3CKKA

Crystal structure of human methyltransferase-like protein 1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
229
structure length
196
Chain Sequence
YPVKPEEMDWSELYPEFAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
publication title Crystal structure of human methyltransferase-like protein 1.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 196
sequence length 229
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ckkA01
3LPMA 1L9KA 2JH9A 5EG5A 4OBXA 3FUXA 2NP7A 2VDUE 5DRYA 5B1SA 3ANXA 4HGYA 5EKUA 2OB2A 1RJEA 5FUBA 5ICFA 1T43A 5DTQA 5FWAA 3GJYA 5CCXA 1ZKDA 3A27A 10MHA 2HV9A 2ZIFA 2NYUA 2ESRA 2AS0A 3FUUA 5K8VA 4A6DA 4RTSA 2O0LA 3M6UA 4HH4A 3M6WA 4QQKA 3LDGA 2ZIGA 2GA9A 1FBNA 2O06A 4FT2A 5T67A 4QVKA 3JWIA 3HP7A 4QPNA 4FSXA 2PGXA 1TW3A 4GUAA 2YTZA 3GGDA 3REOA 4ER6A 2IPXA 1YUBA 3EVGA 5KQRA 1RI5A 2LD4A 3EGVA 4MTLA 3CGGA 5K0EA 3LCVB 2NXCA 2VDWA 3KKZA 5DLYA 2IDJA 1XVAA 2CWWA 3PFHA 4RX1A 4CWAA 5HOQA 1G8AA 2ZFUA 3QV2A 3BUSA 4M7RA 1P1BA 1DCTA 3SVZA 1Z3CA 2PX4A 4QTTB 3UFBA 4Y30A 3KQOA 4MQ4A 5FCDA 3DTNA 1NBIA 1VBFA 3A26A 4HG2A 4GQBA 4ATNA 5CVEA 1D2GA 3HCBA 3I9FA 3M70A 3NMUF 3KQQA 3KU1A 3PVCA 4CKCA 1YZHA 5CM2Z 2CMHA 4BP1A 3FUVA 1SUSA 2PWYA 2QYOA 5K03A 1NW3A 1FJXA 2B9EA 3G89A 3KPWA 4QQNA 1SG9A 1SUIA 3ER9A 1QYRA 2XYRA 3I58A 4FSDA 1P1CA 5FTWA 5K0JA 3R6TA 3V97A 4HTFA 4C04A 5HIJA 3OZSA 1NW8A 2QY6A 2R6ZA 3IEIA 4RVGA 3SGLA 1NW5A 3KPUA 4DA4A 2HNKA 3GRUA 3C3PA 2IGTA 3E7PA 4RVFA 4RWZA 2ZW9A 4K6MA 4LWOA 2C7OA 2GH1A 5DT2A 5E9QA 4P7FA 1SQFA 4FR0A 4CKEA 3FPEA 3NVMB 4M36A 4GF5A 5E9JA 2H00A 3DOUA 4EMSA 4PCAA 3PTAA 3CJQA 4OA8A 5T6BA 1X19A 4XUDA 2ZCJA 1O54A 2R3SA 1AQIA 2AR0A 2Y1XA 5FQOA 3KQVA 2PLWA 4R8SA 1MHTA 3Q7EA 3G2PA 1V39A 3UJAA 3TFWA 3G8BA 4LG1A 5DX1A 1ZQ9A 4IKPA 2ZBQA 4DCMA 1INLA 1EJ6A 4YUWA 3MHTA 1N7JA 4KVZA 1ORIA 4E2XA 1R6AA 3VC2A 1D2CA 2G71A 3EVDA 3HCEA 3P97A 1G8SA 1NE2A 2I6GA 1Q0SA 5K0GA 5EHIA 3WSTA 2YR0A 3A7DA 3GIWA 4KDCA 5K01A 1O9GA 4LWPA 4E2ZA 3HCFA 3MAGA 2HMYB 2P35A 4EKIA 5E1DA 5FA8A 1VE3A 1KPHA 5ICGA 2G1PA 1L1EA 4QDKA 3DMFA 1RI3A 2AOUA 5EMKA 2A14A 5HIKA 2IBTA 3LX6A 2ZZMA 2O07A 4X61A 5DPMA 4QVGA 5DXAA 2B2CA 3S68A 4KIFA 2PXCA 4RV9A 1ZGAA 3EMBA 3HM2A 3I53A 3LKDA 5FWDA 3SSOA 4XUEA 4EVIA 3LDFA 2FRXA 1EQAA 3M6XA 3HVHA 4V0QA 4ER3A 4DKJA 4E2WA 2OKCA 1YB2A 3CBGA 2CKDA 3T7RA 3GRZA 2AVDA 4X60A 2OYRA 5EEGA 3GRRA 5DM0A 1KHHA 2PBFA 3BWYA 1WXWA 3CC8A 2EX4A 5HIMA 2P41A 3TLJA 4F85A 3DLCA 1EJ0A 2PXAA 4G56A 4OX9Y 5CUQA 3G8AA 3P2KA 3R3HA 5C0OE 5K0LA 2FCAA 3T7TA 1JSZA 1VQ1A 2YXDA 5HZMA 2YXLA 3NDIA 4P7GA 4PIPA 3A25A 1I4WA 1KIAA 2Q41A 3FPJA 1JR4A 3C3YA 3DUWA 5GWXA 5EVJA 5G02A 1WZNA 3C6MA 3CKKA 3OFKA 1NBHA 5F2KA 4FZVA 4RTOA 4P7JA 4PNEA 2VDVE 2H1RA 4Y2HA 1FPQA 1U2ZA 2QRVA 3DXXA 3EMDA 2P7IA 1NW6A 3HA7A 5FHRA 5KS2A 5BP7A 2N47A 3AWIA 3LDUA 3BGVA 4DZRA 5CCBA 2C7PA 4BP3A 3DMGA 3E23A 2I7CA 3ERCA 3DMHA 2IP2A 2DPMA 4E2YA 3EPPA 3F4KA 3UBTA 3P2EA 2YUIA 1RJGA 3FPHA 5DSTA 3UWPA 4GC9A 1VLMA 5ICCA 2PWPA 1SKMA 2PX8A 2PY6A 3G5LA 3HEMA 4C08A 3G5TA 1KYWA 1NV9A 2AN4A 5EIFA 4PGGA 3RIEA 1NW7A 1ZG3A 3KQSA 3PB3A 4LECA 2PT6A 2F8LA 3OE5A 4GC5A 4L7VA 2O05A 4R05A 4E70A 3MERA 5K0FA 1KXZA 2YX1A 3B3GA 4QDJA 3FYDA 3OPNA 5U4XA 1R00A 2G70A 2JHCA 2XVMA 3O7WA 2JG3A 5M5BA 4JXJA 3BT7A 4X1OA 4CXMA 1JTEA 4FT4A 4U7TB 1IY9A 3TOSA 2ZWVA 3O4FA 2PX5A 1TW2A 3KPJA 2XYQA 3NWEA 5IH3A 3TKYA 4AZVA 4DQ0A 5LQNA 3KPVA 1X1BA 3Q87B 3QOWA 4C4AA 3DXYA 3E8SA 3FYCA 4BLWA 2HR1A 3DULA 4GOOD 4PCLA 3VSEA 3MTIA 3FUWA 2NXJA 2UYOA 2AOXA 2JHAA 3CCFA 4PYMA 3FTDA 1X1CA 2ZULA 1N7IA 2AN3A 4PYKA 5GM1A 2OO3A 2ORED 2BZGA 1YZ3A 2OB1A 3CVOA 3LKZA 4B17A 4KRGA 4E31A 4YV2A 2I9KA 2DULA 8MHTA 3UA4A 4XUCA 5BW4A 1KR5A 5CD1A 2Z6AA 2P1DA 3FPGA 3GDHA 2NXEA 4R6WA 4KWCA 1WY7A 3ME5A 3PT9A 2V74B 3RODA 1UWVA 2OZVA 3DP7A 4RVDA 4RTMA 2EJTA 1G6Q1 2OBFA 5DSXA 4YUYA 4E32A 4F84A 2PX2A 2ZBPA 3NW9A 3DLIA 2I62A 4RSRA 3OZRA 3UJCA 5LR6A 1KPGA 5GINE 3FTEA 2AOTA 1JG1A 1M0EA 3BZBA 3B7PA 5LQRA 3BKXA 1Q0TA 5EZQA 3MGGA 4FS8A 4RTKA 3NTVA 5EGSA 1BC5A 2FK7A 3TRKA 4CKBA 4P7KA 3FZGA 3EVAA 2O57A 2B25A 3CJRA 5EZSA 4YUZA 9MHTA 2XYVA 1FP2A 5E1OA 3GXOA 3KR1A 2VS1A 3P2IA 4YV1A 1P39A 5BXYA 4PONA 3UJ9A 1UFKA 3R0QA 1Y8CA 3OZTA 5CVDA 5EEHA 4F86A 4HSGA 5EMLA 5KYGA 5GIPE 3O31A 2G72A 3ER8A 4YUVA 4CTKA 1DUSA 3UA3A 3P9CA 5E1MA 4GEKA 3SSNA 1R74A 5ICEA 2EFJA 2IH4A 3MTEA 4ZTBA 1HMYA 2H11A 3B5IA 1N2XA 3FTCA 5DTMA 5C9ZA 3KR2A 5CVUA 1XJ5A 2ZZNA 2AZTA 3KPYA 4HC4A 4PYNA 2BH2A 1BKYA 5DX8A 5E2BA 2JH8A 2VZ9A 4MIKA 5CVJA 4AX8A 4KW7A 1YF3A 1VP9A 1IM8A 5CIYA 2ZWAA 1AQJA 2NP6A 2IFTA 3TPZA 4EK9A 1D2HA 3B89A 3UJ8A 4DF3A 3DXZA 4ER0A 3HA5A 3C0KA 4HTFB 2CMGA 3EVBA 4OA5A 2OPBA 3LSTA 3OU6A 4NECA 1L3CA 3LGAA 5DRTA 3PLAE 4KIGA 4X63A 1SVUA 5K0BA 1L3BA 3TM5A 3TR6A 1H1DA 3QOXA 1SQGA 2G8NA 3IHTA 1XXLA 1JQEA 2JHPA 5FADA 2GLUA 3HVJA 5E8RA 3EVEA 1QZZA 1VPTA 2E5WA 2P3QA 2Y1WA 3HCCA 2ERCA 3OE4A 5HEKA 2IH2A 4M37A 2PXXA 2ONZA 4PYIA 1L3IA 2ADMA 3I5UA 2IIPA 2NNWB 2QM3A 3BKWA 5D1HA 5E9WA 4YV0A 5LQAA 3TMAA 2GS9A 1NKVA 4BY9E 3EEYA 2EG5A 3EGEA 1XCLA 3HVKA 5LQCA 3THSA 2FK8A 2UYCA 2P3LA 3KR9A 3X0DA 1R18A 