3CKLA

Crystal structure of human cytosolic sulfotransferase sult1b1 in complex with pap and resveratrol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
289
Chain Sequence
DILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLGRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sulfotransferase family cytosolic 1B member 1
publication title Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
rcsb
source organism Homo sapiens
total genus 101
structure length 289
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cklA00
2GEDA 2W0MA 4JLMA 2ZYUX 4ESVA 4LBVA 4LJ7A 3SQWA 3K0CC 5HTKA 3L0PA 4GFDA 5B30A 4DLSA 4TZ6A 3CONA 1VCNA 2FZ4A 1D9XA 1Q20A 1LS6A 4IEEA 1E2IA 1E9SA 2PZEA 3PVSA 3I62A 3AVWA 2ZI4A 3W9YA 4C3ZA 1OFUX 1U0JA 2TMKA 2XX3A 1WCV1 2OG2A 3KJIA 2HV8A 1NBME 1G17A 1G5RA 2ZU6A 2NO7A 2C78A 1KAGA 2OUKA 1GRQA 4NYMQ 4DSNA 4NCHA 4YXWD 2YOHA 4DCUA 4PQFA 1OH6A 1P2SA 4TMKA 3ZQ6A 2D7DA 3NIBA 3EW9A 3THWB 3NEJA 3TW8B 5DHFA 2GK6A 4OKSA 3CPEA 4LYFA 1KY3A 4QKQA 1MOZA 4QJ4A 2HYDA 1E9BA 3CZQA 1JR3D 1OKKD 4L15A 3A1WA 1Q22A 2Q21A 1E99A 2IC5A 2WKPA 4H1VA 4IOKA 3NDPA 3GJXC 2RHMA 3B78A 5JWRA 2C03A 1XJ0A 1ZVQA 5JECA 3IBYA 4CEHA 3U6KA 1W4CA 2MMCA 3RS4A 3FGNA 4B3XA 1IY0A 2C9YA 2BEKA 1N6KA 2HLDA 2OFXA 3FKQA 4QNMA 3PUYA 3QG5A 2XAUA 4I1OA 1QVRA 1P9WA 2CL7X 3REGA 1MO6A 1WMSA 2ZAOA 1AKEA 4DCSA 2VP9A 4BASA 2R6AA 1ZU5A 2PT7A 821PA 4RD0A 2IL1A 1YZLA 4BLPA 1T4GA 3H2YA 3MLEA 2BBWA 4D0LB 1E2PA 4TMVA 1QHHB 3QF4A 2JLWA 1NKTA 5C18A 1RKBA 1CJVC 2OXCA 4HZIA 4F38A 3PEWA 3SDZA 3FWYA 1E9CA 4B73A 4DDTA 1Z08A 3W34A 2J45A 2HT1A 5JEDA 2X19A 4QXAA 4BLRA 3K70D 1RW4A 3L82B 1II9A 4LYAA 4QBHA 2GKSA 5FOWA 4Q1FA 2HXSA 4Q1BA 5EP4A 2VQSA 5LPNA 4M1KA 4DXAA 1G8YA 1G8PA 2IF0A 2JIZA 3CRMA 1EFCA 3W3ZB 1VYVA 2JLRA 4G0NA 5GVRA 1FL9A 5CB8A 1US8B 2REXB 3IIJA 2J0SA 4C7OA 1X8LA 3E5HA 1E4VA 1P61B 4Q47A 4AG5A 4IVPA 4D25A 4O0MA 1P2TA 1ZNZA 3RABA 4Q4HB 1EG7A 2XXAB 1Q12A 4NU0A 1KKMA 3VKWA 3W6OA 3QXHA 3LD9A 1XBTA 3DDCA 2O5VA 4XWAA 3TUJC 1B0UA 2GAOA 1DBSA 121PA 4NYIQ 2EFDB 2FA9A 4Q48A 1OFTA 2XZLA 4WZAE 3ZVMA 2ATXA 3M0EA 1DAGA 3EPJA 5KOYA 2F55A 4BZXA 5EUQB 1WRBA 2OCAA 1N0VC 3LQQA 4QG7A 4LPKA 3T15A 3UWOA 3P32A 1E3MA 1Z6GA 3K8YA 3TSWA 4LY6A 1Q3HA 3H84A 3MAAC 5KNDA 2C9CA 3P20A 2V9PA 3FTQA 2IYUA 3LY5A 4LDJA 3ONWA 3PUZA 1DG1G 2DPXA 2PCLA 4KYIB 1R0WA 4QJ5A 3AH8A 3B5JA 1CRPA 4LV8B 4QNRA 2GHIA 2FMXA 4ARZA 1G7TA 5TB5A 3K70B 2F43A 2OCPA 4H9GA 2P6RA 2X2EA 2AXNA 2E1RA 1OV4A 1UJ2A 1XMVA 4NE2A 4JLAA 3HU3A 2QP4A 1XMJA 3Q72A 4FXPA 4WVFA 2FWRA 3QPVA 3QNUA 4FD2A 3LX8A 4IKEA 8OHMA 1TF7A 4IVQA 4TTQA 5F3WB 2OO7A 1G7SA 2ZXUA 3G5UA 2ANBA 4BLTA 2F1IA 2BBOA 2I3BA 1NIJA 2BVNA 2V54A 2X8AA 1WQ1R 3RS0A 1KDOA 5KNBA 2FF7A 