZO B;  1A62 A;  4MNO A;  3A5Z B;  4RG1 A;  2N78 A;  1I5F A;  4A3C G;  1CKM A;  1F9P A;  2NZO A;  4BS9 A;  2B2V A;  5JJK A;  1A3T A;  4QIW E;  2K5N A;  4A3B G;  1X55 A;  5M5Y H;  4LMQ D;  4FXG C;  1NE3 A;  2F0J A;  4JPB W;  5M5Y B;  3J80 L;  3S1R H;  1Q12 A;  4ZLT F;  2DY7 A;  3M7G A;  2OQ0 A;  1WTH A;  3S1R B;  3IKJ A;  5DAU A;  4X66 Q;  1ET6 A;  2WAQ B;  3J81 i;  3K80 C;  4AYB E;  1PLF A;  2IWH A;  3DM3 A;  5E1F A;  1O7Y A;  1KIX A;  2E5L L;  1FNV A;  1KAA A;  2AUK A;  3SK4 A;  3KFU A;  1Y8P B;  2N8N A;  1I4P A;  3M4P A;  4IZ8 A;  1F2M A;  1PH4 A;  1SR3 A;  3HOZ G;  2WKD A;  4YHH Q;  5JOB A;  1WCM H;  1VS0 A;  2FFK B;  4ILW A;  3MFY A;  2YTV A;  1WCM B;  3R2T A;  2VB3 X;  2KBN A;  1WYD A;  2FIN B;  5C44 G;  1BO0 A;  4DV6 L;  1YZ6 A;  4RKL A;  4KN7 C;  3I72 A;  1STE A;  2ENB A;  4IFD G;  1PH8 A;  1WD0 A;  5C4X H;  3VR2 A;  1F2L A;  1E1T A;  2Q2H A;  3SEB A;  4DAM A;  4LFA L;  1FGB D;  1HA5 A;  2CWA A;  5C4X B;  3E6Z X;  3HOV G;  2JXM B;  4N9T A;  1Q8K A;  3I7F A;  4LW1 A;  2NVX H;  2QKI C;  2F0O A;  1VCI A;  1I3Q H;  1EIG A;  2NVX B;  1IBK Q;  1SYC A;  1I3Q B;  1TU2 B;  4GKK Q;  5ELD A;  1HNZ L;  4GS3 A;  1YBY A;  1H9J A;  1EFI D;  2PZU A;  4CJ1 B;  3J7Y W;  5HGQ A;  2UXD Q;  2D0O A;  3H6M A;  5LHY 1;  4A3I H;  1WTQ A;  4XIG S;  1RF2 D;  1IYV A;  2CH4 A;  2R3Z A;  4A3I B;  2F0K A;  3NK9 A;  5IGC A;  5IYB G;  1PA6 A;  4GNX C;  3ICE A;  1LM0 A;  3MTS A;  1L0W A;  1X56 A;  5CV6 A;  2D9U A;  1E3P A;  1KRT A;  4YCV A;  1G2S A;  1SYB A;  1JOR A;  5JEA J;  4KV6 A;  3NSW A;  1U4P A;  3UDI A;  1W2B A;  2ICI A;  1D7Q A;  4C3H G;  2AQ2 B;  3LWU A;  4MZ9 A;  1C9O A;  3L7Z C;  4DR5 L;  4RKB A;  1HR0 W;  2SDF A;  4KD3 A;  1TQO A;  1F2Y A;  4O0A A;  1JOK A;  3UI2 A;  1EY6 A;  2A6E D;  4HCE A;  4EQN A;  3K5N A;  4K6D A;  3GTK H;  4B3R L;  1K3R A;  1X3P A;  3I56 A;  1D5M C;  2F0S A;  4GN5 A;  3GTK B;  2UUA L;  5M5X H;  5EGT A;  3FDT A;  2ZTE A;  2F0E A;  1TS3 A;  2PCF B;  1BXT A;  5DEH A;  3R93 A;  1FD7 D;  2JYO A;  1X54 A;  3NUC A;  5M5X B;  2A8V A;  3TBI B;  1B2T A;  2MNA A;  3B6Y A;  1S5B D;  2V4D A;  1QIL A;  2EOT A;  4DR1 Q;  5JJI A;  2ASB A;  3S1M H;  4DK0 A;  3GTO B;  3S1M B;  1Q8I A;  2ZM6 L;  1PYB A;  4OGQ C;  4OIJ A;  3U58 A;  4HJ9 A;  3BDC A;  3EA6 A;  5FLM G;  3I4L A;  3NWS A;  1B4O A;  2B8G A;  1K8O A;  4B3M Q;  1A0I A;  1VQM A;  4BBR H;  2OTL A;  3CCL A;  1SRO A;  1U4R A;  1LT3 D;  1BNZ A;  4HCS A;  4BBR B;  4A3C H;  3F2B A;  5GRO A;  1LLR D;  2Z9H A;  4AIM A;  3BVG A;  1NTG A;  2K5V A;  5LMN W;  1Q1B A;  2A69 C;  3CCE A;  1B8A A;  2L11 A;  1YHB A;  3CC7 A;  1JQY D;  1Q86 C;  4L5R C;  4RCN A;  3A5U A;  3MEH A;  1PRT D;  5IOC A;  4KJN A;  3MC0 B;  4FDB A;  3TME A;  1FGU A;  4R4O A;  1WVL A;  4K2L A;  3HKS A;  1QE6 A;  2B2V C;  1G2T A;  2J4X A;  5L37 A;  2F0G A;  3TP6 A;  2HIV A;  4CKC A;  1EUJ A;  1SYG A;  1UE5 A;  5I9P A;  5BR8 L;  2Q2T A;  2XWJ B;  5EQ0 A;  4IPH A;  5CMD A;  3DM1 A;  3VR6 A;  2NZ1 D;  2Z8L A;  1EYC A;  2RA4 A;  5DLQ E;  5IYD G;  5G3L F;  2C5C A;  2BA1 A;  1JWU D;  3P75 A;  3ULL A;  5GAG C;  1J5E L;  1EIH A;  1E0B A;  1EWC A;  4IFD H;  3KLS X;  3AFP A;  4UHV A;  5CBE E;  4DV4 L;  1BBW A;  2ZJQ A;  4JG2 A;  1XJV A;  3HKZ E;  3TDQ A;  3HOV H;  2KCT A;  3L0O A;  4LFB Q;  3VDY A;  3HOV B;  2WII B;  5EJW A;  2K32 A;  3CHB D;  5T1I A;  1XPO A;  5EKI A;  5CYU A;  2B2U A;  4NXM L;  