3CKKA

Crystal structure of human methyltransferase-like protein 1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
229
structure length
196
Chain Sequence
b'YPVKPEEMDWSELYPEFAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human methyltransferase-like protein 1.
rcsb
total genus 59
structure length 196
sequence length 229
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ckkA01
5D1NA 3U81A 3AJDA 4O29A 5K05A 3P2IA 3FYCA 5T67A 1AQJA 1SUIA 2ZZMA 3HCCA 2C7RA 3G8BA 2HR1A 3LX6A 3EVZA 1KR5A 1DL5A 2V7EA 3BWMA 4FS8A 1L3BA 1Z3CA 3TR6A 1KIAA 2XYVA 3EVDA 5K0FA 4FSDA 4DZRA 2P3LA 3G88A 1RI4A 2YQZA 3UBTA 4YMGA 4C08A 2EJUA 2P35A 5FWDA 4ER3A 4GOMD 4KDCA 3OU7A 3FTCA 3OZTA 5K0GA 1YFJA 3KQVA 4LWPA 3S68A 5D1HA 2FPOA 4PYOA 2EFJA 3LKDA 1VQ1A 4PYJA 3ER9A 3AWIA 2O07A 3MERA 1VPTA 3AXSA 3KKZA 4MWZA 1R8YA 1UFKA 3KQWA 2BM8A 1EJ0A 3VC2A 3OFKA 2PWPA 1WS6A 5FQOA 1VBFA 5HEKA 3THRA 1WZNA 2XYQA 3LSTA 4L7VA 5FCDA 2K4MA 5DXAA 3P97A 4IV8A 2XVAA 1SKMA 3HCEA 2GLUA 4RTQA 2JHCA 4ATNA 5IH3A 3VSEA 4RVHA 1QAQA 1BHJA 3B7PA 4MTLA 2YUIA 3KR0A 2B2CA 5LQRA 1NT2A 5DM0A 3KPJA 5EKXA 4DM3A 3KR1A 1NKVA 3A27A 3LCUA 4FP9A 3R6TA 3X0DA 4LG1A 4AUKA 4BP1A 4GC5A 5DTMA 1EAMA 3MQ2A 5K0CA 2EX4A 1FJXA 1KYWA 1YB2A 2CWWA 2CMHA 3SX0A 4RTMA 2P41A 3GXOA 3UJAA 3BXOA 5EQJB 1JG1A 3UJ8A 1G38A 2I9KA 5DTRA 3QOXA 1X1AA 1U2ZA 1ZKDA 1FP1D 4YUYA 4MHTA 3TM4A 1P39A 3RIEA 4UOEA 4YUWA 4X41A 3UJDA 2IBSA 2C7QA 3PFGA 2NXNA 4KIGA 4RX1A 1XDSA 4G56A 5HIIA 5ICFA 3MCTA 1YF3A 1NV8A 4C05A 1YUBA 1EQAA 5CIYA 3OZRA 3KPWA 3DMGA 2YVLA 3UA4A 2PXCA 2FK8A 2PJDA 2ESRA 3CJTA 3IHTA 3OE4A 3ELYA 2VDWA 1YZHA 5E9JA 3OPNA 3A7EA 3B3GA 2PKWA 3CC8A 4PYLA 2BM9A 2VDUE 3DMHA 2BR4A 5E9QA 2XBMA 3G2MA 2FYTA 3EVFA 2ORED 3EVGA 4DMGA 2AN4A 3GGDA 1NBHA 1NBIA 1JG3A 2GS9A 2NXCA 1KPHA 3R0QA 4U7TB 3M33A 5H02A 4BY9E 4DCGA 3HEMA 1D2HA 3JWJA 3VYWA 1RJDA 4FT2A 5E8RA 5EC8A 2PXAA 3JWIA 1IXKA 4QTTB 3T7TA 1TW3A 2O0LA 3GRUA 3HCAA 3NWBA 2YXDA 4QDJA 2VZ9A 4QQNA 4RYLA 1KHHA 2UYOA 3KQPA 3B3FA 2AOWA 4PYNA 5HIMA 4Z2YA 2P3QA 4DCMA 2AVDA 1WY7A 3B5IA 2OZVA 3BGVA 3FZGA 5GWXA 4HGYA 2ZIEA 4ER7A 3NDJA 5FULA 1R18A 4YUXA 4RVDA 1SVUA 3PT9A 1I4WA 2I6GA 2WA2A 2XYRA 5G02A 3C0KA 3C3PA 5DPMA 5T64A 4BLUA 5KS2A 5KYGA 1KPGA 4RV9A 1NW3A 1X19A 3SSOA 2GB4A 1PJZA 3G5LA 2IIPA 3DUWA 3TLJA 5LQNA 3DOUA 4GBED 4WXHA 2QE6A 2NXEA 3DLCA 1JQEA 4YUZA 4CKCA 3NTVA 4LECA 2R6ZA 4QVGA 3M6VA 5LQCA 3FUUA 3CVOA 3NJRA 4OBXA 2I7CA 2G70A 1ZHFA 1XCLA 2IPXA 3BGDA 3FRHA 2PX2A 2ERCA 5JR3A 5EMMA 3TPZA 4IWNA 4E32A 3G8AA 1JSZA 2AOTB 4B17A 3DR5A 3ELWA 3KQSA 3FUXA 2CL5A 3OU2A 2V74B 4X1OA 1KYZA 3FRIA 4GEKA 2ZW9A 3TKYA 3CGGA 4GUAA 2N47A 1VP9A 2H11A 2P7IA 2XVMA 3KQTA 2NP6A 3LCVB 3MCZA 3P9KA 3LDGA 2ONYA 1JSXA 4HGZA 5LQAA 2FRXA 3GRVA 2JH9A 3LHDA 2JJQA 1F3LA 1WXXA 2QRVA 2PBFA 2PGXA 3O7WA 4QTUB 4R8RA 2NP7A 3GWZA 3K0BA 3NW9A 1H1DA 1Q0TA 4R6XA 2PLWA 1NW5A 3UJCA 10MHA 1NE2A 5CM2Z 3TQSA 4P7FA 4DF3A 4OA8A 3AY0A 2O57A 5B1SA 4QPNA 5K0EA 3SGLA 5IKMA 1HNNA 5E1MA 1P1BA 1NW6A 5EPEA 5DSTA 2C7PA 3HCFA 2GA9A 5K0JA 3BKWA 5E9WA 4RTJA 1WXWA 2AOVA 5DRTA 3GO4A 3FUVA 1P91A 3V8VA 5GOZA 1SQGA 3M6XA 3M6UA 5K09A 5EEHA 3VC1A 4EMSA 3ANXA 4HTFB 1YFLA 3UWPA 5KQRA 4KDRA 2Z6QA 3OE5A 1G8SA 2C7OA 2I62A 3KQMA 2OKCA 3KR9A 1HMYA 3HVJA 2ADMA 1VE3A 3I9FA 3UJ9A 4AX8A 4DQ0A 1R6AA 4RTPA 3EMBA 2HV9A 3BKXA 1DUSA 5EIWA 5P8WA 2GH1A 2PV0A 4RTSA 1XJ5A 1XVAA 3UA3A 2AN3A 5EZQA 2VP3A 3UZUA 1G6Q1 2AOUA 3BZBA 2BH2A 1D2CA 3EMDA 3I5UA 4CWAA 4RVFA 4GF5A 2VS1A 1JQ3A 4HC4A 1VLMA 2O05A 4ER6A 3E05A 4NECA 3HTXA 3A26A 2JH8A 3DXZA 1XXLA 1RJGA 2OXTA 4RTLA 1NV9A 4PINA 4V0RA 4YV0A 5EOVA 2ZZNA 2FHPA 2BZGA 1N7JA 2UYQA 2B3TA 3EGIA 1RI3A 3FPEA 5T6BA 5CCXA 1IY9A 1XTPA 3NVMB 3I53A 3A4TA 5DT2A 5LSAA 4AZVA 3DULA 3E8SA 4KW7A 1ORHA 3FPFA 3UJ6A 2YTZA 5CD1A 3GJYA 3FTFA 4PCLA 3KPVA 3REOA 4CTKA 1BC5A 1Q0SA 3OFJA 3NDIA 3SSMA 3T7RA 2HMYB 3GRRA 3Q87B 2R3SA 4CKBA 1D2GA 3RW9A 2G71A 1KXZA 3EPPA 2UYHA 2IDJA 4MQ4A 4X61A 1XCJA 1AV6A 2NYUA 2AOXA 5EVJA 3EVAA 3M6WA 3FUWA 5M5BA 2OBFA 3EVEA 5K01A 2JHAA 3AXTA 5LQJA 4HRAA 4XUEA 1N2XA 5EKUA 1F38A 2NXJA 5KQSA 5FHQA 3MTIA 1ZGAA 3TFWA 3ELDA 2B25A 3G2OA 3K6RA 3KPUA 2HNKA 1M6EX 3FPHA 3KPYA 3KQYA 5ICEA 3BGIA 3EVCA 4FGZA 5EHIA 3P9NA 1PRYA 2YX1A 3HA3A 5KVAA 5E1OA 4GQBA 3THSA 4PGGA 1O9HA 3C6MA 4WVLA 5K8VA 3OZSA 1Y8CA 3OU6A 2ZWAA 5DWQA 3ELUA 4C07A 2IBTA 4OA5A 5HFJA 3R24A 3MTEA 2PT9A 2Y1XA 3M4XA 1G55A 4GOND 5EMJA 5DM1A 4DA4A 5MHTA 3TM5A 4PIMA 3P9IA 1M0EA 1ORIA 3MB5A 4H0NA 5ERGB 2OY0A 2BR3A 3HVHA 4CTJA 4EK9A 2JG3A 1FP2A 3R3HA 3WSTA 4RTNA 1QAOA 8MHTA 3BUSA 5C0OE 4ER5A 5CCBA 4EKIA 3SMQA 3TKAA 4C4AA 5FUBA 5K0BA 2H00A 5FA8A 5EMLA 3D2LA 1SQFA 4EQZA 2EG5A 1AQIA 3E23A 2ZSUA 3LDUA 2E5WA 4FSXA 3G2PA 3P71T 4KWCA 3GNLA 3JWHA 4P7GA 4R05A 4A6DA 4E2WA 4HSGA 1X1BA 4RVGA 1ZGJA 2P7HA 3BWCA 3UJBA 3HCBA 3LCCA 4CKEA 3HNRA 3I64A 3KHKA 2Q41A 3PB3A 4ER0A 1JTFA 2GAFA 3LBYA 5C1IA 1JR4A 3EVBA 2EJTA 3LL7A 3PX3A 1N7IA 3GDHA 4MIKA 2OPBA 1EIZA 3DP7A 3E7PA 4V0QA 1ZG3A 2YR0A 3ERCA 3OCJA 4PWYA 4XCXA 1RJEA 4PONA 5EGSA 4BLVA 4M7RA 2ZVJA 4PYKA 1O9GA 3EGVA 2PX5A 3ID6C 5E8JA 7MHTA 3P2KA 4GOLD 