2QT0A 1OHHA 3NTUA 1EX6A 3HYTA 3QKSB 4P31A 4ZDKA 3QEJA 3KXKA 1JI0A 5JZVA 2DR3A 3TJZA 1T3SA 4N0DA 3V9PA 5DH9A 1E0AA 2PZFA 1Z6XA 1HYQA 2I4IA 4LBZA 3D6TB 1IY2A 3NKVA 1CR0A 2B7BA 3P26A 2IYWA 4B32A 1KI4A 2H18A 2HT6A 1D5CA 2HF9A 3WHLA 3CRQA 5BW8A 4TYNA 2QAGB 2PMDA 2WKQA 1TMKA 4XSGA 2XITA 1UDWA 5DYGA 2DFTA 2VP6A 4B74A 2IS1A 4B35A 2ZI5A 4KVGA 2IS2A 2WWFA 1L2TA 2Z43A 2CLCX 1GILA 1Q0UA 3ASYA 1BKDR 1Z0JA 3FMFA 4UXHA 1MO4A 4PTLA 1WF3A 2HJVA 3BE4A 4JLOA 1LF5A 1JJVA 4D4JA 2IX3A 4PFSA 2OSBA 3I8SA 4Z1MA 4Q7KA 4MRPA 2QMEA 2R44A 3R8CA 1F2UA 4ZO4A 2VO1A 2FOLA 1CKEA 3OIUA 4PQYA 3HR7A 5GADl 4Q4JB 1FW6A 4Z8YA 4RZXA 4F91B 1Y3AA 2ZRIA 2CE7A 3EC1A 1NSFA 4NL4H 4X8MA 3ICEA 2W6JD 5EQTA 2JIZD 1U90A 1XD2B 2HEIA 5IT5A 4URZR 2QG6A 4M53A 3SU8A 1K8RA 4UQOA 2V6JA 1F48A 2Q9CA 4TMWA 3U3KA 4QBFA 2ONJA 1JXMA 2PJRA 2VHCA 1Z0AA 1CTQA 4C0JA 5A5GA 1E0KA 3M4YA 4ZPXA 4MRNA 2ZJAA 3ICQB 1PVOA 4R9UC 4DUGD 3WBKA 1HT1E 5DI9A 3ZYCA 1NLFA 2REBA 4YONB 4ESHA 3KFVA 1E9FA 4BLSA 3IBGA 3KTAA 1C4OA 2R6GA 1E2KA 4EFNA 4CEHB 4IDPA 5AK0A 5SZJA 3F0TA 2B8WA 3FB4A 1J99A 2JJ1D 4DLZA 1ZD9A 4A0HA 2ZRCA 1W4BA 3K9GA 4C0BA 2HCBA 1AK2A 1CR2A 1JR3E 2IYXA 2J7KA 3KXIA 3OESA 4M22A 1ESMA 4ZDIA 5FTMA 4PPNA 1KJYA 2RGGA 5KPJA 1OB5A 4HEJA 5CLLA 2O8EA 1I2MA 2IHYA 3LBIA 2V3CC 1SVOA 3QF4B 2HCJB 4U7DA 5EZ6B 5DLQC 3OIVA 1AZSC 1N0WA 2W0SA 3AKEA 4LJ6A 1GITA 2RH5A 1JNYA 1N0UA 2VHUA 5DSZA 3GFPA 2R6DA 3WYGA 4W5WA 4X8OA 3KKPA 4DWJA 1YRAA 2QA5A 3W3AA 3TUIC 4F7WA 1F3OA 4RCZA 2DYKA 2J9RA 4KV9A 1GDDA 1Z83A 3K0EA 1TNDA 1GUAA 5AUQA 5F9HA 4QM7A 4P0TA 1NJGA 2HF8A 3ZIAD 2QM8A 4C7OB 4RD4A 2H57A 3FPAA 4F4JA 4POAA 5KTYA 5EP2A 4HI0E 1OXUA 1QF9A 5LD2B 4CZ2A 2EU8A 1TF2A 3LAWA 4HUQA 5AUNB 5H8WA 3QQ5A 3VHXA 3U7GA 2G3YA 4BFZA 4E22A 3CRVA 1E1RA 3VKGA 2WJJA 4Z54A 3TE6A 1Q1ZA 4A1FA 1KSFX 1U99A 1QHGA 2HJGA 1ZC4A 1ZMXA 1R6BX 5FUVA 2D06A 4X8HA 3EZ9A 3TR5A 4CT5A 1YQTA 1DAKA 5JWOA 5CIWA 3RRNA 2CCJA 3AVQA 3TSZA 2ZJYA 4HB0A 4LHXA 4OQFA 2GEVA 3UG6A 3SZRA 1W1WA 3DZ8A 3RS5A 4AI6A 3CX6A 2QROA 2ZJ2A 5FBRB 4M0LA 3BOSA 2ERYA 2JDIA 1S1CA 2DBYA 3B1VA 1R2QA 3EIQA 4LHWA 1P7CA 2AX4A 1ONBA 3GJ4A 3MJHA 1NRJB 1RE0A 1SXJA 1FX0B 1C1YA 1WXQA 2DWQA 3PITA 4KLNA 4WBSA 3BIFA 3FFBA 3W8RA 4GL2A 2NO1A 1MT0A 4PPQA 3WRXC 1NL3A 5DI3B 1UM8A 2VHJA 4HB2A 4J0QA 2ZRJA 5TDHA 3MRSA 3GLGA 1Z8FA 3QSYA 4L9WA 4Q00A 3GJ7A 2IUTA 2A30A 3DZDA 1N3BA 3A4MA 3EA5A 721PA 2BM1A 2F43B 2KBEA 2ZVQX 3OAAA 4GZLA 1E9EA 4JYCA 4NTZA 3AB3A 2EFHB 3C5CA 4RKFA 2Z4SA 1LY1A 4WXPA 3PEUA 2P65A 3CF6R 1N5JA 3K09A 5AWFC 4D80A 5BN5A 3B1ZA 1XU4A 3ND8A 1H65A 4DT1A 4ZCIA 4OQLA 4UNNA 2G1JA 1XJQA 4NONA 3U4QA 1SVSA 5IDVA 1R0ZA 2GXAA 1VCIA 5HKKD 1I4DD 1PZNA 2AWNA 4QL3A 4A2WA 1XMIA 3RS3A 3FHTA 4JT4A 1IXSB 3AVTA 5DGXA 