1HNX L;  1N36 Q;  4IN3 A;  1VMC A;  2XRQ D;  1B9M A;  1Z6H A;  4HJ5 A;  1YHA A;  4A3D G;  1KL9 A;  1BVS A;  4F87 A;  2LXK A;  4P75 A;  4CJ2 C;  1LUZ A;  4P73 A;  4JI6 Q;  1HXY D;  2G9D A;  4A3J H;  1TT2 A;  1LT6 D;  3OWF A;  3LNN A;  4IAL A;  4DV1 Q;  4A3J B;  5AJ3 Q;  1KD1 C;  1SNM A;  4H02 A;  2Z4I A;  1AW7 A;  3J81 L;  5CGK A;  4FF4 A;  3V05 A;  3DEP A;  3TQY A;  1SSO A;  2JEB I;  4IUR A;  4QUC A;  1EQR A;  2AWN A;  2CWP A;  5FJ8 H;  2QA4 A;  4MIU A;  3MXG A;  1JOQ A;  2EYF A;  5C3X A;  1C48 A;  2A74 C;  4C3H H;  2KEN A;  4KLK A;  4JI8 Q;  4JI4 Q;  4C3H B;  4KHV A;  5ELC A;  5ELE A;  1Y1V H;  3D31 A;  4LF5 Q;  1FR3 A;  2EJG C;  1U4M A;  1ZYR D;  3HRZ C;  1FNU A;  2EIF A;  5FLX L;  1I94 Q;  1Y1V B;  3HS0 C;  2RKS A;  1SE4 A;  3S14 H;  2KA7 A;  1QJO A;  1DXM A;  1EQV A;  3M7N A;  4TKO B;  3S14 B;  1A2T A;  1A3U A;  2BDO A;  4U67 3;  2PNH A;  2K52 A;  3EBE A;  3JC6 6;  2XNA C;  2Y0S G;  5IT9 E;  3CPF A;  4L6T B;  5BN4 A;  2OQK A;  1D1K A;  3MVV A;  3HOX G;  2NUC A;  2NN6 I;  1C8C A;  5M3F H;  1TS4 A;  4A3K G;  2F0W A;  1TWA B;  2RDF A;  2K01 A;  3SXH A;  5BN3 A;  5FLM H;  4B3T L;  5M3F B;  1L1O B;  2Z4H A;  1NCV A;  1VQ5 A;  3TN2 A;  5EPK A;  1GUW A;  4FXK C;  4G7H C;  3M4Q A;  1PH9 A;  2VW9 A;  5C4Z A;  1KAB A;  4HED A;  4R9W A;  5LL6 S;  2EJF C;  2D62 A;  1LYL A;  1IBM Q;  5JEA G;  4JI0 L;  2NVQ H;  4DV5 L;  4DV7 Q;  4JYA L;  4AH6 A;  2MPM A;  1CHQ D;  1PTO C;  5IGF A;  5M9O A;  1Q7Y C;  1VQN A;  2NVQ B;  4GN4 B;  1QVC A;  2F0D A;  2PMZ B;  1VDZ A;  2UXB L;  1STA A;  5CV5 A;  2A6E C;  5IGD A;  4HTH A;  4FXD A;  4HJ7 A;  4TVA B;  1ZXT A;  3OMG A;  2HQL A;  1K8M A;  1GUN A;  4LAA A;  4WJ3 M;  2ES2 A;  1UNS A;  4GZY C;  4LJZ C;  5D3I B;  3SDZ A;  1PFB A;  1A6X A;  1EYD A;  2ZJR A;  3JAM c;  1ROD A;  1D5X C;  1LTL A;  2GVA A;  3CC4 A;  1OXT A;  4L5Q A;  2VUM G;  2VS1 A;  3BS1 A;  3EVQ A;  5JJL A;  5JJZ A;  2X6G A;  3CXC A;  2BH2 A;  2Q2I A;  1KHI A;  1LTR D;  1AEX A;  2NB0 A;  4L5T A;  5IYD H;  1VQ4 A;  2YU9 H;  2ZXP A;  2HCC A;  1TWC H;  5I6Y A;  2YU9 B;  3C1F A;  4U68 A;  2YV5 A;  1N33 Q;  4BY7 G;  1VQ6 A;  3VYR A;  2WAQ E;  1B70 B;  3EQL C;  4BWG B;  1CT1 D;  4QMG A;  3URY A;  1HNW Q;  3OMC A;  3TRZ A;  5C5M A;  4LFC Q;  1TWH H;  3GP7 A;  1BKB A;  2XWB B;  3D4D A;  4L8J A;  3A7A B;  1TWH B;  4JI7 L;  2TMP A;  5EPJ A;  4IO9 A;  1WTR A;  3PV0 A;  1XMO L;  1PRT C;  2RQX A;  1TS2 A;  3FMC A;  2B2W A;  3FP9 A;  4RHR A;  2K6A A;  2MJ8 A;  2K04 A;  2HHH L;  3P1H A;  2N49 A;  1EEF D;  3MXN B;  4POF A;  4A3D H;  1SE3 A;  2KQ3 A;  1PRT F;  4A3D B;  1U0L A;  1J9O A;  2I5M X;  1F77 A;  3CP0 A;  3NWT A;  1ESR A;  2E2I H;  4JI2 L;  1EY5 A;  2WFW A;  1DOL A;  2K50 A;  2E2I B;  4BA1 I;  4KY6 A;  4OL7 A;  3NBH B;  2EY1 A;  2VL6 A;  4DN4 M;  1HRJ A;  1N32 L;  3K7A H;  1RL2 A;  1VQG A;  4GLV B;  4GKJ L;  1JT8 A;  2IW3 A;  3K7A B;  4A3E G;  2Q2U A;  4GOP C;  1SE8 A;  2VQE L;  4H0L C;  3R2I A;  4RGM A;  1OXV A;  1EZ8 A;  1LAC A;  2M2L A;  4X64 L;  4JOI C;  3H3V C;  4XTC S;  1J8I A;  4WOR A;  2E74 C;  2IJ0 A;  3VR4 A;  1YJ9 A;  1ONL A;  3SK8 A;  5IWA Q;  5JAV A;  4AQY L;  2A6H D;  4QUF A;  5CR3 A;  3HOY G;  2KEC A;  3M4O H;  2DJG C;  2Q8R E;  2Y0S B;  4G4K A;  3AEV A;  4DGZ A;  3LWE A;  5I4D A;  1Q46 A;  3M4O B;  1I4Q A;  1R4P B;  4R8N A;  1I50 H;  3E9H A;  1LTA D;  4HID A;  2JE6 I;  1TR5 A;  1I50 B;  4ME3 