4M38A 2PX8A 2DULA 5FADA 3GU3A 4EVIA 2ZBPA 4QVKA 2WA1A 2ZULA 4RTRA 3SXJA 2CKDA 3LBFA 4BLWA 2LD4A 3CJRA 2AR0A 3IV6A 4FR0A 5U4XA 1INLA 5HIJA 4FZVA 3G7UA 1G8AA 5DM2A 5GM2A 5BXYA 5DX1A 2P1DA 2UYCA 3FPGA 5DTQA 5ICCA 2Z6AA 2OB2A 3G89A 2PWYA 5GIPE 1QYRA 2VDVE 4X63A 3EGEA 3MAGA 1FBNA 5C9ZA 5DX0A 3LGAA 2ZCJA 3KU1A 2Y1WA 4E33A 1RI2A 1QZZA 1RJFA 2OO3A 3T0IA 5HOQA 4OBWA 4M37A 4OX9Y 2YXLA 2ZIFA 4X60A 2P40A 3SM3A 3O4FA 5BP7A 1VL5A 3ORHA 3ER8A 3SR4A 3TOSA 4YMHA 3TRKA 5LQUA 2ZFUA 3DXYA 3HCDA 1MHTA 3R9XB 2PSSA 1R00A 1VP3A 5F2OA 4OQEA 3DTNA 4Y2HA 3PFHA 3FPJA 2G8NA 4U7PB 2CMGA 3B3JA 1MJFA 3V97A 3DMFA 1RI1A 3HVKA 2H1RA 2ONZA 1SUSA 1UIRA 1QANA 2G72A 5K03A 4HG2A 4M36A 5K0NA 1XDZA 1JTEA 4C06A 3GRZA 2BR5A 2AZTA 5CVJA 5DLYA 1P1CA 2ZIGA 4C04A 3A25A 2FCAA 3C3YA 3SSNA 4F86A 1M6YA 3HM2A 3IEIA 2FK7A 4K6MA 3MGGA 1O54A 2QRVB 3MHTA 4XUDA 2QY6A 3NVKI 5JUWA 2ZLBA 2ZZKA 1DCTA 2PY6A 3EEOA 3H2BA 4EKGA 4R6WA 3P8ZA 4P7JA 5LR6A 2YXEA 2GPYA 4LWOA 2NNWB 5DXJA 3A7DA 3RODA 3CJQA 3ME5A 5FHRA 3Q7EA 5HZMA 3F4KA 5CUQA 4RTKA 2G1PA 1X1CA 3QOWA 3C6KA 3DLIA 4F85A 1NW7A 2IH4A 4HH4A 1UWVA 3FYDA 5CVVA 2WK1A 5CVEA 3UJ7A 2A14A 4JXJA 3LKZA 5DRYA 2IGTA 5CVDA 5FTWA 1OR8A 1VIDA 1WG8A 3GCZA 3PVCA 4PYMA 3P2EA 5GP1A 4YUVA 4E2YA 3LDFA 2QM3A 2IDKA 4PYQA 3BWYA 4GC9A 5EZSA 4KRGA 3HVIA 4E70A 5K0LA 3FTDA 3KQOA 4PGHA 2F8LA 4F84A 1G60A 4YV2A 2IFTA 2AVNA 2HWKA 3GIWA 1FPQA 4E30A 4C03A 3BWBA 3JWGA 1RI5A 2ZBRA 1QAMA 1X1DA 3CCFA 4IKPA 4YV1A 3L8DA 2HTEA 2AS0A 5E1DA 4PNEA 3GRYA 2ZTHA 1JG2A 1T43A 1JQDA 4Y30A 4AZWA 4POOA 5EHGA 1IM8A 2P8JA 2QYOA 3PTAA 4PIPA 1BKYA 2PXXA 5EEGA 1R74A 2IH2A 2B78A 4BP3A 5BW5A 3HA5A 5ICGA 2O06A 3HA7A 2Z6UA 5BW4A 2ZBQA 5DSXA 1KP9A 2IP2A 3IYLW 4KIFA 1L3CA 4GOOD 4PYIA 5E2AA 2UZ4A 4E2ZA 3PLAE 3DXXA 1B42A 2KW5A 3I58A 4A6EA 3KR2A 5DX8A 4CXMA 1R8XA 4R8SA 4HTFA 9MHTA 5EIFA 3LPMA 3BT7A 4FT4A 5GM1A 3TMAA 3NMUF 2PT6A 2AOUB 1TW2A 2AOTA 5E2BA 1YZ3A 5CVUA 3PX2A 2DPMA 3M70A 3LECA 4P7KA 2P3OA 3FUTA 5DM4A 5EMKA 5GINE 4DKJA 2OB1A 1EJ6A 2IH5A 5F2KA 3FTEA 1L9KA 1V39A 3CKKA 5F2NA 4RWZA 1KPIA 3G5TA 1I9GA 3KQQA 4IV0A 4P58A 5FWAA 5HILA 4KVZA 5HIKA 3B89A 1XDUA 4PCAA 5GIOE 3PS9A 4AZTA 4AZSA 5E1BA 2AN5A 4RSRA 1JG4A 3SVZA 2OYRA 4QPPA 1TPYA 3O31A 2B9EA 5LQKA 4QDKA 1NW8A 2PX4A 3T7SA 4E31A 1EG2A 3NWEA 4OQDA 4QQKA 4ZTBA 1I1NA 3CBGA 5FQNA 3G2QA 1ZQ9A 1BOOA 2PVCA 4XUCA 1AF7A 2JHPA 3P9CA 1L3IA 4ISCA 5EG5A 4RTOA 1L1EA 3EEYA 3HP7A 3QV2A 4E2XA 3UFBA 5FA5A 1SG9A 3DH0A 2ZWVA
chains in the Genus database with same CATH superfamily
1CUJA 4XB6B 1VRCA 3E3MA 2HHJA 3FHOA 1PQWA 3JY6A 3ITNA 5H3LA 5HUQA 3OZEA 1IXSB 2VDKB 3ESAA 2V7EA 3HP1A 1B0AA 3LRXA 1T8RA 4F11A 4DA8A 3G1TA 2R1TB 1GKIA 5CA1F 3KEOA 2GILA 1RPNA 1DIOB 1KVUA 1ZVKA 3BREA 5LBIA 2IZ6A 1VPEA 4YLEA 4R2IA 2RGRA 4HAVA 4Q3KA 3BE8A 1T0UA 3IPAA 3A2KA 5DXFA 2O8DA 1J70A 1SU8A 1UJBA 1ZVVA 3V3TA 5M2QA 2GEBA 2Z30A 4Q66C 1XU7A 4BGUA 1I7SB 4J07A 3L4JA 3IIIA 1OLUA 5CDHA 3VBEA 4N39A 1G6HA 1P2FA 5FLEX 3GVCA 5JS1A 1YRAA 5CB6A 1AMUA 3BFJA 1G4AE 5TDHA 3VH1A 4YT4A 2Q4RA 3OOWA 1H22A 4MV1A 3KJQA 2IXTA 2FQWA 1IWBB 1GGKA 2F17A 4DWWA 4HH3C 1I2MA 3FGOA 2H29A 5LQRA 3MYYA 2QTRA 2REXB 3ECSA 3KDPA 4F4DA 2AWNA 3DGFC 4FHEA 4E6PA 2OV8A 4CM1A 1GQRA 4HOYA 1EDOA 3A1DA 4QGBA 5DTMA 1KMCA 1UBEA 3CSDA 3COZA 4M9QA 4KNVA 4PQGA 5DBFA 3KB6A 2R1VB 4EW1A 1UKVY 4FHCA 1ZA1A 5JZBA 3LUHA 3DAGA 4PR0A 2I1QA 2DR2A 1FP1D 4DLBA 1JILA 2VHVA 3REGA 4V24A 2K7ZA 1EDBA 4D4JA 1YZUA 1YD7A 1I4EB 3RUAA 3ZH9B 4NZ9A 3BHMA 5JNSA 1FSGA 1H2ZA 4DQUA 4M98A 1GG8A 2UZAA 4KIGA 1B4DA 2HJVA 5INTA 5C53B 2F2TA 4Q7JB 5HWSA 5JAOA 3BE4A 3H0CA 3G6KA 3NLLA 5D8DA 3D3WA 1A5SB 5DP2A 3VPDA 2W98A 3THYA 1PGOA 2C4TA 3QE0A 3GLHA 2G4CA 1G21E 3R74A 2C0PA 3OEHD 4UEWA 4FZRA 4ZAZA 2OYSA 4K9KA 3ZXYA 1RRFA 2H3HA 2Q50A 2HJGA 3ASVA 1GDTA 4BFVA 1S8NA 1ZK3A 1ECCA 2QRNA 3I8OA 2DPLA 4DMGA 4ITRC 4O8ZA 3RWBA 1M75A 1YAHA 4DL9A 1G59A 1TVKA 4HJXA 4QRDA 4OMCA 3ETCA 5E8RA 4HLDA 3ZV6A 4OGKA 5FQOA 4O1HA 1W5TA 4J6EA 3JAWA 2UYOA 4O63O 3A28A 4Q37A 3WMFA 1P9NA 4DPMA 3AGPA 4JDPA 1E1RA 1YDHA 3TW8A 2NUPA 4MR7A 2VPWA 5IF9A 1KDOA 1GHTA 2RHOA 1OTYA 1HDYA 2FQ1A 5LU8A 3CPJB 2AT1A 3KEFA 5K3DA 5KS2A 3UB4A 3GARA 5AJUA 1HMPA 3MTQA 5KTRA 1HSZA 3PJFA 4J1NA 5KC8A 2GEJA 4KC0A 1N78A 3R2JA 1T15A 1IY8A 3AEZA 1JNYA 3BTOA 1L5RA 3OH8A 3EC1A 1D8AA 2ZI7A 1F7VA 1VCHA 3W1WA 4FMCF 4L8GA 4Q9KA 5DTJA 5TPWA 3FX2A 3GHHA 3B1XA 1KE2A 1DUVG 2D2FA 3U17A 1ZHFA 2HH9A 3C4VA 1T4CA 2PX2A 5AKKA 1TF5A 3JQGA 3TPZA 2FW7A 5D3KA 4KN8A 2Z09A 4E5SA 4B84A 3FUXA 1JIVA 1CBUA 1NQVA 3OX1A 3OOJA 3KQKA 2VZEA 2ZW9A 1NONA 2P7IA 1GAQA 2JCVA 2ZR9A 3Q11A 4CTMA 2XKKA 1K5PA 3DPSA 1MC8A 4RGQA 3U48A 3M4NA 4XRRA 1Z0AA 4CEJA 1AN0A 4PO3X 4IWYA 5E7JA 4IIJF 4RENA 4EG6A 2DXIA 1TEVA 2I66A 4OHFA 4P7FA 4RVUA 4CQMA 2OM6A 3OHMA 1C1YA 3OKPA 2V8OA 1AB5A 1PNOA 1PZGA 2AC4A 2EKPA 3GDGA 1GUDA 3DBOB 5HK8A 4D97A 3T94A 1J00A 3A58B 3NC4A 4NV3A 2CW5A 1I2AA 1KO5A 4JROA 4YMIA 5DRTA 3T99A 4AZ0A 1SVSA 3NHKA 4RTJA 1U2EA 5LNK6 1WTCA 4NBNA 5DTQA 4TRMA 5EEHA 1OU0A 4OQNA 3TMKA 1E1QA 2PMCA 4P22A 1DPGA 2G36A 3ZBQA 3D1LA 1UZAA 4GSLA 4IIJB 4Z54A 4UHCA 1FVFA 1AS0A 3EXHC 