3CKKA

Crystal structure of human methyltransferase-like protein 1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
229
structure length
196
Chain Sequence
YPVKPEEMDWSELYPEFAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
publication title Crystal structure of human methyltransferase-like protein 1.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 196
sequence length 229
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ckkA01
1X19A 4KWCA 5DT2A 4PYQA 5CVVA 4E2XA 3HCDA 3FUWA 2UYCA 1RJDA 3G89A 1T43A 5H02A 4E70A 2HMYB 2BR5A 3PT9A 5DXAA 3BWBA 3TLJA 4PNEA 3UZUA 5E9WA 5EPEA 3FZGA 4M36A 3GRRA 5FQNA 3EVEA 2YVLA 3MB5A 5FWAA 2NYUA 3A4TA 1X1CA 2AZTA 3FPHA 5IH3A 1JTFA 5CUQA 3KHKA 1KPHA 3A27A 1QANA 4ZTBA 1FP2A 5LR6A 3GO4A 1UWVA 3Q87B 3SX0A 1O9GA 3EGVA 2PX2A 3KR0A 3AXTA 3QOXA 4IKPA 5EHIA 5EHGA 5GP1A 3SR4A 1EJ6A 4M7RA 4X1OA 3R9XB 3OFJA 1QAOA 2JG3A 4F85A 4XCXA 4CKEA 1L3CA 3T7SA 1QZZA 2KW5A 3MQ2A 4QPPA 1I4WA 4PYLA 3SMQA 3UWPA 3SSMA 2NP7A 1B42A 4C04A 4BP1A 2PWPA 2YXLA 3M70A 3SSOA 2ZTHA 1R74A 2AOTA 3A7DA 5EZSA 1RI5A 3DLIA 2GS9A 2ZBRA 1RI4A 2I9KA 2N47A 2YXEA 4RTNA 3BWMA 3I58A 3DP7A 3C6KA 3TKAA 3UJ6A 1G8SA 3CBGA 1F38A 2GLUA 4GF5A 1G55A 4R8SA 2VDWA 3ELUA 3G2MA 2ORED 2EX4A 4RVHA 1O54A 4DCGA 1IY9A 1R18A 5GM2A 1TW2A 1SKMA 3UJ7A 1KPGA 4YUWA 3FTCA 2BR3A 2ZULA 4GOMD 3LPMA 3HCCA 9MHTA 3OU2A 1N7IA 3TFWA 2PSSA 3MAGA 3TOSA 4A6EA 2PJDA 2OXTA 2FYTA 2VDUE 3CJTA 1PRYA 2P8JA 4C08A 4JXJA 5C0OE 5FA5A 4EVIA 4AZVA 3NWEA 1RJFA 2JJQA 4QVGA 3A26A 5EMKA 5K0FA 2EG5A 1JG2A 4X63A 4ER5A 4IV8A 1R8XA 3NJRA 4P7GA 7MHTA 3NVKI 2UYHA 3KQPA 1R6AA 3GGDA 2QRVA 4E32A 2H11A 1EIZA 5K03A 3LBYA 1QAQA 3I9FA 3EVGA 3E7PA 4GBED 4WXHA 3X0DA 4FSXA 5T6BA 1P1CA 2IH5A 1H1DA 3EVDA 5DRTA 2CKDA 2E5WA 3IEIA 5P8WA 4FR0A 3RODA 1QAMA 4Z2YA 4PWYA 2HWKA 1I9GA 4YV1A 5BW4A 4BP3A 4HSGA 3DTNA 4X60A 1FBNA 3M6XA 2XVAA 5HIKA 1JSXA 4CKBA 4O29A 1WZNA 2UYQA 3SXJA 2ZCJA 4WVLA 5M5BA 3HA3A 1JSZA 3OU6A 2O06A 1YFJA 1WXXA 2G70A 5FUBA 5KS2A 5B1SA 5GWXA 4R6WA 1EJ0A 1AQJA 3OU7A 3TM4A 2FCAA 2IDKA 3DH0A 4F84A 4BY9E 2OB1A 1BKYA 3GCZA 3DMGA 3KPUA 1KP9A 3M6VA 4GOLD 3HVJA 3TMAA 2AR0A 5DM4A 2AN5A 3OPNA 4R8RA 1L9KA 4A6DA 4EK9A 2P3LA 2GA9A 5GIOE 3OFKA 5C1IA 5GIPE 5DSTA 2PT9A 2FK8A 4PIPA 2AVDA 5D1HA 2H1RA 1D2GA 5HIIA 1N7JA 4OA5A 1P91A 4YUZA 3KU1A 5CVDA 4RSRA 4RX1A 3TPZA 3U81A 2PGXA 1I1NA 2AOUA 3DUWA 2Z6UA 3F4KA 3DXZA 2OZVA 3CCFA 4KW7A 1SQFA 4E2WA 1NW3A 3PVCA 3KQTA 3EPPA 4FT4A 2ADMA 2ZW9A 2QY6A 4HC4A 5KVAA 1WY7A 2ONZA 2P41A 3SM3A 3MGGA 2FHPA 5EEHA 2OY0A 3TQSA 2DULA 5F2NA 2FK7A 2AOXA 3DR5A 5CD1A 2B25A 5FTWA 2XBMA 2OO3A 3O31A 2O0LA 3FUUA 3KPWA 4L7VA 5E1OA 3SGLA 3UJDA 3E05A 3FPEA 2ZVJA 3NTVA 1N2XA 4MQ4A 1XDSA 3G88A 4GEKA 3C3PA 5GINE 3S68A 4MIKA 5FA8A 1JG4A 3QV2A 5EMJA 5BW5A 2ZSUA 3AWIA 2VDVE 4GC5A 2OB2A 1JQDA 4HTFB 5F2KA 4U7TB 2VZ9A 3MCZA 2PXXA 4YUXA 3EGIA 3LL7A 3TM5A 4RTSA 3FYCA 1UFKA 3HVIA 3PFHA 2AVNA 3KQSA 4YMHA 2QE6A 2LD4A 5FHRA 3ID6C 5GOZA 4KIFA 2Z6AA 1NBIA 2BM8A 5K0GA 1XCLA 3NMUF 4GOOD 2K4MA 3KR2A 2B3TA 3FUXA 4Y2HA 3HCBA 4U7PB 2V7EA 3HCAA 3BGDA 3CGGA 4AUKA 1VLMA 2JH9A 2ZFUA 5BP7A 4OBXA 2JHCA 4F86A 3KQWA 2O57A 4PCAA 1FP1D 5K0NA 3UJ9A 4BLUA 5LQAA 2A14A 3FPGA 1R8YA 3OZRA 5EEGA 1G6Q1 1P1BA 4NECA 5DM0A 2UZ4A 1DCTA 2CWWA 3G7UA 5KQRA 3PLAE 1U2ZA 4LG1A 4OX9Y 3G2OA 1WXWA 3BKXA 3LECA 2P3QA 1RI3A 3FYDA 3JWJA 4ER0A 4POOA 5K0BA 3PS9A 2C7PA 1FJXA 2ESRA 2ZIEA 5GM1A 4HG2A 2ZWAA 4PGGA 1JR4A 3FUVA 2EJTA 2VS1A 3GRZA 3HCFA 5E2AA 1ZHFA 2ZIGA 1OR8A 2BR4A 2OBFA 4KVZA 3KQMA 3LDGA 1ORIA 3ELYA 2YQZA 2PT6A 4PYOA 5K09A 2NXCA 3FPFA 3HEMA 3CJQA 2P7HA 3P2KA 4RVDA 3G2QA 4RTRA 1HMYA 2Y1WA 3MCTA 4V0QA 2IFTA 2QM3A 4OQDA 5DX8A 3KQOA 5EQJB 3REOA 3BGIA 3CKKA 4C4AA 4PYJA 5F2OA 2XYRA 1X1BA 4DZRA 3DLCA 5DTRA 2OPBA 4MHTA 3OZTA 2O05A 4Y30A 3IYLW 3WSTA 1EG2A 3UJCA 1EAMA 1MHTA 3VC1A 4EMSA 1IXKA 2BZGA 2Q41A 5FHQA 3ORHA 1UIRA 4FSDA 5KYGA 2AOTB 2C7RA 3HVHA 5LQNA 2HR1A 1KHHA 3HM2A 3HP7A 1KYZA 1RJEA 3ERCA 3I64A 4FGZA 4PYKA 3LCCA 4XUEA 4LWOA 4EKGA 5IKMA 1YF3A 2Y1XA 5EMLA 1TPYA 3EMBA 5K0LA 2B78A 3FTFA 1YZ3A 3UFBA 3DXYA 5ICCA 2PXAA 3LDUA 4CTJA 4ER3A 3KPYA 3R6TA 4PCLA 3L8DA 2ZWVA 3AY0A 3G8AA 4RWZA 2P1DA 4PINA 3E23A 4RVGA 4PONA 4V0RA 3NDIA 3B3FA 3LGAA 3FUTA 4IV0A 1KPIA 1XJ5A 3EGEA 1INLA 3P2IA 4EKIA 5HILA 2H00A 1TW3A 2OKCA 5E8RA 2ZZKA 4K6MA 4QPNA 4RTMA 3TKYA 2NXEA 2P40A 4P7JA 5K0JA 2EJUA 3EMDA 2G71A 5EC8A 5LQJA 2HNKA 4AZSA 4E2YA 3B3JA 2ERCA 3GRVA 2AN3A 2PLWA 4XUDA 2VP3A 3CJRA 2FPOA 4LWPA 4R05A 1AQIA 1DUSA 1XXLA 1NW6A 2QRVB 5LSAA 1M0EA 4UOEA 3MERA 3MTEA 1G8AA 3C0KA 3EVBA 3KR1A 3K6RA 1ORHA 3EVZA 1JG3A 1KYWA 1NKVA 1ZQ9A 4HRAA 2GH1A 3DOUA 4PYNA 5DX0A 3TRKA 1VPTA 3VSEA 4ATNA 4DKJA 4DMGA 2ZBQA 5LQRA 5HEKA 3P71T 3C6MA 3HA7A 4BLWA 1KXZA 1NW5A 2O07A 4ER6A 1JTEA 3KQQA 3TR6A 3T0IA 2F8LA 1RJGA 1F3LA 2YTZA 3BWYA 3I5UA 1SUIA 2G8NA 2GAFA 3GXOA 4C07A 3HTXA 1D2CA 3O4FA 1XTPA 5E2BA 2PXCA 1WS6A 1SQGA 1WG8A 5EKUA 3SVZA 3GJYA 2P7IA 3OZSA 1VIDA 3GRUA 3R24A 5CVEA 3UJAA 5ICEA 2XVMA 3JWGA 4CTKA 2IBTA 5DSXA 1VQ1A 1YZHA 5LQUA 2IIPA 3BZBA 2UYOA 5K0CA 4YUYA 1KR5A 3G5LA 3FTDA 2G1PA 3DULA 1ZGAA 