A;  2C35 B;  5I2Y A;  1EY8 A;  4R4Q A;  4JI5 L;  3TP8 A;  3T53 B;  4R4I A;  1SYF A;  1CQV A;  1B3Q A;  2JA9 A;  2KEE A;  4LK1 C;  1QUQ B;  1QNK A;  1X3E A;  1XNQ L;  4DR4 Q;  3I55 A;  2WB1 G;  4BA2 I;  3IFT A;  3CCU A;  4HIO A;  1L2F A;  1FJG L;  5JEA H;  1GD7 A;  3QJY A;  2ID0 A;  1CHP D;  1F9R A;  4CJ0 B;  1ZYR C;  3W1B A;  4IJL A;  4BY1 G;  3MHB A;  2D5D A;  1AZQ A;  1PYW D;  4K8I A;  1EWI A;  4JW0 A;  3BJU A;  2DNE A;  4N8F A;  1DZ1 A;  2RF4 A;  1JE4 A;  1V1P A;  2P5Z X;  4A75 A;  1F9Q A;  4FP5 D;  4ME5 A;  3VR3 A;  1LO5 D;  1YIT A;  4Z9C B;  3QWN A;  4ABN A;  3C3L A;  3KJO A;  4G7O C;  1ILP A;  4XQJ A;  4TRD A;  4QY7 A;  3D4R A;  3STB C;  5LMU L;  5G3L D;  3VYT A;  1I4H A;  4KK7 A;  2F1M A;  1I6H H;  5IYC G;  4LF8 Q;  2VUM H;  1TWF B;  4DV0 L;  1I6H B;  2VUM B;  2R92 G;  3OIP A;  4C3J G;  3J7A 5;  2XTI A;  4XDX A;  2F4I A;  1U9R A;  1NAP A;  4YY3 Q;  2EY6 A;  3K57 A;  4IUN A;  3PO3 G;  3G7L A;  3IRB A;  5F2D A;  1Q82 C;  1HJP A;  2F0N A;  1UE7 A;  1QCB D;  4LF4 L;  1TXY A;  4YIJ A;  3SVM A;  1ASY A;  5C0X G;  3H09 A;  3PUY A;  3OTO Q;  4A4I A;  4K14 A;  2LY7 A;  3E0E A;  3VA7 A;  4DAP A;  3I4N G;  1W3S A;  4DV3 L;  1TY0 A;  2N3S A;  3F8T A;  3TRE A;  5IGE A;  3NBI A;  3NE5 B;  4RA8 A;  2K03 A;  5ELN A;  1GUT A;  1SAP A;  1CSQ A;  2EPB A;  1DOM A;  1Y1W G;  3HOU G;  2O2L D;  4P74 A;  3QOL A;  4ULL A;  1V9P A;  2IHF A;  4LF9 Q;  1BUV T;  1IKM A;  1XNR L;  4B9X A;  2JA5 H;  3LGJ A;  5EKL A;  2L1B A;  2JA5 B;  2IX3 A;  3OOC A;  3NEN A;  5FK9 C;  2R7Z H;  4RGN A;  5IGG A;  2JN4 A;  2L5T A;  4NXN L;  1IKL A;  1TII D;  3W1G A;  2EY2 A;  1QZG A;  2R7Z B;  3PCO B;  2B2W C;  3ERO A;  1TS5 A;  1JJ2 A;  4KI0 A;  4MHE A;  4JC0 A;  1F9S A;  2Q8T A;  1N9W A;  2KOL A;  3Q6S A;  3MEF A;  4A3M G;  3T1H Q;  4AYB G;  3A55 A;  4X62 Q;  3I8Z A;  2EYO A;  3I4M H;  3U4V A;  1CA6 A;  3U50 C;  3QO2 A;  4PQX A;  2E76 C;  3I4M B;  2A5H A;  4OXP A;  4X3K A;  3CME A;  1EU3 A;  4S3S A;  1SJE D;  4JI3 Q;  2L15 A;  3AYH B;  3PO2 H;  2ZJP A;  1SNC A;  1STN A;  4PZ6 A;  2VNU D;  3PO2 B;  4K2K A;  3E9I A;  4RHS A;  1HUM A;  2KJX A;  1EOT A;  3SHL A;  5I9O A;  3L2P A;  1YI2 A;  4PMB A;  1PH7 A;  4K0K L;  4GLX A;  1SJH D;  1STG A;  4XXE A;  3G4S A;  2UXC L;  1CKN A;  4I65 A;  3NQT A;  1CK1 A;  3HOY H;  4H7B A;  4JK1 C;  3S2D H;  1ENC A;  4DUY Q;  4ZRZ A;  1WTV A;  1SEB D;  4HJ8 A;  3FPP A;  4OO1 I;  5H1S E;  5C5L A;  3S2D B;  4JVZ A;  1VQP A;  1TWG H;  1PFS A;  2UU9 L;  4IOA A;  4QQB X;  2B8F A;  1K8G A;  4K5X A;  2BH8 A;  1QG7 A;  1TWG B;  1ML0 D;  2ALY B;  2I5L X;  4CKE A;  1JB7 A;  3M9B A;  3TS0 A;  3GTL H;  3PUV A;  3NTI A;  1E2Z A;  5CV9 A;  1JE5 A;  3T51 B;  2AUJ D;  3GTL B;  3SR1 A;  4YWM A;  2MO0 A;  4DR7 L;  4IOC A;  1PFM A;  2QIL A;  4HMI A;  1V1Q A;  3S2H H;  3H0G H;  5CBA E;  2VXW A;  3DLL A;  1KQS A;  3S2H B;  3H0G B;  4RGO S;  1H9R A;  5IY0 A;  1LTS D;  1VQK A;  3Q23 A;  1WFQ A;  4G7Z C;  2E5L Q;  5C3E H;  3CPW A;  2MP1 A;  4A76 A;  4ZCK A;  5C3E B;  4DR6 L;  4A3G G;  5KGU A;  4X6A H;  1NMG A;  4C1N I;  3A54 A;  4FF2 A;  2A6H C;  3A56 A;  2PQA A;  5KNC A;  1K0S A;  2FHT A;  4GNX B;  3F1Z A;  2B29 A;  2F03 A;  1VF7 A;  3MAQ A;  4LF6 L;  4JBJ A;  4JI1 L;  3RLN A;  2A68 C;  1R4Q B;  1SBB B;  4DV6 Q;  1MHW C;  2XRS D;  4K6L A;  1OO9 B;  2R92 H;  4O1N A;  4DR3 L;  5J1Z A;  4JV5 L;  2R92 B;  2VQF L;  4LFA Q;  