3VVMA 4XWWA 1QZTA 4BKOA 3D2BA 3ZIAD 2RGAA 1QPBA 5HGJA 4MWCA 3ZJVA 2GEDA 5ALUA 1T4GA 2VATA 2XQGA 1M8KA 3AP3A 2YDYA 1G3IA 4S1TA 4XZ3A 3ZWWA 4B2LA 2YOFA 5E6RA 2H4FA 2WUVA 2R7AA 1YQ9A 2PS3A 4EI9A 5KU1A 1VFNA 4M1YA 3HXKA 1WQ3A 4RK0A 3SC2A 4CIAA 4D8VA 4H2DA 4QFDA 4CG0A 4XEHA 2F90A 2B1IA 4BYMA 3I5UA 1CB7A 2W6JA 3DONA 2FN8A 4J3FA 7ABPA 3SLGA 4KBGA 2EGHA 2O05A 4DIUA 4MVCA 1N2HA 2QB5A 4ND3A 1GV0A 4EENA 3I23A 1NPYA 1PX0A 2GQ0A 2V59A 3KWFA 2FMXA 3L8FA 4UMDA 4V0RA 1Z6TA 3QVXA 3WA7A 2PNJA 3B7GA 5EOVA 2UYQA 2HRZA 4UC0A 4CM8B 2I2AA 2IYOA 4CV1A 4BGEA 1OLXB 1IY9A 1ZUIA 1Y9DA 1ZM3A 2FSUA 3A4TA 5DT2A 2G9QA 3HUUA 3DL2A 2ZI5A 2Q6IA 2IHVA 5CD1A 2Q9AA 3KPVA 4GX0A 4NR0A 5FPHA 1NDHA 2HPVA 8GPBA 1YA6A 4WI1A 2YCLA 2MSCB 3SQNA 3AYXB 3NVAA 2EL7A 5IS2A 4DV0B 1OFVA 2HIGA 2QL9A 4BFUA 3U7FB 1GJRA 1ONBA 5FJJA 1KO7A 4P3PA 2MSNA 4ZZ2A 3R7NA 1AV6A 4E5KA 1J33A 3VH2A 2I4MA 2EHJA 1YOVB 4TMYA 3HO6A 3QELA 4D3SA 3DBIA 5I45A 1XT6A 3WGTA 4CLRB 5EKUA 4U5QA 1SXJA 5KQSA 4QU5A 2W6PA 3JQ7A 2L2QA 3K6RA 1II9A 3F6PA 4AMYA 5BNTA 5IFLA 3K96A 3PXEA 1TT5A 4JP3A 1NN3A 2FJ0A 5L4SA 2BEUA 1ZVMA 3M49A 1IHYA 2VOJA 3WQRA 5L4LA 1JXOA 5CDFA 4J2TA 1EPUA 1V48A 3KUXA 1ONSA 3BB1A 1GFZA 1NM5C 1NIJA 1IWOA 5I7AA 3ZW9A 5WRFA 4B3FX 5B7PA 4C5BA 2IXGA 3U56A 3C3WA 1J8DA 2OZPA 2WE7A 5D01A 4RU1A 2IBTA 4YIKA 4OXXA 2D2EA 1PT9A 2PL9A 2GAAA 2ORYA 3H1TA 3KTOA 4XYMA 4Y6GB 4ZVNA 2XYPA 2IUSA 2HRCA 2OCPA 3AM4A 4MQFA 2BMFA 2WTMA 2ZJZA 4U2KA 4E88A 5LB4A 4ENUA 3W4JA 4Q4DA 5SYNA 1ORIA 4B5KA 3RANA 4V1CI 1XRJA 2Q3BA 1U8FO 4JT9A 3SKXA 4C9BA 4CUKA 1N3BA 1YB6A 1EXDA 2HCRA 3IX7A 3BUSA 3ED5A 2IGBA 3PKZA 5BWLA 4HYEA 2Q7DA 3AKEA 3O91A 3K1AA 4KK3A 4TLMB 3U0BA 4N65A 2F59A 2XSZA 5L7TA 2F6RA 2I7XA 4G5OA 3E23A 3R5HA 5FL7A 3T3NA 2PH1A 3DUFA 2WHRA 4ZQHA 5KTKA 1CF2O 2P77A 4D46A 1PV1A 4TTAA 1I5OA 3ENZA 3WYNA 2P7HA 1QJCA 2OZLB 1JT9A 3H1GA 3KQHA 1CY0A 4MR9A 4CKEA 3A3OA 4KZPA 3JD0A 2B30A 1C4WA 2XDWA 5DYTA 1MMFB 3OD5A 3H1EA 3M9LA 4QT0A 1SBQA 3TIVA 3G23A 5BSTA 3H05A 1CE8A 4MGYR 1IHDA 5E6SA 3R3WA 2PVSA 4LXIA 2Q6TA 3BJEA 3KWJA 3LUKA 4IOJA 4PONA 3I34X 2BFBA 5G4KB 5KQPA 1LA2A 1SCQA 1O9GA 2AJTA 2VJAA 3C97A 1CTQA 1SUWA 2WFZA 2Q3FA 4WKBA 2ZBPA 3JZFA 4FC6A 2IVZA 4P4NA 4EG7A 3H6KA 4XJVA 2XW6A 1OD6A 1LUAA 4QTZA 1G7CA 2JGMA 2PK3A 4ZC1A 4C2UA 1CJTC 3DDOA 4OFBA 4BMSA 4LJ7A 3FPGA 1DKUA 1XAGA 4IH9A 4YACA 1GILA 2JFOA 1T5IA 3G89A 4FYMA 2QORA 4C0SA 1CUZA 2O5EA 1AGNA 3QSGA 4QDZA 4X63A 3ZV4A 3BZUA 4G1FA 5A0VA 3MC1A 3E7FA 1ZZGA 3UVEA 3F8SA 2IPMA 1UK7A 2IVFA 4TXJA 3GVXA 1L7VC 2VJCA 3IERA 1VFPA 4JIMA 4B46A 821PA 3RAEC 2YFQA 3LY8A 4L15A 1A04A 4LTMA 1I7QB 3RVJA 4GOKA 3EXG1 5DM60 2EIXA 3TRJA 2DWPA 3R9XB 3U9LA 4H3SA 2E4AA 2OWEA 4EG0A 3ORFA 1E4YA 4AS2A 4R2JA 5JVDA 2X9NA 1PJ2A 5C18A 2EBWA 5KJCA 1RQRA 1YRBA 1MJFA 2V5AA 3O38A 3T5CA 3V97A 1U0TA 2ONZA 5CRIA 3WL7A 5JECA 1NPTO 1ZUNA 3WXBA 3OTWA 2XA9A 4EWLA 2CL7X 4LGCA 4L0CA 4TVBA 3Q7PA 3GRZA 2GK3A 2BR5A 3X43A 1N2JA 2NPFA 2BDUA 1FYVA 1FS6A 1KZ6A 2FCAA 2V4ZA 1XX6A 4F72A 3WB2A 2DQSA 5HZKA 1M6YA 2P2SA 1WDMA 2ZQZA 4HX5A 2GTIA 3H84A 1HF3A 3IVMA 1XYGA 1EINA 4MYHA 4Z9FA 4TN1A 1GR0A 2M6RA 4LDQA 5GGYA 3T5MA 2KS6A 3NVKI 3WK4A 1CY4A 3WK9A 3M1LA 2HLDA 1PG2A 1YE8A 2YXEA 4LWOA 4XIJA 3KLBA 1GYPA 3QOYA 3N5KA 1CZUA 1P44A 3L0DA 4XX1A 1DX9A 1F6DA 2C2XA 5AKLA 5D51S 5HZMA 3KKLA 3F4KA 5ARBA 2G1PA 1PGJA 2B7BA 4KWIA 5CLIA 5TT0A 3D0QA 2RAPA 1T5BA 3CNLA 3VFDA 5ERYA 1P18A 2A14A 2H5EA 1L4FA 5J5AA 3P96A 4G0VA 1G4UR 3JPWA 2I67A 1VIDA 3N3AC 4OQXA 3D4BA 4Q05A 3MZ0A 1T1SA 4G0OA 2AZDA 2FTKE 3H3JA 3G2KA 2P90A 5BOVA 3CA8A 3BWVA 1GFWA 3KO8A 4HB0A 4TV8F 3DLHA 2FFAA 2HWKA 4I3HA 2P2ZA 5IVPA 1QBKC 5JNLA 5BW6B 5U9CA 3HG7A 1BQ4A 3JALB 1NX9A 1BKSB 3SHQA 3EC7A 3ZY2A 5DEOA 4M83A 4IQ8A 1QQ6A 2GLTA 1PZMA 4M9RA 5FL7D 2JFNA 1LQ2A 5KTNA 4CMCA 3JYNA 2WU0A 3C8MA 3LQ4A 3R41A 1W5AA 3T7AA 3FSGD 1G2IA 3EAFA 5K4HA 2VDMB 3LG2A 1DC3A 2P69A 3WRYC 2I91A 1UWLA 1U9IC 2Q1WA 4H4CA 4ABTA 2KW5A 3I58A 4YYZA 3GB9A 2IOHA 4HAIA 1R8XA 4QXAA 3UPUA 2AYXA 1ORVA 2VAMA 3WLPA 2G77B 4UBLA 2B4KA 3IQIX 2Q46A 4I5DA 2R11A 3Q9NA 3KIPA 5CVUA 4QO8A 4RFVA 1Z6QA 1UXKA 2BMEA 1EB8A 2V4MA 3DGEC 1GGJA 2AMLA 3W3AA 4P7KA 1R88A 3TL6A 2HFKA 3KUCA 3T3GA 3WJ2A 1I0LA 3HYTA 4OGLA 5GJWC 3ZHBA 1I2BA 2Q49A 4TTPA 1Z2EA 2IRWA 5KKCA 4P58A 4ERXA 2Q2WA 4LSGA 2BZSA 1YASA 4PCAA 1MG5A 4OLAA 3H8WA 5E1BA 1R6VA 2ANCA 3VR4A 1GGHA 1UT6A 4FW9A 1TE2A 5L3SB 5GMOA 3EZ7A 2C2YA 3LT4A 4PG5A 2F3UA 2P65A 4QDKA 1NW8A 3CX6A 4JT2A 4ZDIA 5B57C 1ZOLA 1G3QA 3NWEA 3WAGA 2B8WA 3ST7A 2QI9F 2ACEA 2JAQA 3M34A 1AU9A 3G2QA 3QPCA 1ZK4A 5E6SB 3ZZMA 4DQVA 1VOTA 3K4PA 4F04A 4JKIA 3O3MB 4ISCA 3HP7A 3EEYA 3PRKE 4F92B 3UFBA 5B58C 4IBOA 1Q1QA 1IL0A 5K05A 3W1EA 4ZTZB 3P2IA 3UCXA 3N0RA 3LZDA 3GLGB 5J63A 3TLGB 4B3CA 2ZVPX 1HA3A 1HDEA 2Q62A 3CURA 3LX6A 2B83A 4J1SA 3BSWA 2I29A 4B80A 1C0KA 3T3EA 2V3WA 4TV9F 1Q0ZA 4CM4A 3F97A 2AFVA 2CNWA 3ZNNA 1NF9A 1OH8A 4IFTA 3TSWA 5A1TA 2OCXA 2VP9A 1YFJA 2W5UA 2X8JA 2NZJA 2ODTX 1FTYA 1LS1A 1J1IA 2IY9A 3EQ2A 4WK4B 1YJBA 1C0IA 3V7FA 4W5HA 1H9AA 3KXKA 4DGSA 4BTVA 1OILA 1IN5A 2VDLB 4WCFA 4HN9A 5L3ZA 4WFJA 1Y6GA 2QM7A 1UJ5A 2IQIA 