3KPJA 1NT2A 4AZWA 1BOOA 3GWZA 3FRHA 1ZGJA 5EZQA 5BXYA 4M38A 2PWYA 5HOQA 3KQVA 4AZTA 3D2LA 4LECA 3DXXA 3OE5A 5DXJA 5C9ZA 1YFLA 3ER8A 1JQEA 3C3YA 2AOUB 2NP6A 4MWZA 3IHTA 2B2CA 4CKCA 5EIWA 3LCVB 1QYRA 4DQ0A 2BM9A 3LBFA 4H0NA 1Q0SA 3Q7EA 3R3HA 1VP9A 4RV9A 5EGSA 3FTEA 2GB4A 5D1NA 3OCJA 1KIAA 3KQYA 1D2HA 3GIWA 5E9QA 2P35A 4PYIA 2IH4A 3H2BA 4PGHA 4FZVA 3V8VA 4QQNA 4MTLA 4QVKA 3RW9A 1X1DA 3BXOA 2P3OA 5CVUA 3HA5A 3B89A 1M6YA 3O7WA 1SUSA 2AN4A 4GQBA 5U4XA 4AX8A 4CXMA 1NV8A 1MJFA 2I6GA 3G2PA 3LSTA 1SG9A 5E1MA 4GC9A 5EKXA 3M6WA 4RVFA 3CVOA 2WA1A 2V74B 4HGZA 4KDRA 4DF3A 3EEYA 1V39A 5K01A 3ANXA 2BH2A 4C06A 3UA3A 5T67A 1JG1A 5DPMA 2PX4A 5FADA 4FP9A 1BC5A 1XVAA 2YR0A 3R0QA 2PV0A 4IWNA 3K0BA 3M4XA 3UBTA 4QTUB 3KPVA 2C7OA 2ZIFA 1JQ3A 1VP3A 1VBFA 2R3SA 4RTPA 3QOWA 3NVMB 2IBSA 3LKZA 4QDJA 3ELWA 3PX2A 2IPXA 3EEOA 2AOVA 3B3GA 2C7QA 1FPQA 1P39A 4PYMA 3BGVA 1R00A 3IV6A 4YUVA 5MHTA 1DL5A 4GUAA 5JR3A 3P2EA 3P9NA 3P9KA 4R6XA 3DMHA 3PFGA 5K05A 2I62A 2OYRA 1XDUA 3BUSA 3ER9A 5CIYA 3VC2A 2PX5A 3LHDA 3LCUA 3B5IA 2DPMA 5K8VA 2PBFA 1XDZA 5LQCA 4YV0A 4C05A 2ONYA 2NXNA 3BT7A 3JWHA 4E33A 4DCMA 1L3IA 3I53A 1HNNA 3T7TA 4OQEA 3A25A 1SVUA 4CWAA 2GPYA 5FCDA 2PX8A 2ZBPA 1NW8A 8MHTA 4C03A 2CMHA 5T64A 1NE2A 3UJ8A 5KQSA 1PJZA 3JWIA 3P97A 3BKWA 4OBWA 3GNLA 1ZG3A 4ISCA 1Z3CA 5ICGA 2PKWA 4ER7A 4G56A 3P9CA 4EQZA 2EFJA 5DX1A 1AV6A 3LKDA 3VYWA 4RTJA 4RTOA 3EVAA 1YB2A 5DLYA 4FT2A 5E9JA 1RI2A 3G8BA 2HV9A 1Q0TA 1XCJA 1EQAA 2PVCA 5E1DA 3KR9A 2XYVA 3GDHA 4XUCA 4E2ZA 2I7CA 3HNRA 5DM2A 4RTQA 5HIMA 4E31A 4DA4A 2G72A 1RI1A 2YX1A 4YMGA 5CM2Z 4HGYA 2YXDA 1VE3A 3RIEA 2JHPA 3MHTA 3PX3A 3ME5A 2WA2A 3G5TA 4QTTB 1NBHA 2NXJA 1L3BA 5E8JA 2XYQA 2FRXA 5K0EA 3FPJA 3FRIA 3GU3A 5G02A 3UA4A 3KKZA 1AF7A 3NWBA 1X1AA 4X61A 3P8ZA 2HTEA 4X41A 4B17A 3NDJA 1G60A 1VL5A 3PB3A 1ZKDA 4KIGA 4QQKA 4PIMA 2AOWA 2R6ZA 3AXSA 1BHJA 4KRGA 5FQOA 3M6UA 5DWQA 5E1BA 2JHAA 3HCEA 3T7RA 5CCXA 3LDFA 5HFJA 1NW7A 4RTKA 5HIJA 4KDCA 2WK1A 3EVCA 4FS8A 3LX6A 3NW9A 3E8SA 3CC8A 4HTFA 1L1EA 2IDJA 4DM3A 5LQKA 2B9EA 2YUIA 2ZLBA 5FWDA 3P9IA 3GRYA 4RYLA 5CCBA 4P7FA 5EOVA 5DTMA 2CMGA 4QDKA 3V97A 1IM8A 2PY6A 3DMFA 3AJDA 4E30A 5DTQA 3PTAA 3THSA 4P58A 5EIFA 2Z6QA 4GOND 5HZMA 4M37A 5ERGB 3ELDA 3SSNA 4YV2A 2IGTA 5DRYA 3M33A 2NNWB 5CVJA 3UJBA 5ICFA 1M6EX 4P7KA 1Y8CA 1YUBA 3EVFA 2AS0A 5EMMA 10MHA 4BLVA 2IP2A 3MTIA 4OA8A 4HH4A 4RTLA 2ZZMA 3A7EA 3THRA 5FULA 5JUWA 1O9HA 2ZZNA 2JH8A 3OE4A 3BWCA 3B7PA 1G38A 2CL5A 2IH2A 1NV9A 3HVKA 5DM1A 2QYOA 5EVJA 5EG5A
chains in the Genus database with same CATH superfamily
3SY8A 3DZGA 2ZSKA 4NFHA 3ZOKA 2GYUA 3I2FA 2HMYB 5DHSA 2GN2A 2V9CA 2QGZA 3P2MA 5LBIA 2FSHA 5DF1A 5SYMA 3MK31 4RLQA 3V1KA 2YWBA 4OFBA 1PFQA 3HO6A 2VJMA 2HNAA 3IAS6 4PX2A 2IC5A 1UZNA 2NYUA 3GGGA 3IERA 3K9QO 4CCSA 4Z0HO 2W6ID 4Z1MD 3PQ3A 3HZHA 3KHKA 1F14A 1I5RA 3O1JC 4NZNA 3BWDD 2Q1SA 4X00A 1M6HA 2RI1A 2IV3A 1GN9A 5FBQB 3Q87B 4F45A 4UHJA 3IQWA 2ADFA 5LU8A 2XEDA 3WLQA 4G4JA 4U7DA 2OP0A 3N5KA 3Q3IA 4KWTA 1T4CA 2IXAA 2PRZA 3EDRA 1ZN9A 5ENZA 3RIHA 4ZVSA 1KI9A 3FXAA 4GOJA 3E7XA 3MQ2A 4PYLA 3RSZA 1E4YA 3P2JA 3SMQA 5IX8A 5JASA 2WWFA 3FDXA 4F3CA 1XZHA 2WJWA 3A4YA 4ZT6A 2R9VA 5ALXA 4JAVC 1U9IC 3DEIA 1H4SA 3RT9A 5LB2A 3A7DA 2RGRA 4G1CA 3X1YA 1OYYA 2CE2X 2EV9A 4RCVA 5KC8A 3DZDA 4JN6B 4S1TA 4KTTE 4A2PA 1DI0A 4PO3X 1G8SA 4N5MA 4B1FA 1IHOA 5EIEA 4FUTA 4D98A 3VI3B 2YHSA 2OPHA 1HYBA 4ZC1A 2HRZA 1IY9A 4F6CA 1M8GA 3S40A 5F7XA 2JL1A 5BMVF 4MHOA 9MHTA 3GA0A 4FDAA 4RY8A 1EGQA 1XMXA 2I7XA 3QU7A 4IUBS 3TFWA 3SYKA 1W34A 5TGZA 4YAUA 2OGSA 2GRAA 3SQMA 5A5DA 1CF4A 1OGJA 4OJTA 1HDXA 3OQ6A 1KRXA 1E92A 2P8JA 3KM0A 3EODA 2CLOB 3S1AA 1PJ2A 3MB8A 2PGOA 2H5EA 2DFTA 3MRXA 2JPDA 1YJBA 5LNK1 3PYMA 1F5SA 2VNJA 3LUBA 1WMSA 2QBYA 1C5KA 3ZY5A 3WLJA 3N2KB 5L51A 1A8QA 3LKVA 2UYHA 3QKWA 1T6BY 4MGZR 4BNFA 1B14A 3VJLA 1Y7LA 4JLVA 3OQHA 4TTRA 4WOJA 3A31A 3DB1A 3BZUA 2YKGA 2YHBA 3GCXA 3IQZA 3D8TA 4OGKA 1H1DA 3EVDA 5DRTA 3L9XA 2XV1A 1Z5PA 3GLHE 3MS2A 3BSSA 3F6EX 1I33A 4JUFA 4L78A 4E5DA 4BP3A 3E9YA 4OJQA 3I92A 3VDRA 3TNFA 1SCNE 2EJWA 3KZ1E 2UYQA 3Q3JB 1R4ZA 4BJ3A 3PC4A 5SZIA 1BWQA 4DWOA 4UCFA 4JEUA 4RORA 1O58A 3RTCA 1TO1E 1KVQA 2QYHA 4CM9A 2W6ZA 5KNDH 4LY6A 4H18A 4MKRA 5DCUA 4BEJA 4G85A 3NIWA 1RWBA 1QK3A 3WMXA 1EP1B 4H7PA 2WIAA 1PNQA 5E4TA 4RZUA 4EHJA 4CM4B 5HCUA 1E9EA 1TZBA 2Q3BA 1IHPA 2I3ZA 3ZDYB 2B5VA 4DXHA 4U2CA 5D1HA 2ZXUA 1PR5A 2ZJAA 1GNTA 1QR2A 1XVIA 3EA4A 1ORDA 4WBNB 1FTGA 2FN7A 3E0XA 4IBOA 4RX1A 4HGQA 1G6HA 3U81A 1E4VA 5DNDA 2WQ6A 4G0UA 2X8AA 2OHJA 2X8JA 1IVYA 2O8CA 3BF8A 1DAMA 1X8LA 1R0ZA 2B8EA 3FWHA 1IN4A 3PVCA 4EW3A 4F5EA 3FZYA 2A88A 4ZYWA 2QY6A 4D3YA 2XXJA 3U3ZA 2ONZA 2YN2A 1Q0PA 3TOVA 2ZUEA 1WXHA 3R5SA 1AK9A 4HBGA 2NOAA 2Y1OA 3U37A 1V0JA 1KA9H 5JXIA 3KB1A 1Q15A 3K0EA 1NNI1 3KUDA 1JPNA 3V3KA 5BSKA 3T3DA 4C7OA 1UFVA 3IQIX 4XLLA 3EHDA 4U63A 1SUFA 1RKQA 2HAEA 3L7MA 3TSWA 3TX6A 4BVEA 1R9JA 4DDVA 1QRUA 1DARA 1JQJC 2CLMB 4TV9B 3CRMA 3C3AA 3ZTWA 4M9ZA 2IOYA 1ZCAA 3P9ZA 4UCWA 3T3EA 1KWGA 2C2WA 3IP6A 3R2JA 1LLCA 2WMOB 3MCZA 1WPXA 3S81A 1VCHA 2FZVA 4DQXA 5C4IA 1P5FA 2NXWA 3TM5A 3T9CA 5ERXA 