5EXPA 2G0TA 2JLQA 4PSKA 3HP1A 4A2PA 2ZREA 3C4JA 2PH1A 1HE8B 4A82A 1IOZA 4EFLA 2ZE6A 1S9DA 3OFND 2QMUA 4DB2A 4XD7A 5GVSA 3MUFA 2RCNA 1IXRC 2YOFA 2B7CA 2ZE7A 2ZUCA 3NH6A 1N6LA 3LXRA 1U8AA 3CWQA 4HDCA 4G5SA 1ZUNB 2LKDA 1P75A 2W00A 1OIXA 1RZ3A 2Q9AA 2A3RA 3BORA 1ZUHA 4Q18A 5HE9A 1GL6A 2VTKA 2XOKD 2GCPA 1AIPA 4S35A 3GFTA 3QXCA 5TV2A 1FQKA 3PEVA 3B1YA 2VP2A 1KNXA 1T0JB 4HAXA 4M9ZA 4P4SA 4TYWA 4F4IA 3JZMA 4PHGA 4WZBE 4URXR 5E95A 4Q4LA 5HE8A 3T1QA 3SJZA 2WTUA 4N3NA 1XD8A 4ZDJA 2VBCA 4M1OA 4LHZA 2D62A 4PO9A 4C4PA 3C15C 3PEYA 5FBQB 3TSOA 4EPRA 1XTSA 4BRUA 2CE2X 3UANA 1NMZA 4D4MA 2IK8A 3WYAA 4ZV4A 621PA 1IXZA 4IXNA 4PPGA 4A8JA 2FEMA 1M2OB 1M6NA 2WICA 1CBUA 1JQLB 1GWNA 1KI2A 1Z2CA 3CH4B 4OYHA 2GJ8A 2IYRA 1VECA 1E79A 1IJFA 4DJTA 4XVUA 3EPLA 1NY6A 2RGEA 3ADKA 1XPOA 1BMFA 2XNSA 2ZRBA 3OEHD 4DSUA 4Q9KA 1D2MA 3AF4A 4RZ2A 1E1RD 2WPDA 1IN5A 1NG9A 1T6NA 1R4AA 3KKNA 4PAQA 3VFDA 3SFVA 1FNMA 4V0OA 4JYBA 5SZKB 3KTAB 5J40A 5K8LA 3FVQA 1P73A 4K46A 1CRQA 4JVNA 1DOAA 1XFAA 4OK6A 2WBLC 2EFGA 4HUTA 3AF1A 4MDEA 2J0UA 4V0NA 3VX4A 4XVQA 1NVUQ 2CNWD 3OF5A 1G41A 2NO9A 4GMDA 4IJMA 3T1OA 2G77B 4B2LA 2V7QA 3EASA 3LRPA 4NDZA 2JDID 2W58A 3FKSA 2J46A 1XDBA 2F7SA 2O8EB 2ZI7A 2RGAA 4C9BA 2KBFA 2ZS8A 2ZAMA 4NYJR 3A1VA 4XH9B 2ZS7A 1G5TA 3NVAA 3LBHA 1OXTA 1U0LA 1HTWA 3B60A 2DCUA 2VPPA 3CRW1 1DARA 2CJWA 2QNRA 5JWHA 3AVYA 3ETLA 3RWOA 2VSOA 5FBWB 4BE7B 3R9IA 2FU5C 2ZVPX 3UMFA 5J4KA 3OAAD 3QBVA 3IIMA 3B2EA 4X8LA 5CITA 1QHSA 1ZD1A 1ZP6A 2QT1A 3KUDA 3U5ZB 2WMNB 4WXRA 2WSSD 1DPFA 5CYPA 1XPUA 1VPLA 2VSFA 1ZW6A 4IDNA 3CNOA 1C9KA 3WMEA 2OBLA 1R5BA 3ND9A 1X8JA 2EFEB 2K5UA 3KL4A 5FTNA 4TTRA 4TL9A 3SOPA 4B3CA 4F92B 3GJ3A 4FIDA 4JL8A 3QXSA 2IXEA 3Q5DA 4PQRA 5K8IA 3BS4A 3BXZA 1XEXA 1LNZA 3BFKA 1RFLA 5EE0A 4RZ3A 4XOIA 1XZPA 3HU2A 4XD7D 1KZ7B 1GIAA 2QN6A 1Z22A 4M1SA 4IXMA 1SVMA 1ZCAA 3AUXA 1D2EA 1KO7A 3JZAA 3LA6A 2C04A 3B9QA 2CMKA 4JJKA 2JA1A 3MWJA 2JJ8A 4UXJA 2NPFA 4W5HA 4ERNA 1ZD8A 3GLFB 3VNVA 4QM6A 1LS1A 1GNQA 4JSTA 1HURA 1P72A 5FPTA 2PEYA 1KJWA 4RCYA 1Z29A 3CNLA 4JLJA 1GTVA 4KJZA 2AD1A 5JRZA 2NTYC 4BQSA 2FG5A 2ODEA 2VYFA 4G5QA 4M8NE 2QBYB 3GEHA 4N0EA 4YMSA 3GLGB 3HU1A 2CCKA 2GEUA 3CH5A 2BKUA 2FPKA 3DKVA 2A5JA 2G0NA 3ZDQA 2FSIA 2QPAA 1O3YA 1PLLA 3BC1A 2G9NA 4GPTA 2AKAB 3VU9A 5KYKA 2ZRPA 2W2XA 5SZIA 1U94A 2KSQA 3QUSA 4ITRC 3CRRA 2ZPTX 5HPYB 5G41A 5E4FA 1GL9B 2FZLA 3QF7A 4F93B 4A0FA 4IOLA 1XP8A 5KSPA 2IUSA 5FL7A 4DT1B 3SJCA 1H8EA 2VP0A 3U4QB 2J5XA 3LLMA 5FH9A 4MDFA 4AY2A 3K0FB 4AK9A 3S1AA 1YR8A 4EQ6A 3SC3A 2JLZA 1VHTA 3ADBA 2JASA 1OF1A 3VR4A 1E79D 4FW9A 1SQ5A 1ZYUA 3L43A 2YWGA 3VR3A 2ONKA 1BMFD 3LWNA 4Q5IA 2WM9B 2NZ8A 1HA3A 1QVAA 4KI0A 3BGWA 4PZZA 3RS7A 2JLUA 4I81A 5GJBA 1A2BA 3GD7A 