1GO2A 2WHXA 3GDOA 1CUWA 1I13A 3OMWA 1I0IA 2QUJA 3IOCA 1O97D 3EF1A 4KGXA 3RT7A 1Q0UA 1VL8A 3WYBA 5IXJA 3E7DA 1SJ9A 4A15A 3UNXA 3DDWA 2Y67A 2XMBA 5EMNA 4AN0A 2EZ8A 1CQPA 1HE2A 5KPJA 2OR3A 1EHYA 1JXAA 4NMLA 4TOIA 2H1LA 1UAGA 3EXHA 4K87A 1MDFA 1YJQA 1UC8A 4RL6A 3X0DA 3K0KA 1X9GA 3DFZA 2VUHB 2Z9DA 3F7OA 1T9AA 4LZLA 1EAMA 3WRXC 2EX4A 2Q2QA 1QRRA 3HLYA 4MYSA 4B32A 2BJWA 2CMHA 3T52A 3OJ0A 4KXVA 4I5IA 4ARUA 4BBPA 1RHMA 1ZKDA 4Q4AA 2F8MA 2GD2A 2VZLA 2OCBA 4QFCA 1JKJA 3QU9A 3UXEA 4UXIA 1Z0IA 3INGA 2HO5A 3UJDA 1ZGBA 3PFGA 4CETA 3FAKA 3K9QO 1UQRA 1F14A 4D9EA 4UW9A 4EYOA 1Y4UA 2P75A 3KFXA 2OC4A 4KXMA 3YASA 4WBNB 5I7FA 2OO5A 3QBEA 1DQPA 4IJMA 4PZYA 3SBEA 5I7OA 1C8VB 1IEWA 3O26A 2OGUA 3EASA 3OZGA 4KK4A 4PS0A 5TX7A 3SQXA 1BCSB 3FLAA 1RHKA 1V11B 4JY7A 3BDVA 3ROGA 5DBHX 3C3JA 3AI3A 4XGQA 3MQFA 2PU5A 2C4WA 4J7AA 1PZXA 4L8WB 3VHXB 3CUTA 5FO1A 1E2GA 1VJTA 2A0KA 4OHVA 4R31A 1N1MA 1KQOA 1GPLA 1UT8A 4JA2A 3II6X 1D2HA 1UPUA 4KJXA 5EZ6B 2DWUA 1ZJYA 3WNQA 4X66B 2CSUA 3HGMA 2WAOA 4JOQA 5FR1A 2PXHA 2ZJ6A 5CLGA 2WJ3A 4WHMA 2WJVA 1IYZA 3KP1A 4LXYA 4WBNF 3NT4A 4JLVA 4PYNA 4HWGA 4UHKA 5LOVB 1K89A 4DCMA 4HX9A 4NOMA 4DPLA 4BUJA 2QBYB 8AT1A 1ZRSA 2OZVA 1MPTA 2ZR7A 3BSFA 3IIEA 3K8QA 3PD0A 4KXLA 4UHBA 4XR9A 5H4HA 2OHFA 5BN4B 5AJYA 1IVSA 2WF6A 4IZHA 3F98A 4MH0R 4JI5B 4ZHQF 2ZVDA 2FWMX 1G5FA 1NW3A 3I9V6 4Q3DA 1W85B 3OOSA 1E1NA 4L9AA 4BCBA 3I6QA 4RK5A 3HUFA 1WKBA 5TEWA 2EKQA 2QK4A 4JITA 3WRWA 3WV4A 4CN8A 3DOUA 5LQNA 4MO2A 1I7NA 2JC3A 3GUHA 4E4RA 3NGLA 1EFUA 2ATVA 4ADSG 2GTHA 5ENVA 3A3PA 3C1UA 5LQCA 2QN9A 1XZGA 3GGJA 2WHQA 4OBXA 3SE0A 4CZ2A 3HLKA 3BXEA 3V1NA 1VKJA 1L7QA 2XE8A 3PX7A 3GLTA 4GH5A 2JIBA 1E0KA 1DO0A 5F1YA 4C6SA 3MTBA 3A9TA 2G07A 4CQLB 2VEDA 4KHPB 1A9RA 3GGCA 4RKEA 4DR3B 1IQRA 4HXEB 4YDHB 2W2XA 2C4MA 3P9KA 3AESB 3L07A 3IUSA 5DI3A 4R9NA 1OAKA 3NYRA 4RD2A 4QQFA 4UTZA 3AZQA 3GUVA 5IRCD 3ENQA 3PDUA 2JFBA 1QUEA 2CJYA 1ECPA 2XUDA 3GWZA 2PLWA 4J0JA 1ABFA 4PVDA 1ZCFA 2QU8A 1CUEA 5G0SA 4BJ1A 2Z5LA 1KWGA 1KR2A 4DV4B 1HC7A 1TD9A 5AVQA 2GA9A 5K5EA 1RQNA 5DNCA 2AOVA 2BV3A 1T0JB 4B6RA 4AUMA 3LT2A 5B30A 1D0VA 1RTKA 5GOZA 3CSUA 2ZIVB 4M0PA 4UAVA 1SVLA 1YIOA 3L7IA 4C7OA 3OE5A 2VP4A 2JRCA 2AKYA 4YMWA 1DDGA 3DJYA 2YZMA 3MLBA 3VZDA 1FLNA 3M6AA 2PMDA 2ROQA 4KE6A 5H0IA 1FXSA 1ZDMA 1Q7BA 2XODA 4ZU3A 3UJ9A 3OETA 4GI5A 1QU2A 3VZPA 2E1PA 2V6GA 3BPSA 4R7GA 1T0IA 4DCCA 1DUSA 1M1YE 1NQAO 4DNFA 2Q3EA 1XJ5A 3BD8A 4Q9DA 3FWPA 2OQRA 1A76A 1V5GA 2BISA 1VYUA 2CDCA 2FPSA 2I4RA 3E0QA 4B40A 3TUJC 4XDYA 1BW9B 4Y1FA 1N0VC 3PGMA 4QJ3A 3VOAA 4ZRNA 5GJVC 2NSHA 3FLEA 4HC4A 1E8DA 4ARAA 4ZZ0A 5HF8A 1DAGA 3QW4B 3L4KA 2O7VA 1RJGA 5EYPA 4J3JA 2FFHA 4PINA 1OW3B 3EPHA 2D1YA 3MGBA 4LYHA 3SDBA 1IZ0A 4MYRA 2HLPA 3G6WA 1ZFNA 3GP3A 4X1IA 4WVFA 4ECEA 1CR1A 1PJ8A 4MW1A 1N25A 2P4QA 4I5EA 4TL6A 4TTIA 3KFVA 3CW8X 1Y8AA 3UJCA 1F0YA 4E5VA 3FTFA 4HLCA 2H2GA 5J58A 2BSQA 3B6JA 4Q4LA 1I2CA 3JR3A 4P36A 3QUSA 2ZUTA 2XCQA 3BXPA 3L2OB 4MI1A 3DWEX 2IDJA 5BN3B 4A92A 1PVOA 4TMVA 2OKGA 3EQ7A 5BWOA 3AF4A 1O08A 2NYUA 1XV5A 3IT0A 1Z3IX 2DUJA 4RKQA 4Y8VA 3SG0A 2FUKA 1PUXA 2OEPA 5A7GA 1IM5A 3VC7A 4Z7NB 1VHDA 1YVUA 3QU5A 2B36A 4KAJA 2AJCA 4G5HA 4XUEA 1GQFA 2A9QA 3OZDA 3CLRC 3MWEB 1JNXX 1RWKA 3DL0A 3Q5GA 1PEKE 3A3NA 5DU2A 2B25A 4NICA 2AMVA 2YN0A 5DHTA 3PXGA 4YXWD 3VSDA 3OIFA 1VYHA 4M0CA 5A5GA 3UY4A 4GEGA 1P77A 3UHJA 4XPIB 1P7ZA 3C6MA 4PGGA 5IDQA 1PU2A 4D25A 4EW2A 3QWAA 1LX6A 2ANBA 3EZNA 1W8DA 3ZY3A 4BLSA 3K0CC 3STVA 4BHTA 5IH7A 2VTDA 4YV7A 1AKTA 2FZLA 1S2OA 1DKMA 1TGYA 5JY1A 2I3ZA 3DD1A 3WRVA 3JU3A 2W8ZA 1Q3HA 2GAOA 4C07A 5D2CA 4LA4A 3RFTA 1N33B 3Q3HA 4L4UA 1T8PA 5COQA 3WLSA 2EF0A 3LUAA 3E9ZA 1S2NA 1H8HD 2B4AA 3DVAA 3P9IA 1NASA 4LEIA 1K75A 4C7KA 1EDDA 2C7VA 4CL0A 3M3DA 3U4MA 3H2IA 1EYZA 3GJXC 3PUZA 4GWKA 4II2A 3ROPA 2CXRA 1Z2NX 3WSTA 9LDBA 3DAFA 5JJBA 1M1ZA 1V2GA 2PPLA 1RM4A 2XUFA 4A10A 3QSYA 3A0RB 1N75A 4HQLA 1GU0A 4HWTA 3UGKA 4R1SA 5IAGA 4LMAA 8ABPA 1XDGA 3WP1B 3RJMA 2WV7A 1ZXLA 3RARA 2ZAYA 4Q9HA 1E1KA 1TQ2A 4TVSA 1X80B 5EL0A 5IJ9A 3DV0A 5TF4A 5KNLA 4CQMD 4YR7A 5ALHA 2UVPA 4JLAA 3W6ZA 4KO1S 4N76A 3OQ1A 5K2MA 2O8EB 4NFYA 2EJTA 3I6BA 3ZQJA 5BSFA 4ZO6A 1NBMD 2ZRQA 4LJ4A 4F1WA 3SC6A 3RJ5A 5CEJA 2YR0A 4FZ3A 4HGOA 4EJMA 1L9XA 5DEIA 3QU7A 1U9IA 4GKAA 4EEZA 2V97A 3AF3A 2HK6A 1VL1A 3LMKA 3VU3A 7MHTA 5IHPA 1S2MA 3I8XA 4PY2A 1MH1A 2RI1A 1K9SA 2FPGA 3GU3A 4RCZA 3PI7A 1J9ZA 3BRWA 3SN6A 2GFQA 1RCFA 2ZRJA 3K30A 3LBFA 4OREX 3NBQA 5U4XA 1FRVA 2LKDA 4OQFA 1OXKB 1NN1A 3NPAA 4RNCA 3UAWA 3EQZA 2V3CC 2UYCA 5BXYA 2IYAA 4G6ZA 1TUBA 4BLPA 5BVHB 1XWWA 1XZNA 3ASZA 4LYGA 1KYIA 2W2LA 3E27A 4F7WA 4AG3A 2JGDA 3IHKA 5K0SA 3RM3A 4LRSB 5F4ZA 1VBKA 1PT6A 2FX3A 3I9NA 4CR6A 3HWRA 3Q9UA 1F2UB 4N01A 2ZJ4A 4E33A 2DBRA 2P9FA 2OO3A 1HUQA 3IP9A 1PP4A 3LRPA 5AVKA 5FPSA 1P1IA 4TUYB 2RH5A 5KCZA 1FVXA 3O75A 4OK6A 3VUFA 4P53A 3C43A 3NDBB 1SK8A 4INOA 5AUNB 1GTSA 3E3OA 4IR7A 4O2BA 2XWPA 1Q6YA 5KSZA 3TPCA 4LF7B 2VSXA 3TTWA 3CVXA 1O95A 1IOZA 3M82A 3HXOA 1U81A 2NWQA 2VHYA 3FNGA 5TGZA 2FETA 4EJSB 4JFRA 1ESDA 1ZBDA 1SIBE 5KSOA 3CIOA 2IXDA 4WK6A 1XMOB 3EG5A 2ZUWA 4TM8A 3UMFA 