2XUKA 1NVMB 1IJEA 1RRFA 4KXUA 3LT5A 3KQSA 3ZU4A 3A1VA 4UAGA 4QLBA 3VR3A 3WHPA 2G76A 1O3YA 2H7CA 2OFWA 3KJIA 4J7AA 5GY7A 5LL6P 3IE1A 3DPSA 3AY6A 4O1HA 3IJ5A 4OFXA 2B8JA 3MWKA 4MVWA 4Q4LA 1XT6A 1SCQA 2HJGA 1E3EA 2HMSA 3K4HA 3WKEA 1Q7RA 3U6KA 5DHUA 1FDRA 2QSYA 4U2DA 3TNDA 1RXIA 2X14A 1TRHA 3VKWA 5CB0A 3P9QA 1Z6XA 1Y7IA 4C88A 2FAXA 2G1JA 1I4TD 4PCAA 1J33A 3AM3A 3V2IA 3L7KA 5EE1A 2XDYA 5H4HA 2ZSHA 4MPDA 3KXKA 3U4QA 4GGMX 5EE3A 2BEWB 3HR8A 4BNMA 1ZVVA 1WUYA 3B1FA 4WL0A 5H3CA 1Q20A 3TTVA 3L18A 1W49A 3L2OB 5CBKA 2FN4A 4GOKA 4M1MA 5LB4A 3T0GA 4ZTUB 2VJNA 3EA5A 1C3XA 4DV0B 1PZNA 4MR7B 2VCEA 2W2LA 3U7RA 4Y2QA 4KITB 1C30B 4ZIRB 4WVFA 2NZ2A 4FOPA 3EIHA 1R27A 4LY9A 4DPMA 4ESEA 2XA9A 5AXBA 4DMKA 4M1YA 1YULA 1QIDA 3P52A 1K8ZB 1J8QA 1GR0A 3I9V6 3COYA 1FJ2A 4J1TA 2DJIA 3RFTA 3AR2A 2Y0CA 4RKFA 1ZDMA 5CT8A 5TY0A 4O08A 2JJ8A 4UW9A 3WLFA 1DMSA 4HOYA 2Q5EA 2QD3A 2QTHA 3DOIA 4NJEB 5CAEA 1O5IA 2J46A 3PDUA 3MRTA 3K05A 3HM9A 1JHQA 3HL4A 4DG9A 4EMSA 2Q41A 1VE7A 1YZGA 2RGNA 4FSDA 3TTWA 1OBVA 4GH5A 2REBA 3RSQA 3CUEF 4HGPA 3ZLJA 3LO5A 4BAGA 1KZ6A 1X7WB 2W7TA 3C24A 1OYVA 3EK2A 3IT2A 3LTEA 1HQKA 3DFIA 1RHUA 3L6RA 4U6NA 5G4LA 1PZXA 4AD8A 4FD3A 1WKBA 4DJJA 3OQPA 1XU9A 1OXKB 2VDWB 4HEA6 4BB9A 1SQSA 3A8TA 2Y92A 4HCJA 4R1MA 1SKYE 4RFSA 4BQSA 4QHYA 3J81A 1VYTA 4OKIA 4RD6A 1HYQA 3AY3A 3W5JA 2P8SA 1GTRA 2GAIA 2VAVA 4MAAA 4RWZA 4Z49A 2P1DA 1XLWA 1NA5A 3PP8A 5CFRA 1HEUA 5BQXA 4LJ5A 1P2DA 1PN3A 3GHYA 1BHSA 3NQ41 2X5JO 2VJQA 3C3XA 4JJ7A 1XUOA 2X8BA 2PKXA 4Y67A 2J59A 4X6YA 2FR8A 1JAZA 2IVZA 3WGVA 2P40A 3H1TA 3M4ZA 3HJAA 4QUJA 3VJMA 1JJAA 1JV2B 1SZCA 5EA2A 4EYQA 4JU9A 2AZ4A 2AN3A 3GRVA 3BMQB 5JCOC 1JN0A 2NTVA 1B73A 3ANYB 4H7JA 5D5PA 3TTUA 3BTOA 2DT5A 2FQ1A 3WLIA 3EGDB 2Y71A 4BNLA 3K72B 2QJWA 3VU9A 1UKEA 4AJLA 1OFIA 3MFYA 6NULA 4Q1FA 2ASEA 3OHPA 1EWYA 4HQFA 5JH7A 1X6VA 4ENVA 4KX3A 1UXGA 1AGPA 3ESRA 4GXQA 3K2EA 5BSUA 4NP6A 1K63A 2GLTA 2OG1A 3HA7A 4OCZA 5JS2A 1K4MA 1JTEA 1J4AA 1MO2A 1ZM2A 4LE0A 4LMBA 4RZ3A 3ZZ1A 1R6XA 3IEKA 5EI5A 5ALFA 2FMHA 2I6TA 3BWYA 4Q6WA 2Z2YA 1BMQA 1DWOA 2G8NA 2Q7XA 2RB5A 3KL4A 4IDCA 4Z9AA 1P72A 2XX3A 2XTNA 1WG8A 2EBUA 1N3IA 3OIDA 3O8OA 1TT7A 4IIFA 4LZZA 1V43A 3VMMA 2QUJA 3JU3A 1E8NA 2G25A 4Y9SA 5ICEA 2BGWA 4UAVA 3ZNOA 5EWJB 4EYSA 5B64A 1CF9A 4TZTA 3KQNA 5JQGF 5LQUA 2J9RA 5KQMA 4ZKEA 1T5SA 3FTDA 4Q39A 2BMEA 3X43A 4AAYA 3KPJA 2D13A 1JFFB 1TDJA 1GD1O 2DUMA 1QF9A 1RMYA 2O1XA 1P1HA 2C2ZA 2DFDA 3QMMA 4DHWA 3R4CA 3A6EA 5ALSA 5CFNA 2BF7A 3U1VA 1D1PA 2OCIA 2VF8A 3UT0A 4DA7A 5KYUA 5KDLA 1MX9A 5FR2A 3TK1A 1G3UA 4P0PB 1Q0SA 1NT4A 2QNBA 2AA3A 5JH7F 3FTEA 1YQUA 2C4VA 2WWGA 1Y3CE 1T25A 1N32B 3GDWA 1G9TA 4Q4JB 1DXQA 4GGPA 1ZXBA 3E3OA 4KPUB 4PYIA 2GN6A 4H08A 5K4HA 1ZM3A 3BB3A 4QQNA 4QYSA 1Q83A 4MTLA 3TQFA 4LF9B 1XFDA 1J9EA 1YUMA 2XNSA 1V16B 3CW9A 4HQOA 1U2GA 4TQUS 1M6YA 3OAAD 4O4HB 2M6SA 5U4XA 1CEQA 3DAHA 4QOJA 5TQ2B 1GUYA 2GKGA 2FW8A 3O8DA 4KQ1A 1RCTE 4FYKA 3B38A 2VT6A 3GGPA 4CI0B 1K2VN 1S0UA 1T91A 3BF7A 1I51A 5FPSA 3WGOA 1T13A 4KB5A 4NHEA 2DHQA 5CLLA 4J4HA 1I7QB 2BGNA 7REQA 1A1VA 1W0JA 1IHYA 2VNKA 2CL7X 4GMXA 1CYEA 4GX1A 4K5QA 1G20B 1UPBA 1D2MA 1KEKA 3IR6A 3QUBA 4MIEA 3EZYA 4F8YA 1Q57A 2YH2A 3WK7A 3K0BA 3H0KA 5B1YA 1JHRA 4PICA 1BDJA 2R3SA 1TKRA 3BXGA 4UEQA 2OD7A 3WJ2A 1BE0A 1GPKA 5IJ0A 2FP3A 2H1FA 1N7GA 3H18A 1SEVA 2HRBA 4MV4A 3FWYA 3U44A 2JBWA 2F4NA 3T5BA 2R1UA 3NP7A 4DJEC 1M83A 5D6NA 5J5AA 1HT2E 2CLLB 2OYRA 1XDUA 4ARBA 2PSDA 2SHKA 2LW7A 2VP4A 4IM7A 2PR2A 3DBRA 3GLRA 4PQYA 2Q2NA 3VC2A 2E7ZA 3B5IA 3HMKA 1JR3D 1XDZA 2AI1A 5FO1A 1WXIA 1L5RA 1E7WA 2VRCD 1CJBA 1VECA 1AURA 3Q0TA 3SKYA 3TPFA 3KELA 2FPIB 1ML4A 5BSEA 4LCBA 3NNNA 3G9TA 3ZU6A 2B20A 5DDIP 4EO4A 2O0KA 4IG4A 5IJAA 1ENYA 3EYAA 1ULTA 2GBLA 3L7CA 1FRFS 4C29A 4MRAA 4YK7A 3GYGA 2LIVA 4U6SA 3H2SA 1T6XA 7YASA 2YYZA 4XB1A 2NU7B 3LX8A 5IYZA 1LV7A 1AV6A 3LKDA 1OFUX 3VYWA 1H69A 3Q7TA 4HB0A 5ILGA 5DLYA 3RANA 4N82A 1RYFA 3GVHA 2OHHA 1EX7A 1R4AA 1CNEA 1SZJG 3F3YA 1YIAA 1LDBA 1ULZA 5LYYA 4F60A 3HDTA 3B1XA 2UU9B 1XZPA 1VSVA 4F12A 2CC2A 1FLAA 3L0CA 5IWCA 3MLAA 1FFEA 2YXDA 2IDZA 1CVRA 3PNVA 4WX2B 3W8FA 2NTNA 3ICCA 3P19A 3GPLA 3NTXA 3WTCA 4KLRA 5JANA 2G5PA 5GAJA 3RSSA 1XFAA 2Z5FA 4WLFA 2J67A 1FFWA 1ZNZA 3FFAA 4DCUA 5GADl 3P8ZA 5AO9A 5DHTA 2PZKA 3NDJA 4DWWA 5FJIA 1XLUA 5HF6A 2BJVA 4PIMA 1M6NA 1SBTA 1F2VA 2UKDA 3DZBA 2XIJA 3B20A 4W9NA 2PUBA 1FTQA 5JD6A 1FUEA 4OQYA 5HFJA 1ZD4A 3IUNA 1RJ9A 2VP6A 4IZHA 5NULA 1I4DD 3GJXC 4OGLA 1EA7A 4PLHA 4TV8B 4HAZA 4O3FA 1QV9A 2X1MA 5DM70 5AI9A 1O7JA 4UNPA 3K53A 4DNQA 4JBXA 4JI2B 2WMDA 4UBKA 2PTGA 1YOVA 3GDFA 5TQVA 4CLEA 4DLWA 4P7FA 1HLGA 2AGVA 4HAVA 2CMGA 4QDKA 3D6TB 5HKKA 2OAQ1 1OD6A 1IC6A 4KBYA 2Y67A 3DV2A 2Q28A 2Y93A 3GVCA 3KXIA 1N9KA 3UOAB 2H1CA 1NVUQ 4WXMA 1XA0A 4BLUA 5CVJA 2NPOA 2DC1A 2AS0A 1SZDA 1Z6QA 2CHQA 3NHMA 1GV0A 4TUYA 5K3AA 4ETWA 5CR9A 5B1EA 1TXGA 3WA6A 1YQQA 3IDQA 4AC9A 1MF7A 4QOHA 1JVNA 1CZKA 3HABA 3UPDA 4YCNA 4A4DA 2IUSA 3ZIDA 4UASA 5IKXA 1JA1A 1TNDA 3NUZA 1OWNA 3FIJA 3PNPA 3QOFA 1QFJA 3PWSA 4FFDA 2VTBA 1NVFA 1WL8A 2UZ0A 4NZMA 5TEWA 2X4IA 5IMSA 1YZVA 5LP6B 3BMXA 1JPUA 1CUWA 