1ORHA 3PFGA 3D2LA 4DCGA 4R8RA 3OU2A 1DL5A 3G2MA 2YQZA 3GO4A 4PYLA 3OCJA 1NV8A 4EKGA 3ID6C 5EC8A 2WA1A 1XDUA 2BM9A 2K4MA 5K0NA 3NVKI 1X1AA 2ZBRA 4H0NA 4RTNA 2P3OA 1OR8A 3BGDA 4FGZA 1QANA 1IXKA 2CL5A 2UYHA 3HCAA 3M33A 4ER5A 1YFJA 3IYLW 3G2OA 4IWNA 4PGHA 4RTRA 3SXJA 1RJFA 5DM2A 4C06A 3JWJA 5JR3A 2OY0A 3ELWA 2AVNA 3LCUA 1JQ3A 4PIMA 4YUXA 2HWKA 5EQJB 4AZTA 3KQTA 1JQDA 1I1NA 1O9HA 2AOUB 1EIZA 3BWBA 1FP1D 3LBFA 3ELYA 4WXHA 3GNLA 1JTFA 4C03A 3GRYA 3KQYA 3AXSA 3FRIA 5DWQA 4MHTA 2VP3A 3SSMA 2C7RA 3AJDA 3UJBA 3VYWA 5LQKA 4IV0A 4C05A 4AUKA 4YMGA 1RI2A 4PWYA 1PRYA 3KHKA 2ZZKA 3AXTA 4PYQA 3THRA 3VC1A 3MCTA 1G60A 3G2QA 3P71T 2BM8A 2PKWA 2PV0A 3DR5A 2PT9A 3JWGA 3KQMA 5DM1A 3B3FA 5C1IA 3PX3A 4BLVA 3PS9A 2P8JA 1R8XA 5K05A 5LQUA 2PSSA 3P8ZA 1M6EX 1VL5A 5FULA 3U81A 3LCCA 4GOLD 1BOOA 4PYOA 1VP3A 1QAMA 2BR5A 3ELUA 1G55A 2P7HA 5MHTA 5F2OA 5EMMA 1RI4A 2HTEA 3MQ2A 2AOVA 1F38A 4M38A 3CJTA 5HILA 4ER7A 2ZTHA 3UJ6A 3EVZA 4KDRA 2WA2A 5K0CA 5K09A 2EJUA 3MB5A 5KQSA 1QAQA 2B3TA 4MWZA 3A4TA 1JG2A 5E2AA 4C07A 2Z6QA 4R6XA 5LSAA 3E05A 3SR4A 5GOZA 2IBSA 3FUTA 2QRVB 2ZIEA 5D1NA 5FHQA 3TKAA 2PJDA 3T0IA 3PX2A 1TPYA 2NXNA 3NJRA 3KR0A 3GCZA 4QPPA 4UOEA 2UZ4A 3EGIA 2OXTA 1KPIA 2PVCA 2UYQA 1X1DA 1F3LA 4U7PB 4RTLA 5FA5A 1AF7A 2ONYA 4IV8A 1RI1A 1WG8A 1WS6A 2YXEA 3P9IA 3K0BA 3V8VA 2GPYA 3R24A 4X41A 4DM3A 1NT2A 2GB4A 3LBYA 2FPOA 3H2BA 2ZVJA 2JJQA 3BWMA 5EMJA 2Z6UA 3I64A 1VIDA 4FP9A 3R9XB 4AZWA 3TM4A 5ERGB 4OBWA 5E8JA 5EKXA 3FTFA 4DMGA 3UJ7A 1M6YA 4HGZA 3KQWA 3AY0A 3G7UA 3HNRA 2GAFA 4XCXA 3GWZA 3FPFA 3HCDA 3JWHA 3MCZA 1JSXA 4P58A 2IDKA 5DXJA 3G88A 5FQNA 3RW9A 5BW5A 3OU7A 2QE6A 4RTPA 1ZGJA 4A6EA 4POOA 2AOWA 3GRVA 2BR4A 3L8DA 4HRAA 5JUWA 4GOMD 5E1BA 3EVFA 3KQPA 5EPEA 5H02A 3ORHA 5DX0A 2WK1A 3GU3A 4OQEA 4PINA 3C6KA 3T7SA 4EQZA 5KVAA 5GM2A 5LQJA 2P40A 1XCJA 5F2NA 4E33A 4BLUA 3A7EA 3BGIA 1B42A 3FRHA 2XVAA 3P9NA 4Z2YA 2ZLBA 1QAOA 2B78A 3SX0A 3BWCA 2AN5A 3EVCA 4PYJA 1UIRA 3LL7A 1XDZA 3K6RA 2ZSUA 5IKMA 4GBED 4GOND 2FHPA 4RTJA 1AV6A 4O29A 5HIIA 4RVHA 1EAMA 5DM4A 5CVVA 3OFJA 5EIWA 4OQDA 3HTXA 3HVIA 1EG2A 3UZUA 1G38A 4CTJA 3SM3A 4AZSA 2C7QA 1JG4A 1KP9A 1YFLA 1PJZA 1I9GA 2IH5A 1KYZA 2V7EA 1BHJA 1WXXA 3LECA 3LHDA 3M6VA 2KW5A 3NWBA 3SMQA 5GP1A 2AOTB 3TQSA 1RJDA 1HNNA 3B3JA 4YMHA 7MHTA 4QTUB 5EHGA 2FYTA 1XTPA 3P9KA 3NDJA 3BXOA 3DH0A 3HA3A 5P8WA 4E30A 3EEOA 1R8YA 5DTRA 4RTQA 4V0RA 1P91A 1ZHFA 2YVLA 4ISCA 1MJFA 5HFJA 5EOVA 2XBMA 3IV6A 4RYLA 1XDSA 2BR3A 3M4XA 3ELDA 4WVLA 5T64A 5GIOE 1JG3A 3UJDA
chains in the Genus database with same CATH superfamily
1S2OA 1YCDA 3USZA 2XB9A 1Z6TA 1KARA 4EHNA 2BKVA 2EEZA 4N1AA 4G8BA 3QVSA 4EJSB 1NN3A 3QKRB 4ZI7F 1WBBA 3ESZA 4IDQA 1MOSA 4A4DA 4MW0A 3E84A 2Z58A 2PO7A 3ZGYA 3ZCXA 5FWAA 1L4FA 4OJKA 1SCJA 3VYVA 1MA3A 4RK1A 4F3RA 2J4CA 4YRNA 4I5EA 4C4YA 1IB6A 4XQ0A 3MQFA 3A37A 5DZSA 3JX9A 5IP5A 4E12A 3P2MA 3NGLA 3RKSA 1GM5A 1R2QA 1Z0AA 1RHMA 4UEOA 3TQFA 3L2OB 4OP1A 2R8OA 1K8QA 2XMDA 1YQ9A 2ZITA 1K6XA 1U9YA 2LIVA 1E1LA 2VDKB 3A9TA 4K46A 4NCJA 4WLUA 3KKZA 2VDWA 2EHDA 4L8FA 3BDVA 4XH9B 1L7MA 2KQUA 2DBVO 2ZE8A 3BUSA 4MI9A 4AMBA 3W4IA 4KKVA 3O1LA 3ECAA 1VKOA 2C95A 2NUAA 1D2RA 3UFBA 3VKHA 4QQRA 5L4SA 3H86A 4E5KA 2CL6X 3O3MB 3F9IA 4ZYYA 4DNQA 3U7QA 4D92A 2P4EA 2V55B 1U94A 2EWVA 4HLUA 5CVEA 3TEMA 4B6SA 1O95D 3B1XA 3EXIA 3FCCA 4ZZ0A 4N76A 3B60A 2C1EA 3PVCA 4WLVA 1CYEA 4GI2A 4BC0A 1E2HA 3S29A 2WV7A 5KYWA 2YHSA 4JYAB 1RXUA 4YRIA 2OQIA 2QKYA 2REOA 4DCTA 3NUQA 1QYRA 1ZRMA 2F00A 4FSDA 3F3MA 1KI6B 5F1YA 5GV8A 1F7VA 2JIRA 1II0A 1IEVA 1Z7GA 2VOEA 5JTTA 2IU0A 5DNDA 3ZW7A 4C78A 1OBVA 1FVFA 1QIEA 4CEHB 3HBLA 3NTXA 4JL6A 5AIBA 1DQZA 4MCJA 4DJJA 2E9SA 4YASA 3DE4X 3OQVA 5JCJA 4QU8A 2UZ1A 3NHMA 1CUVA 4LBZA 2X3FA 1M83A 1Y9AA 2E4XA 3MA0A 3V8RA 2ZPAA 1M1NA 1V1JA 3V1KA 1X1QA 2AX4A 2VZ8A 3NDPA 3DBHB 3KFLA 4ZKEA 4B3CA 1KZ1A 3DZ8A 4TQAA 1Z5GA 3F8WA 3HRIA 4DAEA 2VHCA 1PHRA 2ZKLA 4XWGA 4I55A 4B85A 3LCJA 1R0SA 1I8TA 1UKEA 1L5FA 2IBMA 1T3TA 3KQVA 2V4MA 1KJYA 2X5JO 3PRKE 5FQOA 2HL6A 3CWCA 1CQJA 3TJMA 2ISCA 1OOEA 1ZQ9A 3M4YA 1QYIA 1E8MA 1SIWA 5L7TA 1MO4A 2HF2A 3GLIE 1NQAO 4G8JA 3N2EA 1VHTA 2FQYA 3B1JA 4MPJA 1K7XB 1NQVA 3R23A 4KJZA 3AJ9A 1YU9A 3P97A 4U2GA 1WO8A 4EFLA 4LGVA 1Z6QA 3M4NA 4C7MA 3EOBI 4FCVA 5LB4A 1VHQA 3AR8A 1O9GA 1YAJA 4XYEA 3U0VA 1SUBA 4UM7A 3WNBA 5HGXA 3MAGA 1BXKA 3ND5A 4IIYA 4MW5A 5AQ1A 1CDZA 1DDIA 1QFXA 5FA8A 4LKRA 1NNSA 1H2YA 2G83A 2IYAA 3GUUA 4H6WA 3N8DA 2BLLA 2FEOA 4QDKA 4BX0A 4CRWB 4K3VA 2YKGA 4CM9A 4FQ8A 4EG1A 3I04A 2PH7A 5CT9A 4AS3A 3KTAA 4FFDA 3SF8B 2WTBA 2WP0A 3EFOA 1PS8A 3FPCA 2QPLA 1QLJA 1HE8B 1RHUA 2Q62A 2VPZA 1A50B 6YASA 1XBTA 4JJIA 1WZCA 1IQRA 2C0CA 3L77A 3MRSA 2W8BB 1YR2A 5IX8A 3UUGA 4A10A 2BEWA 3MD0A 4DKJA 2G28A 1A2KC 1P1HA 2J9GA 2XNJA 3GJ6A 4KLCA 4UXIA 3SWWA 4F4UA 5EEGA 2PL9A 4O1MA 3PICA 3M8KA 5ETJA 2Z9CA 3O90A 4GWKA 5ESXA 5HIMA 2O8EB 2P41A 3PPIA 2IYFA 1RP1A 2ID4A 4FOTA 3IDSA 4B8ZA 1J2RA 4CLXA 4NH4A 5C0OE 2A5LA 1Z6XA 2GBLA 3A1TA 1L6IA 2O48X 4CMKA 5EERA 4C20A 1YHNA 4PIPA 4BO6A 2OXRA 3PC4A 2G5TA 4ND6A 1L5HB 4BO5A 4EUKA 3Q0IA 4UUMA 3FCUB 3MWKA 2W6OA 4ZOCA 1A8IA 2A4KA 