4ODG A;  4DV2 L;  1SRU A;  5ISR A;  4HSV A;  3U9S A;  2HQE A;  3PO3 H;  1HPC A;  2ZXO A;  2EXD A;  4APV A;  4K5V A;  3PO3 B;  4V19 0;  5CC4 A;  4DA2 A;  5DM7 3;  5C0X H;  2ZT9 C;  2K14 A;  3BVM A;  3K0X A;  2K28 A;  4A3B H;  2KED A;  1KRS A;  5I6W A;  2KHJ A;  2CCZ A;  4A3B B;  5IT9 L;  1HNZ Q;  4DKA C;  4X3T A;  3QIA A;  2NTT A;  3FVQ A;  3M4Y A;  4R4T A;  2AKW B;  2F4V L;  5CV7 A;  3T1Y L;  1NNX A;  1ESF A;  3IL8 A;  4DR2 L;  2JK8 A;  4POG A;  1HA6 A;  4EQO A;  1KDA A;  1Y1W H;  3I73 A;  4FO2 A;  4LF7 L;  3SK6 A;  3J81 c;  1WOC A;  5EPL A;  5E3F A;  4Q0F A;  2ATW A;  1Y1W B;  5E7N A;  3HOZ H;  3HZX A;  2JSO A;  1KNA A;  1GXD C;  4OX9 L;  3HOZ B;  4LF5 L;  3RN2 A;  1HR0 L;  1EY0 A;  5E4X A;  1WI5 A;  1D8L A;  4ZKC B;  1IBL L;  2VZA A;  5C44 H;  3OHX C;  2OTJ A;  3E3X A;  3P7J A;  5IP7 G;  5C44 B;  2LMC B;  2F52 A;  5FLX c;  3D6C A;  2K7V A;  2NTS A;  2WKC A;  1HTP A;  4DR5 Q;  1S5D D;  2F0Q A;  4EQP A;  3S16 H;  1EFW A;  3H15 A;  3S16 B;  4UP7 A;  1VQA A;  1MKH A;  3HG9 A;  5FKA C;  4B3R Q;  1MSG A;  1UEA B;  1BCP F;  1PZI D;  4KD4 A;  2B2Y A;  3KLS A;  2UUA Q;  4HMJ A;  3D8G A;  5CV8 A;  2UUB L;  2PI2 A;  3KF8 A;  5KRU A;  2K5W A;  3T4A C;  3OPO A;  1VQL A;  2WP8 J;  1IL2 A;  1BCP B;  3H3V I;  4C3I G;  5KNB A;  1N34 L;  2EYM A;  4IUQ A;  1IBM L;  4KMU C;  1B44 D;  2ZM6 Q;  3CCJ A;  2F3V A;  3HKZ G;  5A2Q E;  3TS2 A;  1SNO A;  2EQS A;  1VQJ A;  2EJM A;  1Y14 B;  3X3N A;  5IYB H;  4DAY A;  1G29 1;  5KIX A;  1PMR A;  1A2U A;  3L3O C;  4GOP A;  3Q24 A;  3MZ5 A;  2AMC B;  2I0Q A;  5LMN L;  1H9S A;  2PW7 A;  5CV4 A;  3M85 A;  4JOI A;  3K59 A;  2MFI A;  2Z6K C;  3ND9 A;  2PI2 E;  1XTD A;  2X6L A;  3GTG H;  5KND A;  3AFQ A;  5JVH 3;  3PIP A;  1EY7 A;  2DJF C;  3GTG B;  4CDE C;  1Q3L A;  1C4Q A;  1HZA A;  3PUZ A;  5HY6 A;  1ICF B;  2O4X A;  3J7A V;  2RSO A;  3K58 A;  1QOH A;  2Y0S E;  1LT5 D;  3V96 A;  5K5P A;  3FHW A;  4ID6 A;  4LUV A;  4KKU A;  3KDF A;  1IYJ B;  1S3O A;  2EYJ A;  2LSS A;  1PXU A;  1SMY D;  4A3G H;  3DWP A;  4B3S L;  5BR8 Q;  1EL0 A;  2I46 A;  4A3G B;  1SDF A;  1BBX C;  1DJR D;  2G9H D;  4I7A A;  3UDF A;  4K5W A;  3WOE A;  1J5E Q;  1X32 A;  1PV4 A;  3H91 A;  2Q8I B;  1D1I A;  4HIM A;  4K8J A;  3NEM A;  4A3F G;  3A8J E;  1WTP A;  3A0J A;  4DV4 Q;  1NUC A;  3ND8 A;  4RCO A;  3U4Z A;  4A3L G;  3BDL A;  1B3A A;  1U4L A;  3OIQ A;  1ZEQ X;  4P2C B;  3NTK A;  1I4X A;  2NVT H;  1XMQ L;  4KHP L;  2R93 G;  4R4C A;  4PG3 A;  2NVT B;  2F0T A;  3MXP A;  1L0Y B;  5JPN C;  2NVY H;  3HGB A;  3J80 i;  1C7Y A;  4NXM Q;  1HNX Q;  1EOV A;  2ZTC A;  2NVY B;  3HFZ B;  3DWQ A;  1KLU D;  1YVC A;  2CQA A;  5KEE A;  2DY8 A;  1FYC A;  2F0H A;  1XYI A;  5J22 A;  2EXZ A;  4B9W A;  3C46 A;  4TQU S;  1DCZ A;  4CKB A;  3CCM A;  1W6K A;  3AU7 A;  2E75 C;  3D3R A;  1NR2 A;  2UUC L;  1B1Z A;  5M3M G;  1V8Q A;  1UUP A;  1QWY A;  4UPA A;  1HUN A;  4QGU A;  1M90 C;  2CHB D;  1EEI D;  1PH2 A;  4IPG A;  3QOJ A;  1X9N A;  5IP7 H;  1K3B C;  2PW5 A;  1PTO H;  3KLW A;  3RR5 A;  3Q0A A;  1TWC B;  2F0M A;  3NEL A;  1PTO B;  4MN3 A;  3CRK C;  4DUZ L;  1BDO A;  2F3W A;  4IFD J;  1K73 C;  1VQI A;  2HD3 A;  4LUZ A;  1S5E D;  1VQF A;  2NBF A;  1RHP A;  5GAD C;  2KHS A;  2N55 A;  1D5Z C;  1BR9 A; 
#chains in the Genus database with same CATH homology