4KAXA 1YZGA 3IUYA 4Q9LA 1S1MA 3LW7A 1NVVR 2R9VA 2YC4C 2ZRFA 2Q3HA 3RSLA 4LSGA 3EWAA 4OK3A 3CPJB 1YRBA 2MSCB 4E07A 4TSFA 2FFQA 5F9FA 4CVNA 1GKIA 1OLOA 2BJWA 4HAWA 1EFRA 3K9HA 3K9LA 5J4VA 2O8DA 1U8ZA 1VCOA 3IHLA 3IDQA 2BMEA 2V7QD 5C46F 1L7VC 4ASUA 3FKSD 1ZBDA 1GP2A 2J0VA 4PO8A 1F6BA 2QAGC 4P4SB 3C14C 4G5GA 1UBGA 4PR0A 1E2DA 1BOFA 5C4MA 1NN3A 4LHVA 3RWMB 4V0LA 4MGIR 4GNKA 3LXXA 4JLNA 4EJSA 2H5EA 4OI0A 4JL6A 3WNDA 4EAQA 1H8HA 3BB4A 4Y0VA 4BEJA 3GPLA 1XTRA 1Q1BA 1CXZA 2ERXA 4LPSA 2QSYA 4I1UA 4MGZR 5CYOA 1CLUA 4MUAA 3T5GA 1Q44A 2DFKB 3MJRA 1QG4A 2WJGA 2DB3A 1XEFA 3QE0A 4BFYA 1OYYA 3DM5A 4HAYA 4OI1A 2WWYA 3UPUA 2FFHA 4IOMA 4C2UA 4A8JB 1N5KA 4EIWA 3B13B 4Q1CA 1YHNA 5DISB 1G7RA 1YR9A 2FSGA 4WZ6A 1X6VA 2Z0MA 3RS2A 4AYWA 1Z6YA 2C2HA 2PZGA 5D3QA 4OHVA 3GFOA 4FN5A 4TQ9A 2E9SA 5EJEA 2O8FB 1XF9A 5D3MA 2OLKA 4DDUA 2CHGA 3WY9A 4MRRA 2CVHA 4DBLC 5FOXA 1CP2A 1R8SA 4HDOB 1G16A 2YWEA 5CB6A 1AM4D 2CDNA 4Q9IA 1G3IA 2J0UB 3PFIA 1WDTA 3VQTA 1YZQA 3A4NA 5G53C 1SHKA 5F2EA 3TRFA 1Z6AA 4BLOA 4BLQA 4TLDA 1IY1A 1KI8A 2D7CA 2EWVA 3H0KA 4DCTA 1NLZA 2JLXA 4CEIB 5JSZA 3DOEA 1W44A 5B58C 1E2MA 1ZINA 4OHXA 4UNSA 4D26A 1OE0A 2X2FA 2CBZA 3AP1A 4UNPA 1CS4C 4WA7A 3MCAA 3TW4A 3K1JA 3TR0A 2NGRA 3EPKA 3DVLA 4MYUA 2WJHA 2A5FA 2CEAA 5CDFE 2EYQA 2BOVA 1TAGA 2FEOA 1DAEA 1VCMA 2XSZA 2WJIA 2ZI3A 1Q1QA 3OIYA 1LFDB 4C0LA 2Q3FA 2ZSDA 4DLVA 5KSYA 3LDAA 4OQNA 4JLKA 1RYFA 1TQDA 2CJWB 5FTKA 2G83A 3GLFE 2AK2A 2JJ2A 3X1ZA 2ZANA 1S3GA 4S2EA 1ESNA 1XB2A 1KI9A 1LB1B 5FFMA 1KO4A 4NZYA 3I72A 1XRJA 3IO3A 1JPJA 2BCGY 4C30A 3GLGE 1PLJA 4MH0R 1ZJ6A 2JAQA 3LLUA 4LJYA 3RRMA 4PC1A 4A15A 1EFUA 1ZNWA 2BV3A 3B9PA 4IEIA 5KDLA 1G4UR 1GSIA 2IYVA 1UEJA 1EXMA 1G6OA 2R6FA 1UADA 3K9NA 2OV2A 2D3WA 3EARA 5JMTA 1XEXB 4G5RA 4ZCLA 3UK6A 3UWKA 2VP4A 1KAOA 5LD2C 3NHAA 1W2HA 1P2UA 2RGNA 2WAXA 3TVDA 5EUMA 2Q9BA 3Q8XB 2IYLD 2HUPA 1AGRA 4EPWA 2OBNA 1VG8A 3VX3A 2IS4A 4OQXA 4JVSB 2GA8A 4OBEA 2GETA 1MH1A 3NXSA 3PUXA 3TH5A 1KO8A 2WWWA 3AVOA 3EIEA 4JVLA 4RD3A 1W0JA 1W4AA 5KU1A 2YNMA 4JBXA 1KMQA 3KQLA 2QE7A 5FOTA 1YZTA 4L4UA 2ZJ8A 2KE5A 1WBDA 1R0XA 1EFRD 2QU8A 4DLYA 2NZJA 2A5DA 5KO2A 2OBMA 3VMFA 2BBTA 5E3HA 4G01B 3VR2A 1KY2A 3FE2A 2WWIA 4RFSB 4Q7MB 4QGGA 2WHXA 4PANA 4I4LA 1HEIA 4F4CA 3I92A 2OHFA 3EXAA 2QTFA 1FPMA 2OESA 4V0MA 2B8TA 1UBEA 1N6IA 3K0AB 3F5FA 4M9XA 3U6BA 4EPYA 2CLDX 3VU9B 2OEPA 2PBRA 1N25A 2XEXA 4WIAA 1VIAA 1VTKA 2ODNA 3IO5A 3AKDA 2YINC 2F1RA 1NG1A 2ZJZA 4KU4A 5FPHA 4A6PA 1S96A 2RGNC 4R7ZA 1G7CA 2QUZA 3DOFA 3E1SA 4BFWA 2HLDD 2P6NA 3A4LA 2VL7A 3CB4A 1M74A 3RLFA 3RRZA 3PR1A 4QJ3A 1W0KA 4JS0A 1YZNA 3LQRA 4TQUS 3S1AB 4EQ6B 5BWMA 3BH6A 1AS3A 3CLVA 3RYTC 2PX3A 4KFSA 2OXRA 1T9HA 1YE8A 2HDNB 2YOGA 2W2VA 2O0KA 1A7JA 