3K05A 1T6ZA 2FP3A 4QNMA 4NPHA 3FYHA 4G8CA 4M6WB 5CA0F 1GAWA 3FB4A 3MSCA 3O8BA 4KRYA 1N6PA 1U8ZA 1DKNA 3QE4A 4BLTA 2XGJA 5K7SA 4ZAVA 2Z9BA 5CDUA 3MT0A 4I9GA 3AWIA 3K9QO 3C4VA 3CF4A 2DEUA 4LZLA 2AIRA 1C3EA 1CQWA 3NKVA 2WJGA 5FX2A 1EXDA 2IOFA 3PLNA 4LAFA 1WBJB 5KPDA 2BCGY 1T4MA 1OFHA 5I9MA 4D4JA 3TTTA 1AV7A 2DB3A 1AB6A 1CUGA 3KG2A 2Z8ZA 4QUIA 2PWPA 3I2YX 5HBGA 3EGWA 5E4YA 3ZXUB 4B3DA 1Z4IA 2H18A 2COKA 5A3RA 1CQXA 1Y48E 3T5AA 5KKNB 1ZVVA 4RS4A 3AVOA 4DQLA 3VYTB 5BOVA 2P9TA 4A2WA 2GEUA 2G4VA 4BVJA 1ZRNA 4PQYA 3AP1A 4ZGBA 1XCPA 1XWWA 2JD1A 1E94E 1QYDA 1PYOA 3K0KA 1E32A 4OMCA 4QDJA 3S2UA 5M34A 1ENYA 2A0KA 3HJUA 5DTIA 1SMKA 2Y99A 1Z56C 3ZWOA 1GSOA 4A16A 2CY0A 4QRHA 1QGZA 4TWBA 4WTOA 5B58C 2IYQA 3ZU6A 1QHHA 1H8HA 3EQ7A 3OETA 2VNSA 4GM1A 4C4AA 1DAMA 5BQPA 1EE1A 2W2QA 4F11A 1B8OA 1N6LA 4PZPA 2AOXA 1DEXA 1VTKA 1O5TA 1ZN2A 1KMMA 2HLPA 3CCFA 4TV9A 5JS2A 5A06A 5I4CA 1FU7A 2I4RA 1AURA 8AT1A 4HGPA 1GNQA 2N1BA 3NNSA 4IIDA 3S1AB 3PEUA 1Z0KA 4Q4LA 4C6TB 4PLPA 4Q7EA 3PYXA 3ICEA 1C3XA 4JVLA 4XUCA 1T9BA 4JY7A 4QYMA 4JFRA 4JSTA 2V8BA 2X7JA 1P4HA 3PT9A 1XRMA 1U9JA 2OOKA 1U3VA 1U6KA 2JGMA 3DP7A 3SZOA 4KYUA 5ALTA 3EIQA 1U1FA 4TV8B 2JFOA 4EH1A 1LW6E 1H5UA 1H42A 3QW2A 4YBRA 2DP4E 8ATCA 5A02A 3EZFA 3K2IA 4JNKA 1FP7A 6REQB 5HM6A 1B76A 3QLVC 3D8BA 1SVSA 1QFMA 2I62A 4KN5A 3UJCA 1TUIA 4DGQA 5GINE 1QRSA 1G291 3MBOA 3I34X 3QBEA 1Z7YA 1M2HA 2QMHA 3P0HA 1LBEA 4WEQA 4AIRA 4F06A 4F71A 1V1RA 5AHWA 2RI1A 4N5MA 4NE7A 5CCEA 1PUJA 2GETA 1RPAA 3EA5A 1CT9A 2RHDA 1PT8A 4QULA 3U3XA 5I7UA 1O89A 4D9IA 4I4TA 1NVEA 3VX4A 1DTWA 3W3ZB 3ORFA 1A5AB 2P4QA 4KBYA 2QP4A 3HU5A 1ISMA 4MXDA 2ZROA 4ASUD 3ONDA 2C1ZA 1S96A 2GPJA 2Z0MA 1I2AA 5JECA 3FTNA 3K2BA 3MTEA 1FTQA 2PLFA 1MGPA 3Q8XB 1GGVA 3M9XA 3PC8C 5ES4B 2GSDA 1PR1A 2ZR8A 2MYNA 1RAEA 5BSGA 1YIAA 2HK9A 5HQ3B 2ODNA 1XJ5A 2I2DA 2Q27A 4FHCA 4R9SA 5IM5A 1G18A 4Z4FA 1E6CA 2AEEA 3JASA 4EJFA 1G5HA 1NU6A 1PX0A 5CA1A 1SG6A 2W6ID 4HP8A 3ZXYA 1I5RA 5AVVA 3O75A 1CY7A 1GUYA 2QENA 4OI0A 4HBZA 3IQXA 4JQCA 2A57A 5FWYB 4X24A 1D5CA 2J5RA 1YVEI 3FHCB 1JAXA 1ZISA 2C82A 3DMRA 5CHYA 3Q41A 2PUBA 1SUDA 4ZI2A 2BFPA 4J91A 5B7PA 3OE7D 4NBVA 5AM2A 2RGWA 1SVUA 4C5AA 2FZCA 1SCDA 3CZCA 4K9KA 3QJGA 4LYFA 3TR6A 4B2YA 3RHSA 2ABWA 1B0ZA 1UJNA 3HADA 1RWXA 3K0FA 1E9DA 1JR3D 1XKXA 2QQFA 2QN9A 5I5GA 1WMFA 1G64A 2PWZA 1CEXA 3K9NA 3HR8A 4PY2A 3RSQA 3U4MA 4JSYA 1VOTA 1QGYA 4X66B 4RD2A 2J08A 1DS6A 2EFGA 2NM0A 2X8LA 4Z9XA 3TUJC 1E5VA 1NVWQ 4N03A 4W5RA 1J23A 2AJ8A 4V24A 1M8FA 5T4BA 4UQPA 3HR4A 4Z3KA 3HCNA 3PIDA 3P2OA 4PYRA 2AYXA 1E60A 2ZRKA 3BQNB 3GDOA 4Z86A 5FD8A 4N18A 1QCZA 4CUZA 5L4LA 4JZYA 3QMPA 3B8EA 3GBVA 4UM8B 1NLUA 1UJMA 2R4UA 3ZKWB 2ZQZA 2D1FA 4BV3A 3ZQ4A 4UDYX 2WA1A 4TTRA 2OVBA 3ZXIA 4CCYA 4EY6A 1IBSA 4ZVTA 4BVHA 1FZTA 1OIWA 1N57A 4H0NA 5LUBA 4Q03A 3RS8A 1LBHA 1MNQA 4UU8A 3EVNA 3M33A 1L8XA 1UANA 5AH0A 3RJMA 1W1WA 4J7AA 2UZAA 1O8BA 2JVJA 4YCAA 3PX7A 1QV9A 3DAFA 4LY3A 3EIOA 5DM2A 3RC9A 2OY0A 3VO1A 5JEEA 2AVNA 6NULA 3AF6A 3E1GA 3AIIA 1N78A 5G0SA 1U5BB 5ITWA 5IZ4A 1E8DA 1NY5A 2BMEA 3TQQA 1ZINA 4RK0A 1C7RA 4O0MA 4JBYA 3SJ7A 4U2FA 2Y71A 2GZ1A 3T12A 3GAFA 3VPXA 4CIVA 1PFUA 4FBMA 2MSEB 4EB6A 5HVNA 1NI3A 1TCAA 1TVKA 4M86A 2NV2B 2MR5A 3D1LA 3HKDB 1DADA 4RD0A 4ZEOA 4YYEA 1T9ZA 2PH1A 4PYQA 3CLSD 4RANA 3LY5A 1C2YA 3K5WA 4XGKA 4OHZA 3W9UA 4IUBS 1YRQA 4LXUA 5HFAA 2PV0A 3FNFA 5JV5A 3TLKA 4NXMB 3CB2A 2ZB2A 3V00A 4BX2A 4WNIA 4W5NA 1T1EA 2PSSA 3HXPA 4TS4A 4LYYA 5FULA 1ZD8A 5K8CA 5AXCA 3G5UA 4PSUA 3QGMA 2ORVA 4BKUA 4OTZA 2VHTA 4ACBA 3DEFA 5MGBA 1M2OA 4DKXA 3FJYA 3IAHA 5JAHA 2EKBA 4MAMA 1E1CA 4MW9A 3MB5A 4QDTA 3FGZA 4MGKR 3E8XA 5LA6A 2HRCA 3GFQA 2RJ3A 1MDBA 4C4TA 3TGWA 1PR0A 2R8XA 2FGKA 3ZGXA 5LN1A 2WM8A 4ID9A 4QYSA 1H8ED 4D8UA 2PGLA 3PQDA 3T5GA 1PR6A 3PX2A 2ZM5A 1ISRA 1JLMA 1IHXA 1WMDA 4TN5A 2Q7DA 3ZG6A 5L40A 4X84A 3IKLA 4R0VA 1NTOA 5D3MB 2HK6A 3LO8A 5COAA 5D86A 4ZODA 5E7JA 4RTLA 4WZ6A 4LMRA 1USVA 1QDEA 4CV3A 4DM3A 3MGKA 4LJ5A 4A0HA 4UQOA 4FBGA 1EEXB 2JDIA 1RPJA 3SM9A 1WA5A 5BVGA 2Z6UA 2YJTD 5DWDA 2X86A 1T3SA 5B1HA 3HPQA 4FZRA 3S6JA 3TM4A 3EDOA 5IAAA 3GGPA 3O0TA 1QIKA 2WF9A 4FHDA 1VJRA 3A14A 2YCLA 3CXUA 3ZJVA 1UC4B 1KETA 5HM8A 2X0IA 3QA3E 3UJ7A 2CV0A 2R1TA 5FA6A 4C0KA 1T24A 1E9CA 2AWNA 1G1AA 1JZQA 4WMLA 1DLJA 4GI7A 1HT1E 3FN4A 3C3JA 3QFHA 4HH1A 2FP4B 3RW9A 1L5MA 1BD4A 1Y5IA 4TXNA 3UT5A 1FYWA 4P6VF 3K3PA 5E1BA 1E3WA 3CNQS 4R41A 2OFPA 3K70B 4I9FA 5ARCA 5DX0A 4AAYA 2HXYA 4B3IA 3T7SA 2BI7A 3GUHA 5HZKA 3V8MA 1SBYA 2ZRBA 3X1ZA 1KS2A 1M33A 1A2QA 4QGBA 2PX6A 4GI3A 1LK0A 5JPCA 3P9NA 5K8TA 4KXLA 2J0VA 1JLSA 4OHYA 1D5WA 1Z45A 3GH3A 4CQLB 4CU2A 4E15A 3OPXA 1KK2A 1RYDA 3KO8A 4NU6A 3TLAA 2AQKA 2BTOA 3KJGA 4WFQA 3K6RA 4JYPA 4RTJA 3IKMB 4V1CA 1BO6A 9ABPA 2CK3D 3BMNA 4PLTA 2OLJA 5TMDA 2NIPA 4C4PA 4YN3A 1T2UA 1ADGA 3T3PB 1H6CA 3IVCA 1V48A 4J43A 1A7JA 1Y1LA 1CUDA 2WJYA 2FR1A 3OVMA 4LNUB 4AI6A 4XB1A 2H4WA 3TD9A 1UBRS 1E1QD 5L6LB 1Y4UA 2KW5A 4E7OA 3W2HA 1GU0A 2DUJA 2QLJA 2Z08A 4I99A 3B3JA 4YMHA 2P6PA 4CF7A 1OH7A 5GJBA 1O08A 3AI1A 4CLRA 1XTPA 3G2NA 4AWBA 1SD1A 1NVTA 3ADKA 3I12A 2V0CA 2X2PA 1PS9A 5JJLA 