 1MGS A;  1ENF A;  1L0X B;  2LFN A;  2NN6 G;  4IUU A;  1GOZ A;  4FVM A;  1DM0 B;  5FO7 B;  4J6H A;  2KVM A;  4NKL A;  3P20 A;  1PDQ A;  1VMP A;  2AQ1 B;  4IQZ A;  3IAY A;  2WAC A;  2B2Y C;  3GTM B;  2L12 A;  1LTI D;  3DUZ A;  3HKZ B;  2D2C C;  1CI3 M;  3ZYY X;  2IL8 A;  2OT2 A;  5C4H A;  2EZV A;  4B08 A;  1IL8 A;  1H9K A;  2PZT A;  3KK7 A;  3MWY W;  3VYU A;  1D6E C;  3NXW A;  1TY2 A;  1ZKO A;  3PUX A;  3WDN A;  3TZD A;  2M9V A;  1CFM A;  4KY5 A;  2QCP X;  2L0C A;  2SNM A;  2XIW A;  2XSC A;  2PNR C;  4HAE A;  2IT1 A;  4DK1 A;  4F7X A;  3HOX B;  3E0J A;  3PIP 3;  2L9H A;  4IUP A;  4KHZ A;  4A3K B;  2IX1 A;  3OWE B;  1V43 A;  1XX8 A;  4A3F B;  3N6R A;  3BDO A;  4C2M B;  1KDB A;  3S1Q B;  1S5F D;  2B2T C;  1WTO A;  4FNF A;  3QG1 A;  1BOS A;  5EKK A;  1JIC A;  5D14 A;  4CGY B;  5FO9 B;  4OIK A;  4HSP A;  2J7Z A;  3SK5 A;  3EJI A;  1SMY C;  3IFD A;  4JBW A;  2O5I C;  4IFD I;  3GTP B;  4DNT B;  1RTN A;  2BOS A;  1RKN A;  4ZKB B;  5IGB A;  2TSS A;  4N9P A;  4L63 B;  5M3M B;  1I6V C;  2AWO A;  1HFN A;  5IOD A;  1I4G A;  1BCP D;  4ZAI A;  3EFX D;  3NQI A;  1MI2 A;  4ZQ3 A;  4H13 C;  2K33 A;  4DNR B;  3H94 A;  3KBG A;  4O42 A;  2EY5 A;  5HGT A;  4I7Z C;  4KN4 C;  2EYH A;  4BY7 B;  2O5J C;  2Z1C A;  2EDG A;  4PNY A;  2R61 A;  5D3D A;  3T13 A;  1RCV D;  1UAP A;  2NN6 H;  3DWA A;  1II3 A;  3JAM E;  3TSS A;  1G6Z A;  3TP5 A;  1T5X D;  1KNE A;  2XN9 C;  1KLG D;  4TSS A;  1M4V A;  4RAU C;  2WV6 D;  2PQE A;  2A73 B;  3GV6 A;  3W2D A;  3T56 B;  2QF7 A;  4C1N K;  2OEO A;  5T1G A;  1STY A;  2JEA I;  1HFG A;  2EYP A;  2K05 A;  1K83 B;  2MHV A;  1RD9 D;  1PZJ D;  3MFG A;  3HEJ A;  3M3Y B;  1RDP D;  2C9O A;  2F0P A;  2K5Q A;  2HCI A;  4EGV A;  1SNQ A;  4DF7 A;  4A3E B;  2BE5 D;  2GA4 B;  2EVB A;  1TVX A;  3FRP B;  2F0L A;  3X3M A;  3MA2 B;  2HUG A;  1EY9 A;  1JR0 D;  3I91 A;  1F2Z A;  2E2H B;  1B9N A;  1LT4 D;  1B50 A;  1ICW A;  3Q22 A;  4FYD A;  2AQ3 B;  3CKI B;  4RWS C;  3HOY B;  2E2D C;  2RDH A;  4FF1 A;  1X3Q A;  4DFA A;  3KUP A;  1M8A A;  2NWG A;  1ILQ A;  1O7Z A;  1D2B A;  4G57 A;  4NMZ A;  2EYL A;  4RGT A;  3U9O A;  1EY4 A;  4A93 B;  3G6J B;  2WB1 B;  2OXP A;  1E2V A;  1EQT A;  3TP7 A;  4PV1 C;  1MSH A;  3HOW B;  5I2X A;  4NP5 A;  5A2Q L;  3AB9 A;  4RFB A;  4BY1 B;  4NW2 A;  1GJX A;  3I90 A;  3C1E A;  4WFN 3;  3ITP A;  5KYI A;  1PTO D;  3S17 B;  1RTO A;  4J8Q A;  2FMM A;  2PO4 A;  2J0T D;  1LAB A;  2SOB A;  5TSS A;  2B63 B;  2LKV A;  4PMC A;  2PPB C;  3HP3 A;  4QF4 A;  2LS0 1;  4C3J B;  1XWE A;  2CW0 D;  4BBS B;  3J80 E;  2N88 A;  2RBM A;  5ELB A;  2JA8 B;  1YNN D;  1BQQ T;  1TKW B;  1V1O A;  1W6J A;  2FJ2 A;  3GTJ B;  2F0V A;  1MBY A;  2R6G A;  5DNF A;  3I4N B;  4OO1 G;  5HUR A;  2KCC A;  2MUY A;  5ELF A;  4DU9 A;  3R8B A;  2QDB A;  2IPK D;  5C6A A;  3PIO 3;  3HOU B;  3DXJ C;  3MXN A;  3E5S A;  1CQF A;  3WOF A;  2YYZ A;  5DM6 3;  1V1P B;  5JVG 3;  2JA7 B;  4ZK9 B;  1AN8 A;  4QIW B;  1JCK B;  4WRD A;  1SYE A;  3RZD B;  2PZW A;  3KLR A;  1BCP C;  4CBV A;  4J1M A;  1CM9 A;  3NBH A;  4A3M B;  3LX0 A;  1SXT A;  4AYB B;  1SYD A;  3L9A X;  1JB3 A;  4Y7N B;  3GO5 A;  4DXF A;  3PMF A;  1O80 A;  4PMW A;  4KTA A;  2F0U A;  4R8I A;  2DNC A;  1GHJ A;  5E4W C;  1B53 A;  1OXU A;  3A8I E;  3BVZ A;  2ZXR A;  3BG3 A;  3K6O A;  1DON A;  3D4W A;  1H9M A;  3BYT B;  1EZ6 A;  1Y69 U;  4XT1 B;  3AMU A;  5FOB B;  2B39 A;  3OW7 A;  1IYU A;  2MGS A;  4HR7 B;  1AFP A;  1OXX K;  1EWH A;  1QB5 D;  2E2J B;  1DOK