4CG1A 3MOGA 2RHRA 3U26A 3AJ8A 4FOPA 3TGWA 1YKFA 5IBRA 1U02A 2Z8YA 3H2ZA 2HY7A 1JR3D 3OEWA 4Q4HB 1XA0A 3CZAA 3OPYA 1UR5A 3K09C 1O54A 1U7ZA 1Z16A 2GYYA 2NPIA 2HQSA 2Y27A 3GJ0A 3MGGA 1H0RA 2GBFA 3OCYA 3P26A 4NV1A 3TXAA 3WRYA 1IK6A 1U28A 1XLTC 3ZY6A 2O1EA 2EZUA 4EP1A 5KSYA 3RVQA 5EJ5A 2YH2A 4J90A 4X92A 4P7JA 1Z13A 3DCIA 1Z8NA 4BNNA 2NNWB 3RV3A 2QV0A 2DCMA 1EWQA 2J9RA 1J0BA 3N8IA 2ZM6B 1U2GA 2ZG6A 4M4SA 5CUQA 3GGPA 4C0JA 3E8XA 2GO1A 2HT6A 1QTRA 5JADA 3UB3A 4AQDA 5HJ7A 3MGCA 4PLWA 2NYRA 4YCDA 3DNMA 4WFQA 3R9WA 1KI6B 1X92A 4LOJA 1OFHA 5FOQA 1QYWA 4AY5A 2FSVA 2IPLA 4PYMA 2Y4OA 2XIJA 3O0TA 4AO8A 3QUBA 3LDFA 3WWZA 3ZWNA 2E49A 3F8WA 4JSYA 5FBVB 3NHUA 2QUHA 3WA6A 3MAJA 1FPQA 4XR4A 5IF3A 3PC2A 1ZK1A 4WRRA 4BB6A 2ZJ7A 2GCGA 3BCUA 1RYZA 4N9WA 2X6TA 4NYMQ 5AW5A 2QN7A 3CZ5A 3MBIA 3OPVA 3IODA 2IXEA 4PC3A 5D5HA 3ZGLA 4B6EA 4DCSA 1THTA 2WTNA 3TRDA 3OJXA 4PTLA 5A3QA 3WOVA 1VKNA 4OLBA 3UAVA 1GUAA 1NSYA 1JBKA 1QS0B 2GYWA 2R85A 2B61A 1W49A 4UASA 1JSCA 2Y6UA 5EEGA 4E11A 1ENPA 1C2YA 3UMCA 5D85A 1TCAA 1C3VA 3CZCA 4OXNA 2O06A 1N5OX 3RRJA 5HPYB 4YQZA 3BQ9A 3FKJA 1Z5OA 4TWBA 1ZH8A 2C2BA 1OBOA 2B98A 3TXYA 3VXKA 4MUKA 4EZIA 5E2AA 4D8UA 1P62B 4QZVA 3BMQB 1CF4A 2ZYVX 2A4MA 3ZZ0A 4AKEA 4CXMA 2PR7A 3G2NA 3LE8A 1FZTA 3G1UA 9MHTA 1VKHA 3M3HA 4GNRA 4EGCB 1O96A 4ZRMA 2ZQ5A 4DV5B 1F20A 2HBYA 2GXSA 2OQ2A 4PZZA 3IAAA 1XRLA 2JZNA 3M6LA 2C3YA 4EGQA 3FETA 4G26A 4II7A 3IDSA 4R2HA 4W5TA 3FBWA 3FUTA 3Q6MA 3NBKA 4TSFA 1QB8A 2D06A 1FTGA 2DYKA 5JCPA 2FH5B 4D0GA 2Z5VA 4RWZA 3ANNA 5TGTA 5I9IA 1XMXA 2WPDA 2WQ7A 3ZCQA 3WYGA 3RHTA 1WPRA 4ZYLA 5ER9A 4L74A 1PL0A 4LVCA 5AKJA 1K92A 5FTNA 5L95A 3PQ5A 2XADA 4FMBB 3OLXA 1P73A 4H6XA 4PM4A 3SEZA 3UGTA 3WL5A 5JSZB 3ROMA 2YY5A 1RC8A 2VWHA 1KE1A 1XJCA 2VHEA 3RT9A 4BU0A 2Q4OA 4JUDX 2RC5A 3CU5A 3RFXA 5C32A 1QFXA 2O8CB 3T9FA 2GN0A 5J4YA 5MFZA 4UHDA 3L7JA 1RADA 5A0FA 3IJEB 1WB5A 2XLCA 3ZHCA 5FPKA 1OTHA 2XQIA 1VMIA 4FMPA 4ARZA 4YMVA 1Q0RA 4OXYA 4D9KA 3OM9A 4KN6A 1UDCA 3F7TA 4QGFA 1UP7A 2B8TA 4O29A 3DE4X 3DZCA 1FFBA 1SEPA 4QATA 3LT1A 2DY0A 3WBKA 2RHBA 3MT9A 5TE9A 5GZ1A 4KLAA 3ZLJA 1U9CA 1QM5A 2E5LB 4N4AA 2AG8A 3B5JA 3UWSA 3KU4A 4YXFA 2AMYA 2VJBA 2W0MA 1CIJA 4RIHA 4DMCA 3TR6A 3W6PA 1K6IA 3VH3A 2Y05A 2O52A 3BHIA 3KJXA 2P3LA 2C8LA 4PAQA 5DHQA 3WLEA 1N3IA 1CJBA 4E5YA 4C08A 1FTQA 5FWDA 4B47A 4GSYA 4DRXB 3ROQA 1J5PA 3NASA 3P5BA 5HBRA 3BRCA 1Y1SA 3AETA 3QKRA 1KDVA 1RWVA 1K66A 2O07A 2RHDA 1M1YA 3JSXA 1Y3BE 3MA0A 3QQPA 2V5VA 4JEMA 1IQ0A 4MWZA 4PZDA 4YPFA 1ADJA 1D9XA 1G3MA 1R8YA 1SBNE 2F4NA 1WXEA 3L84A 2J5BA 2X0IA 4G3XA 4IF4A 2PWPA 5LLSA 4QXQA 4Q3EA 4TYYA 3MUNA 4A8TA 1EXNA 3CF6R 5I3ZA 4Q9NA 1LZKA 5GVSA 2BCGY 2GF9A 5ENDA 1D8TA 1NWCA 1ADGA 1A4IA 1WP9A 2PMKA 4V0NA 3D3JA 3C6BA 4HMPA 5AM4A 4ZHQB 2NG1A 1FFAA 1F2VA 3T7CA 1W87A 4ALMA 5BUZA 5DBOA 2VSFA 4YY3B 4YALA 1NYLA 4MCJA 3LCUA 3WQQA 2IS6A 5TQJA 4G41A 1N9GA 2R6R1 4PE5B 2WAYA 4EY3A 4CEIA 3CN7A 1KSHA 2VKQA 4TXHA 2NTEA 2QU7A 4QTXA 5A4KA 2F8TA 3CH6A 2UVPB 3B9BA 1Y63A 3BHNA 121PA 4H7JA 2I9KA 3GFPA 4Y1RA 2POQX 1AB6A 3TQOA 3KJGA 3RIEA 3NUQA 4KBYA 4D9HA 1ULZA 1W5EA 4Y9RA 4IRMA 1EUDB 5F52A 5JS8A 1TZCA 2J9FA 5J2TF 4YAWA 2YJGA 3IVGA 4XLTA 3RSZA 1NV8A 1XL1A 2IS1A 1O5TA 2GN9A 4WOPA 1TVEA 2NZUG 4EG1A 1KMMA 2ASVA 3V4RA 2HXYA 2AEMA 4IJQA 3SK0A 2BI7A 5KQLA 1MEJA 4Z0HO 4PHGA 2P8SA 5ALOA 4LC9A 1E1YA 1JEJA 3B3GA 2HNBA 1EVEA 2MR6A 2YZKA 2NZ2A 4YCSA 4B6OA 5L6MB 1AN9A 2CF6A 1OWLA 4R5HA 4TLAA 4M0KA 1LBQA 2XQKA 4L50A 1Z7WA 4OCZA 4TMFA 2ZYSA 1WPGA 1Z88A 2AZ4A 2YWEA 3D4IA 3V4OA 1Y7HA 2YMQA 4BY9E 1F1JA 1V4BA 2G40A 3JQRA 3O6VA 3MJTA 4RMJA 2V58A 1B8VA 2FP4A 2J0UB 1ZUHA 3BCSA 2H08A 1T9BA 3BFVA 4JI0B 4EITA 1DWOA 3WGGA 3WFIA 1VB3A 4D57A 1E3WA 4J4HA 2JA2A 3EGWA 5JSFA 5L45A 5CTJA 1Q50A 4GPZA 5IW8A 5ALSA 4QLBA 5JSUA 3FCUB 2WWHA 4TSFD 1XMQB 2OZKA 1JS1X 3NDJA 4YI5A 2CXXA 1AY0A 5K3FB 5FKJA 1W4AA 3LH5A 1I4WA 3MIIA 4RAOA 5CK4A 1CUXA 1E60A 1DADA 1JJIA 2QRUA 3C0KA 2JAUA 3PFNA 4XASA 3IDFA 3PHGA 4I9FA 5TY0A 3WYFA 1ATZA 1KOFA 1UPAA 5B2FA 2F3SA 2I6QA 1WUKS 1PJZA 3GCDA 1VE9A 1XZHA 4KZKA 4NENB 2WJJA 4BU1A 3KYCA 4RMIA 1TYZA 3BZWA 3M2TA 2FUG6 3DLCA 4L8VA 3AT1A 2FPMA 4XB1A 3PDIB 4OQLA 1X70A 4R1MA 4K3VA 3TTUA 4WK0B 2ZPTX 4Y6PA 5JTTA 1C9KA 2BSAA 2DUWA 4Q7LA 3UUWA 5DGHA 3RAFC 2G9RA 4LRYA 3CO5A 4WNYA 1QV7A 4BO1A 1L7PA 3OP1A 4HH0A 1YCGA 1KA9H 3CE9A 1I32A 1NU6A 3IPLA 3KOOA 4BQRA 4OVKA 3VSCA 1U0HC 1Z39A 3KLOA 1O77A 1HE8B 4CF5A 5CG2A 1AG9A 1OUMA 1EHIA 4K6OA 4J3NA 4H7PA 2NP6A 1ULHA 2BP7B 4TQ9A 5FWXA 2CJWA 2VH5R 1NFRA 2FRXA 2VCHA 2EWVA 3DOIA 4ZVLA 1PT8A 1F3LA 2RIPA 3WGIA 2GHTA 2PBFA 5ALYA 3TK1A 3CR3C 4H17A 1KK3A 3HN6A 4ZVUA 1V35A 2QOEA 4R68A 4RC9A 4R9SA 4CBVA 4F4FA 3PC8A 2X7XA 2ZIUB 3CR8A 1TC2A 1KVSA 4QD3A 1KTVA 3SGLA 4IVNA 4MUHA 1HH4A 1GPKA 2I8AA 4HGRA 4MUNA 5JAZA 3QPUA 1Y4ZA 1X7YB 3HY4A 2H8GA 3BMNB 5HQTA 4UUOA 1ESZA 4RE5A 1BKDR 1XRNA 3O90A 2B5OA 4QOEA 1G20B 2FFQA 3UWPA 2VDOB 1JTVA 2YWJA 1PEDA 4P2BA 2Z6QA 4RK6A 5IP5A 1XK7A 5A2GA 4V2IA 4YMLA 3FHCB 4BMXA 4D42A 3UAOA 3EH1A 4YWHA 2HOQA 4F2DA 4BO3A 5DHPA 2GLXA 4CEIB 1FW6A 3ESRA 5TB5A 4JGBA 3NOQA 1Z7BA 2UUBB 1NTOA 2DF8A 