2C3UA 3I01M 4TQ9A 4ZQBA 4CKBB 5CYOA 1C41A 4MYRA 2O2EA 4YAWA 4FJ2A 1DC7A 2DERA 4DV7B 3P7MA 5IK2A 2QORA 5M2QA 4B81A 3FBWA 1XQYA 4QGAA 3ZDYB 1JBKA 2BFWA 2JHGA 4R4JA 3E5MA 4KXNA 2JC3A 3ILYA 4EYGA 4UE3S 4ZV4A 1YONA 3DM9B 4E3ZA 4L7QA 4WW0A 1PZEA 2NP7A 1TJYA 2X41A 3C87A 4OSEA 3FOFC 4L3WA 1I13A 1P1RA 1JU4A 1RWQA 2H0QA 2VF2A 3VR4D 1GTMA 4HYTA 3O9VA 2ROQA 5ICFA 5CDSA 2X77A 4HKTA 2WIKA 3UAVA 4R9UC 1XZGA 2ZU6A 3FUUA 1XYVA 2EF1A 2HA4A 3O7MA 4K9PA 4S3MA 1SHTX 4A6DA 4EW3A 3CX3A 3V4SA 1PFGA 1W9MA 3FZNA 1QFZA 2H59A 1AXRA 5ADUS 1RADA 4QVKA 2J5BA 1BROA 2PGXA 2DWOA 3E1KA 3I32A 4GUAA 3FE2A 4B3XA 2PPLA 3AEXA 4CM4A 4YJFB 5KQRA 3D1VA 4P32A 1ARZA 1GHTA 4RZ2A 3Q6MA 3FVRA 3JZFA 1XNRB 2QMZA 4JUDX 4BNZA 4XYBA 3QMVA 4NYMQ 1UOQA 5HK8A 4O4HB 4B48A 4B8YA 1S3SA 5T41A 3BTSA 2G9RA 3H6GA 1P5HA 3KQOA 1RACA 1TM4E 1DKUA 2FLWA 2IA5A 3KWJA 2H9IA 1FRVA 3AI3A 2GYWA 3ORQA 3F7OA 3ZDBA 1PQYA 3ITNA 1FUUA 3NUGA 3ZWYA 1I51A 4N7BA 4FIDA 3ZCPA 1IHDA 4FIZA 5FBZA 3GWGA 4UW9A 4ZTZB 1KE2A 1TEZA 1XZNA 1XK7A 1EE2A 3C7DB 3SNKA 4HFNA 2C20A 4DMLA 1KH1A 1E0JA 2KB0A 3CEJA 1AK9A 2XWBF 3O3OB 3TNFA 3OTQA 2K87A 1NC1A 2UVQA 5ULLA 3OZAA 3V48A 4LJ4A 1DELA 1ZM2A 2ZDGA 4QPDA 3T34A 3UGTA 4ZDJA 4CIBA 2RAFA 3LY8A 1WQ1R 4QM6A 2NYVA 1PNOA 4YAGA 1JB9A 3GPCA 2W0MA 1XAGA 4FR2A 4IKOA 3WLPA 2RGXA 3CT6A 1R4NB 2FEAA 4MVWA 4BCBA 4F2GA 3RAEC 1NM5A 3GROA 2ZW9A 4QHSA 4Z0NA 2P2CA 1VG0B 2Z5LA 2QDXA 1CZHA 3PXBA 3BMCA 2Q5CA 1E3TA 2I3ZA 5A1JA 3RUFA 4NOJA 2LXNA 6AT1A 1UAGA 2ID8A 4JH0A 5JNUA 2H54A 3TR5A 2HIAA 1EUDA 4K9SA 1JVNA 2IOQA 5HP4A 4XIJA 3RU7A 5BT8A 3DEIA 2HPAA 2R7AA 3CJQA 3L6UA 2GVNA 3HJBA 3OY7A 4Q1AA 4R0NA 5JQWA 3RSSA 4JB2A 3IT1A 1Z0FA 5EXXA 1T6BY 1WB6A 2BC9A 1KQNA 3T7AA 3TW0A 3TFWA 3B53X 3CGWA 3UJAA 4D7AA 4QEDA 1GT6A 1Q0ZA 3MHTA 4GZ3A 5H59A 2A8YA 1IXRC 1FQKA 3JU3A 1AMUA 3JATA 1BJKA 4KDFA 3AHCA 1MR3F 4BO8A 3GR6A 3TEFA 2HCJB 2XNDD 3ENWA 4BYMA 3ZNQA 3U7HB 3FI0A 4URVR 1N3LA 2WWIA 4BWGA 2AOUA 3LPLA 4G81A 4YAEA 3ZDZB 4Y6RA 4M55A 4TVKA 2A5DA 4IZHA 4M4SA 1K1EA 3QW4B 5GOTA 4G5XA 2AFIE 3ZCSA 2PXCA 4MHSA 1ZGHA 3LM8A 3N2ZB 7REQB 3KEMA 5LPNA 2F43B 1UMDA 2A7XA 2GI4A 3DO6A 3HYSA 1GAJA 2YFHA 2PZJA 4TT3A 1CRQA 1N1GA 3CZ9A 2OKCA 4UULA 4DVJA 2BKEA 3IVMA 4GSKA 4ZAWA 3EFHA 5G1OA 4CKYA 3O8CA 3U7IA 2I4NA 3TAUA 3LUAA 3VO2A 1MO5A 4FYKA 2PBFA 3G2JA 1E6LA 2PRIA 1K9VF 1VDMA 2XQJA 3G68A 1KAHA 3CB4A 4R54A 3RU3A 3ZWXA 4EABA 2R5WA 2EEPA 4NQRA 5AJWA 1XMXA 3H84A 4HLUC 4MW7A 5KYYA 2GDZA 3L82B 1OLSA 3FPJA 3UWDA 4DBVO 2HNBA 3EGDB 2R5FA 1ZU5A 4WAUA 2OECA 3UV3A 3OZDA 5EP1A 4X97A 2RIPA 4NJOA 3LCRA 1I32A 1DHRA 1HYQA 1NQXA 2JLUA 1QRAA 1X13A 2WRZA 2YY6A 1H1LA 4TSKA 4DLXA 2P6MA 4F5WA 4AY2A 2O3JA 2AXNA 3IP9A 4G5RA 1XPJA 1Y7TA 1UK9A 5IDXA 1PV1A 4DCJA 3NHAA 2NWQA 1AK1A 4MV0A 1TM5E 1GEEA 3D3WA 3L7IA 2CXXA 1J7JA 4K8OA 5HTKA 4WASA 2GPWA 1S0UA 1RYEA 1TU0A 2QQ0A 4ZMSA 3MWGA 3REQB 3DO8A 1VCNA 1H2EA 5H7XA 4D3XA 2BE7A 3G5LA 4ZT2A 2NACA 2PU7A 3FTQA 3H16A 1UQUA 1K0FA 2OAGA 3T5PA 2WHYA 3RIEA 3W04A 3VR6D 4JHLA 4BQNA 3NEJA 5AVUA 4WI1A 4XD7A 2RI6A 1Z35A 5K0FA 3PR1A 4MSUA 5MN4A 5F9HA 4U00A 3I2KA 1W96A 2YX1A 4HYEA 1U1IA 4G0OA 3WLNA 1QU3A 2ASEA 1SXJD 3U1VA 1T2CA 2QRHA 4NEGA 3WLFA 4RZSA 3U6BA 1IY9A 2C2XA 5BN5A 3RIGA 3RYHB 1TW2A 5LYJB 3DAOA 1NBWB 1LDNA 2CMKA 2XYQA 3I9MA 3NWEA 1A82A 4L2IB 5C5DA 1D6NA 2AXQA 3IDAA 2RGCA 3N3AC 3CPJB 2HR1A 4JYBA 2GTPA 2ZT5A 2RGUA 2XLCA 1SXQA 2W6ZA 1URPA 2QW8A 3TIFA 1AO0A 4PF1A 1LK7A 1L5SA 4ML3A 1NXWA 2UZ3A 1AOXA 4H15A 3K1AA 2W9XA 3T6KA 2O1EA 1M34A 1ZL2A 3F3SA 3OLXA 4QXAA 3UXEA 4W9RA 2QI9F 3HSKA 2F3UA 4PYKA 4UHDA 5GM1A 1KSGA 2BGLA 3LKZA 1R15A 2QDKA 3FFBA 4A8HA 2DY1A 4X7PA 2F3QA 2B21A 3AFHA 2GJ8A 1T5IA 3C45A 3QTLA 4K6GA 4RQTA 3ME5A 3RJ9A 3C1OA 5AKYA 1XX6A 5ALNA 1MG0A 1K5PA 1P6XA 2ZUVA 4B4UA 3GEIA 3JWEA 2ZCUA 2QTNA 5K4HA 2CMFA 4RXUA 4ABYA 4NNOA 1C3JA 4O3FA 4Q4AA 3R41A 2VEDA 3GZTB 1H2RS 2POQX 3BG5A 3DDNA 4XSVA 3WGLA 4C9BA 1NBMD 4EZIA 3BKXA 3IP1A 4Q9HA 4L0MA 3DMYA 4Y7DA 3QPBA 4OMUA 4WJLA 3T35A 2FK7A 1I6KA 2Y67A 4S04A 1OYOA 3EVAA 5CB0A 1O2DA 3LUFA 4RSMA 2DTEA 3AY7A 3WGGA 4YUZA 5IJ9A 5LZ9A 1Z5NA 1UPFA 4FTWA 4K7JA 4TKMA 5E3IA 3A04A 5KPJA 1LPAB 1CZOA 3HJNA 2Z2ZA 3MCAA 4WEOA 5EA2A 2NUPB 4ZVKA 4DA0A 2RK3A 2M1XA 3FPSA 1QQBA 5DYWA 3MCWA 4IO1A 1BE8A 1GCUA 1GPBA 2LPMA 4K0KB 2XBLA 3F5FA 2JGEA 2VDWB 1TX4B 4M9QA 4KHPB 2JF0A 2OHIA 4RE5A 2EFJA 4BZPA 4OXNA 3I9KA 4US2R 5IDWA 3BXEA 3SKYA 4MWOA 3TFQA 1B8NA 1E6WA 1N2XA 2LIPA 1ANKA 2NUAB 4RC9A 1IUPA 5KNBH 3DJYA 3E0QA 2HLHA 1F1JA 1KA9H 2X4IA 3U7QB 4XW2A 4PV7A 1F0KA 1OX5A 1B93A 4CKZA 4BGDA 3UUWA 2ZM6B 2IYUA 3EXIB 4IDCA 4MYCA 3CUSA 4OK6A 1EK5A 5ECYA 2DH5A 2VZ9A 5T6MA 1TM2A 5EJ5A 3C7AA 4B44A 1PW7A 2ARKA 4QHTA 2RHJA 3K92A 4HGNA 1JSRA 1WNTA 4JS0A 4A5OA 5KYWB 3HDQA 2Q2VA 2JFFA 3FDIA 1D2HA 2IYOA 5JQGF 4U4AA 3DE1X 4UU1A 1YE8A 3CTMA 2JAXA 3PHIA 5JPIA 2B4TO 3E9RA 1DU4A 3LSTA 1XRJA 1DGQA 2VJBA 2J09A 2IS6A 3AQ4A 1UBMS 4UUNA 1O6ZA 2LKCA 2NQ8A 3B7GA 4X63A 1BS2A 4AURA 4BQFA 4UREA 2QQGA 3OTHA 4WLEA 4DW8A 4MICA 4TRMA 3EGCA 3NM4A 3RVKA 1QCYA 3HACA 4JD5A 4TMWA 5FADA 2NVWA 4HNVA 3A1UA 2P3QA 4PR3A 2UZ1B 1EB8A 4M37A 3EXEA 1OI4A 1M9NA 3I5UA 