A;  1E2W A;  3F2U A;  2RDG A;  5EBD A;  1KTK A;  3PUW A;  4H44 C;  1CZG A;  3R3O A;  2ICE C;  2XVS A;  3RD4 A;  3NHH A;  5J39 A;  4M1U B;  4F88 A;  1PZK D;  4M8A A;  2HDM A;  3VR5 A;  5IIF A;  1O78 A;  1G8Z D;  3FKI B;  5NUC A;  2BE5 C;  1T5E A;  2F0F A;  1S5C D;  1S4Z A;  2X69 A;  3CQZ B;  4ZUI A;  2SNS A;  1WTW A;  1G91 A;  2EE1 A;  5BN5 A;  2I07 B;  1SNP A;  1VF5 C;  2B2T A;  3A7L A;  1GUO A;  1SE2 A;  3S9W A;  3NTH A;  1FNW A;  3GQB A;  1IW7 D;  1HCZ A;  2BA0 A;  3FEW X;  4ZUJ A;  1EU4 A;  1GUS A;  4Q5V A;  1JOO A;  1DYQ A;  2RVL A;  1YNJ D;  4KY7 A;  5C0X J;  4OO1 H;  4KKT A;  3A8K E;  1GHK A;  5LL6 X;  5K36 G;  3QB3 A;  2KUM A;  5KYL A;  4KJO A;  2PYK A;  3K0Y A;  4XQQ A;  1ENA A;  2SEB D;  2L4N A;  1SFO B;  1PTO F;  4IUV A;  2DN8 A;  1AZP A;  1JC7 A;  4ZYS A;  4OHJ A;  4C56 C;  2CW0 C;  4CHT B;  1A3V A;  5D65 A;  3I70 A;  1HQM C;  1HQR D;  5AFW A;  3BZD B;  1YNN C;  3GD7 A;  1SND A;  3O13 A;  1LTB D;  5EBC A;  2HDL A;  4XYQ A;  3DMU A;  1Y8N B;  3RLF A;  1STB A;  1ET9 A;  3S1N B;  3GV3 A;  4XT3 B;  4FF3 A;  4F8M A;  2K5D A;  3J81 E;  4EVO A;  3VYS A;  4C3I B;  5C3W A;  2RSN A;  1CTM A;  2FMC A;  2JP1 A;  1HTL D;  5FLX E;  3MXU A;  3ERQ A;  3RMH A;  1MD2 D;  4DAV A;  2IX0 A;  3D6W A;  2B2U C;  3ONA B;  1EYA A;  1R9T B;  3T16 A;  4XQN A;  4UAI A;  1AP0 A;  2K1B A;  3JAM L;  3K5L A;  3OSO A;  3FPU B;  3V2T A;  1CZW A;  1PRT B;  1HHV A;  2VB2 X;  4RH6 A;  3NP8 A;  1LTT D;  4X3U A;  3K5M A;  4WJW A;  1NR4 A;  4NDX A;  3I3C A;  5COY A;  1DD2 A;  5C4J B;  1XTC D;  2JA6 B;  5FO8 B;  4QB4 A;  2OF1 A;  1Z47 A;  3DEO A;  4V0B A;  4UDU C;  1GUG A;  5M5W B;  1I4R A;  5C0X I;  1LTG D;  2M00 A;  1O7L A;  1IHZ A;  2NYZ D;  2WIN B;  1A15 A;  2L55 A;  2A68 D;  1WTX A;  4E6I A;  1H9S B;  1KDC A;  2F0I A;  1CA5 A;  3TZU A;  4HN7 A;  1BF4 A;  5COR A;  2R93 B;  1QNU A;  2BCO A;  3S15 B;  2QEJ C;  5A35 A;  1LV9 A;  3GTQ B;  4XYO A;  3CU7 A;  3N52 A;  4DXG A;  5K36 H;  1Y8O B;  3K5O A;  1JWM D;  2KCN A;  2A69 D;  3NPP A;  5JPM C;  1Z7T A;  3C2P A;  3RUZ A;  4IUT A;  4KKS A;  4QCL A;  3J7A F;  1XXG A;  1Q90 A;  3VA5 A;  1WD1 A;  2BDN A;  1IW7 C;  1Q1E A;  2H4O A;  1OXS C;  4X3S A;  3DHQ A;  2CVR A;  2H1E A;  3KBX A;  3W3A A;  3BYY B;  3SE0 A;  3CRL C;  1PFN A;  1NSN S;  1STH A;  1JWS D;  1YNJ C;  1RJT A;  3RZO B;  1F9P A;  4BS9 A;  2B2V A;  1A3T A;  4LMQ D;  4FXG C;  2F0J A;  5M5Y B;  3J80 L;  1Q12 A;  4ZLT F;  2DY7 A;  3M7G A;  3S1R B;  3IKJ A;  5DAU A;  1ET6 A;  2WAQ B;  1PLF A;  2IWH A;  5E1F A;  1O7Y A;  1FNV A;  1KAA A;  2AUK A;  3SK4 A;  1Y8P B;  4IZ8 A;  1I4P A;  1F2M A;  2WKD A;  5JOB A;  2FFK B;  4ILW A;  3MFY A;  1WCM B;  3R2T A;  2VB3 X;  2FIN B;  1BO0 A;  4RKL A;  4KN7 C;  3I72 A;  1STE A;  2ENB A;  4IFD G;  1WD0 A;  3VR2 A;  1F2L A;  3SEB A;  1FGB D;  1HA5 A;  5C4X B;  3E6Z X;  2JXM B;  4N9T A;  2QKI C;  2F0O A;  1VCI A;  1EIG A;  2NVX B;  1SYC A;  1I3Q B;  1TU2 B;  5ELD A;  1H9J A;  1EFI D;  2PZU A;  4CJ1 B;  3J7Y W;  3H6M A;  5LHY 1;  1WTQ A;  4XIG S;  1RF2 D;  1IYV A;  2R3Z A;  4A3I B;  2F0K A;  3NK9 A;  5IGC A;  3MTS A;  5CV6 A;  2D9U A;  1G2S A;  1SYB A;  1JOR A;  5JEA J;  4KV6 A;  3NSW A;  1U4P A;  2ICI A;  4C3H G;  2AQ2 B;  3LWU A;  3L7Z C;  4RKB A;  2SDF A;  4KD3 A;  1TQO A;  1F2Y A;  1JOK A;  3UI2 A;  1EY6 A;  2A6E D;  4HCE A;  4EQN A;  3K5N A;  4K6D A;  1X3P A;  1D5M C;  2F0S A;  