3E2IA 2GXQA 4M21A 4PHFA 3HWSA 1IN6A 3FMIA 3IQWA 4HLQB 4ZKDA 2PMKA 5JHHB 1TQ2A 4OHYA 4KHZA 1DG3A 5FPYA 3RANA 4LZZA 1XXHA 1E2HA 3L0SA 4FMBB 3F3YA 4ILEA 4YDSA 3L8YA 3SYLA 1KZGB 4YMWA 2OZEA 4D6PA 5CM8B 1XNJA 4GSYA 4PZLA 4Q1EA 2O8DB 4NH0A 3NG1A 5JS8A 3SBEA 2P6UA 2IBMA 3NBFA 1XCGB 4MKIA 4PC7A 3ZZUA 4B3GA 1G1MA 3AUYA 3KKOA 3VR1A 2GNOA 4TT3A 2ASEA 4FCWA 4HB4A 3QPWA 4EFMA 4NMMA 3NC1C 2C95A 4RKEA 4MYHA 2N46A 4XSHA 2PLFA 2QGNA 3GLIA 4I99A 4N1AA 2GWHA 4E03A 3RC3A 1T3HA 1TF5A 3LFUA 2GCOA 1FMLA 3ZS8A 3T61A 2ZROA 2O8BA 1LTQA 4GI7A 1A4RA 3PXGA 1DVRA 3IEUA 4NBSA 3IKJA 4M1YA 1VIYA 3KB2A 2CXXA 2DWOA 5C4GB 1X3SA 4L5BA 4RVCA 2RKOA 4FINA 3MGCA 1W47A 2Q0HA 2ZRNA 1RJ9A 4BPBA 1A1VA 1M7GA 3FHCB 3I73A 2WJYA 2YJTD 1P60A 4K81B 2XZOA 1GRRA 2ZUBA 1A82A 1P2VA 4MGKR 3MWLA 5P21A 2GF9A 1R8QA 2J41A 2ZRHA 3CF0A 2V55B 1T5LA 3QEOA 5IK2A 5L3QA 5LB4A 4LV5B 5ELXA 2NIPA 2WJVA 2OM2A 2BKEA 3BFVA 4LJ9A 1TEVA 2OT3B 3U7EB 3W6PA 1GNPA 4B3DA 2JLYA 3D7MA 1VYTA 1TQ4A 1XTJA 2MSEB 2REOA 5D3MB 2P5SA 1AQUA 3P1JA 5JCZA 4L9SA 3BFXA 4KFTA 2RGBA 2DY1A 1VDZA 2VH5R 1NF3A 2WWGA 2ODBA 3BERA 4KSCA 5ANRB 3K0SA 1AS2A 5JI2E 2ZRAA 1IQPA 2BJVA 2QEQA 1D2NA 1L4UA 3CX7A 5BYJA 2C99A 4DSOA 4LV6A 2KB0A 1W0JD 5JSZB 1BYIA 2IW3A 2QE7D 3KZ1E 1S2MA 1X8KA 2MMGA 2RGDA 2RGXA 3F8TA 4P4TA 3CBQA 3RAPR 4U5XA 3U61B 1MKYA 3FYHA 1G3QA 1Z0DA 2YV5A 4PHHA 2QORA 4TLCA 2G88A 1E9AA 4E09A 3LW8A 3KB1A 2YZ2A 221PA 2XTNA 1OHHD 3MWYW 3SJBA 4HYYA 1KKLA 4Q01A 1S4QA 2AKYA 1W4RA 3FHOA 1R10A 3SN6A 3O47A 3AKCA 1N5LA 1UDXA 3GP8A 3ECCA 2F1JA 2D2EA 1YZKA 1YR6A 2BBSA 3OHMA 4KBFA 3WHKA 3JVUA 3KX2A 4D0GA 2QZ4A 5EP1A 4KFUA 4Y0AA 4RFVA 4L8GA 4BUJA 2IYYA 2X1VA 3SEAA 1JR6A 1ZNXA 5CM9C 1ZRHA 4HB3A 1VKJA 3L0IB 5FBLB 3EPHA 1N5IA 2WVJA 3SFZA 1M34E 2N42A 1RPZA 4KSBA 4GRAA 3EZ2A 4BGDA 5KHOC 2IEZA 3B1XA 4ARZB 5LBIA 4CW7A 1JAIA 1RRPA 2Q3MA 4Z1MD 3SR0A 4FMDF 1M1YE 4DDVA 2EW1A 1Z07A 4US1R 5AJXA 1CULC 4EPXA 5JHGB 4PC6A 2A5GA 3ZS9A 3NDBB 1G19A 1F2TA 1QBKC 4I1VA 4BWYA 5EZ5A 3EX7C 4TWZA 2QMOA 1ZM9A 4CEJA 2QRZA 1EFHA 2GVDC 4QGAA 2IEYA 4BFUA 5IHPA 4AWXA 5IF9A 1ODFA 1TADA 4DRZA 4PAMA 4QRHA 1E69A 5CJ2A 1AN0A 4TT3D 2A5YB 3BWDD 4V03A 1IAQA 5HCIA 1KSJA 4C0AC 1QG2A 1D9ZA 3I5XA 3W5JA 1DAMA 2J7PA 5EXXA 2CL0X 1SXJC 2P2LA 1KI1A 4LJ5A 4LC0A 2O8CA 1TPZA 2PCJA 1UFQA 1AA9A 3MD0A 1Q1EA 4C0SA 3I32A 3PIRA 3N2EA 2JATA 1S0UA 1UKEA 1ZM2A 1WA5A 3AGQA 5L3VA 2ZSBA 1MRNA 4M1WA 2ZRDA 1KI6A 4QGFA 4Z51A 1JPNA 3ASZA 3ZJYA 2WIAA 1OXSC 1K5GA 4MKGA 1HY3A 1MABA 2XB4A 4EUNA 2F6RA 1GKUB 2WZQA 5EE5B 4FWTA 4MQBA 3THXA 3DMNA 1KSHA 2Z6VA 3K09C 5KUTA 4IDQA 1WB9A 1DTSA 3DPUA 3A36A 2XNDA 3HPRA 4BRWA 2RGCA 3AF2A 3NH9A 4JLBA 3HJNA 2ZI6A 1G5PA 3OIWA 4DZZA 1HUQA 3VR5A 1TUEA 3TQFA 5HCNA 1SKQA 1F2UB 