1YZTA 1M1NB 5DGIA 3WGQA 3BWXA 1HXHA 3ND6A 4QXPA 4BMYA 4LFAB 1XCLA 3ZY3A 5CU7A 5JNSA 1O95C 4PRYA 2FEMA 3ZR4B 3SKXA 1JE1A 4GPD1 4I55B 3V2IA 2VPWA 3ABQB 1MC5A 5CNJA 5AIAA 2H9YA 4GP7A 1QQAA 3A4MA 1T9HA 2A58A 1OZ0A 1DFGA 3NOOA 4JC4A 3NJ8A 5SYNA 1KYVA 3OO0A 1CQJB 1CUWA 4B3MB 2HWYA 2OLEA 3EIHA 3OCJA 5FPSA 2AK3A 5IANA 3KSUA 1W46A 2ZRJA 2AFRA 4IFBA 1DKMA 2ACEA 3G9ZA 3Q8KA 5DNUA 1MMFB 1SUEA 1YS7A 1OR8A 1C2TA 3DVQX 4LZAA 2HRZA 2B8EA 1IG3A 1NZDA 3FFAA 4G4SP 4IWNA 2BEJA 4FE7A 4RA6A 4FLMA 5SY6A 1SVOA 3N39C 2X8BA 1EVIA 1XFAA 3OBIA 4FFVA 3PI7A 3LA6A 4FFBA 4IDNA 2WOJA 4RLSA 3KKOA 4CUJA 3D6MA 4AZTA 5K0SA 2E89A 4N8EA 1H22A 2A84A 3OZUA 1IUOA 3KTAB 3LBFA 4HXYA 5FLKA 5IVIA 5C80A 4GKKB 1K6EA 1U0TA 2Y4OA 3DC7A 3EFOB 4RCYA 2QN8A 4A8TA 5I9BA 4QUGA 1ILEA 3OC0A 1EUZA 3IEXA 4G89A 3ZBTA 2F2TA 2YJ6A 1CY6A 2BEWB 5AK4A 1SEPA 2Y1OA 4K6KA 4AF6A 5GVSA 4DDWA 2HK7A 2OFFA 1PNVA 3G3EA 2QJOA 2QE7A 4DSOA 1FBTA 3HO6A 3PS9A 3ODPA 3UJNA 1TPZA 1LUAA 1BOOA 4IKEA 4I4NA 1XQ1A 4EI7A 2KM1A 2BR5A 3ELUA 2N1MA 4JJ7A 2VHZA 3ZTYA 2XR1A 3MQ2A 1II8A 1Y1RA 3ZK7A 3A1DA 4WA7A 4BO2A 1MZPA 4FN5A 2WA2A 5FBKA 1LVHA 5KQGA 1KZHA 2WYWA 4FFWA 2PZEA 3MF4A 4NKRA 4MNTA 5FBVB 4OO3A 3UB2A 3OIUA 2BTEA 1BN6A 3D02A 5IVDA 4NCXA 3TKAA 2VQEB 1YJQA 1BQ4A 1ESMA 4OXQA 5KBYA 1GYQA 5KKCA 4C22A 1V7PC 4X3CA 2J6BA 2WC1A 2G8LA 2RSLA 2IY9A 4CM8A 3L8ZA 1Y82A 4LXIA 1CDEA 5EE9A 1E2QA 1Y5RA 3QFTA 4QREA 4FX5A 5E0KB 4ILEA 3H99A 2WM9B 1AN0A 4NTZA 2A1TR 3GRCA 3F7MA 5HIAA 3UCXA 2CUKA 4MW1A 3T3NA 1M5RA 1BMQA 3ED1A 1HNZB 2XPCA 3HWX1 3EVTA 2HJWA 3G0IA 1KMCA 1K06A 4GU5A 3ROGA 3E15A 2WJVA 4XD2A 2QS9A 5J5AA 2GF0A 2XTZA 1O77A 3KEFA 4Q4DA 4LSMA 4CIAA 4PO8A 3OEYA 4I46A 1S2LA 2FZVA 1MAHA 4PU0A 3QYFA 3KTDA 3PDJA 5BMVF 1ZIYA 1HLPA 2Q4TA 4Y6SA 5JJBA 1DOAA 1JSXA 3UMVA 4D25A 3BS4A 1QHHB 2ZI6A 2XVZA 3GRVA 3D8TA 3LUCA 3AP3A 1CHNA 1N5DA 1X1EA 2E4WA 3D6NB 4FYMA 4N7MA 1VLVA 3GEHA 4P34A 4PBRA 4V03A 4EQZA 1GSAA 3EW9A 2HK8A 4L3VA 4QJ3A 5LOVA 3G2LA 4LQLA 2J41A 3ESYA 4AMVA 3U3OA 4OMFG 3VVMA 4TV9B 4IYJA 3GLVA 2C84A 3K6SA 1F6DA 2XRYA 3FDJA 1KKMA 1EBUA 1Q2UA 2BL4A 2X23A 3M3PA 3NTRA 4N7JA 5DCYA 2AN5A 3C1UA 3PNOA 3AMVA 5H9WA 4Q6BA 4AW9A 4KAJA 2W37A 4XJVA 2FCRA 1CUAA 3HNOA 5HIIA 4G0VA 1KMIY 3VV2A 2WICA 3UWOA 3TRDA 3PQFA 2B2NA 4EVSA 1KP9A 2R85A 3N0VA 1ZS9A 3BIJA 4I1UA 4UTPA 4JT2A 5HKKD 1YBHA 4CL3A 1PFVA 4F56A 2FEXA 1NAHA 3BXXA 3GJ4A 2RHRA 3N74A 2F17A 2ZBFA 4BEBA 2GNAA 3OZ7A 4GEGA 3BERA 2DX7A 1CJUC 4BNKA 2Q9CA 2W2LA 4UXHA 2IZ6A 3AF1A 3T41A 2GCOA 1V1RB 1ZHFA 1RRVA 2YVLA 4GWGA 4QBHA 4R7GA 4IUYA 2CUNA 4PGMA 4PPFA 2QTHA 4DJAA 1XDSA 4OHFA 5T64A 4KGXA 2XT6A 3KU4A 4I4TB 3WQSB 4Q19A 5GGYA 1ABEA 2OP0A 1AGXA 3K5IA 2DCUA 1EPUA 2F1OA 5EG5A 1DTWB 2Y92A 4K9QA 3V1MA 2J4FA 3FUXA 5DLEA 3BH6A 3VR5H 2IDMA 2YMQA 4R01A 2X5NA 3GJYA 4ZOLF 3E2MA 3T0GA 2JJMA 2OPHA 3KBBA 2QUJA 1VSVA 2F9MA 4PQEA 3D7LA 3GDWA 1EAYA 2QG6A 1P4JA 2EFDB 1MDFA 2GHQA 5C4IA 4FSXA 3NEPX 3JASB 4JJ4A 2SKCA 2XMCA 1JI3A 2ORWA 4JLDA 3DYVA 3S2FA 3TD2A 5F1OA 5CA1B 2ODEA 3DZHA 3ADOA 1SY7A 3EVGA 4R0MA 5JAOA 3PF8A 4MTLA 3JD0A 2PKYX 3T4PA 2VYCA 2JIDA 3LCVB 4FNAA 4URFA 2I4OA 3KZOA 1Z25A 1ECGA 2C07A 4TYMA 5DO9A 4EYEA 5KJCA 4QAJA 1MTOA 4G24A 3R5TA 2DC1A 3RU2A 1B8UA 2YWCA 3QVGA 3V55A 1LQ2A 1DCTA 4JLJA 3A6KA 3HWWA 1CSEE 1JUDA 1RCTE 5FCDA 3AINA 3RQSA 1QTNA 3DBRA 3EEBA 4HX2A 1GGNA 4O2AF 3V8EA 5A2GA 3RPEA 1GPKA 2JLWA 2VYVA 2V0GA 3PWKA 1U0JA 1LSUA 3ZOZA 3IQZA 3K0FB 2EFHB 2VR1A 4R84A 4ZALA 3SU8A 1Y3BE 2PTGA 1IOVA 3GD5A 4E08A 3GAZA 4HFMA 4XDZA 5LMUB 2O3SA 5SY9A 5B2EA 1GILA 1A7KA 4DANA 2Z3VA 2QZ4A 2V0NA 3AKZA 1I4LD 1U0NA 1K7SN 3RSGA 2ZAGA 3HPRA 4FFPA 2WT4A 3HA2A 4EPXA 2ZJ0A 1GGHA 3B1ZA 3TL3A 3TB4A 4L9RA 1N32B 2V5UA 5I7VA 2FHSA 2B36A 2IGBA 4LYDA 5IEJA 4QATA 1JGTA 1G0OA 2QG4A 1R9NA 4F2WA 1Z6PA 1YKFA 5KYNA 4BS9A 5FAKA 2OCLA 3LGXA 5DMHA 1ODCA 3AYZB 5A04A 3F71A 4HEA1 3UN1A 4DADA 2GH1A 4CCYB 3S0JA 5TNXA 4CKEA 3BHJA 3UKJA 1IE3A 2XRMA 1ODKA 1G9TA 4H1VA 1NJ2A 3QVTA 3H2SA 1YZLA 5TPZD 4M88A 2R47A 3OQJA 1QRTA 2VI5A 1GLVA 4N5DA 4MV8A 1OB2A 2R5NA 3IP5A 4Y2RA 1YQXA 4OHCA 3OMLA 1WKBA 3E0XA 5A3VA 4UUOA 5J4VA 1ABFA 4G6ZA 4GX2A 1WEKA 1SCIA 4IQ0A 4PICA 4KVZA 4BRSA 4MOWA 4EB6B 4YUWA 1D2CA 1JEAA 3DEJA 3EVDA 3TD6A 1TVKB 4US0R 4L15A 2SICE 5BN4A 1RYMA 1KZYC 5EHIA 3A7DA 4RQAA 5CB4A 3ZLJA 4E2ZA 1MX3A 2VK8A 4DCUA 3SE7A 3ED5A 3OEHA 4IJKA 2JFVA 1VE3A 4PWZA 3CX6A 4EOGA 1W94A 1JDUA 4QZVA 1ISIA 2CHUA 1NN1A 2ZTUA 5TS2A 3FD8A 3V80A 2JK0A 3S2EA 1TNDA 2YWJA 3M6AA 4WE3A 4CVNA 3ORRA 1JFLA 5CK4A 1LPMA 1M2OB 3IQEA 5CTJA 1QF9A 1E1CB 1ZQ1A 1F2UA 3WJ2A 1YB4A 3HO8A 3KCNA 3VVLA 1YV9A 1JILA 3BC1A 1YB2A 5LA6B 3T7RA 1Z47A 4LX8A 2W8ZA 2PQMA 4H7IA 1F2TA 3OWXA 3PNBA 2OYRA 2EC5A 3N6VA 3F6CA 4GYWA 1B1CA 3BWYA 3UAOA 1DAPA 2GHIA 3NS7A 3P9QA 3JQ8A 4K81B 4MA5A 4MYTA 3SKVA 1NY6A 4YO8A 1QORA 3K4QA 2OC9A 3RSZA 2CXTA 3SCZA 1JFTA 2XVXA 3V7FA 1BSVA 4XFKA 1KIAA 3LHKA 2P65A 4UD6A 1JR4A 4GOXA 3GLRA 2NT3A 2Z2KA 3C6MA 3NIDB 3T5MA 2XMSA 3HVUA 5I7SA 2UUCB 5BVGB 1KGSA 3GEGA 1HQCA 2HJGA 3DO5A 2JANA 4DV6B 1QDLB 3DA8A 3HDGA 1YRLA 1NLZA 2JCSA 2P7IA 1MT0A 1P4RA 1RYBA 1YOBA 2VK1A 3F67A 1USWA 3HA7A 