3GTK B;  5EGT A;  3FDT A;  2F0E A;  1TS3 A;  2PCF B;  1BXT A;  5DEH A;  3R93 A;  1FD7 D;  2JYO A;  3NUC A;  5M5X B;  3TBI B;  1B2T A;  1S5B D;  2V4D A;  1QIL A;  2EOT A;  4DK0 A;  3GTO B;  3S1M B;  1Q8I A;  4OGQ C;  4OIJ A;  3BDC A;  3EA6 A;  3I4L A;  3NWS A;  1B4O A;  2B8G A;  1K8O A;  1U4R A;  1LT3 D;  1BNZ A;  4HCS A;  4BBR B;  1LLR D;  3BVG A;  1Q1B A;  2A69 C;  2L11 A;  1JQY D;  4RCN A;  3MEH A;  1PRT D;  5IOC A;  4KJN A;  3MC0 B;  3TME A;  1WVL A;  4K2L A;  1QE6 A;  2B2V C;  1G2T A;  2J4X A;  2F0G A;  3TP6 A;  4CKC A;  1SYG A;  5I9P A;  2XWJ B;  5EQ0 A;  5CMD A;  3DM1 A;  3VR6 A;  2NZ1 D;  2Z8L A;  1EYC A;  2RA4 A;  5G3L F;  2C5C A;  2BA1 A;  1JWU D;  3P75 A;  1EIH A;  1E0B A;  1EWC A;  4IFD H;  3KLS X;  5CBE E;  3TDQ A;  3HOV B;  2WII B;  5EJW A;  2K32 A;  3CHB D;  5T1I A;  5EKI A;  5CYU A;  2B2U A;  4IN3 A;  1VMC A;  2XRQ D;  1B9M A;  1Z6H A;  4F87 A;  4CJ2 C;  1HXY D;  2G9D A;  1TT2 A;  1LT6 D;  3OWF A;  3LNN A;  4IAL A;  4A3J B;  1SNM A;  2Z4I A;  1AW7 A;  3J81 L;  5CGK A;  4FF4 A;  3V05 A;  3DEP A;  1SSO A;  2JEB I;  4IUR A;  4QUC A;  2AWN A;  4MIU A;  3MXG A;  1JOQ A;  2EYF A;  5C3X A;  1C48 A;  2A74 C;  4C3H B;  4KHV A;  5ELC A;  5ELE A;  3D31 A;  1FR3 A;  2EJG C;  1U4M A;  1ZYR D;  3HRZ C;  1FNU A;  5FLX L;  1Y1V B;  3HS0 C;  2RKS A;  1SE4 A;  2KA7 A;  1QJO A;  1DXM A;  1EQV A;  3M7N A;  4TKO B;  3S14 B;  1A2T A;  1A3U A;  2BDO A;  4U67 3;  2XNA C;  5IT9 E;  4L6T B;  5BN4 A;  1D1K A;  3MVV A;  2NUC A;  2NN6 I;  1C8C A;  1TS4 A;  2F0W A;  1TWA B;  2RDF A;  2K01 A;  3SXH A;  5BN3 A;  5M3F B;  2Z4H A;  1NCV A;  3TN2 A;  5EPK A;  1GUW A;  4FXK C;  4G7H C;  5C4Z A;  1KAB A;  4HED A;  4R9W A;  5LL6 S;  2EJF C;  2D62 A;  5JEA G;  2MPM A;  1CHQ D;  1PTO C;  5IGF A;  5M9O A;  2NVQ B;  2F0D A;  2PMZ B;  1VDZ A;  1STA A;  5CV5 A;  2A6E C;  5IGD A;  4HTH A;  4FXD A;  1ZXT A;  3OMG A;  1K8M A;  1GUN A;  4LAA A;  1UNS A;  4GZY C;  4LJZ C;  5D3I B;  3SDZ A;  1PFB A;  1A6X A;  1EYD A;  1ROD A;  1D5X C;  1OXT A;  3BS1 A;  3EVQ A;  5JJZ A;  2X6G A;  1LTR D;  1AEX A;  2NB0 A;  2ZXP A;  2HCC A;  5I6Y A;  2YU9 B;  3C1F A;  4U68 A;  3VYR A;  3EQL C;  4BWG B;  1CT1 D;  4QMG A;  3URY A;  3OMC A;  5C5M A;  3GP7 A;  2XWB B;  3D4D A;  4L8J A;  3A7A B;  1TWH B;  2TMP A;  5EPJ A;  1WTR A;  3PV0 A;  1PRT C;  2RQX A;  1TS2 A;  3FMC A;  2B2W A;  4RHR A;  2K6A A;  2MJ8 A;  2K04 A;  3P1H A;  1EEF D;  1SE3 A;  2KQ3 A;  1PRT F;  4A3D B;  1J9O A;  1F77 A;  3NWT A;  1ESR A;  1EY5 A;  1DOL A;  2E2I B;  4BA1 I;  4KY6 A;  4OL7 A;  2EY1 A;  4DN4 M;  1HRJ A;  2IW3 A;  3K7A B;  4H0L C;  3R2I A;  4RGM A;  1OXV A;  1EZ8 A;  1LAC A;  2M2L A;  3H3V C;  4XTC S;  1J8I A;  4WOR A;  2E74 C;  2IJ0 A;  3VR4 A;  1ONL A;  3SK8 A;  5JAV A;  2A6H D;  4QUF A;  5CR3 A;  2KEC A;  2Q8R E;  2Y0S B;  4G4K A;  4DGZ A;  3LWE A;  5I4D A;  3M4O B;  1I4Q A;  1R4P B;  4R8N A;  1LTA D;  2JE6 I;  1TR5 A;  1I50 B;  5I2Y A;  1EY8 A;  3TP8 A;  3T53 B;  1SYF A;  1CQV A;  2KEE A;  4LK1 C;  1QNK A;  4BA2 I;  3IFT A;  5JEA H;  3QJY A;  2ID0 A;  1CHP D;  1F9R A;  4CJ0 B;  1ZYR C;  3MHB A;  2D5D A;  1AZQ A;  1PYW D;  4K8I A;  2DNE A;  1DZ1 A;  1JE4 A;  1V1P A;  1F9Q A;  4FP5 D;  4ME5 A;  3VR3 A;  1LO5 D;  4Z9C B;  3QWN A;  4ABN A;  3C3L A;  4G7O C;  1ILP A;  4XQJ A;  4TRD A;  3D4R A;  5G3L D;  3VYT A;  1I4H A;  4KK7 A;  2F1M A;  1TWF B;  1I6H B;  2VUM B;  