3TLJA 1QIJA 1WCXA 2EBWA 2GJ9A 2QZJA 4G8CA 1I13A 1OZFA 2R6JA 3BE8A 1TF5A 1UOEA 1V4BA 1M7BA 1ZMTA 2P5TB 3EXG1 4IAOA 3F9IA 1OXMA 1TM5E 4B7CA 1Z68A 2JA1A 1IXSB 5ALMA 1GDTA 5CM9C 1JDUA 4LK3A 4O59O 1E2IA 1LSJA 2I4RA 4EPRA 3W5VA 1ESZA 4UM9D 1COWD 2A58A 2GHRA 3EF3A 2NVUA 1C9JA 1I4EB 2PX2A 3WKBA 1UF9A 4D9EA 3AYZB 5KVAA 2V1UA 3QMPA 3F7MA 3R9XB 5FUWA 5ABPA 3GGJA 2WZBA 1Q92A 3OZAA 5K51A 1KI7A 2V4MA 4DLNA 2NP7A 1ZM9A 1HLFA 4A1FA 1HNZB 3HRKA 4BP1A 2PWPA 1OH7A 1Z8FA 4P4NA 2IV2X 4LWQA 2JLWA 5EIAA 4XWOA 3S1SA 3HSYA 3QQ5A 1QF7A 1UBSB 2R4UA 2GERA 3IUBA 4GLBA 5I5GA 1J2RA 4J0IA 2EDCA 3I5MA 4G0NA 2HZ7A 3L3BA 2FFQA 3QUSA 2AIRA 2XUZA 4U2KA 1Y9JA 1Q22A 2CNDA 2Y4NA 1A50B 3SX2A 5T4EA 1W47A 3EZ9A 5F5NA 4DSUA 1G55A 1JLSA 2O3UA 4J76A 5JNTA 5KYTA 1IL0A 4HXEB 3OTWA 4DCGA 3LQ1A 4E46A 4HBZA 1KMIY 4YXFA 3VSDA 5BOVA 1LGYA 3RO7A 3VXKA 5AKHA 1SQ0A 2P78A 3DLTA 1VKJA 4IUYA 1FIUA 3KSDO 3MWEB 3BFPA 2WHRA 4YRQA 1QGDA 1KGSA 1Y4DE 1FLNA 2W93A 3UHOA 1S1CA 1X9HA 4QTYA 2FYTA 4B6OA 4MP6A 2GN9A 2JLXA 5FA5A 3TB6A 1VSQA 2OM6A 1EB9A 3G0GA 1HWYA 3WNBA 5BUSA 3OOJA 4PGAA 1T1SA 1XAJA 1R8XA 4NBLA 5GJVC 3NVKI 3FCXA 2ST1A 1C7FA 3HV0A 1R6AA 3NDPA 3R3WA 4U2BA 2GM5A 3PRHA 3R0ZA 4IHQA 4M9SA 3S2GA 2SKEA 2XWBF 3N8HA 3RWBA 5HM8A 2UVPB 2BJWA 3QNUA 4W9MC 1XRNA 2PH5A 4HXFB 1SEPA 2P4SA 4FSXA 4ZU3A 4BNDB 1Z7YA 2A5LA 3N2EA 4HRYA 3TUJC 2CKDA 1YR6A 2WF7A 1T9KA 2GCOA 1GZ4A 2X7XA 2CGEA 3MTAA 4OHBA 3ROPA 4LXIA 3IAEA 2CLSA 1GRVA 1V8ZA 2F3QA 3SIWA 3HY3A 1HQYE 4CM8B 4YQYA 1Y4ZA 5CIQA 3AG6A 1WZNA 1EH5A 4NVRA 3W9SA 5BWNA 3OJEA 1CZUA 2XKAA 3TIIA 3L7DA 2ENUA 1H2ZA 4S1VA 5B1SA 5JXHA 2GQ0A 2B94A 2YCBA 3NJ8A 2AH5A 1KP3A 4U7JA 1QYCA 2HLDA 5J4LA 3LVRE 1ZO8A 2C2HA 1FRQA 3KWMA 2YZ7A 1CLUA 2CDAA 1AXEA 2AHOA 3DMGA 4G1MB 3QE0A 4HRVA 1KP9A 4YVFA 4ARCA 5L3QA 1IBKB 2H17A 2QTFA 4A6DA 2FY8A 2HMAA 1JIUA 2Q5CA 4XD7A 3W5CA 1E98A 2GA9A 4RW0A 1HM5A 3T5AA 1GNQA 4IUCS 3RC1A 4PIPA 4B7ZA 2AVDA 3JQ8B 4IMPA 1EUCA 2JI8A 2HPHA 5F1KA 4ZAXA 3LNCA 4F04A 1HE2A 2C4TA 3D4BA 1DKMA 4DDUA 3Q7IA 4G36A 4GIBA 1NVDA 1ZESA 3U4AA 2NPIA 2P67A 4KQWA 2B4RO 3NT5A 3QXHA 4JXKA 5J5VA 1N1EA 3RTGA 1CUIA 2X4DA 3MFQA 1UCFA 1EGHA 2Z08A 4NFYA 3T4XA 2ZB2A 5B2ZA 3VPGA 4ARUA 1E9SA 4U02A 1KO8A 1G8MA 3UMJA 4YDSA 5A7HA 1TEHA 4O1IA 4QOSA 1U6IA 4FXOA 3TQSA 3N5CA 1IPHA 1CQPA 3UUWA 4AF6A 5IK2A 4Z7QB 1PR4A 2KE5A 3DV0B 3UJDA 3QEMB 4HL6A 4Q0MA 4WK2B 3W3ZB 3AINA 2A59A 3PQ7A 2IPOA 2QTTA 3C3PA 3K0CA 5JNVA 2HU7A 1EX9A 4D3SA 1ZFNA 1CR1A 1FNMA 4DNOA 2AW5A 2JAWA 3ZV5A 2HYIC 3GFTA 3AWIA 4GC5A 4N5HX 3UFXB 4TYMA 3G1WA 1JQDA 3GZNB 4TS1A 1NJSA 4HDSB 1NVWQ 3ABQB 4BV8A 4YJ2A 5G0WA 3TQIA 2C3YA 2IEZA 3DVSX 3OZVA 3RYCA 1KAGA 3K20A 3UPTA 2ZTUA 5C8ZA 2Y76A 3VV3A 1X0VA 2Q21A 3IPRA 2GT1A 2QE6A 2Z3VA 3GFSA 5GOZA 1R12A 5DBFA 1WHTB 1WMFA 3EXIB 1XZFA 4KPGA 5BSTA 4E6EA 1P3Y1 3D6AA 1ECBA 3Q2KA 4M21A 2K4MA 1T8YA 3QVVA 1YZQA 4UD2A 4ZVNA 3NDBB 3OJWA 1Q84A 1I7LA 3BMCA 3RVMA 3X1KA 5CG1A 5LVAA 2QPTA 3UATA 2BC9A 5C51B 4DIFA 4N5NA 1A8IA 2GCGA 2JHCA 4F72A 2FPPA 4L9WA 2C4UA 3TYXA 4W8HA 2Z5LA 1THTA 3OO1A 4MR9B 3AIKA 1UDWA 1XCPA 1M76A 3DQQA 1TD9A 2JEZA 4KYTA 1DCTA 4PLWA 2CUZA 4LVUA 1D3AA 4YXWA 3UW3A 4QFBA 3VSAA 4UUNA 3F78A 1VG0B 1FMCA 2ZVPX 3GJ8A 4FW9A 3AESB 3P5BA 4G24A 2O6LA 2PG3A 4KGVA 4L5IA 3EY9A 4XM2A 4M7OA 4LRSB 5GM1A 1E9FA 1IUNA 3G6WA 3OZ7A 4DPLA 3CPJB 3HCFA 1ITZA 5IASA 3ZWWA 2WVAA 3IEMA 5I7AA 3T7IA 1J5XA 4R3WA 3T1QA 4BP9A 2ANCA 1UK8A 2E4AA 3DAGA 1PK8A 1YB6A 3BDIA 4J4BA 4UMVA 1MC8A 1GZDA 1WA5A 3P2KA 2GYYA 3H8VA 4RL6A 4RVDA 3UAOA 2QM8A 4DHEA 4RTRA 3MCTA 4V0QA 2A35A 2ATEA 2VWQA 1RYBA 1W1UA 3NYWA 1VHDA 3QKSB 2DBVO 1GAQA 3L7OA 3Q9SA 1CD5A 2X4LA 2G7ZA 4LUCA 5BWBA 2O05A 4RO0A 1P9RA 2GYWA 5IJ0B 4KXMA 2Q5FA 1XHLA 2MINB 3KYDB 1B8UA 1R15A 1YA6A 4LOLA 1GL6A 3OE7A 3HU2A 3JD4A 2WFMA 3GZ4A 3WGMA 5KNCD 1K8YB 5B3KA 4QYTA 1E6KA 3WGZA 1KYZA 2QYTA 1RJEA 1YRYE 2QL5A 3ANNA 2HBYA 3JQEA 1KI6A 3TFOA 3FFTA 2D2FA 3JQAA 4O6VA 4AJNA 2A9OA 1GUAA 3AI3A 3DXYA 5ICCA 2PXAA 4UHBA 4G26A 3AUXA 3F3MA 4DOMA 1DKRA 2GFHA 4HAUA 4TKVA 3LE8A 1ZSYA 1Z0AA 2WSSA 4JBWA 2Q4DA 1KYVA 1DIRA 2VYVA 4L2IB 1T2UA 3HDVA 1TQHA 1AQ6A 2PL5A 3WKCA 1ZA1A 5HILA 2ZIZA 5AIAA 5HMLA 2B1QA 1DFHA 4Z3KA 2WE8A 3OEEA 1E7QA 2QVGA 5E2IA 2P1RA 2ONCA 3UT6A 4IDPA 1Y3AA 4RD3A 3ZLVA 2G71A 1JH9A 4RZ2A 2HNKA 2Q9BA 1V48A 4C03A 4Y7CA 1CCWA 3TINA 3VHLB 1K7FB 4QTZA 3B7WA 2I6XA 2QTZA 4UOEA 4G09A 4QGAA 4Z8XA 4Q1DA 2NU8A 3A70A 1CQJA 1I4OA 4H6VA 3SBXA 1FFCA 2O0JA 1CERA 1ULBA 4B4DA 3TXAA 4ZPXA 2XB8A 3QITA 1L7MA 1Q7TA 2OTCA 1N25A 3MCUA 4IINA 4TRJA 3SX4A 2HU8A 4DV5B 4JI0B 4DJDC 3MJFA 5BUCA 4UXHA 1O5OA 3HCWA 3OPYI 1AGXA 2E6UX 1VMKA 2FV8A 5J2TA 4DXAA 4CKBB 1EVIA 1BFKA 4XOIA 4YJ3F 2IY9A 2HK6A 4KN8A 3RRBA 1QVZA 2PUTA 1SUDA 2BRUC 4XQ0A 2FUG1 4PN3A 3W2FA 3VKHA 1XI2A 3OJXA 3HLKA 1P0FA 4BCCA 4KUHA 2R7MA 4KR2A 4MWBA 3GJYA 2DOKA 1SCBA 4KAAA 1VKOA 1B1CA 1ZJ4A 3V7YA 2OZEA 3VGPA 2H1SA 2R2GA 8LDHA 4Y0VA 3LZCA 2QTBA 4EGJA 1E3LA 5K3FB 4EG1A 4NG4A 2JD1A 4B09A 4YUYA 1VYVA 3IDAA 5GPBA 2AJDA 3S2FA 2O8FB 4AZWA 3OF5A 3F97A 4TSFD 2D3TA 2VPIA 3I2KA 4WUTA 3GLGA 1CZLA 1XJ0A 1VGRA 1TKBA 2DCUA 5E7QA 2AOUB 1DJNA 1MC5A 1UXKA 