3LVRE 4BFSA 4C0AC 1W0CA 1V6CA 2C2WA 3PNPA 4ONEA 4GLLA 4MP8A 1U0RA 1TU4A 2I8LA 2R1TB 3AKDA 3ZNPA 1H1TA 1JHUA 2ZRLA 3PHGA 1NP3A 3PUVA 3AV3A 5ALIA 4ENPA 5EHXA 3T0FA 4G4JA 3P2EA 3T3HA 4ZJUA 2F3PA 2WR8A 4PC2A 2HUNA 2JCBA 3FPHA 4KR9A 4AKTA 4F4CA 3HO1A 3HC7A 2J7PD 4KIWA 2C1XA 2GR9A 1CUFA 3UT5B 1GL7A 3NETA 1E3WB 2PY6A 4GVXA 2HA0A 2CE2X 4XTCS 3MUFA 3IAM6 1Q7TA 4G0QA 5CRIA 1K4YA 1V2GA 3VTAA 1BCSA 3DP9A 4RY2A 2OBYA 4WOPA 3SP1A 3ZBPA 2WIFA 2F8LA 2MMGA 3MRVA 4PO3X 1FUKA 5AW2A 4JJKA 2C2OA 3OPYI 3WK4A 2QTRA 2VJLA 4Y9UA 2JGRA 4NYMR 1LLQA 4B35A 3Q8WA 2GZRA 1NT4A 5CLQA 4DSAA 1FDIA 7ABPA 1DARA 2RGBA 3JQAD 5H68A 3D6VA 4Z3OA 3RRNA 4YMSA 1G21E 4U6QA 1EFRD 1BWQA 1YXMA 5TB5A 4V1CB 4U7JA 3BMNB 4L9WA 4AQDA 2OHHA 1C14A 4PSVA 1X1BA 5B3JA 2MT9A 4UDXX 3UG7A 2DLCX 4PCLA 1SM4A 1G7CA 1MB9A 3CYFA 2CSUA 2XCUA 1L5YA 3QHAA 4GD3Q 3TOZA 4JXZA 3BRWD 2JHAA 4KV9A 3CLKA 4MUIA 4NQZA 5DDIP 4MEBA 4CHTA 5JYBA 1TJ3A 4FM9A 1Y5LA 1T8YA 3QIAA 1QQ6A 4CLRB 5A3JA 4ZYVA 3D4LA 4KYTA 4J1SA 2I9KA 1PSZA 1I5OA 3C7KA 1ZIXA 3MYYA 4D44A 5EE1A 2W98A 3PYMA 1A4IA 3G85A 3WGYA 4XIFA 2HJSA 1R6DA 2D5LA 5IN4A 1T8WA 1RAIA 5KZMB 2HBQA 1VFNA 3TQTA 3UYLA 2ECQA 1E2FA 1V3VA 1JFFA 3T7KA 3U44A 1P5ZB 3EGOA 3Q6IA 2PKEA 1MD9A 2EX0A 4ENRA 1SUPA 3BQMB 1Q19A 3OHMA 3ZGOA 1F48A 2ZSHA 1X7ZA 2VDLB 5J2TA 3VPAA 2AI2A 2NVOA 3QENA 2FWPA 3PXDA 3TW4A 4ARAA 3QKUA 1A8QA 1Y9ZA 5CLHA 1JRLA 2ONCA 2GAJA 1BC5A 1KFCB 1IBRA 2YWEA 1BKDR 1QF7A 3FZGA 1GNSA 3CJRA 3TXAA 2VQFB 4KPYA 1KQ3A 4QOHA 4Y9DA 4GKVA 3GF4A 5KINB 4J3FA 1UDAA 4V3CA 2I71A 3P2IA 3PCRB 3V5NA 2VL7A 1N2CA 3E5RA 4LDZA 1VB5A 5D5QA 1QONA 3EULA 5ECDA 3TGPA 1F8UA 2JGFA 3G8DA 3KOXA 1D03A 4CM4B 3SS9X 3CLVA 3BJEA 3LT2A 5EMLA 4BDTA 5BORA 4U8GA 2V98A 2VXOA 2FNAA 4KMRA 2AMJA 1DAKA 4CTKA 2QTGA 2YBDA 2H1WA 4F91B 4YRQA 1UM8A 4ZZIA 5JWOA 2E1PA 5CP8A 1EGQA 1VGVA 2RAVA 3L3BA 1JQLB 4KRXA 4BZZA 1MC4A 3S40A 4EHIA 4UAJA 4YRSA 4MDYA 3X2FA 1DO0A 1QE3A 1NOJA 3KPYA 4B0PA 3Q12A 3HJCA 4EF5A 3R6DA 5KJFA 1SKAA 3CCCA 1T6XA 2Q99A 4WZAE 4RVCA 4ZT4A 1E3IA 1D2AA 2KI5A 4F12A 2I66A 1YF3A 4KR7A 2QTAA 3C8UA 4KXXA 1Y0BA 2R751 2YZNA 3CHYA 3ORYA 1A7UA 1IN5A 1AQJA 4XA8A 5EXTA 1WCIA 4UM9B 4DF3A 1IZYA 1HTWA 3DXZA 2ALJA 5DP1A 1SUWA 5DTEA 3ZWCA 5C52B 1G6KA 1XRNA 3CW8X 2IUFA 1KRHA 3PLAE 2O2JA 4JT8A 1FMTA 5K0BA 5B6IA 1RT9A 1TE2A 5KYVA 1GUAA 3MUNA 3TM5A 2IZ1A 4B1FA 5K3OA 1N5IA 3HVJA 4MKXA 2ZUDA 4CHGA 5K8IA 1WE2A 3WNCA 4W9MC 2Y1WA 5CIQA 4GZMA 1G8MA 3WKDA 2SHKA 2ZTLA 4QXMA 5D8DA 3IAUA 4QXOA 3QXXA 4BRUA 3WNZA 3DNPA 1ODTC 2IIPA 3A6EA 3BMCB 3ET5A 3MGBA 4U0KA 4G63A 2HMSA 5FYDA 3Q4GA 3EGEA 4X44A 1E3EA 1EUDB 1P0FA 2A2ZA 4O4IF 4BJ5A 5DCLA 5B4VA 2ODBA 4GWLA 1QMPA 5BR4A 3NRBA 1KNQA 4BU1A 1X7XA 2B4YA 4HDCA 1UC8A 1ZN8A 4F1JA 4ZMBA 1DL5A 1FFSA 5DW3A 5LKRA 1FRZA 3R0IA 1TC2A 4O59O 4EKGA 3W5UA 5B64A 3U4HA 4QBGB 1XDUA 4MUNA 1Q11A 1PWYE 1EHCA 3N58A 4PPGA 3T9BA 3SZGA 4RTNA 3AEQA 3JATB 4HXGA 5HTOA 1GV0A 1FU8A 1QG0A 5A4AA 1VPVA 2OUKA 1OAOA 3NXKA 4MEJA 1KORA 3LQQA 3WXMA 4ZI3A 3JWJA 5FV7A 3L8EA 1L9XA 1E9AA 3E9QA 4QKQA 3ND9A 2AOUB 3FR8A 1QTRA 3A9CA 5CG2A 4H16A 1X9IA 1YBFA 2I80A 3EZLA 1LLDA 3KT0A 4KN8A 1Z17A 3AXSA 2VSYA 2B5WA 2ONKA 4OPMA 5IJZA 5JNLA 1U5CA 1CUUA 4PZZA 5ED4A 1UMDB 3AJDA 5TVKA 5CXSA 4Z9AA 5JJCA 3EZ2A 3DTYA 4CF4A 5EJIA 4YP5A 2EP8A 1V7CA 3PIRA 1XGKA 1R7RA 3H13A 3KEQA 1PQ4A 5HE9A 2PAAA 3WDSA 2PKWA 4O3MA 4IICA 3RAPR 4L4XA 2QJWA 2YXNA 5C1IA 5L95A 1KAEA 1VYTA 1XZIA 2F90A 2ZSFA 1CJVC 1M6EX 1RHQA 2HU5A 3EOZA 3I2FA 4LYGA 4GOLD 2NZVG 3AF4A 2H0AA 1ZKMA 4K87A 1U7XA 4XEHA 2KLHA 4D8WA 5KYYB 1YS1X 3TI9A 1S7GA 1OLSB 4DR1B 3UJ6A 1P0QA 5AHXA 2EJUA 1BTOA 4YDHB 3HNPA 3O4GA 1H4VB 3EHEA 4J2HA 3QVVA 2Q9BA 1L7PA 3FPKA 5GOZA 3UHAA 4IGAA 2W6MA 3H2IA 5HJEA 1H1LB 4PHTA 1IH8A 2CLSA 3BH0A 1NDHA 4H9GA 1NFQA 3A2MA 3B1FA 5C8VA 3QI7A 1YKSA 1TJPB 1QHGA 3GCZA 2E5LB 4YPVA 2R60A 2PVCA 5KYTA 3D3WB 3ZZTA 3HCPA 4E46A 2AZDA 2FN7A 1NNI1 1E2PA 1RI1A 3QEKA 3LK6A 1LC3A 1VA5A 4I4LA 1QOPB 4D4LA 3ZUPA 4W5QA 1TEVA 4AX4A 4LMBA 3CRQA 3HSSA 2P90A 3MJTA 5TMPA 2FGJA 5FLXA 4IW3B 4AZWA 4M8NE 2A9FA 4HQKA 2Q5EA 3SICE 4MQEA 3VUEA 1X39A 3BX1A 4INOA 1UAAA 4LCEA 4HWSA 3CX7A 3DBOB 4LQCA 5CYGA 2QN3A 3DZKA 2GCNA 3KQWA 1PJ8A 1UMBA 3ESCA 5AKJA 3H5TA 4XCXA 3QPCA 3FPFA 5EMNA 2EWWA 5TQ2A 4RTPA 1KSHA 3TYXA 2P5SA 5BN5B 4ZYWA 1YFZA 3FOBA 4ZT6A 5KNDA 5J2UA 2NZYA 4OEHA 5EFOA 1LWNA 2YQ4A 4ROSA 1XU9A 1KVUA 3LP6A 5DN9A 3VSCA 5LZ2A 2WSSA 4O2BF 3LVFO 2G76A 4KODA 2B8NA 2FQXA 1UDBA 2W93A 5HX7A 5IUJC 3TVDA 5U1PA 3OQ1A 1B42A 2HT6A 2JH3A 3K1AB 2QGZA 4RSHA 1M34B 1CCWA 4IDDA 4GL4A 4LI0A 2ZLBA 1W0KD 3CV3A 3WDLA 2FVYA 3KTFA 3C2QA 1E20A 1U2TA 3O2JA 1TT7A 2HCBA 1VPDA 2IZ7A 3IUJA 3DFIA 4NCNA 4XIYA 3SG0A 1A8SA 4DJFC 1VC2A 4V0ME 2HT1A 1LBQA 1CS0A 3ULKA 3DKIA 4YECA 3H2YA 1AKEA 3G6KA 2ENWA 2ZQ5A 5HF5A 4U1RA 1DWPA 3O0DA 4E94A 3JTMA 3UZUA 2N9UA 3PP8A 4QASA 5ITSA 5AICA 1ZEMA 2QL6A 4Q4AB 5DK6A 5TVGA 4B6GA 2GHTA 1SXJC 1QP8A 2ZYIA 1DXYA 1T2DA 1J5EB 1H3EA 4TKVA 1WU8A 2QG9A 3PC7A 2C8KA 3ROZA 3RRFA 1TADA 1WJGA 2GX6A 3IOEA 1AH2A 1OU4A 4QFDA 2FYTA 2IW3A 2WTMA 4E30A 4IR7A 1R8YA 3OM0A 1LJLA 1SOWA 1U2RA 3EIEA 3W06A 4F5EA 5IJ9B 3W78A 