2Q4TA 2ZB8A 3GQVA 4ZDKA 3MJSA 3RC1A 5T5QA 1COWA 5EIWA 2EG9A 2C4VA 3KQNA 4RKFA 2AN3A 1TIKA 1PTKA 4I7EA 2ZYTX 1DAMA 3CH5A 4MKRA 1J8YF 1A5AB 4RGYA 5G2OA 3HKDB 3FHJA 1Z4JA 5I7WA 2WD9A 5HA5A 3T06B 3TVYA 4IKOA 1KFEB 4K46A 3WXMA 3Q7SA 4JX8A 2Q0QA 1R0YA 1UEXC 1U8AA 2AXPA 1PDVA 5HIAA 4H3VA 3K0SA 3DW3X 4O4HB 3B6ZA 5A4IS 2Y2UA 2DKOA 5IABA 1NVVR 2DJ5A 2I99A 4DNPA 3MTAA 1XQVA 4JVNA 4Q1EA 1JKMA 2W71A 3H65A 4A6PA 2PGOA 4PWZA 3KBOA 3N75A 4GBGA 4S1VA 4C30A 1ZNYA 4NV0A 2OYCA 2A1UB 4DSOA 2GI4A 4PCLA 5AK3A 3K9HA 4XTRA 3U5ZB 4I14A 3ESCA 3OFJA 1V1MA 2HA0A 1Z6PA 2GYVA 1KHTA 1YCHA 2OGZA 2P5YA 3MJ4A 2WSSA 4D44A 2QSJA 1TMGE 1VYVA 1XTRA 4C4XA 1OIWA 5JH7F 4LOHA 4CM5A 5M5BA 2X5JO 5CX1A 4GIBA 3IQDB 3CMMA 4RADA 2WJ6A 1BDBA 1RU3A 3EZXA 4B2PA 5CFOA 2RGDA 1ZGAA 1ADYA 1SN7A 1UF9A 1Y8RB 2Q5FA 3HP4A 3ITKA 3LXXA 4LKRA 3M81A 5JARA 3G5UA 4NOKA 3UH0A 1NUSA 4M3NA 1T9GS 3N1UA 1O7JA 2JPDA 4XKJA 1FP4B 2HIMA 2W9XA 3GPDG 3H2KA 4MUMA 3U31A 4CN9A 4M1OA 4EQ6B 1ID1A 1M9NA 3HBJA 4LDNA 1IBSA 2O2IA 1CKEA 1QYXA 1YQQA 2XNHA 4BRWA 1RHJA 1E0DA 3GROA 3CZPA 4AF6A 1SUCA 3KL4A 3G0DA 5ES3A 2IHTA 3FCCA 4KYTA 3A1NA 4YC7A 1U1IA 3NJ4A 4F2HA 5KVSA 1GTMA 3LC7O 1FU8A 3M4XA 2REBA 2ACVA 5EUBA 2QUZA 1LGYA 5DM1A 4A9AA 2Q5LA 2SHKA 2PKEA 4QM6A 3UOGA 1GIAA 1M0EA 1YNOA 3MD0A 3PUYA 5B7NA 2DE0X 3SHVA 1YVPA 3N8GA 2BF7A 3IBSA 1C50A 3PSHA 2J46A 3IXMA 1UKZA 3K9LA 3EXFB 4C0XA 1SQ0A 3NJ8A 2RONA 1DT5A 4PFKA 3IAM6 4OXRA 3V4PB 4J1TA 4KQWA 3CR7A 1FRNA 1IZZA 1KAOA 2C61A 3DEAA 3LDUA 4JUAA 2BKXA 1MTOA 3FNIA 3QKWA 4P7GA 2CCKA 2PKXA 4WBSA 4YRAA 3FWHA 2FSFA 3NNDA 4OQZA 3RSSA 3KFLA 2MIIA 4RULA 5B6JA 1FQOA 3LDAA 3JALA 4UDOA 2P91A 3A9CA 4LJKA 3O8RA 3B9RA 1JTFA 4X65B 1OLSB 4CF3A 1QCDA 3WIVA 4ALNA 3ZWBA 1DPFA 3C3EA 3F71A 4NK4A 2P6PA 3F3YA 2JK1A 4C0HA 5C8ZA 1WXIA 3KE8A 1H9BA 3NANA 3RU2A 2OBYA 1FDUA 4NTZA 4BO0A 1DVRA 4ECAA 5CVCA 4JUFA 4V3CA 2V6FA 3SEFA 5LP6A 2H63A 1E89A 2IHUA 4MRRA 3WB9A 3IURA 3B36A 2B20A 2DULA 2PX8A 4K9LA 5DNAA 2IYTA 1PF7E 3TNJA 1IOLA 2ZKLA 3QVSA 1XROA 2X9GA 3DYBA 4PNPA 4CV2A 4YJ2B 5TMPA 4E7OA 3LOQA 3R23A 4XX0B 1VB5A 4RESA 3FOZA 4PCUA 4L4SA 3WNDA 3VVBA 2QVLA 1NMSA 1X86B 3BVPA 2OOSA 5ESWA 5EY5B 1AKQA 1ZGZA 3LYLA 1ZIPA 1GRRA 3LS2A 2NO1A 4YAGA 1KZ9A 1O57A 3CLSD 1N5RA 3HL4A 3P52A 5EJAA 5KYKA 1HR0B 3H9JA 2XNKA 3KYIB 1UBTS 2J5XA 4PRZA 1RI2A 3HWX1 5F51A 2ID9A 3G0CA 3W90A 3DT6A 5JAPA 2VYVA 4DV6B 3K8OE 3COJA 1EE1A 3HBAA 1TMYA 2GZ3A 3HJUA 4RZXA 5EPOA 2VSYA 1SQSA 1OJ7A 3KK0A 2XB2A 3KXPA 3DXYA 3HCDA 1UDAA 2PSSA 4O33A 2B37A 3HJAA 3ZGVA 3DTNA 4WZAE 1C1DA 1OH7A 4BFXA 5LP6F 4JVSB 3B3JA 5NULA 4CT5A 4WNIA 2XUZA 4BX8A 1G7TA 1T0BA 5I5GA 2O4CA 3FMPB 4JVLA 1XHFA 2QUKA 4O1MA 4RLFA 4YMTA 2PUAA 1V8PA 1GUFA 4B45A 4KO3S 4J4BA 2C3UA 2LXNA 1W73A 3M6FA 3PQEA 2KJQA 2PDAA 5CCDA 2ZBGA 1U8UA 2ZIGA 2OGWA 1Y8ZA 2JI4A 5M04A 4QASA 2IYLD 3HHPA 3IEIA 3K0AB 2FZGA 4K6MA 5I9BA 4EHLA 2QDKA 2MMCA 3JAWB 3Q6IA 3EFBA 4YRTA 2MYTA 3KOUA 3KXIA 3ZLUA 1DC7A 1IG0A 5KTMA 5J23A 4UUBA 1SELA 1C0PA 1X6VA 3ROFA 1DHTA 1T6YA 4ZXFA 1X1SA 1Z6XA 3C3KA 1JEEA 3CW2A 3W9UA 2GYUA 3GJ3A 4DA7A 4EYEA 2VLBA 1QR6A 1XCOA 3DEFA 3E5RA 1E2UA 1UWVA 1TAGA 4B3BA 2ZBUA 1N2CE 4W1QA 3RVKA 3H5VA 3I9JA 4YASA 5BT8A 2UXDB 3GAAA 3JASB 1PLKA 4YUVA 3ND6A 2D8MA 3I0ZA 1IY2A 3DLPX 1YJCA 3DAHA 4JXKA 3TKLA 5IJWA 3HKCB 2V6MA 3HVIA 2ZT5A 3E0XA 4NYMR 3G0HA 3CRW1 3RT1A 1B8OA 1MOSA 4WW0A 2QT1A 4LS3A 1FXUA 5F7OA 1KYXA 1UH5A 4PG6A 1GZUA 3IQZA 2Q21A 1VL0A 3I4CA 2BJHA 3GMDA 2PRJA 3QVUA 4MRMA 3U3KA 1UPXA 4X84A 3T5DA 4O25A 2Y9PB 3QE2A 4XGRA 5ISMA 1F3OA 4QHTA 1U3FA 3FMFA 1RMQA 4UEKA 4ALIA 2G09A 1RQPA 1WF6A 2ZIXB 4LOKA 3IFSA 2IH2A 3L4BC 3ZHYA 4EHHA 5LYJA 1NMYA 1Y1TA 3N2ZB 2JAOA 1HE4A 1XKTA 3GV0A 2J7PA 2G83A 3C24A 4JLWA 4OB8A 4PQRA 1GZ7A 2XYGA 2CD9A 3HR8A 3TEJA 3DCNA 3BORA 3GJ6A 3KR2A 4ZT6A 4YA6A 4R8SA 2JB9A 3AM5A 1J99A 2B94A 2KSQA 3T3MB 3SQDA 1U04A 3KSDO 3LPMA 3NBMA 2YMLA 4JBYA 3QVOA 4CDNA 1QPGA 4DT1B 1WQ4A 3AVXA 2XWQA 2CLEB 3R0ZA 3N8KA 3HJTA 4S35A 1AXRA 3K0FA 3W1VA 5B6IA 1XP8A 2QT9A 4KUEA 3ZWYA 2GJ4A 1V1RB 1XZBA 1YDEA 4WN9B 5TVGA 2A92A 3JQ8A 4A23A 3JQEA 4EO4A 1K1EA 3IILA 1A5ZA 1F8GA 1P6XA 2ZIAA 3BE5A 4JOCA 1V25A 3RYFB 4N0MA 1HOXA 3BN3A 3R7DA 3HXMA 1UDRA 1RWPA 4NYIQ 4KSCA 4S1NA 3N6XA 3ICWA 3K16A 4TTRA 3CRRA 5FWYA 3PJRA 4LAFA 3A4IA 3L6EA 1TUGA 4UTRA 1MN6A 3DW1X 5IVIA 4GMHA 5BYBA 3OPQA 2EVWX 4OHOA 1I3NA 2A0XA 4RMNA 4M7OA 1SH7A 4KODA 2E9SA 3BMNA 4E4TA 2CFRA 3LBHA 3E1SA 5CDSA 4TKUB 4XOIA 1E6CA 2PVCA 4ES6A 1E98A 3H9EO 4XUCA 3KB8A 4RV4A 2JANA 5EG5A 2LNDA 4E2XA 4KQGA 3O4VA 2ZUUA 4HDQB 1SG9A 4BJHB 4F3YA 5L51A 5CH3A 2QNRA 4IH4A 5T67A 1EP2B 1U6KA 1BJKA 2BKEA 1MVNA 1QYIA 2PS9A 2I54A 2Z3WA 1N92A 1SUIA 2XRMA 3HCCA 3I5AA 5CLQA 3FSEA 3G8BA 5C7OO 4D5EA 2JAWA 2PD6A 2FEPA 1HPLA 4BGDA 2XBLA 4BNTA 1H5NA 3LGSA 2YYYA 4Q3BA 2XYVA 5IC5A 5AICA 5K3BA 3SKVA 3TX2A 3CEMA 3VDXA 1C9NA 1GPDG 3G88A 1RI4A 5L9AA 1AV7A 5FWNA 2A9FA 1OVGA 5C46F 3RS9A 5K0GA 1PWXA 2ODWA 2ASEA 3L7YA 2FPOA 4RPIA 4DXAA 5E3IA 3ORYA 1G4HA 4LDRA 3ZIAA 1UOQA 1JLLB 5JCJD 4WV3A 2UVDA 3QXCA 2L17A 3BMXA 3ZXIA 3AEQA 3KQWA 3VC2A 2IODA 3GA5A 1U8EA 1WHSA 4FE4A 5JRZA 1WZNA 