1IZ8A 4HAXA 4HN2A 4HJXA 4A2CA 1LLFA 2A57A 2BM9A 4MOWA 4O2AA 1SURA 4K9PA 2GSDA 3A1FA 1PP4A 4BVAA 2XCQA 2MU1A 3IP5A 3ZQ4A 3VZCA 2WRZA 1BMFD 1EJ2A 4TMYA 3PUWA 2EP8A 4V24A 5E9QA 5J2TF 3RS2A 2F3SA 3IDFA 3KAJA 4FZVA 4K9QA 4R54A 3V8VA 1G16A 1A9TA 1F8GA 1J24A 1SCUA 2GNAA 3K1TA 3AOGA 4FEYA 3W2GA 3OTQA 5G3YA 4BRUA 4EMTA 3O7WA 2C04A 1CZNA 2I91A 3F96A 3MJDA 1RXSA 3O8QB 2PPLA 3KT3A 4KXWA 4PZZA 1CTQA 3PSHA 1EDZA 1MO6A 1YQDA 1N1GA 1YBVA 1J70A 3LK7A 1XCOA 3CIOA 5C7IO 5JY1A 2H54A 2JGDA 3RKSA 1SVOA 4HGZA 2I7DA 2XITA 4GFDA 4U7WA 3DDNA 4IDFA 3WK8A 3EPJA 1U28C 2DQKA 5ALJA 4YN3A 1HBJA 1A4XA 5H3HA 4FP9A 1P7PA 2I4LA 3E22A 3VR6A 4DR2B 4M98A 3C7AA 2VPYA 2H1HA 2QLJA 4BE9A 2WAXA 3DFFA 2FFHA 4I4TA 3BD9A 2W2MA 2WYWA 3PJFA 4ITVA 4O2AF 3RUFA 3ROQA 1Z4PX 1N0UA 1J07A 3DAYA 1CDDA 2G07A 1PR2A 1FPQA 1CB7A 3FMPB 4NBTA 2EZTA 5B37A 4BJHB 5K9ZA 2XGOA 2CSXA 4HWGA 3REQA 3M2PA 2CDNA 3L4SO 1LRKA 2KQUA 2YJGA 3FFWA 4M0LA 1NFRA 3K6SA 3FROA 5F73A 1FA9A 1EHYA 2W00A 5EP2A 5TS2A 3IPXA 3ZCXA 4E4YA 1SCDA 2JNWA 1FFBA 2DPMA 3LCRA 2HADA 1VHWA 1WUHS 2I1VB 3LGXA 2R7KA 4Q4DA 3QUCA 4LYGA 3ZKWA 4XJSA 3ZDZB 1E1MA 2G1UA 3BM5A 3EEQA 4R9SA 3WVNA 4CWAA 5IULC 8MHTA 2UZ1B 1NQWA 1NW8A 4Q4HA 1JIIA 1ADJA 5T64A 1DKOA 2IYYA 3DEYX 5JYCA 2WJ3A 2P9BA 4IV5A 5JS1A 2HDWA 2XUIA 4I4CA 1NYTA 1NOIA 3GOHA 5ICGA 1T8RA 4FGLA 3UXMA 1KIMA 4HZUA 2XWQA 3EYWA 2WHYA 1OAOA 1FMLA 3SJZA 2R2AA 4YAWA 3GUCA 1SHJA 2AYYA 1BU5A 4US1R 1Y4UA 5AOVA 4RTOA 4H9GA 3VHXB 1RWWA 5TMEA 3UNXA 2I2DA 1BWRA 2D0OB 5D00A 3QXSA 2W90A 3H3FA 3OT4A 2QM0A 1Q0TA 4C3ZA 2GMWA 1KQNA 5G0VA 3PCXA 3DLBA 2X77A 3NC4A 4DCNA 1KSHA 3ISVA 4OOEA 1PD1A 3EY4A 3AUAA 3L4BC 4LDZA 2NUAB 2QPOA 3KRTA 5FF9A 5IVKA 2RGGA 1ZR4A 5DM60 3BIXA 1KMHB 2VAPA 2EHDA 3EJWA 1LPAB 1UINA 3LPAA 3OESA 2QX4A 4O4LB 3G5TA 4N0MA 2LZ0A 2Q7OE 1AUPA 3IBCA 3N8NA 5GMOA 1Q0UA 2AFHA 4R2KA 5EZYF 5KINB 3GLGE 3GAAA 3IVRA 2MOKA 2X4GA 1MG5A 2G8LA 4GPZA 4BO9A 4OI2A 3I01M 5BNIA 1QP4A 1M8FA 2WWIA 1PTJA 3ENZA 3F6BX 3MWGA 1E1DA 4G2NA 3SFZA 2XBLA 3WRVA 1AKMA 3PX7A 1YRBA 3F8WA 1BS9A 1ZKDA 4X8LA 1DIHA 1J49A 2AOWA 4EJ0A 2JFUA 4JQSA 4I0WB 5K8TA 1JHXA 2ZRLA 4KRGA 4UVDA 2ZWOA 5J40A 4BOYA 3KCNA 3R20A 4RMIA 1VG1A 4OP2A 2K7ZA 3AQ4A 4JH0A 1RQLA 3CBQA 2X6TA 1U1FA 4D6YA 1F8YA 2FUKA 4CIYA 8GPBA 1OFHA 1L4UA 4CTOA 4FYWA 4AYTA 2ZLBA 2QRPA 2ZSDA 2CLHB 3ABIA 1LLQA 3FMFA 3IMCA 2ZRQA 1Z2CA 3I8OA 4HWRA 4J0KA 2QXYA 4XEHA 3T3MB 2RH8A 4AL4A 3QVMA 4US2R 5HM6A 4B31A 3D7NA 4WOKA 4X62B 5DP1A 3JQBC 4KVGA 2H7XA 4FYPA 3S3TA 1OB2A 5EMMA 3M3PA 2AI3A 4PSVA 2VJOA 3NV7A 1FX0B 4OQPA 1YS9A 5BY2A 1NX6A 4YBRA 3PQ5A 3QLTA 3U9SA 1FFYA 2ZRJA 1ISMA 1Z25A 3DE2X 4P32A 1PNTA 4IQGA 1KY3A 3VU3A 3OKFA 3OP1A 5EVJA 5EG5A 1BS1A 4RQAA 3S7ZA 4KWCA 1E6CA 4YP6A 1CY8A 1IZZA 2QRKA 3FE2A 3GLSA 1Z0ZA 3AZPA 4FC6A 4PYQA 5CVVA 5ALEA 4E2XA 1CR6A 1LA2A 2WF6A 5EYPB 4EPYA 4D82A 4PRZA 2NVBA 5E9WA 2D74A 3CVXA 3EQ2A 4R41A 4XPIA 1BH2A 1KAHA 1YUNA 2ZIVB 4WK0B 5FWAA 1VYHA 2F8MA 1C7EA 4M9XA 2GI4A 2RI6A 3FNIA 4PBRA 1VE1A 2Q27A 2W6IA 5BN4B 3EDQA 2GWHA 4Q1EA 3RYCB 1QANA 1XR3A 3IESA 4MV0A 2A2ZA 4BEWA 3IRUA 4O02B 4WOPA 2PJZA 2HXGA 4CLHA 3QX8A 4HDNB 3DWEX 4L27A 4FX2A 5JNLA 2Z2KA 3LG2A 4ZDWA 2PPVA 2C20A 3CZMA 3V4LA 1U9CA 4CKEA 5FTNA 3DCNA 4QICA 2MDTA 1RR6A 3TRFA 3UWPA 4ZGWA 4PVCA 1V1JA 4LSGA 5K7SA 1KTVA 2FFRA 1L5LA 2QVBA 4HP8A 3JR7A 3SZUA 5I9LA 1ONPA 1XD2A 1Z15A 2WV9A 3MGBA 4ITRC 4V0SA 1L1FA 3WZMA 3H75A 3L40A 1QIMA 2HO4A 1SNYA 2NQTA 3JQGA 4ZCTA 4D4GA 3BBPA 1YMUA 2Z3ZA 1UANA 3E6AA 3GJTA 4IHJA 3T38A 3I58A 3A6PC 4IILA 1T10A 1M2GA 3LA8A 2PGJA 1L7QA 3C1TA 3IUPA 3OPMA 3GNTA 5CBPB 1W4BA 4FSHA 1O0SA 5ALLA 4C1NA 5JXJA 1E58A 1J8DA 1D6SA 2HH9A 3QNWA 5CH5A 1JYSA 1YCFA 4UM5A 4BX8A 2AFHE 1NLYA 1GPLA 2OQ2A 3FKSD 4AYWA 4OB7A 3SF8A 1TCVA 3HWX1 3M5WA 3NC0C 2G83A 2BFDB 2DQSA 3ANTA 3WJ7A 2QF7A 1KU0A 2BKAA 5DNVA 1KXJA 4P53A 4C08A 8ABPA 1G2PA 3SYMA 1F0KA 4O5OA 3A6DA 1Y1TA 2BISA 2DUJA 2QS9A 1EPUA 1NZFA 2FSVA 2FWMX 1ZLXA 3C1UA 1JHMA 2BY4A 3KK0A 4IV8A 4OSPA 4ZCPA 5IM5A 3VR4A 2JB9A 4ACBA 2PIAA 4OQLA 1DBPA 1LF5A 2DHRA 2GEFA 3EXFB 4DDTA 4HAWA 3WDLA 1QAQA 2KS6A 3EVGA 1ODSA 1SULA 5CA0A 3WG9A 1PSDA 4DCVA 5A9RA 4X1KB 4IHJF 1ZU4A 5TMBA 4G4SO 4RKQA 3L0BA 4IQ8A 2KI5A 4URFA 4MB6A 4DCSA 3PGMA 5DXFA 1I9GA 3DL4A 4UJ5A 4XDZA 1P61B 1RKVA 2CNNA 1E5XA 1RXYA 3ECCA 3NBFA 4HSGA 4X60A 1JSXA 3VHQA 1AKWA 3ZKAA 1L1RA 2ZCJA 2EWVA 4LSMA 2J33A 4BP8A 3BHNA 3R74A 5A4KA 4O8CA 3NBAA 4E88A 5IZ4A 1YVRA 1H93A 3PUYA 2VHWA 5GV8A 4MVJG 1MQSA 5IBPA 3V48A 5ITSA 1XWIA 1L5QA 4ZAFA 1Y8ZA 1JAHA 3UHAA 1SD2A 1BKYA 1WCIB 4L3WA 2XT9A 1FDOA 2KLHA 1CRLA 1KR2A 4OQMA 4MI6A 3P0HA 3QGMA 4GOLD 4MV3A 3ZJ4A 2WLTA 4DXDA 6ADHA 2N75A 1M67A 2ZSAA 3T1VA 4EDFA 3PNSA 4XJXA 1EFRD 5I4IA 3U09A 4LBYA 1E3WA 1SGWA 4ID9A 4R8KA 5AXCA 2P2SA 3RS9A 2EGUA 3S29A 3MELA 3IAS1 1PNOA 3QSGA 1D5WA 3D1JA 1R50A 3SCZA 16PKA 1NPTO 2PTHA 3RLIA 3WL6A 2Q49A 2X1LA 2ZKIA 3NKLA 1XRLA 3PE6A 4DBVO 3E4CA 5CFLA 1VL8A 2HJVA 3NTLA 5DBIA 1YRQA 3LQ4A 3D4OA 2PZ8A 2HCFA 1VLZA 4MIOA 4GECA 1M66A 4CFYA 2OT3B 4FKMA 2I2CA 3AGQA 3ZWCA 1EFVA 2W6QA 3L8ZA 4FT4A 2ZW9A 5K3SA 1NW9B 2ILVA 2R85A 2VXCA 3RYTC 4IHKA 3EDOA 