2QQ0A 4P3YA 5CIQA 1OYWA 1XXHB 2BCJQ 4FI3C 2A7QA 3IPXA 5G40A 1G3UA 3EZFA 3KXLA 3GJ8A 4HSEA 2FDCA 1J8YF 2NPIA 4UXIA 3J81k 5KDDA 4R98A 2G1KA 3SHFA 1CJMA 2Z4RA 1NI3A 1Z28A 4NYMR 3U3RA 1HV8A 1HQCA 4Q03A 2Y8EA 1FP6A 3R20A 1TUIA 1JB1A 5FI1B 3GLIB 4B75A 5DNYB 1E94E 1Q21A 2FFBA 2GCOB 3MSXA 1UPTA 5A0FA 2QAJA 4A92A 2R8RA 4GBMA 1KGDA 2ZE8A 2VEDA 2KI5A 5CLQA 1BH2A 3LO5A 4XTRA 4IFBA 4Q1DA 1MV5A 3CWZA 2JCSA 3M1IA 4LYJA 3QXJA 2Q6TA 4B71A 1CR4A 1TX4B 4Q7JB 1Z63A 1RJ9B 4ACAA 2O52A 4FMDB 3U3JA 2ZSEA 3H1TA 2H8KA 1P62B 5KPDA 1RRGA 3CX8A 2WOJA 3GLHA 2ZI9A 3I8XA 2OFWA 5KDOA 1J90A 1XMSA 1E0SA 1OIWA 2XJ9A 2O0HA 3QOFA 5CJPA 1X1SA 5L3QB 1OPXA 4US0R 2LCFA 4QGHA 4KO8A 1CR1A 1G6HA 1SXJD 4JZKA 2A9KA 4MUBA 3X1WA 4A8JC 4JBWA 1MRSA 4R71A 4MRVA 4Q9JA 1ZM7A 1JQJC 5FPSA 2ZE5A 4P33A 4GT1A 1G8GA 2YHSA 5J4HA 4OK5A 4IW3B 4PSVA 4GP7A 1ZIPA 1J70A 4LUCA 4TMTA 3CIOA 4MITA 3T12A 1IM2A 1KK0A 1UBFA 2YC2C 2ZEJA 3KKMA 4HDQB 4DKXA 3TK1A 1G3RA 2DWPA 3FDIA 5EE9A 1W5SA 3O8RA 1BYUA 3A58B 2XTZA 2ZR7A 4JLPA 2QY9A 1T5IA 2QGZA 1JR3A 4GOKA 2QM7A 4G3XA 4YMUA 1ZC3A 1G8FA 4HUQB 4BFXA 1KDTA 3LVRE 4LYHA 1IN8A 5GJVC 5TVKA 2WKRA 2OILA 1DAHA 1QHNA 3N2IA 4AIIA 4DLTA 2J87A 5BXQC 2ORVA 1P9RA 1II8A 2F9MA 5TMPA 2OCBA 3A1UA 1G64A 2D4HA 1W36B 2ZR0A 5E7JA 1WE2A 4JVMA 3EAQA 4NYIR 2BMDA 1KDRA 5DHAA 3BB1A 4II7A 5L3SA 4TL7A 1M7BA 3SE0A 1N6OA 1SVWA 2GRJA 1Z47A 2QENA 2AR7A 1OW3B 1EK0A 1SKYB 1XWIA 4LGMA 4A4DA 2FGKA 2WMOB 4M9QA 2ECKA 3UMRA 3MG9A 1XTKA 1KIMA 1LW7A 1SXJB 2GJKA 2JLVA 2QP3A 2B6HA 3Q7QA 1JALA 5EXSA 1RVDA 5AJYA 2F1HA 1TTTA 3TKLA 2Z83A 2UVQA 1XCMA 1G21E 1DE0A 3DL0A 421PA 2FN4A 2XNDD 3B6EA 3BAFA 4D81A 5KSZA 4LJ4A 3THYA 3V00A 4MKFA 1ZCBA 2PX0A 3TAUA 4AKHA 1AGPA 2BEJA 3NBYC 1LVGA 4BFSA 1RIFA 3C5HA 5JRJA 2ZM5A 1E9DA 4JKYA 1F2TB 5EXTA 3X1DA 1X86B 1Z2AA 4DB4A 2H17A 1E9RA 2ZYWX 1KHTA 5J5CA 1CEEA 2IYQA 2QPOA 1FQJA 3ZVRA 4W7SA 3GCGA 1F60A 1U8YA 1P6XA 4U02A 4RD2A 5EP3A 1XXHE 3SJAA 4EDHA 3NC0C 5AUPB 1GG2A 1E98A 3U7HB 1VG1A 3R8FA 1D6JA 2H16A 2ZIAA 1JBKA 3ZH9B 2AHOA 2O8CB 2GZDA 3IGFA 1W5TA 2WPDD 3KQHA 2CHVA 5TARA 1DADA 4KITB 4DLXA 5GJCA 1KK2A 4DIEA 4DDWA 3AM1A 3ZD6A 2IYZA 4WAUA 1XCPA 1YKSA 3QPUA 4OL0A 4TL8A 1KI6B 4GOJA 5F98A 1CJTC 4R2IA 1W49A 2J1LA 1MABB 3VTKA 4AG6A 1AJEA 4OJKA 1SHZA 1KYIA 2QTHA 4BFVA 4CDGA 1JAHA 3ADCA 4WW0A 3LH5A 3THXB 2KJQA 4BFTA 4D4LA 3DO6A 1ZNYA 3EZ7A 3TGPA 4AKIA 3M6AA 3TLXA 1AS0A 3P27A 4Q4JA 2CK3A 5H1YA 2EFCB 3TMKA 3GEEA 5TXGA 1ZUIA 3C16C 3U7FB 1XD2A 3I5YA 4M1TA 3DM9B 2B21A 5IRCD 4Q02A 3TAHA 2I1VB 4TN1A 3T34A 2GESA 3X1XA 2D74A 4LI0A 4LWZA 4DVGA 4HLDA 1T3LA 3R9XA 1KSGA 2F9LA 1CJKC 3T35A 2MSDB 2FNAA 4XJXA 2QSZA 1WP9A 4URWR 4UJ5A 1OH5A 2BHRA 3IEVA 2XGJA 1GVNB 1GZSA 4D0NA 3LVQE 5JS7A 1IJEA 