4EUHA 1V41E 4CKZA 4IV8A 1TA9A 3ZU2A 5BORA 2FGKA 5HKKD 1YB4A 4QVIA 4JC4A 2YJNA 3VSEA 3O2QB 3HXTA 1EUCB 2H1WA 2Y76A 2YJ5A 3CPHA 4NEGA 4XGNA 3PNOA 2NADA 1P2SA 4L02A 4Q1BA 4XYEA 3D1VA 3V4ZA 2BFMA 1Z74A 3QVLA 1OLOA 2CL6X 2RBEA 2ZCUA 4ZGWA 3WBJA 4X20A 2O23A 3C4QA 1JJVA 3GCXA 2IHKA 2JCBA 3A11A 3R6TA 5JJCA 4OMFG 2Q5QA 3F4BA 1QRUA 4WY2A 1G8JA 3S2GA 2J09A 1NP3A 5AJTA 5LNK1 5LQMA 1FJXA 1YS1X 2DQ4A 2MDTA 2Q9UA 3UJ8A 3VJRA 2DPYA 3JQ6A 4QPZA 3Q1LA 3DDHA 1JRLA 2ABWA 3BDAA 4MLPA 4Z8YA 4YUYA 4L73A 3GLIB 2JH3A 5HUHA 1FUIA 5EJ6A 1KI6A 2ORIA 1XRMA 3VR1A 1EUYA 4FGSA 4UARA 2GN2A 2UUAB 2FN7A 2LP4Y 4I2VA 3VUEA 3NAZA 3VRHA 4NAVA 3ISVA 4Z7QB 1YUBA 2QZSA 2RHTA 4AB1A 3JV7A 3HSSA 1CUHA 3JS5A 2JLCA 1X39A 2QLJA 3ZTYA 3O0DA 2C97A 2R86A 1TQ6A 5KINB 1T4CB 1Z6AA 2CNOA 2JZOA 3JQCA 4AJOA 1YMVA 2OBMA 2VYVD 2X77A 2PJZA 3W2FA 4D45A 3LYHA 4AYTA 4U7TB 4ZHQA 5JANA 5KZMB 1DRJA 5DULA 5LXTB 1D1PA 2BRUA 4P0QB 4D8WA 3GI1A 4HAWA 5EJFA 4YP9A 4CUZA 2PXAA 4YN3A 3I2YX 1W48A 3OVMA 4DSTA 3ADBA 3BH7A 4ZODA 2HMWA 2YNMC 3COSA 3IVCA 1WRBA 2AVDA 1NW4A 2HJSA 3OAAD 4GBMA 2MCFA 2PUGA 3EOAI 1NRJB 3NAQA 5BN5B 5I51A 1XA3A 2Y2VA 5BQ3A 3NP9A 4Z3OA 4GVXA 4X6UA 1V26A 1X2EA 1XZEA 4IGKA 1Q14A 3USCS 4CIWA 1PNQA 2X8LA 3KYDB 4DLVA 3G5LA 1JDBC 4UUQA 5H8WA 3KCNA 4ZIRA 1QH8B 1BXKA 1JQEA 3W3ZB 5LUAA 1K8XB 4EW6A 3QNMA 4KACA 3OZVA 2V54A 3LLUA 3P32A 4MI9A 1UIMA 1OH6A 3C41J 3NJRA 2GPWA 4GRIA 4D1YA 4EDFA 3V7YA 2QP9X 2G8LA 3PF9A 3V8PA 4C4RA 3IB3A 4R16A 2FCRA 4D81A 1P60A 1OA0A 4BV3A 3AJ9A 3COWA 3ZYZA 3BJRA 5FOUA 1VP9A 4J0HA 3V7WA 2O3JA 1S8AA 5EJ7A 1US8A 2Q5IA 2XKAA 4Z9BA 1JSXA 1SXJC 2HU7A 1CUFA 1TPZA 2X5XA 1YC2A 2O7RA 2VKTA 2JH9A 3DL4A 3GRVA 3ILHA 1W29A 3LHDA 4HWRA 1FEZA 4A7PA 3FFXA 4EB3A 3UHAA 1KEKA 1A8SA 2WVGA 3HB4X 4FEYA 4TYMA 4YRGA 5AQ1A 1SUPA 1HDOA 3E70C 5BN5A 2IKQA 3AUJB 3LQKA 1R4NB 4D0RA 3A1CA 4E1AA 4EEXA 1QDEA 4OA8A 5CYOA 3JD4A 3EQ6A 5JXWA 3UPTA 1E9SA 4G25A 1ZNXA 3JQQA 3QPBA 4Q9IA 4ZCSA 1U0NA 3RG2A 5NLLA 1IN1A 1AQNA 3A6DA 2XGJA 2W83A 4CMEA 4ZO4A 4JXZA 1CETA 3OZCA 3VDNB 3IDZA 3LUPA 4FI3C 3WAKA 4F46A 2PWAA 2EFGA 3I04M 1BX1A 2BM0A 3MMSA 4O8CA 4XLLA 1GT6A 1C1HA 4LNUA 5CEFA 3GLSA 4NZYA 2QS9A 1K27A 1DC8A 2XUAA 3PPVA 4WKGA 1XMPA 3WIEA 3K70B 3HYLA 1V16A 3AG5A 5ALWA 3OD1A 4JGGA 4U6NA 4CKCB 3CPSA 3O7MA 4P5PA 2FWAA 2OKCA 3QHQA 4X6XA 4F6RA 4L9SA 5GJBA 4GO1A 1UXOA 3TVTA 4RTPA 5GZ6A 2CVOA 4I8IA 2XY4A 1M5RA 4HL6A 5EUQB 4WLEA 1XVAA 1K0UA 5JROA 3OQOA 2AK2A 1B16A 3DB2A 2Q6LA 3AFHA 1Y48E 2Q1TA 2ZJYA 2WP8J 1N5KA 1TJ3A 3AK4A 4OFZA 2PH7A 2RHLA 2GN4A 4P31A 3O4JA 1CD5A 2EU8A 2H4HA 1CULC 4MUXA 4R1LA 3WWPA 5IZCC 4ZI3A 5TC4A 1ZD3A 3ZV7A 4MVJI 5EJIA 3FB4A 3VTAA 2VF4X 2YJ4A 1EP3B 3GPIA 1W581 2AUMA 3R0XA 2AHOA 4EAQA 1YR9A 2ECOA 2C20A 2WFMA 3QP9A 3VA7A 2L0XA 4EF4A 1R0RE 1RYEA 2C5FA 5LDHA 2VA8A 1P0PA 1PLLA 1CFZA 1RZRD 1JE0A 2Q3MA 4PZ0A 3S8MA 5B7QA 4WUVA 1QF7A 4EI8A 2BGKA 4W7HA 4BZXA 3JZAA 4G9GA 3RV4A 2Q1SA 3RFCA 4CE6A 1L5YA 2V3VA 4KGDA 4EI2A 3IQGX 1QIIA 3FGPA 4LQCA 1Z28A 1H23A 2D5IA 3Q87B 3RU3A 2AF3C 2B3DA 1CSEE 4BEJA 4HXGA 5DLQC 4JBXA 5KYUA 2AOXA 3IAM1 3SOZA 2C59A 2WTXA 3AWDA 3LZCA 3G8YA 4FS3A 4CIBA 4FCCA 1FSFA 5KNBD 2H65A 2CJPA 5G0TA 4GX2A 1EK1A 2I3DA 4EFNA 2GN6A 3T1HB 3R3UA 5FHQA 1O8CA 1R4NA 5HBGA 1R6UA 1WW2A 3K4HA 2X5OA 3L7LA 3PNYA 4FTWA 2FV8A 4NABA 4GZ3A 2FX2A 2XMPA 3ORSA 2PH3A 4EABA 4KQ6A 4BO8A 1DBIA 3FAZA 2R6JA 4IP0A 3MOSA 3ORQA 2PKQP 1CW2B 2ISCA 2OECA 3K2IA 1V47A 3NYWA 3QW2A 4EB6B 1BO6A 5DP1A 1Q83A 3LC1O 3FD8A 3FFWA 2HC9A 1OQAA 3S1AB 1CG6A 5ETJA 2XVYA 3LF1A 1SBYA 1C0EA 3ZYCA 1RQ2A 2LVBA 2IYEA 1KP2A 3AX6A 3T35A 3T4PA 4NULA 1DBSA 1Z18A 1Z17A 4JQYA 2XCUA 3OZIA 4CTJA 3A1UA 1SCBA 1QAOA 4PZEA 4Z1OA 4HEJA 1K9VF 4Z3DA 4V0SA 1A9YA 1NY6A 3UAZA 3JYHA 4QJBA 5B4TA 4QXRA 3WLJA 3FNBA 3MWKA 3HXPA 5LLDA 1X8KA 2PYZA 2UZ1B 3MGKA 5SYMA 3WOHA 4AWXA 4JODA 1K4KA 3P71T 2IY7A 1MABA 5IAAA 1J2EA 3IHLA 5JQGB 2G25A 3PT5A 1V8ZA 4EYQA 2C2OA 2JFWA 4O1IA 4EYKA 2PQ2A 1Z07A 3R20A 1ZCJA 3KHKA 3G0OA 4JB8A 1B73A 1E5VA 4V3BA 4D4LA 3HRHA 3OPXA 1JGTA 2A7XA 2X3YA 4NDNE 3PX3A 3N0VA 4NKRA 4HTAA 2NTYC 1C80A 1IUNA 1E7WA 3QUTA 3IAS1 4BLVA 3DMTA 1DP4A 1N5MA 3T9BA 4PANA 3KUDA 2VAWA 5K6TA 4W5RA 5HJEA 1G9SA 3NIGB 5HCUA 1M8FA 4GOLD 3ZQKA 3UK2A 1FYWA 2A9JA 4BQOA 3NTOA 3X1WA 2NX2A 2WA1A 3L7DA 3W77A 4ZKDA 4TTTS 3NHMA 4FKMA 2LD4A 2AQIA 3NV9A 4WPGA 3BE6A 3U4CA 3F5QA 2A1TS 3N2NA 4TL9A 1ISFA 4MPPA 5FFMA 3SQOA 4FZVA 3ON5A 2P1DA 4TKMA 2NYVA 4JI1B 3JYPA 4FUTA 1UXHA 2OXCA 2RJNA 1TYEB 2NZXA 3HZOA 4FDTA 3K92A 4PC7A 3F78A 4B81A 4QBKA 5FI3A 4RK1A 2HCBA 2XJ9A 2O8DB 1HG0A 5F23A 4UHFA 1KZGB 1QZZA 4RA9A 2X15A 4KO2S 1MGOA 4DDWA 1K6EA 4M37A 3PGXA 4QFBA 4X60A 1E4VA 3ZU5A 4DR7B 4XFKA 1C3JA 1E9VA 1HNZB 1F6WA 3TL3A 5JQGA 2E4ZA 2WWYA 4CCWA 5JZVA 3FNQA 3E53A 3N07A 1JHVA 2X8WA 3UT6A 2VBCA 4YRBA 4J9UE 5JVDF 4N3NA 1VM6A 3IA2A 3F6YA 4FHGA 2I2DA 3GCWA 1IPEA 3NEJA 4TXLA 3W05A 4ASUD 1D04A 2FZKA 3HKCA 2C4KA 2GPSA 3U13A 1J8QA 5CB4F 1BIFA 1UK8A 1HRKA 3QVGB 2IEGA 3ABIA 1Z4IA 4G9EA 2Y71A 2H2AA 3RHZA 4QX6A 3JTEA 5FEMA 2PJRA 3EIXA 2C42A 3D3KA 4REQB 3LWDA 3CX4A 4B3DA 5HQJA 4XD2A 5LFAA 1PT7A 3QWBA 4X1KA 