3K16A 3ANSA 4IH1A 1MIHA 1YMQA 4WCFC 1GYPA 2AOXA 3DR5A 2FPGA 2JANA 1OFGA 3KUXA 4JR1A 4RD0A 1Q0QA 5D85A 5KKAA 3RVNA 3ZZ0A 3SGLA 4K81B 1UMCA 5H7XA 2DKNA 4QC2A 4CMCA 3B53X 2VT3A 3H2KA 4YLGA 2PV7A 1I32A 1WV1A 4A8PA 1CRWG 3QA9A 2X6RA 4LI0A 3ND5A 2Y2VA 3DM9B 4HLCA 3RYHA 4KFCA 4XDYA 1N8TA 4HTFB 3UK6A 3RT7A 1U7OA 4IR7A 3CSUA 3L0YA 1OMOA 4AXXA 5TF0A 1E2GA 3HS3A 3KSMA 4Y9UA 4N7JA 4NZPA 1OZHA 4N8EA 5D01A 2X13A 1R0YA 2WU8A 5HQ3A 2AVNA 4XJVA 4JX8A 1VI5A 1LX7A 1U2RA 4G97A 4OREX 2BM8A 3O73A 4OUDA 3BH6A 4OK6A 4DIBA 1NM5A 3IXLA 1U81A 4KE7A 4RS4A 3RVKA 3FIUA 1WUJS 4U7PB 3CXUA 1KJ9A 2PD6A 3AVPA 2OYSA 3BGDA 4QECA 4EYKA 2Q0QA 1C4XA 2OR3A 2O8DB 1CDOA 2Z56A 3MOGA 4V3CA 2BKVA 2VQDA 4MGYR 2JZCA 3LRXA 2BHSA 4HAOA 5BORA 3CWQA 5B2EA 2DERA 1A97A 1TU0A 3F74A 1VLQA 1XVLA 2REXB 2ZJOA 5TQ0B 2A14A 4X54A 1DE0A 2GXSA 1IQ0A 2HJRA 2P11A 3C4VA 2KM1A 4L08A 4J1QA 4RMJA 2VUTA 5FBKA 2V3WA 3B51X 3SPXA 1BW9A 4IJMA 5INTA 2BYTA 4LRQA 1DQRA 3GHHA 2VNIA 2P3QA 1Y63A 4OSOA 1OXUA 4R8MA 4S1WA 5AK3A 2O14A 1ZYUA 4J03A 4U1RA 1I36A 3K73O 1WB6A 3RUAA 4YA6A 1A96A 1P4SA 3BX1A 2Q5QA 1MQ9A 3B82A 1TE2A 3S28A 4GM4A 5A6SA 4ESOA 2ONJA 2OBFA 3EW9A 1C3LA 1HKHA 4KVZA 4ENTA 5AVXA 1ZNXA 3QVKA 5FUVA 3THYB 3OJCA 3COZA 4CPDA 1TUIA 4NS4A 2JGDB 1FDIA 1Q1BA 3LDGA 4NZYA 2NV2B 3C5CA 4GT1A 3FPFA 4ANFA 5LMUB 1JHPA 3IO5A 4U9IS 4RAQA 3R5FA 2PL1A 2AEMA 3AEKB 3A32A 2A4MA 4MRVA 3IP8A 3LCMA 1VCNA 4UTXA 1F1JA 5EHNA 3COVA 2QW1A 4NE9A 2PNJA 7ADHA 4IJVA 3CPEA 2OFFA 2GJKA 3AKDA 4X90A 4BNWA 3VJRA 5A0TA 3OZTA 2Q2WA 1DTWA 4MICA 2Z8YM 1HE4A 2OV4A 3WWEA 4DLRA 4G0PA 1DAGA 1N92A 1PFVA 2GA8A 2GJ8A 2I4TA 2JAQA 3Q12A 4ZXFA 5H9VA 3REQB 5IN4A 3DSRA 1F5NA 4FHCA 1VE9A 4BKRA 5KUTA 5LQNA 3A04A 3ZS8A 2HHAA 5D87A 4CI9A 1AIPA 2ZVQX 1JFLA 1PT5A 2IJGX 3CH4B 5FLKA 3TZQA 2AWNA 4KWEA 3O2NA 1XDDA 3LZDA 5C5CA 1JSLA 1DX4A 5DE3A 4EW6A 1HGXA 1MAVA 3I05A 4H7DA 1KJZA 1XNQB 4EGCB 3AY0A 2YVAA 1YS4A 4F0JA 1BROA 1IMJA 3H5NA 3VX3A 4B43A 3NHWA 1TQ2A 3QUQA 4JLKA 4KXXA 1T8SA 4RDCA 5FTMA 3WP0A 1MTZA 1SBQA 4V0RA 4DJTA 3B3FA 1QIHA 4G5HA 2B1GA 4HNQA 1LBIA 1KOGA 3OTIA 4QYIA 1DJQA 1GCAA 1H9BA 3KWJA 3ANLA 4XD2A 2FQQA 3L4KA 2FE1A 3EMDA 2I7TA 3JD1A 1GKLA 2I2WA 1PLKA 4F2PA 1KRHA 3C3EA 2CVZA 5AVKA 5KCZA 4XIJA 3A36A 1N0WA 3K70C 3CJRA 1DWPA 4AJJA 2RMKA 3NAGA 4D4JA 3S6JA 3TGPA 3OJ0A 1G8AA 1PJBA 3H11B 2J4CA 4NFLA 4POOA 4YT2A 3TRKA 4KUGA 1SVIA 4DRZA 4HEJA 4KJXA 1R0CA 1SIUA 3O82A 2V6BA 5T6MA 4W7SA 4H4EA 1IBMB 3AIMA 3LRPA 221PA 3CXRA 3PIIA 3EZXA 1NW5A 1DUVG 1L7PA 3QFFA 3TNJA 4N4AA 1GPH1 1WAMA 3SU8A 1W88B 2RONA 4Y9RA 3ZCQA 4DA0A 2J5BA 2NW6A 2ZSEA 3VUFA 1AQYA 3FBTA 4J07A 3DO6A 1FSFA 3RAPR 3O4FA 2I9PA 5LWQA 2C9OA 4EL0A 4GOXA 2RGWA 3MINB 2IOHA 3V34A 1ZIDA 4FFLA 3D8SA 3R24A 4MQ6A 2HXYA 1GXSB 1PWXA 5C81A 3U7IA 1R66A 3TZLA 3D0OA 1KYYA 4D5EA 4Z4EA 2D2EA 3U4HA 4TPKA 2VSQA 5ELLA 1EBUA 1SFRA 1Y3IA 5K0CA 4XXHA 3B8HA 3NHUA 2FDCA 2DLCX 1HOTA 4CETA 2V5AA 4YP0A 3D8BA 1ZONA 3E2MA 3PIRA 4G23A 3DXXA 1K8RA 4N6GA 1PL0A 4RK1A 2FVYA 4Y8VA 2A0WA 4OU5A 1GVNB 3BXPA 5KNDA 1ZU5A 1JDJA 1JKMA 1NW4A 4CKCA 4DDKA 3AI2A 3CTMA 4FFPA 2HRQA 2Q5JA 3QJYA 2X15A 4F4JA 4PY2A 3TZHA 3I9V1 3LUDA 4XVCA 2C2MA 3OCJA 2NUPA 4CKWA 5DNAA 4JUCA 1CE8A 3EQ6A 3GIWA 3SVLA 2CD9A 3CVVA 2GZHA 2FX5A 2HCTA 2QRNA 2YC2C 3EB9A 3M2TA 4RF3A 4UM7A 3IRVA 1J8MF 4E7PA 1LDNA 2JIPA 3MGCA 4Q34A 4EX7A 4LY3A 4RA6B 1YRHA 2D1QA 2HQ1A 4DIEA 1N3BA 3HYLA 1J22A 3FWKA 4X97A 1TMOA 3AJRA 2XECA 4G1FA 2XMDA 3LSTA 4II3A 4Y2UA 2AUMA 4PFSA 1DU4A 3FFBA 1RKBA 1JJFA 1MVLA 2OGWA 3GBSA 1Y98A 2QT1A 3C3CA 1JUDA 1NDQA 4RVFA 4YDRA 5JFOA 5ALDA 1XTTA 5K01A 1IDN1 3D8UA 3TUZC 3NORA 1E9CA 1PQ4A 2HRCA 2FSIA 3ZIAD 5ITZA 2E5LB 1Z4KA 4GZ6A 3UV6A 4MGIR 2YR0A 3BJMA 3JQ9C 3T1YB 3UHFA 4MKGA 1JQ3A 4S2UA 4PRKA 1PT6A 4NK4A 1TJ3A 4A0GA 1QG6A 3ADOA 1M1YB 4NEGA 4QUDA 1GU0A 2GTIA 3EAQA 3JQRA 5BOSA 4C4PA 4YUVA 1RFLA 1G1MA 1R00A 2X5OA 2CXQA 3BGVA 1TAUA 1FFSA 1GARA 3PRKE 1QO0D 2OORA 4RIEA 3FWNA 3T34A 2HPAA 1AD2A 3IDSA 5KZMB 3H1EA 6REQA 8OHMA 5CDTA 4WESA 1E0KA 1UQUA 1O95C 4OHXA 4WXRA 3ENWA 5BURA 5LQCA 2W8BA 2BGIA 1GLNA 1M2JA 1K88A 4D4HA 1CNMA 4YPVA 4FZ5A 4LQ4A 1NVKA 2RGXA 4TMVA 2E1PA 5CPFA 2IYOA 4PSCA 3ZI0A 3B1KA 1P3JA 3EWIA 4ZT3A 5FI3A 3K2BA 1JPJA 3CEAA 1XJWA 1UBOS 1KZYC 2WWRA 1Z5UA 4IO0A 1XSEA 1QFSA 5L4SA 1GL9B 2XB4A 2QWXA 1X7ZA 5EZ5A 1QHYA 3ICOA 3FD8A 3FCCA 3UTDA 2XCLA 4E51A 1TZ2A 4KHZA 1FTWA 1BE6A 5A3VA 2APJA 4H27A 5JJCA 4RTJA 3EIOA 4QWMA 1YJCA 3SF8B 2WVJA 4KP7A 2OZPA 4P22A 1K2WA 3K4QA 1C14A 2NLOA 4GYKA 4KX5A 4BQOA 5AUPB 4XARA 4LE2A 2FU5C 3K9BA 2H4JA 2H9YA 2XOKA 2R6CA 3KTDA 3H5LA 2D5CA 3ZEAA 1OI2A 3JSAA 4W99A 3MT7A 4DMRA 5CT6A 3GG9A 2ZAOA 3GDHA 4CV3A 1LKZA 2I7CA 5A4JA 1XD9A 3FZQA 1RI1A 2YX1A 4MCIA 1ZUNA 3GMIA 1LBSA 4DQUA 2BUAA 2VK2A 4ME6A 4TZ6A 4V02A 3HXQA 3PR2B 1JL3A 2O1EA 1T9GR 4RLFA 4ZYYA 3MHTA 1QB8A 3ENKA 4RFVA 3NIDB 2VK4A 3PHCA 4LZWA 2XYQA 5LOVB 3QKTA 4YH1A 3FPJA 3VO1A 1BX3A 3H2HA 4FEEA 2VK8A 4C6TB 5KTSA 1AUVA 2Y4OA 3PLNA 4WY8A 4JASB 4BVFA 4Z5XA 1L5MA 1IG3A 1PYGA 1ZC4A 3HUEA 3VVLA 4AIRA 2PUDA 3YASA 3RS0A 1WE2A 5DLDA 1XXHA 1L5VA 1FNDA 2IEIA 2H1IA 4YJKA 1AC5A 1E2JA 2ZR9A 3R6WA 1Y1PA 