3OIP A;  4C3J G;  4XDX A;  2F4I A;  1U9R A;  1NAP A;  2EY6 A;  3K57 A;  4IUN A;  3G7L A;  5F2D A;  2F0N A;  1QCB D;  4YIJ A;  3SVM A;  5C0X G;  3H09 A;  3PUY A;  4K14 A;  2LY7 A;  3VA7 A;  4DAP A;  1TY0 A;  5IGE A;  3NBI A;  3NE5 B;  4RA8 A;  2K03 A;  1GUT A;  1SAP A;  2EPB A;  1DOM A;  2O2L D;  4ULL A;  3QOL A;  1BUV T;  1IKM A;  4B9X A;  5EKL A;  2L1B A;  2JA5 B;  2IX3 A;  3OOC A;  5FK9 C;  4RGN A;  5IGG A;  2L5T A;  1IKL A;  1TII D;  2EY2 A;  2R7Z B;  2B2W C;  3ERO A;  1TS5 A;  4KI0 A;  4MHE A;  1F9S A;  2Q8T A;  2KOL A;  3Q6S A;  3A55 A;  3I8Z A;  2EYO A;  1CA6 A;  3QO2 A;  4PQX A;  2E76 C;  3I4M B;  2A5H A;  4X3K A;  1EU3 A;  4S3S A;  1SJE D;  1SNC A;  1STN A;  2VNU D;  3PO2 B;  4K2K A;  4RHS A;  1HUM A;  2KJX A;  1EOT A;  3SHL A;  5I9O A;  4PMB A;  1SJH D;  1STG A;  4XXE A;  4I65 A;  3NQT A;  1CK1 A;  4H7B A;  4JK1 C;  1ENC A;  4ZRZ A;  1WTV A;  1SEB D;  4OO1 I;  3FPP A;  5C5L A;  3S2D B;  2B8F A;  4K5X A;  1QG7 A;  1TWG B;  1ML0 D;  4CKE A;  3PUV A;  3NTI A;  1E2Z A;  5CV9 A;  3T51 B;  2AUJ D;  3GTL B;  3SR1 A;  1PFM A;  2QIL A;  4HMI A;  5CBA E;  2VXW A;  3S2H B;  3H0G B;  4RGO S;  1H9R A;  1LTS D;  3Q23 A;  4G7Z C;  2MP1 A;  5C3E B;  5KGU A;  4C1N I;  3A54 A;  4FF2 A;  2A6H C;  3A56 A;  5KNC A;  2FHT A;  2F03 A;  1VF7 A;  3MAQ A;  2A68 C;  1R4Q B;  1SBB B;  2XRS D;  4K6L A;  1OO9 B;  4O1N A;  5J1Z A;  2R92 B;  4ODG A;  5ISR A;  4HSV A;  3U9S A;  2HQE A;  1HPC A;  2ZXO A;  4K5V A;  3PO3 B;  4V19 0;  5CC4 A;  4DA2 A;  5DM7 3;  5C0X H;  2ZT9 C;  3BVM A;  2K28 A;  2KED A;  5I6W A;  4A3B B;  5IT9 L;  4X3T A;  3QIA A;  2NTT A;  3FVQ A;  3M4Y A;  5CV7 A;  1ESF A;  3IL8 A;  1HA6 A;  4EQO A;  1KDA A;  3I73 A;  4FO2 A;  3SK6 A;  5EPL A;  5E3F A;  4Q0F A;  1Y1W B;  3HZX A;  2JSO A;  1KNA A;  1GXD C;  3HOZ B;  1EY0 A;  5E4X A;  4ZKC B;  3OHX C;  3P7J A;  5C44 B;  2LMC B;  3D6C A;  2K7V A;  2NTS A;  2WKC A;  1HTP A;  1S5D D;  2F0Q A;  4EQP A;  3S16 B;  3HG9 A;  5FKA C;  1MSG A;  1UEA B;  1BCP F;  1PZI D;  4KD4 A;  2B2Y A;  3KLS A;  4HMJ A;  3D8G A;  5CV8 A;  3KF8 A;  5KRU A;  2K5W A;  3T4A C;  3OPO A;  2WP8 J;  1BCP B;  4C3I G;  5KNB A;  2EYM A;  4IUQ A;  4KMU C;  1B44 D;  2F3V A;  5A2Q E;  1SNO A;  2EJM A;  3X3N A;  4DAY A;  1G29 1;  5KIX A;  1PMR A;  1A2U A;  3L3O C;  3Q24 A;  3MZ5 A;  1H9S A;  2PW7 A;  5CV4 A;  3M85 A;  3K59 A;  3ND9 A;  2X6L A;  5KND A;  5JVH 3;  1EY7 A;  3GTG B;  1Q3L A;  1C4Q A;  3PUZ A;  2O4X A;  3J7A V;  2RSO A;  3K58 A;  1QOH A;  1LT5 D;  3V96 A;  5K5P A;  4ID6 A;  4KKU A;  2EYJ A;  1PXU A;  1SMY D;  3DWP A;  1EL0 A;  2I46 A;  4A3G B;  1SDF A;  1BBX C;  1DJR D;  2G9H D;  4K5W A;  3WOE A;  1X32 A;  3H91 A;  2Q8I B;  1D1I A;  4K8J A;  1WTP A;  3A8J E;  1NUC A;  3ND8 A;  4RCO A;  3BDL A;  1B3A A;  1U4L A;  3OIQ A;  1ZEQ X;  4P2C B;  3NTK A;  1I4X A;  2NVT B;  2F0T A;  3MXP A;  5JPN C;  1L0Y B;  3HGB A;  2NVY B;  3DWQ A;  1KLU D;  2CQA A;  5KEE A;  2DY8 A;  1FYC A;  2F0H A;  1XYI A;  5J22 A;  2EXZ A;  4B9W A;  3C46 A;  4TQU S;  1DCZ A;  4CKB A;  1W6K A;  3AU7 A;  2E75 C;  3D3R A;  1NR2 A;  1B1Z A;  1V8Q A;  1UUP A;  1QWY A;  1HUN A;  2CHB D;  1EEI D;  3QOJ A;  2PW5 A;  1PTO H;  3Q0A A;  1TWC B;  2F0M A;  1PTO B;  4MN3 A;  3CRK C;  1BDO A;  2F3W A;  4IFD J;  1S5E D;  2NBF A;  1RHP A;  2KHS A;  2N55 A;  1D5Z C;  1BR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...