1TIBA 1NTRA 1BOFA 2ID7A 4Q39A 2PA3A 1GZHB 1XZ8A 2C9CA 4N0QA 3WLTA 2XMZA 4B32A 4WVLA 1N1EA 1EVEA 3ESAA 4G1MB 1G5PA 4M2LA 2V4ZA 4UZFA 1WV0A 3NZEA 1YDFA 4F6CA 4KR3A 4GXRA 2INGX 1DE0A 4QA9A 4I1PA 2AMVA 3HJTA 4PSKA 5MFPA 1QU2A 2BMVA 1XEWX 1B0UA 4OQFA 1TD1A 1XTUA 1N2IA 2CVHA 4YFYA 1DC3A 1KI7A 3D6TB 3JSAA 4IEEA 4U7FA 2R97A 4WGFA 3E3NA 4V0SA 2WUWE 3NHWA 4UTOA 4R83A 3W2GA 3RVPA 2PA0A 2QW1A 2O0LA 2OENG 1AGYA 5IHXA 1L5LA 3WC4A 3FGPA 2XUHA 2WU0A 2AF3C 2EKDA 3AO0B 4FS3A 3UV7A 5IW8A 2HCRA 3WV4A 3OKPA 4FCWA 4MAFA 3DKPA 1N5LA 3DV9A 1MC1A 1RBYA 2FPXA 3OSUA 3T5CA 1ZHOA 1G8KA 1NF8A 5DNAA 5IF9A 4P4NA 3T54A 1NR1A 1SBIA 3X2EA 4CW7A 4ABTA 2DQKA 3LYLA 1JLHA 4JQOA 1S5PA 1HDOA 6ABPA 3I92A 3SC4A 2G5CA 1BXRA 2FI1A 4Y2VA 3NIFB 5LBIA 2VT3A 4PXSA 4RIFA 1TIKA 3AONB 4JASB 4WH0A 1XZBA 1VXRA 1X8KA 2VAWA 4DTCA 1D1PA 3ZKAA 4L57A 4I4CA 2F64A 4K3UA 2OGTA 3Q3HA 4UBLA 2XZTA 3RNOA 3FCXA 4RORA 4TSFD 1XNQB 1A97A 5G0UA 3I01A 1BGWA 2CMHA 2IHKA 4O4JF 4QFBA 5MFZA 3NV7A 2PWYA 4ARCA 1TLLA 2VP4A 8ABPA 3EXEB 2I2CA 4V02A 1QK4A 3VBCA 2GM5A 3DTVD 2HLDD 3I58A 4J0CA 1CDDA 1ZN7A 3KC2A 4XGRA 3HB4X 4ZEXA 4DQUA 1FRQA 1FUYB 2AG1A 4RIEA 2XGMA 2IC5A 2QN2A 3OIFA 3L0BA 5A6VA 1A2BA 3HB7A 2QY6A 3GVCA 4JLPA 2QLNA 1K88A 3HBMA 1IK6A 1Z2DA 3HGMA 3N86A 4DA4A 1ML4A 5I7AA 1CR1A 3LBNA 1PVDA 5T4HA 1P5JA 1QGDA 2BGIA 2XDWA 2Z2YA 3O1JC 1I3CA 3GFRA 2Q2WA 3G8CA 4BLOA 3RK4A 2XMGA 4LDPA 3EUEA 3I9V6 4RA6B 3HZRA 2RONA 3DQZA 3BZWA 4YT5A 4BZQA 2PYDA 4HR7A 4NR0A 3FWHA 4YP0A 4FFBB 4YRTA 3UXHA 3SPXA 3RF6A 2WEKA 1XO1A 2X14A 3WIBA 4A82A 2C57A 1Y1TA 3CURA 1MHTA 1SVKA 1PHPA 1UJBA 1IQ0A 1L7OA 1V39A 3AIMA 1UZNA 3COWA 2RKBA 3N3BC 2H1SA 3RWOA 1G5IA 1HX7A 1M1YA 2IEIA 4MA0A 2GEDA 1JQAA 1M76A 3H3XA 1RWKA 5JDIA 2Y66A 1VMKA 1QFSA 3JSXA 3HCEA 3FDZA 3ZY2A 5ALXA 5EUCA 2DQSA 2HY7A 1E92A 3PA6A 2OGUA 2JFUA 2DFKB 3L6EA 1DCMA 3LOQA 4L85A 2XCTB 1WDWB 4GMXA 1UODA 4ADSG 3DT6A 4I1SA 4DLRA 3ZHYA 1E0KA 4BTEA 2J9YB 2Z8YA 3CX8A 3N75A 3VJLA 2RGAA 1J0BA 1JKFA 2OL4A 3F90A 4X61A 3MWEA 5E38A 1JQKA 3HEBA 1RZUA 1II8B 1U90A 2Q3JA 2YWDA 4AN1A 3GYGA 3PUZA 2FRXA 3M6XA 1H66A 3HVHA 1BFUA 3NH6A 1SRQA 3ETGA 3PQ3A 3EF1A 3RYFA 1N2ZA 3ETDA 3DVSX 3K9GA 5D84A 3AKEA 3WLJA 3E70C 3ITDA 4QO7A 1SQSA 3TLJA 5F98A 5A0VA 3PQCA 5K20A 2Z5VA 2NV0A 1BMTA 3R3HA 4OP3A 4TTJA 5DNWA 3R7BA 3UJ3X 2PZBA 3L0YA 4QOIA 2PUEA 2J0UA 5C7OO 2IELA 2XEDA 4CM8B 1UXOA 3MQ4A 4TWRA 3JQFC 3C3YA 4WKGA 5C7LO 4XXHA 3LBIA 5LZ7A 2UYYA 2ZSKA 3ZCTA 3NOXA 4AUEA 1G20A 1SC3A 1UBUS 3FRJA 4XQEA 4LDNA 3WHKA 2Y0EA 5C1BA 1OAAA 1FPQA 1RHJA 1U2ZA 5HCNA 2XWJI 3RLIA 2Q2QA 3MZ0A 3VTZA 4EPRA 5ILGA 4X0EA 5KMGA 4OG2A 5EJ9A 5KS2A 4E7PA 4Q7JB 3LTEA 5LLDA 3VH4A 3T1HB 2NYRA 1EFLA 3VOAA 4BP3A 2H2DA 2C9ZA 3ICPA 3QUSA 4MUJA 3PWSA 4CG1A 3OTWA 4MKHA 1JW9B 3F8SA 5DGCA 4E2YA 5IFLA 1VA4A 4TSRA 2V6JA 1KDYA 4RABA 2JIZD 1TQ8A 2ZT7A 5JAQA 5ICCA 3AB8A 2MSKA 4OIMA 4E07A 2C97A 3PD7A 4C0BA 3LK7A 2IUYA 1SAYA 1X86B 3K71B 5EIFA 5C31A 5LOVB 4A0RA 1ZGGA 2WJAA 1BWRA 2UV8A 4WWHA 3FLBA 2D0DA 3EF0A 4L7VA 3NONA 1ST2A 3F97A 4RF4A 4MLDA 4YXWD 4E70A 1W2GA 3K6SB 3HG7A 2XVMA 1NW9B 2DCMA 2JHCA 2OK8A 5TQJA 3WGMA 5M5BA 4JXJA 4X45A 5IMBA 1KYIA 2BBWA 5ECGC 3V4PB 4BVEA 3O4FA 4JJ8A 3WMXA 5KIAA 2GERA 2XUDA 1CUCA 4Q21A 1N0UA 3F3YA 2YRXA 4EG3A 4Z7QB 5IPFA 4YWJA 3WKCA 3QHQA 3VSEA 4G1BA 3H5WA 3V2HA 1I7NA 2Z2XA 3VZRA 1QCCA 4PTLA 3UMYA 1R3DA 1U1GA 3DQQA 1Y8QA 3FTDA 1B6GA 1J1ZA 3D4NA 4AP9A 3KB1A 2C8LA 4ZO9A 3ZXXA 5KTSA 1B41A 2B8TA 2OB1A 1YQGA 4JWKA 2Q2OA 4PZAA 2GWHA 4TV8F 3ZJYA 1JDPA 2H4FA 4NCBA 4K1LA 2GCOB 2VWHA 4EY3A 4DVGA 1DC6A 1C0KA 2YFQA 1GQRA 1H23A 3RRXA 1KDOA 4U0JA 1KRWA 4RJLA 3ZWKA 4E32A 4EUHA 1PL6A 1R6XA 1TKAA 3GP5A 5L53A 1A9PA 4ITUA 4TMKA 4Z2AA 3OUUA 4RSRA 2NMVA 4LK2A 1X70A 4Y6GB 4KVFA 2IHZA 3B9QA 1M3SA 3KUCA 5JANA 4WLFA 4UZEA 3WJ7A 5TT1A 1EI9A 4Y0NA 3F74A 1W2HA 5EP4A 3WNQA 5ALWA 2QD5A 3WJ1A 4DLYA 1XTBA 2LDXA 3BCHA 4M0DA 1OVMA 2EXXA 1XTTA 2C8JA 4G5FA 4MW6A 2PLNA 2QQ5A 1FNBA 4NONA 5LLSA 2JIOA 2I6TA 5IBQA 2HD4A 2VS1A 4UTXA 1FRNA 5K3SA 4ESEA 1T3LA 1KO7A 5F1KA 5K3EA 3NTLA 4C05A 1AHHA 5AXDA 4DNPA 2JKVA 1A4RA 1Y8CA 5KDLA 1TVCA 3W6NA 4F2HA 4HSGA 2ATIA 4F5ZA 2BN4A 1Y7PA 4R8MA 2VJOA 2VWGA 2HCTA 1KZGB 2IHJA 2L18A 3NIBA 3KUUA 4GBGA 5E1MA 3V7NA 1U5AA 3GJQA 4GL2A 2WLSA 1OYWA 2DKFA 2I78A 3QVGB 4U6SA 5ESWA 5BYKA 1JB1A 4CU5A 5DN6D 2PIAA 2W6IA 3A1EA 3KE9A 3MELA 5H83A 1PJLA 3DBRB 2E3JA 5ITZA 3A2KA 4TZTA 2JI4A 2AI3A 1FMFA 4GH5A 1Z7BA 1KQOA 2IHNA 4EDHA 3ZYCA 3WQBA 3EHDA 3S5JA 4AX8A 3ADDA 1I9CA 1SK8A 4MS4A 5KU7A 1N9GA 1TCCA 2IFTA 1Y81A 1PSWA 4AULA 1T8SA 4TTTS 2DJ5A 2QNBA 2YS7A 4EX7A 3AZOA 1WKVA 2CZQA 2QMEA 2OPBA 3ZC3A 1G4AE 3VR2D 4TGLA 1F5SA 5DRTA 4EFDA 4XX1A 3ZW8A 2OM6A 1D0IA 3D43A 3ZHZA 3KQUA 5IU6A 3RCBA 2OO5A 1KDZA 2APJA 2GZDA 4WSOA 1FTGA 3NQ41 1PDOA 2TRSB 1QZZA 1SU4A 4Y9TA 4B6RA 2H31A 3P2YA 4YIKA 4J3JA 1U0HC 3EPKA 5K3AA 4CKEB 1TZKA 2H52A 2WZCA 2GCGA 2QM3A 4KE7A 1XL0A 2NZXA 1EXVA 3LQ1A 2ON6A 1FP4A 4KUGA 4BHTA 1EK6A 2FQ1A 1U80A 3UICA 5M7EA 5JSYA 4AY5A 2DETA 1OFGA 3L84A 5LUAA 1QH1A 4HT3B 1L0BA 2AW5A 3ZPXA 4C0LA 4RHUA 4BN5A 2VDMB 3VSDA 2IEZA 1PTJA 2XJ4A 1VG8A 2D00A 3Q5EA 