4JI4B 4Y2PA 1MRNA 1XZQA 1NURA 2CK3D 2YV3A 4KDCA 4KSYA 4TSRA 1J99A 1KZ4A 3EISA 3G8YA 1V4NA 1GEEA 1PBTA 4HQRA 1BDIA 1L1EA 2JJ2D 4J6FA 1TA9A 4P7BA 1I3OA 3KQLA 4GAEA 5H16A 4EJ2A 1CY4A 3KWFA 4TV8F 5ISMA 3EEIA 4U3JA 2P9ZA 3T5CA 1KH2A 1NC1A 4BE7B 2VATA 3R09A 2G9VA 1BEUB 1G21B 2VKTA 1DQYA 3ABOB 3PNQA 4FLMA 2H4YA 2O2XA 1S3GA 3A4NA 3M9LA 4I9GA 4IGKA 3SYTA 4FE7A 4PO9A 4RUKA 4ZVRA 5B58T 2Z6QA 4GOND 1KS9A 4X3PA 1ZLYA 4CUJA 4GM1A 2IGTA 4UTNA 4PC6A 4G89A 4P7KA 4AT1A 3AGPA 1QRAA 4YCJA 2AX4A 3RU7A 4EHBA 2H7YA 4IX9A 5EP4A 4KJZA 4ZMSA 2QP3A 3LYUA 1CR0A 2GRUA 3IOMA 4RHUA 2LRHA 1CUCA 3CR7A 1ARZA 3WLSA 4F4UA 2BMFA 3C8MA 3V33A 3HVKA 2K2WA 4DMGA 2HHLA 2DPYA 3DBIA 5JSUA 5T7BA 3HCDA 1JDBB 3TJRA 3QUTA 3K94A 5DXAA 4CEHA 1E99A 1YFZA 1YZTA 2JGIA 3O84A 4OKNA 4RF5A 3WI7A 4BPBA 5LP6F 2DGDA 3RYHB 1NY6A 3MB5A 2O8BB 3MF4A 3OFNA 2XUHA 3DVAB 3EN0A 3U40A 1RPZA 1GADO 1XAHA 1PR3A 5FNVA 2F9MA 2OCXA 2V0GA 1BDMA 1MX1A 4TS9A 3R7NA 2R6DA 3GI1A 5JBIA 2W2TA 1X7HA 2Y1FA 3VPFA 3C1AA 3E3LA 1FX1A 1COWA 2O7VA 4MLCA 1DFIA 2XY4A 1X3LA 1EJ6A 3OCUA 5ADUS 4M7RA 1NJ6A 3WYBA 1Z7GA 3PFIA 5CXQA 3U7GA 4OUDB 2O2SA 3PKIA 1ICEA 1L3CA 4LEIA 2DCMA 2H92A 2EEZA 4HATA 4MVJF 3SI7A 4F4HA 5IKPA 2JA2A 1GRNA 1XG5A 2BP7B 4TWAA 4UNNA 4RETA 5JCOA 2AXQA 4AO8A 3OQNA 4G41A 4CLOB 2WNSA 1KZHA 4HLQB 4BTEA 1L8LA 1TZCA 3C5EA 2BBSA 2OWDA 3R44A 1V6SA 2AOTA 3PTZA 3WGJA 4HAYA 2WT9A 5DIZA 3X2FA 2GS9A 2IKSA 4AM8A 1HL7A 1V35A 5DGTA 1C50A 1MD9A 2PHZA 1ZGCA 3DP7A 3NWPA 5DMHA 2WB2A 1QX4A 3M3HA 3GFVA 3ZEIA 3JVVA 3MGKA 2LTAA 3MXTA 3QVSA 4AP5A 4JB3A 4DY4A 4HNRA 1I1HA 2W2QA 4H77A 1Z17A 4OHKA 1R4NA 4L57A 2FZGA 3A1TA 3L79A 4MRNA 2GZ1A 3IS3A 3MCWA 3ZG6A 2L0XA 5CHYA 4BBAA 4E13A 4E22A 1U8UA 3CLHA 5ECDA 4BFVA 1EFDN 4O25A 3ORSA 1SOVA 3FN4A 5EXTA 3AEUB 4KQEA 1HX7A 3WQQA 1JT9A 4ND5A 2AJTA 2DTXA 2WIKA 2I78A 2PH7A 3ZWBA 3H2JA 4L85A 5FYDA 4DUGA 2GZDA 4ID3A 2PMCA 5E4YA 3GT3A 4YRRA 2EG5A 2AR9A 1C8BA 1XXHE 2YV4A 4UAUA 4D99A 2QQ5A 4W6QA 3SC4A 1TLFA 3CNLA 5DGIA 3KQPA 4G5GA 5LDDC 4GKJB 3VPSA 1W5AA 4Q1CA 1L9XA 1N6KA 1ZM4A 3Q4GA 2FH5B 3B12A 3N8KA 3TDKA 3N0RA 3PQ2A 4RK6A 4GZ3A 5FTKA 3X0DA 1T0UA 4CQNA 2D4AA 1U2SA 3PQ6A 5IARA 4AZ3A 3U7QB 4B32A 5H59A 4MS4B 3BGWA 1QAMA 5EE0A 5BW4A 1CRQA 2WFLA 3FYHA 4KC0A 4IOKA 2YWXA 5E6SB 2RJ3A 2G6TA 1I80A 3CCBA 4O29A 4ZYZA 3QX7A 4MINA 1EBFA 1PFUA 2J9GA 3SHFA 3UJ3X 5EJ6A 5JZ9A 4BIIA 2VJBA 2X2FA 2EX1A 3TLEA 1EP9A 1S9HA 1M7HA 1FDUA 2OB1A 2ZREA 4EA7A 4YCMA 3V00A 1GPWB 3KPUA 5CIWA 4YALA 1E4EA 2TS1A 1AKNA 2ISQA 5KJ6A 4QYIB 3ELBA 4S12A 1N57A 5DISB 5ENVA 1P5HA 3R6DA 5C1IA 1XL0A 1ZX1A 2VH1A 2VEDA 3CLRD 2PU7A 1TGYA 3WWDA 4JKIA 4KQIA 5F7ZA 1RXUA 2Y1CA 2ZCUA 3PHHA 4DGSA 4JGGA 3AR8A 1MOSA 2FMFA 1Q14A 2FXIA 3B6IA 2PGXA 3K0FB 4RVCA 1JW9B 3BEDA 1ZIXA 4LN1A 5CP8A 1WCWA 5J2UB 1EGVB 4G4GA 3RJ9A 1H1LA 1NONA 4MGKR 4OVKA 4JBIA 4CCYA 1T29A 2AK3A 1JFTA 3BH7A 1RQPA 1E18A 3VPBA 1MZPA 1PK9A 4MLPA 2IUYA 1UZUA 2QE7A 1U5AA 1J0CA 4RY9A 3WYDA 2QMQA 4W5WA 1XMJA 2GEVA 2BJHA 2FK7A 5JZOA 3AV0B 4POAA 3HJHA 1W96A 3HKDA 1Y7TA 3C48A 3KPWA 3QF4A 4Q19A 5JMWA 4CLRB 1QGOA 3G88A 1ZIPA 3OF3A 5F9MA 1YK1A 2XQGA 3QHPA 3LBAA 5KPDA 1DEXA 1RMTA 2DBQA 3C74A 1PG0A 2NG1A 3DKKA 5BW5A 5THXA 1KTIA 1OZGA 1RP7A 1A69A 1SUWA 3AIOA 4HVCA 4KMOA 5DGDA 3AETB 4ROTA 3FOZA 3D7LA 3KTAB 4IDOA 5JDIC 1OX4B 3HYSA 4DILA 5B36A 2R00C 5G0UA 3HVIA 5DNEA 3QKIA 2A9QA 1AVTA 1G66A 3W1WA 5IHPA 2WU0A 3MSXA 3ICWA 3R3ZA 1KDRA 1U1EA 5FLEX 2ZBFA 3I5AA 3SWWA 2AC2A 1GZ7A 2F3RA 3CX6A 3HWSA 3OIUA 4X45A 5DT9A 1FU8A 2IIBA 3T3PB 3EBLA 3TI9A 4CKCB 3RVLA 1X1RA 1TYEB 1T9CA 3WBFA 2JH9A 4UZEA 1RWXA 3VSCA 1VL2A 3AI1A 4S1OA 3ACBA 2ZTLA 5BQ3A 4K40A 4YONB 2VHXA 5K0NA 3QEAZ 1YV9A 1CE8B 3E0QA 1F6WA 2PCJA 3MN1A 1G8GA 1HDIA 1YKFA 2R96A 2CV2A 3OHMA 1JZQA 4DCCA 5JBNA 3D8HA 4YFYA 3QZUA 4FQ8A 1P2FA 2DFLA 3K8YA 3KLMX 2A1UA 3BRWD 5THQA 3I5YA 5DMXA 2AXNA 4RV4A 5IMBA 4KQCA 2DQ4A 2XJ9A 3CZ9A 4Y1RB 4FNAA 3UHJA 3RAJA 5L53A 3TF5A 5KNBD 4JNCA 4QJBA 4ARVA 1L4EA 1ZN2A 2JLSA 1IRXA 4KQ6A 4X3OA 4DC9A 4DANA 1H4QA 1JIQA 4OK5A 3SIRA 2J4DA 2I29A 4MV8A 4D6XA 3V1NA 3K9LA 4D7AA 5ITZB 2NQ8A 5A3RA 1Z33A 2L19A 3NXSA 3RJ5A 4M9CA 4PYJA 2XAUA 5EFOA 1G8HA 3W5HA 5TE9A 5K45A 1SB8A 4BNGA 2Z83A 4MYCA 3DM5A 3L8FA 1H5NA 3FCUB 1BA2A 1P9OA 2XYGA 3UQYS 4YRFA 4DLVA 2BEKA 4RZSA 2H1OA 1C1XB 2QL6A 5A7FA 1HT3A 1HOXA 1YDEA 5IKEA 4WFQA 1BX0A 2HA7A 3HVHA 1JLLB 4R84A 1JKIA 2YWEA 3FCEA 3QTLA 4F92B 3ZE8A 1P7YA 3BZWA 3LFTA 2O2DA 2VNSA 4FHGA 2WG1A 4C0JA 2JATA 4S04A 1YS1X 3P32A 3QX9A 1Y80A 4L8WB 3NX4A 1SK9A 1NVBA 5A9SA 3FOEC 4ESVA 2UXCB 2Y8EA 3CX3A 3NHZA 2BFMA 4PCLA 2PDAA 1R9GA 4OMDA 2FSSA 2YNMD 3HKCA 1ZK3A 3T99A 1QHNA 3BSWA 3L7BA 1KIFA 3D5EA 4WKNA 4CL2A 3G23A 1P80A 1PG2A 1VKHA 2GESA 3KSBC 2ZB4A 3V1YA 1O94C 3R0JA 4JYPA 1W0CA 1V11B 3A9CA 4N8DA 1DAOA 2G06A 3FVTA 2ZRPA 4PAOA 4FCWA 5YASA 1PFKA 3JALA 2YFKA 4UJ3A 4RDIA 3W7AA 4BJ1A 2FEWB 2WJZB 1UP6A 2X1VA 3S2UA 3THOA 3CSDA 3S5JA 5C8DA 2FPOA 1RVV1 1XXLA 4ZVLA 5LSAA 1NMEA 4ND1A 3DDZX 1GAXA 2IEBA 3PNBA 3VZQA 4PYOA 3K6RA 1I3LA 4GD3Q 1XF1A 4BMYA 3S27A 2JFYA 1ECLA 2BDTA 2FRVA 3L7YA 4B7AA 1ZUNB 1CS4C 3PR1A 1FRNA 1LSSA 1Z39A 1FUIA 