2L19A 1UBMS 4ZPJA 5SZHB 2IUUA 1L8AA 2FLVA 4GICA 3GAZA 2HPAA 3QQ5A 2B4RO 1U80A 3P0IA 2XZOA 1GRQA 2DPXA 2O2SA 1A97A 4GUDA 5C5CA 1IZ7A 3DKVA 4IL5A 4XPIA 5JUWA 3EEOA 3GJTA 2WJHA 2TMYA 2WT9A 3WLFA 1NOKA 4CMGA 1WVGA 2I3BA 5LR6A 3OJLA 3SF8B 5T4BA 3WDSA 1NXTA 4MEAA 3EW9A 3RODA 4H7EA 1LTHR 4DMKA 4RTKA 1A8QA 2IIVA 3CWZA 5LZ2A 3AF0A 4LFCB 1ORRA 2XCRB 4IZIA 4HH4A 3TOZA 1USVA 4EA8A 1KDPA 3UJ7A 1Z4LA 3DMNA 2RKBA 4BV8A 5FFNA 2A6PA 4BVJA 3A10A 3AFNA 3I37X 5DCLA 1RRPA 4QREA 4MA0A 3CG4A 2XOXA 2DQYA 1V7QA 2GZMA 3OFND 3ONNA 4A2PA 1ML3A 3V80A 2VG8A 4D02A 4QARA 3LPLA 5U4QA 3V2IA 3UH1A 2YRFA 2CLMB 2VDNB 2WG1A 2ZUEA 5DI9A 1Z47A 3KQOA 4TZKA 4M8KA 5B53A 4Q7MB 2RG7A 1Y9JA 1EM6A 2O1WA 2DU8A 2ZRMA 3BWBA 3QPWA 4H1HA 1OXTA 2QR3A 3VZQA 3DDNA 2QN1A 2TS1A 5DNVA 1L5QA 2XA2A 3FWYA 4OOEA 4PNEA 1OB5A 5FNVB 4BV2A 3WSVA 2VYND 1U0EA 3I0MA 1VC2A 1M8JA 1SKBA 3HS3A 3IPRA 3ORRA 4N7BA 2BFFB 3FMIA 3RUHA 1Z63A 1C3OA 1SOWA 4UUMA 5BNFA 5K3AA 5SYAA 3TZKA 5LP6B 3B6EA 5BPFA 3IUNA 2O3QA 1DEOA 2J59A 1DQSA 3ASYA 4D8TA 1T3LA 1DV1A 2VJMA 2IP2A 2ZJ8A 3LW8A 4KIFA 3D6UA 3RSLA 3TOCA 1G42A 3I3OA 1GVHA 4NU6A 1Z4PX 3KELA 2QG6A 4JQOA 2X2EA 3LNCA 1RHUA 4YJHA 4I8XA 1GLVA 4HTFA 1UDBA 3JPYA 4DA6A 3HDVA 3W5UA 4MARA 3WYAA 3IMCA 4K2AA 4YMUA 4HB4A 2J41A 4RWEA 5DN6D 1E1MA 1YZ3A 2N75A 2QUBA 3NNNA 3PE6A 2XDQB 3AR4A 4OI2A 4YFYA 1CP2A 2F43B 5EJ4A 4TN5A 4CJXA 3PNLA 2ZATA 4URFA 1QP7A 2Z04A 3AUAA 4M1SA 5DYIA 1IBMB 3LLCA 2DHRA 1MJHA 3A1VA 3Q88A 2FEOA 4C0KA 2ZSIA 1Q92A 3PIIA 4GECA 1Y5MA 2ZWMA 4RD4A 4O2LA 3RWMB 3SQWA 1TO1E 1T36A 4RSRA 1PK8A 2JIZD 4WACA 4ZJZA 4M0LA 5TQ0B 3CHYA 4ZZ1A 1QF6A 1E9BA 1YGPA 1C2TA 3GFBA 3DZHA 3O31A 3QYJA 3WHIA 4F45A 2R2GA 1A2KC 3NHSA 5REQA 4HJRA 4WGFA 5CDFE 5ALNA 3VKWA 3F4LA 3LLMA 3FDIA 4AJ1A 5CD9A 1E2BA 1L5WA 2FHSA 4P8RA 1ZOSA 3EGCA 3QKRB 4B6QA 4NLLA 2OK8A 4AN4A 1D7OA 3CFYA 4GMXA 2NO4A 2IYNA 2HMVA 1FP4A 4N82A 4A2CA 5FI0B 4CM9D 2IT1A 1VGQA 2QJRA 4HUJA 5AW7A 4PG7A 1SKAA 3NTRA 1KJNA 3FYCA 3QTLA 1T1JA 4V1CA 1W2HA 3KV3O 3O21A 4I6JA 4Q3OA 1DC6A 4QRIA 2C8VA 5FL3A 1JI0A 4ENSA 4HDRB 3HFRA 1EFHA 3EVDA 1PUIA 2BOVA 3A31A 4OY3A 4F93B 2CN1A 4NCAA 3KT0A 4W5JA 1Z4MA 1DC5A 3EISA 3WNCA 4EYSA 1ECJA 2R5FA 4NVRA 4RBNA 4G67A 3UG6A 5I7RA 4LRTB 3X2FA 2OV6A 2QX6A 4PYOA 3WHKA 3D3WB 5JG7A 2NPOA 4XWOA 1JB9A 2FZCA 1T36B 1TM1E 1Y5IA 3IAFA 3EIQA 3K6JA 3F67A 2AJBA 1EH5A 1VLJA 3D7MA 1E1DA 1JI3A 2X76A 3D8SA 5FCDA 3NYIA 1EAYA 2R62A 1E4OA 2J1LA 2XVAA 5CA1B 3B2EA 3WKEA 2IPNA 4S0XA 4PPYA 2IOFA 2X6RA 3FDJA 5AWFC 3ZTTA 2R48A 1QAQA 1Y4SA 1VKRA 2DUNA 4FINA 4U7JA 3VYUB 5E6RB 2EFHB 2B2CA 3VNSA 2PIDA 2ADFA 3KPJA 1QE3A 3AILA 3K15A 2DKFA 1TIPA 4L8LA 3OFSA 4HQRA 1RWWA 3CGWA 4FDAA 4O02B 1KRWA 5TGDA 3QEAZ 1AQUA 1U0SY 4FLEA 4B6JA 3EDOA 3EEIA 1WULS 2C96A 1Q19A 2IBMA 2QMHA 1JYEA 3NI2A 1SULA 2OHHA 4YRCA 1RW4A 1YH3A 5ED4A 5EQJB 1WCV1 4B35A 3KT3A 3B48A 1KYTA 4L0QA 5HK9A 5AI6A 2PZMA 2I9PA 3U6BA 1T4DA 2I4OA 1QWSA 2GEFA 1GNVA 3CZ9A 3KLPX 2ZRPA 4UOEA 4TSKA 2YZ7A 1QHEA 1K7EB 1MAUA 4BE9A 4O4JF 5AVUA 5TRTA 1ZC4A 2X2FA 3QBTA 4M1MA 2C5GA 2CVPA 1JLKA 4LRWA 5IT9A 4LE1A 1H6CA 2KPOA 3F6RA 5FBWB 4BVAA 5LM3A 3EFEA 4FYHA 2I2WA 2BTOA 1FMFA 1D1SA 2V03A 3DMGA 2WOJA 2PGDA 3M3PA 1CHDA 2ESRA 3AUYA 1ETUA 1N0IA 2O2CA 3ELYA 3ETJA 3FMGA 5EINA 3OPNA 5A06A 5KWEA 3GJRA 1MQ9A 1FFXB 1O1YA 3BMQA 3ABSB 1EM8A 2PUFA 3PRJA 3UTDA 3CH7A 4DAOA 1VG8A 4K9PA 4E7PA 1YL6A 1MX5A 1R0BA 2HUPA 3ND8A 1QRDA 3HNOA 1XTBA 3R3ZA 1XMJA 3I01A 1JKIA 4U8GA 3OX3A 3WTCA 1NG1A 3FPBA 4MROA 2JI9A 3DE5X 4X7RA 5DLPA 3GFGA 3WIOA 1E94E 1IH8A 2DT8A 4OUKX 2QHXA 2IU3A 1ACLA 2P1ZA 4QQNA 3KQPA 3D4LA 4LQ4A 4QDTA 2H1FA 1OXBB 5A71A 1PO7A 4D79A 3AEKB 1G17A 4YJKA 4BGVA 3RVSA 4ZZIA 3WE7A 3M1IA 2R79A 1EGQA 1BHQ1 4NOJA 3ONWA 1A71A 4CIYA 4U0JA 3SS9X 1P4JA 1J09A 1YBMA 5BSUA 1SOVA 1C3XA 3A6KA 4B3JA 1VL2A 2I8CA 1CUIA 1Z82A 4I50B 3DUWA 1UBUS 3W5VA 4C4YA 3G0BA 3RLIA 2QQFA 3UJ3X 4BL5A 4WCFC 1OI7A 2CNLA 2FR1A 2QJTA 3OIUA 2PUTA 4MS3B 5B1IA 1EX7A 1V16B 3X1ZA 2WM3A 4IUYA 2O5RA 3ZVLA 4CKCA 4X1KB 5AI5A 4DVJA 1A9SA 1SCDA 3FIUA 1A3CA 2GNPA 2W4QA 2QTWB 4B2IA 2NU9B 3HNPA 4MB0A 1BYIA 5JNTA 1IN8A 4U8HA 3RGWS 1SQ6A 4O4JA 3M9WA 5EE9A 1RR6A 2H6EA 1Z45A 4NCNA 1Y9AA 2Z1MA 1X7ZA 2XNDD 2WAMA 4WDQA 3LLSA 4GEKA 5JZOA 3S55A 4G8JA 2VT2A 3GD7A 1PNTA 5IVKA 1Y1LA 4Y2QA 4RKRA 2WW8A 1RYDA 1FTNA 2NP7A 4AO6A 4FMCB 2XBUA 4PPGA 5BR4A 1Q0TA 3R3SA 1HYEA 2XX3A 3KVRA 4FVTA 4L75A 4Y67A 3KV1A 3T7EA 4I66A 4H0CA 2YRXA 4DLYA 1DWQA 2ZPAA 4EIWA 4EI7A 3ANMA 4HB3A 4GI1A 5DHFA 5K8CA 5YASA 4KMOA 5F77A 3HVRA 1ZOIA 1L4LA 3LA8A 1WXWA 3OBIA 4XE5A 3SKYA 1QCYA 4MMXB 3FUVA 3WQBA 1FDVA 3V8VA 1N7GA 3AHHA 4MVJP 4RZ2A 4BX9A 2XHZA 1T6ZA 3GLQA 4F3KA 3I6ZA 5DO9A 4ZEVA 1RLUA 1XI2A 3ICOA 3BHJA 4D6YA 1NRWA 3O2JA 3ANTA 4KMRA 4RGVA 4DV2B 2GETA 2Y0DA 4RDHA 3O8CA 4U9UA 5U1PA 4IICA 1JXQA 4MP6A 3KQMA 2ZJOA 1HEUA 2HMAA 3B70A 1VE3A 3QVWA 4LNHA 4ZC8A 1YS4A 3HN7A 4PLVA 3ZI4A 4IUBS 1Z2DA 4IH1A 4WXRA 1WO8A 2B35A 3BEDA 2HADA 3F90A 1NULA 3THWB 4EHIA 1OH5A 3B1ZA 3OZBA 1Z8DA 1MB2A 3TQIA 4WZZA 4BBZA 3C7TA 3O2NA 2AOUA 4KXXA 5IT4A 3INTA 1D2CA 1W44A 2R8XA 3MJCA 5E4FA 1WY5A 1IFXA 1XTKA 2X6QA 3R7WB