4XDYA 3WICA 4ZHQF 3EZYA 3MC1A 1NP6A 4O2LA 5KAMA 5BN4B 3STVA 4BMPB 4YRCA 3NPAA 2BFFA 5CB4B 3B52X 3IEUA 1N0WA 3M5PA 1W73A 2E2WA 3BL6A 3ST7A 4QM7A 3BCSA 1S7CA 4YTEA 3GP3A 4HNTA 4NFYA 4JYMA 1IZZA 4XYGA 3ELWA 4E5YA 2Y77A 3I5XA 1ISSA 1CY4A 3KUXA 4GSYA 4GSLA 4XVQA 2G07A 3L4KA 1NXPA 3KQYA 1JJ7A 1H5NA 1PJAA 1IZ8A 1UK8A 2X0RA 1J8FA 2X5KO 2F1IA 4R8LA 4ARZA 2C7RA 3UJBA 1F2UB 1I3KA 3L1VA 3LC0A 2XZLA 2HA7A 4N5IX 4UVGA 3IJ5A 4Z4GA 4CZ2A 3MIIA 3OJEA 3KEGA 3OESA 1F2TB 4JLUA 2BM8A 3QA9A 5LDDC 1OKKA 3AJAA 4YDQA 4MS3A 2EL7A 2R66A 3B3FA 4RV4A 3JQ8B 1R4MA 3WO0A 4XPZA 3B36A 4EZEA 2PMFA 2IYVA 4OQPA 3O47A 1G55A 2P7HA 4J2OA 5CD9A 1MJHA 3LIPA 4IVRA 3ZI4A 4EJ6A 4LZJA 3KUDA 1FJ2A 1QUFA 2XNSA 1EK1A 2EKLA 4ZEMA 4ODIA 4LZOA 3KFXA 5A9RA 3EOAI 3IHWA 5CDGA 4N82A 1PGQA 5EL0A 1NURA 4LZNA 5E2AA 1R6UA 4FLFA 3SXPA 4UNSA 4JB3A 1ULTA 2J0EA 3NHUA 1M5UA 1SPBS 4YP6A 1P4GA 5A4MS 1SCUA 3IDFA 2CFIA 1P8JA 3NJRA 1E9SA 1GYRA 3TQRA 1WF3A 3TN7A 4CE6A 1DRJA 1LRKA 5EMHA 3I45A 1FRFS 3PENA 2EZ8A 1CEYA 1SBTA 1WS6A 2YXEA 3P9IA 5JD6A 1RYYA 2RD2A 4NI5A 1QHYA 2B0JA 2BDTA 2NX2A 4G37A 5JXJA 4KO8A 2PMWB 2FPOA 4KX5A 1FP6A 3U3RA 2Q07A 3BWMA 2GD2A 4AIIA 4EHAA 3AUYA 3GJRA 4FP9A 2XZOA 2Y1GA 3TIXB 4WJZA 1BCSB 1RRFA 4B83A 4KIUA 5EWJA 2NZUG 1DAFA 4PHCA 4YPFA 3GFBA 3HB9A 1EFDN 2AC7A 4M1TA 3S2YA 5JAIA 1FUEA 1TGYA 3BILA 3F9RA 3OM8A 4LTNA 1FFGA 3KHUA 3IXLA 4QPJC 3GWZA 3R7LA 5K2MA 4ZI5A 1O5IA 2IDKA 5DXJA 16PKA 3I28A 3JALA 4HRAA 3KKMA 3P4XA 5JVDA 3USCS 2Z9DA 2CXSA 3ZHQA 4AUMA 5FR2A 3B9PA 3P0FA 5IM4A 4I5GA 3R8FA 1YI8A 2HFJA 4NBUA 5DFAA 3MYRA 3BM5A 3M4JA 3E2IA 3R5SA 1PD1A 4D3YA 1OA0A 1TL7C 3U2QA 4D43A 5I4IA 3FCOA 1ULBA 3HI4A 4PYJA 2W71A 3HLKA 2PL1A 2PWAA 1PK8A 2IK8A 3H3JA 3B8HA 4DXHA 4G1VA 1GGJA 3AUAA 5FEMA 3TFOA 2J0QA 3C3BA 2R6GA 4LOIA 1AKMA 3OIWA 4MB2A 1H2WA 3REGA 5IC4A 1G38A 5A5DA 3K5HA 4RH3A 1JFFB 1QGAA 4AZSA 1IPEA 5BN3A 5BNZA 5I7EA 3U44B 1TI7A 4DC0A 2IH5A 2FXIA 2VWQA 3DE7X 4AYWA 1L8QA 3ZHRA 5BW8A 2Q29A 1CV2A 5FI5A 1ZC3A 5J4LA 1X7ZB 2P75A 5J2TB 5EJMA 2H2IA 1NMSA 1M66A 3IBGA 3FGOA 3L7YA 4JI4B 4XB2A 4CMAA 3U19A 3A11A 3EC7A 2NG1A 1SC1A 721PA 2PBRA 4RPLA 4X00A 3BQ9A 5JZMA 1W5AA 2XT0A 3EE6A 5HFJA 1NJ6A 2IHBA 1RBMA 1DAEA 1YZVA 3QBDA 5E3HA 3S8YA 4Q24A 3JVDA 1YHZA 1JG3A 4MCAA 1N2CB 2OTCA 4BNIA 3L46A 4JKOA 5TSDA 1T8RA 1O6CA 4MPPA 3VR4A 2JH9A 4YPOA 4OBXA 3OAAD 5IAKA 3ROFA 4AM8A 5DNYB 2H4YA 2HF9A 1M7HA 2QJTA 3AC0A 1Q83A 4JIMA 5EKUA 3CMMA 1A7AA 5J43A 1KOGA 2C77A 2GBIA 2PZAA 3AWDA 4YCBA 4XR9A 3J80A 2E7ZA 1EP9A 3UW1A 5BMOA 2YMPA 2HQOA 4GECA 1L1QA 3GRFA 1R0XA 3F4BA 1YRAA 3AK4A 1Y4DE 4UPDA 3AIOA 3JQBC 4P80A 4IUCS 2CNOA 3W8EA 2GEVA 1MX1A 5HRCA 3KXDA 3TX6A 5BN1A 3EZXA 2D7JA 4WKOA 2RGRA 1G4HA 1M2NA 1PUIA 4E03A 1JVSA 5AM0A 4ENVA 4CLOA 2ZI3A 2PD6A 4O4HF 4AK9A 1G3UA 5JROA 3EH1A 2JA1A 4P5PA 3WLOA 5A4KA 1WCIB 1V37A 2HBRA 3EEIA 1JBQA 3PFHA 2HDNB 3W5VA 4CWAA 5I5EA 3IMEA 2ET6A 1HEUA 1MO6A 2NU6A 4D45A 1YMQA 2GUWA 3RHFA 3F5MA 3KV3O 3PQ8A 4F72A 4P54A 2H2GA 5FUQA 1WZUA 2XNCA 4G23A 3GLIA 3W7VA 4WA8A 4MGHA 4BN4A 5BPHA 4CM6A 3DE6X 3GJZA 1XALA 1YZHA 5LDGA 2VT2A 1ZSNA 1DBPA 3IOBA 1R0WA 3PWTA 3IVGA 3D81A 4CCWA 4QQNA 5KHAA 1AQYA 2XYRA 3NR2A 5B55A 3R6TA 4IFIA 3NEAA 2GKGA 2RIRA 4I14A 1AGPA 1CJKC 3T7CA 4C2BA 2A35A 3C3MA 2YW9A 5EYPA 4TKUA 4RVGA 3OIVA 4LC0A 3ZH9B 1NW5A 4LJYA 3RS4A 3T61A 1X7XB 5IH7A 3LD9A 5CBKA 1OWMA 4KQWA 1AS3A 1V7QA 2JCVA 4P93A 3KD2A 1K9SA 4K6MA 2CB0A 2IXAA 2FPKA 2Y4NA 1HQYE 3TQHA 5I7HA 4ISBA 4GPIB 2P2SA 2IYYA 4RDXA 1IZ7A 3AEQB 2YIDA 1K7YA 1VJ1A 1IHYA 3WRYC 1JG6A 5FF9A 3JR7A 4D9BA 3IEVA 1QE0A 4U7WA 4F21A 1SOVA 2JLAA 3UMJA 4BFVA 3PTAA 2HADA 3HKBA 2BGRA 1OUMA 3H2ZA 1W30A 3FSGA 4KE6A 4P98A 3V8BA 3I5YA 4IDPA 3G59A 4YQFA 1E2EA 3W34A 2XUAA 2WWRA 1H2ZA 3WBFA 2XUFA 4JSRA 1VFPA 1M74A 3WL7A 1J6UA 3IR5A 2QXUA 1K98A 1QRDA 3OUTA 4RZXA 4P86A 4EY8A 4LJ7A 2WU3A 2XNDA 1B43A 1SIUA 1V2HE 1X1RA 1R6AA 3FNGA 3HBJA 4YHBA 3ROEA 4KK3A 3F73A 1D04A 1Q0SA 1QPGA 3NIWA 3ACBA 4R5HA 3SHQA 3ROQA 3K9WA 1XMJA 1J70A 1P77A 1P9RA 2EJWA 4LWPA 1M2GA 3GX1A 4F38A 1DC4A 3A05A 4JMLA 1J8VA 1RMYA 1XDGA 2CVZA 2OBMA 1KPHA 4RE6A 2GD6A 4YR9A 1WXQA 4UVHA 2JLSA 1OCEA 4X94A 4ERNA 1FFCA 1LDGA 1DT5A 1HQDA 1D1TA 1FLDA 1VGRA 3CRMA 2Y93A 3UK6A 3OTGA 4DWJA 2AJTA 2B2CA 1L4BA 4ZCIA 4KIFA 3IAFA 2WWYA 2D74A 4XRGA 4H7EA 1C1XA 1WETA 4UXJA 4PQGA 2YCBA 4XUEA 2NT4A 1RHKA 5HCIA 1DDGA 1V25A 2IP4A 2NGRA 1VKRA 3QITA 3W2EA 2VDQB 2IIQA 4HAYA 2YV1A 3R3WA 4PGAA 5JDCA 2TYSB 5F23A 3OZWA 4Q4CA 2EIXA 4F85A 1HT0A 3GDGA 1MJ5A 3Q2OA 4ZP1A 5BOSA 1KJ8A 1CEEA 2Q3CA 3F96A 5CUQA 1E89A 4A73A 1T13A 1Y80A 2FCAA 5C1PA 3OPYA 1UR5A 4J0QA 2D1QA 4XOIA 1B74A 3PXEA 4OXKA 5EXPA 3UHPA 3L04A 3WAKA 3KYBA 1XMSA 2P9ZA 4D96A 5IRCD 2C96A 3H4TA 1Q1ZA 3NP7A 2P6RA 4HFJA 1TKRA 4LWZA 3RVDA 3KKKA 4M7PA 2J46A 1VYHA 3OX1A 1C9MA 4B73A 4MVYA 4H4EA 1Z12A 4DLPA 1TK2A 2X2OA 2M6LA 1YQQA 1VE6A 2AQ8A 2JEZA 4NL4H 4MQEB 2JFZA 4XPIA 5HBRA 3PHHA 4UATA 2WWWA 4BVBA 3QP9A 1YB7A 3LQYA 3LW7A 1OBHA 2B9VA 2IP2A 1ZLXA 1UMBB 2D1SA 1A77A 3OLVA 4K6OA 2GXSA 4DMHA 2W42A 2YUIA 2G9VA 5TQ2B 5DSTA 2NZ8A 4GC9A 4EB0A 1CY8A 2FMXA 1ZITA 2Y9MB 4W4TA 2D2VA 5J2UB 3HEMA