1PUJA 2VSXA 1YJ5A 2RMKA 5FTJA 2XB2A 1FP7A 5DN6A 3RVBA 1BO6A 3E70C 4M1MA 4DLRA 3ZZ0A 4ZI2A 3AP3A 1VG9B 2VLIA 5HZKA 2EVWX 3P4YA 4EJSC 4V02A 3T1TA 5JJKA 4TQAA 4NYJQ 5DE3A 3WNCA 3GMTA 1QHIA 2BMFA 3B7GA 1R0YA 1E6CA 3A37A 3AEZA 4OI2A 4Q21A 4QHYA 3GLHB 1E2LA 2ZSAA 4ZKEA 3CM0A 4NHOA 3A1SA 1X1RA 2ZQ5A 3L0OA 3VR6A 5JLJA 3KFXA 5H70A 5M04A 4LHYA 1G4AE 3AF3A 1CF4A 4TZ0A 1IHUA 1T0HB 2AXPA 2P67A 3QKRA 3AF0A 1FOEB 4Q4AA 5C2JB 1DELA 3CZPA 1GL7A 1G9XA 1G3MA 4Z8XA 2GXUA 4LJAA 2RB4A 1SKYE 5K8TA 2W6JA 4PHTA 1Y63A 2OCYC 4XTCS 2IYTA 2YWFA 4A0GA 1FTNA 1SXJE 2IXFA 3CPHA 4JL5A 1E2QA 5J47A 1T8TA 1XJCA 4B6FA 3FOZA 3C7KA 4GDFA 2ZSFA 4DUGA 5GJWC 3HYRA 4DCNA 4JLVA 1VG0B 2C77A 3W6NA 1NN1A 3PG5A 2VHTA 4P4UA 2IUUA 5FL7D 3RNLA 5JFGA 1H8ED 1LF0A 3LX5A 1QHYA 4GZMA 2AD5A 2J59A 2NQ2C 1QZXA 1FUUA 2ORIA 3A8TA 4IRUB 4RZUA 2JJ1A 2OLJA 3AGPA 1XPRA 1NJFA 3GEIA 1FMJA 1II8B 4GMXA 3V4FA 4TLEA 4DC9A 5G3ZA 4NP6A 1GOTA 4PO1A 1ZU4A 4TLBA 5AUOB 5FR1A 3IQXA 1WBBA 4Q19A 4RY2A 3U3OA 3N70A 3VKHA 5AJZA 4B48A 4ZIRA 1OT3A 1UKZA 5KNCA 5L3SB 3A1TA 1FX0A 3NBZC 2FV8A 3FFAA 3UKDA 4TSFD 1TU3A 3NBXX 1E96A 4C0KA 5LDDC 5DI3A 1SZPA 1DO2A 2VHQA 1L4YA 4ASUD 4XWOA 5J4YA 3ZVNA 4TLAA 2LKCA 3LBNA 2FPMA 1GAJA 3PQCA 2R62A 3RSOA 3ZD7A 3THYB 4QBGB 2CK3D 1H8HD 2EQBA 4EPVA 3ZIAA 3AVUA 1G291 1R5NA 2VP5A 1NKSA 4NCJA 3RHFA 4QOSA 2FPLA 2GILA 4LCBA 5UKDA 1NY5A 2V4ZA 4JSYA 4IVRA 4JJZA 4MRSA 5FL3A 4QBIA 3PCRB 3KJEA 3W8NA 4TTPA 2ZUDA 3P4XA 3O8CA 1FZQA 1SULA 4DLWA 3WXMA 4IDOA 2ODWA 4CT4B 4MKHA 4CGZA 1UKYA 4KBGA 4DEYA 5DO9A 1J2JA 4AD8A 1NVVQ 4C2TA 1TU4A 2LWIA 4BECA 5FPKA 2FE4A 3L2OB 1KI7A 5BN4A 3BH0A 4G1UC 2XTMA 1JJ7A 1NMXA 1ZIOA 2ORWA 4KXFB 4NKRA 4A9AA 1QRAA 4B76A 4NCKA 1N6RA 4LX0A 5BQ5A 5B57C 5DN6D 1KO5A 2A78A 2QQEA 3T06B 1VHLA 3DEFA 2FJUA 4YMTA 3ZZTA 2AWOA 4DSTA 5A4JA 3I4LA 3ZQJA 3PJRA 1G20E 4NCIA 2P0EA 5FOUA 4XVRA 5FOVA 2ZR9A 3I61A 1COWA 4TYYA 2ZRKA 4KYUA 3PENA 1JXOA 1XD9A 1S8FA 1XX6A 3QI2A 2VF8A 3H86A 1A2KC 2C9OA 1SVLA 2BM0A 2IF2A 4MYTA 3UIEA 1AZTA 5FUYA 2IA5A 1B23P 2WWHA 3B1WA 1BS1A 2R2AA 2BC9A 3QVVA 4FCTA 1KK3A 1NLYA 3NEYA 2BMJA 2W83A 1NN0A 1OIVA 2AK3A 2ZYVX 2ZITA 3VAAA 2GJSA 4EJSB 2XSZD 4IOJA 3BH7A 3GLHE 4CF7A 2BDTA 1I4TD 1XEWY 1G18A 4D4KA 2E87A 1EGAA 2JJ2D 5LB2A 1KO1A 5HKKA 4URUR 3SI7A 3KJGA 3QXXA 1Q57A 4PC2A 3LV8A 4W5JA 1JEEA 4U00A 1K5DA 3EG5A 4IDHA 5E7IA 5HZHA 3R7WA 3U3MA 4B3BA 4ABYA 1KMHA 1QHXA 2ATVA 4Q66C 3A6PC 3CF2A 1E2EA 3HDTA 3OFNA 1IONA 4UNQA 5EE3A 1NBMA 4HAUA 1NIPA 3CW2A 1RYHA 2IT1A 2PL3A 3REFA 2UZ3A 4LK2A 3UG7A 3AQ4A 1L8QA 3MFYA 4ZI3A 4FWIB 5FUWA 1N2CE 3TBKA 2YVUA 2CCGA 3OEEA 4D2IA 3PUWA 4PSAA 5J4LA 1Z06A 1V5WA 1DAFA 4YC7A 1PJRA 5FR2A 2ZRGA 2C98A 2Z5FA 2XOKA 3EZ6A 5JEEA 2NOAA 4HZUA 3UMSA 5BYKA 