3A6KA 4I3GA 4RHEA 3THWB 3D43A 3P71T 1XZNA 3L06A 4LA4A 3HR4A 1X92A 2QLTA 3ULKA 1P44A 1TZMA 3TEMA 4GS5A 1RJGA 2DAPA 3EWNA 4TRRA 3AUUA 4RJ2A 4W7IA 3UKJA 1E5DA 2E21A 3TVDA 1Z36A 1FXWF 3ZWDA 1QORA 4J91A 4YMLA 2CXHA 1NBMA 4LPSA 4BNUA 2B1JA 4RXMA 1DC4A 2JGMA 1XLTC 1QH8A 4HY3A 4TZ0A 3ETLA 3OCVA 2V9ZA 1DS6A 1JU3A 4KV7A 1E0JA 1JMKC 3GY0A 3TOZA 4CQJA 4BWYA 1ZH8A 3FRHA 3QLVC 4TSFA 4OL9A 1XPUA 5FV7A 1O6BA 5DXJA 1RXCA 3HXPA 4AS3A 2Q50A 1J20A 2HL6A 1V37A 2XSZD 1RAGA 1T3TA 2OUKA 2NU9A 3IHKA 5FB3A 4UOZA 3TAHA 4MWGA 4EAAA 4GDMA 2XCRB 2V55B 3N70A 3AF1A 4KZKA 4LRYA 5LXTA 1LVGA 3FHOA 1GPJA 1AGNA 5HF8A 3RTDA 5KYXB 2FW7A 3OBIA 4MWEA 2O5EA 3Q98A 3AVWA 3WYEA 3S99A 4BFXA 4MW5A 1XZLA 4TMKA 4ZEWA 3TEFA 3GLTA 5T57A 4BFTA 3OX4A 3PDIA 3TIFA 1JQ5A 1VPVA 4Q9NA 4DEYA 1YA4A 5J23A 3LLSA 4ND7A 3UAWA 1YVUA 1VHJA 3KFVA 3ZX4A 3AONB 1TKCA 3QI7A 4R2JA 2ON6A 1SHLA 1RWMA 2ZWIA 3GPCA 2B8WA 3JQPA 1NYLA 1ZVKA 2ZQ5A 3QWAA 2FWJA 4UNSA 5CXSA 3PQEA 2HSEA 5FLXA 4HR7A 3Q1LA 1ADBA 3M6WA 1RC0A 1D8TA 4E5MA 2EKDA 4R3UC 5FYQA 4B2LA 4E5SA 5EL0A 2L42A 2BTQB 1D7OA 2GZ2A 2R8BA 5AVSA 5AW1A 1DDIA 1M5UA 2QVXX 1UOOA 2FZEA 4M8SA 3PSAA 2QQ0A 1HE8B 3DQZA 2WV7A 4IWNA 4QTUB 1QLWA 1KEVA 3G82C 1I6KA 2X5NA 5LZ8A 1KFBB 2VDNB 4C7JA 4UM9B 2BKEA 4RXTA 1QYXA 5LXTF 2P4HX 3N8IA 4WNCA 4P93A 3B3GA 4QO7A 3ZHRA 2WSMA 1QWOA 2JLZA 4ZEXA 521PA 1TUBA 4AJ2A 1D1TA 4KIWA 4QOFA 4Z0TA 1T9BA 4GXRA 4M0KA 4UUBA 3O8CA 2VNAA 1LI5A 1XZGA 3DMHA 1Z2PX 3H6HA 3HSSA 3NHLA 4HDMA 5K05A 5JVDB 2EP7A 5B7NA 1LPBB 4WFIA 2I3BA 1ADYA 3GFBA 3ASVA 5LIPA 3EUEA 1W85A 5JTTA 2FF5A 3MBIA 3WTBA 2UVDA 1Z6PA 4HAIA 2QEQA 2FSGA 4IOMA 1XYYA 4AO6A 1J0BA 4A9AA 5AI5A 5AVWA 2C92A 3O3NB 3OPYB 2X9GA 1EQUA 1UKYA 2H57A 4RCZA 1Z2DA 3ZHCA 3P97A 3GRCA 3GNLA 2N42A 3DOHA 4M0FA 4ER7A 1LNSA 3P9CA 4G56A 3D02A 1GT6A 4QYMA 1ZNYA 2HLHA 4AWBA 3B6JA 3LGSA 4W5JA 3WB1A 4IKOA 5EWMA 4DNFA 5JYBA 2XKBA 4I6JA 1G0NA 1ULAA 3U7EB 3PYXA 4GU5A 1Y6QA 2AG0A 3WE7A 1JP7A 3ZI4A 5BQPA 3FB1A 5A4AA 2ZUFA 4HO1X 3K6KA 4HNUA 1XELA 4DV6B 5CB4A 5LIRA 4I9NA 4FZJA 4EUKA 2M9MA 5BV8A 2AMVA 1NBME 1QIGA 2NO9A 3IUMA 4ZQBA 4BLOA 4MVCA 4YPOA 4PZLA 2I7VA 4WD3A 2IYSA 2Q4OA 1JFVA 1A7UA 1NN1A 2ZYDA 2QT0A 1MEEA 2AQHA 1S8NA 5CCDA 1CEEA 5BVGA 1GGEA 2NXJA 4INOA 4R2WA 1XNGA 3DOJA 4WK4B 2VHUA 2JFZA 3ILXA 1MCZA 4QVIA 1BD4A 2Y05A 1ST2A 2IIQA 2QRHA 5C5IA 4X41A 4GL4A 2PGIA 4JMPA 1G60A 2XTAA 1E1CA 3BHMA 4PG7A 4BPRA 1ND5A 4UDNA 1N6LA 1PAUA 2CNOA 3OZXA 1YB4A 2A8YA 1II0A 2HK7A 4I1SA 2B4AA 1E2LA 1GO2A 4JEIA 4RU1A 5BNFA 5JNWA 5JRDS 4C0QC 4M54A 3OA0A 5DGHA 2OQRA 3PG5A 5EMHA 1NZDA 1JLKA 4XVRA 2A92A 2D62A 4S2EA 4K8RB 3ZWXA 2VF2A 3BOSA 4WNAA 2C1ZA 4COKA 1RLJA 1T0HB 4MJ7A 3PUVA 4RYLA 5JCZA 4B4VA 1PF7E 1USUA 3ACDA 1PLLA 3F3KA 3M0EA 4TKUB 3E5HA 3STTA 2BEUA 3VR2D 3FF4A 4WECA 4E30A 1ETHA 3OSZA 4B0OA 1ZK0A 1EUZA 3OLWA 1SVWA 1CR2A 3LKBA 2VUHB 5EAIA 3F5SA 1XL1A 1E1RD 1RACA 2AN1A 2QR2A 3ZCTA 4HPJB 4R1TA 4NNJA 4JJEA 3AHGA 3V9PA 4EHHA 1K5DA 3U3MA 4B3CA 2IP2A 2B7BA 3ED5A 1IOLA 3HYCA 4RJKA 1QLJA 1QIFA 3THRA 1IBSA 2FEKA 3GNSA 2V5UA 4FBMA 4JCCA 4D56A 1SKBA 1WOMA 5CFZA 1M9NA 4EKYA 4KAXA 4C2TA 3UJNA 1N34B 1NASA 1WDTA 3K0AA 5DM1A 1B8PA 3HUTA 1XTJA 3DL2A 1UKAA 2WZDA 4XCQA 4JUBA 4Z4IA 1M6WA 4ZCMA 2QTAA 1Q1GA 3G89A 4XX0B 1EXDA 4DUYB 1E2KA 4PNEA 3L8EA 4OLHA 3BWBA 4HQNA 4HNTA 4RHXA 4LTDA 4HYYA 4WBSA 2D0DA 5HQTA 4DJFC 1Q0ZA 3LDAA 2C5HA 1H0SA 3TBKA 2YVLA 1NMYA 1QV7A 1U6KA 3TDNA 2P1ZA 3WHLA 3QY9A 2XJ4A 1IY0A 4HLUA 1F6DA 4U9HS 4DAEA 2ATVA 2ID9A 3FA2A 4X9XA 4GI3A 2BKUA 4LRUA 4XWGA 2J09A 1CEXA 5AVVA 2Y6VA 3HNPA 4PHHA 2ZRBA 2BEJA 4ZA2A 3QHAA 1MN6A 3RROA 4WY5A 4LDNA 4HHEA 4D79A 3KYBA 3LPDA 2ZJ4A 5CH3A 4LXYA 4DLPA 1B42A 2J08A 1TK9A 2WYOA 1M8KA 3V7FA 3VNSA 3L01A 1ADGA 2FEMA 4ZOLA 3UK7A 5ITVA 1CY1A 1V8PA 2JFGA 2Q5LA 3GD7A 1AK1A 3NH9A 3U3DA 4KPEC 3OIVA 1VHTA 1TAQA 2YDXA 3H4MA 3KKMA 3QMWA 4L5YA 1RI4A 1HORA 4NCXA 2DYKA 1C9KA 5HOEA 1YTLA 2G0TA 2QV7A 1FNCA 2ZT6A 4MWTA 4N03A 1SOWA 3TKAA 4FMCF 2K2QB 4A16A 2CSUA 5EJ8A 1F38A 2JKVA 5KJCA 2ZIUB 4IS3A 1LQ2A 2OXRA 1AA9A 2ZUCA 3F8SA 5F33A 3VOAA 2D2IA 2BRUA 3LUAA 5DLPA 1KSGA 5ALOA 1R18A 4O4IA 4P34A 3ZJVA 1IN1A 4D80A 1FU4A 3DNMA 2PIDA 1D2RA 4J94A 4UU8A 3SZOA 3IUQA 4BX9A 3S8EA 3U60B 4HQ0A 4MGEA 5A0VA 1N7IA 3HCRA 1OC4A 5D5HA 3BL5A 3HEAA 5EJ9A 3N0TA 4KQFA 4OXQA 4Y9TA 2HTFA 4D0SA 2WM9B 2JDID 3OQ1A 3RUHA 3SXUA 2I4NA 4CG0A 4OMFG 1YQTA 3HI6A 4LW8A 1QX3A 3Q0EA 5CFQA 2ECQA 2IZZA 2R66A 4X63A 5JHHB 4HFRA 1Y6GA 4P7GA 1ISIA 4ZOLF 3U61B 3GGDA 3BN3A 2P6MA 4X94A 3RBXA 2H11A 3OOEA 5CDYA 1KEWA 4QREA 3F6SA 4N65A 3UF0A 3LQQA 4B6FA 2GRJA 2R44A 4L0DA 1OLXA 3NXKA 1P1CA 5DYTA 2IODA 3QKUA 3GFOA 5JSHA 3A06A 4YI5A 2FEXA 3N9IA 4KBGA 3I9LA 4NFSA 4TYPA 1AS2A 3GX1A 2L18A 5HIKA 4G3XA 1VLLA 3TI7A 1VSUA 4PBSA 4F2WA 3JQ7B 4O4IF 3SHTA 1NBEA 5A2GA 2YICA 4PR3A 3BT7A 4N8SA 1UBTS 3NETA 4QASA 3QIAA 2FCAA 1BXKA 1G1AA 2QV0A 1NPYA 3GJ0A 4TXMA 1RYNA 2OCYC 2WF9A 4PW0A 2IA5A 4TM8A 1IN7A 2AR0A 4WT7A 2P75A 1J06A 3EH1A 4UFPA 4K6FA 4MV9A 1LTQA 4G9BA 1U28A 2PT9A 1BD3A 2HJ9A 2M6RA 4Y1FA 3ZS9A 1D2GA 5HIAA 1QUFA 3TKLA 3USCS 5CVDA 3DEHA 1H5UA 5HF5A 2EWMA 2G08A 5A5GA 1V1RA 2XRYA