4O3MA 4TMXA 3NWJA 3U44A 2VA8A 1JEDA 2H1LA 4DEXA 1AKYA 2FH5B 4B33A 2WSMA 2ZU0C 3L8ZA 2ZRLA 5JCPA 5JJLA 4DLUA 2WV9A 4QHSA 4RD1A 2IS6A 3QJYA 3CR8A 3D3QA 2QRNA 2DFNA 1KOFA 1NP6A 3AP2A 6Q21A 1O87A 2FSFA 2VF7A 3Q85A 5HR5A 2GZHA 1GKYA 2JGNA 3WP0A 4LBWA 3QKRB 2RHDA 4Q4AB 1OSNA 2AN9A 4AYTA 3B82A 3AV0B 5FUXA 3SQXA 4G5OA 1NNEA 4BZQA 4B6EA 1N6NA 5KSOA 1W2GA 4AURA 1EWQA 2IXGA 1KTVA 4FCVA 4HATA 1II0A 1DS6A 3I3SR 3OEHA 2ZETA 2H92A 3Q7PA 2DHRA 1YVDA 2F3TA 2VIIA 4TYPA 3SS8A 2BIFA 3OZXA 3B85A 4HAVA 4B43A 5L8VA 1SVIA 1U0HC 3BD9A 1W0KD 5BN3A 4Q9HA 2WIBA 1GM5A 3GJ5A 3AVXA 5DYIA 1U9IA 1XTQA 3TIFA 3R9WA 1XEWX 3KQKA 1ZM3A 2CNWA 5CDFA 1TL7C 4TL6A 2UZIR 1A5TA 1M8PA 3NHBA 4W9MC 3TNFA 2PT5A 1UKVY 4Q1AA 3LNCA 3GLFA 5JBQA 1FUKA 4UJ3A 1ZM4A 1UF9A 4ZIRB 2YKGA 2W2TA 3HPQA 1VYUA 4HLCA 4M4SA 5JJIA 1W36C 1E2JA 1E4YA 1COWD 1I2DA 3KUCA 2L0XA 1F5NA 4M2LA 4QHTA 2QBYA 3Q9LA 2QL6A 1S9HA 1OJLA 3BJIC 1NN5A 3TQCA 3QBTA 4RSGA 1ELOA 4KLZA 1D8TA 4ACBA 3UATA 1CJUC 1HH4A 5DIFA 3VHLB 1UEIA 1YU9A 1EFTA 4D82A 1Z0KA 3BRWD 4EPTA 2FSHA 2QP9X 2J3EA 3SHWA 4PC3A 4PXAA 2WSSA 1OFIA 3QKTA 1IBRA 2QTVB 1U9IC 1U2RA 3MWKA 2R6CA 2PLRA 1OXVA 3C8UA 4JMPA 4YMVA 2QMHA 1W46A 2F3RA 2X77A 2WWXA 3K0FA 4OI4A 1GFIA 3D8BA 4TMZA 3RC8A 1Z0FA 3O8BA 1Z0IA 2ZS9A 3GJ6A 1W7AA 1E2GA 4QC2A 4B44A 4GP6A 4MGYR 1I4LD 4XWKA 4XIGS 3KDSE 2HYIC 1IN4A 1E0JA 1NMYA 3TVTA 4CYMA 3X2SA 1NBMD 2GVZC 5IK2D 1MO5A 4JKIA 1J8MF 4YLGA 2IWRA 2FFAA 2G6BA 4OQMA 2N1BA 2OFOA 4IHQA 5CK4A 2ZRMA 1PV4A 1Z6TA 3KQNA 3QVUA 1E32A 3OEED 5K8UA 2GJAA 1JECA 4DIDA 2CL6X 1P5ZB 1HE1C 4L16A 2HXYA 4PPFA 3SBDA 2ZJOA 3T1VA 3V4RA 2GAAA 1E2FA 4RJLA 1E1QA 2NMVA 3C41J 1FFHA 3EWSA 3SYKA 4O2RA 4DHEA 3FMPB 2WOOA 3WNBA 3THWA 3BB3A 1BIFA 3EIHA 3FMOB 3DHWC 3IHWA 3AVVA 2IHBA 2QPTA 4JLDA 1U81A 1E2NA 3O8DA 4MA4A 4AYXA 1J7KA 2P5TB 4LC1A 3SNHA 4URVR 1FNNA 1GNRA 1CIPA 2FGJA 2UKDA 4URYR 2ZYTX 4E5UA 2OE2A 2O8BB 2GJ9A 3HR8A 4KFRA 1P3JA 3Q5EA 4HAZA 1RRCA 5SZHB 5C1BA 4WOPA 2SHKA 1PUIA 4PX9A 1W36D 4QFMA 1OH7A 4K8OA 3OE7A 4LOAA 5JI3E 3ZVLA 1KJZA 1SGWA 3IILA 2W6IA 1EX7A 1QHHA 2YYZA 4R2HA 3VNUA 3R7WB 1XZQA 1LV7A 1UBCA 1V43A 1KMHB 3K53A 4JBYA 4UKDA 2O0JA 3U2QA 3CUEF 3PV0A 3WP1B 1ANKA 3WYFA 1N6HA 1FTSA 1Z5ZA 2B92A 3IPYA 2O8FA 1R5OA 2V1XA 4HLUA 1EESA 2AFIE 3UXMA 1ETUA 4PAOA 4FMCF 4UNRA 4P32A 2C96A 1U98A 4JIMA 5TY0A 1T91A 4O2LA 3W90A 1OB2A 3CO5A 2XJ4A 1M7HA 4ZDWA 4NCNA 2EYUA 4YQFA 1OXXK 2JEOA 5FTLA 3WBJA 4PZYA 5B2ZA 1K6MA 4HZUB 3WMFA 1US8A 3ZLJA 2V1UA 3U44B 4YXWA 1R7RA 1KK1A 3AVPA 4CEIA 1GRNA 2NO0A 2DFLA 2ZJ5A 3D31A 3CKLA 3SYNA 3THOA 4ZCMA 4I1SA 4ON9A 3N5CA 2GXSA 4KCGA 1TQ6A 4Q4HA 1VMAA 2XXAA 5H68A 4NPHA 4OHWA 2NO6A 4TYQA 1HQYE 1OKKA 2OAQ1 3CNNA 3X1YA 1EWRA 1SVKA 3QY0A 3BK7A 2A2ZA 3Q3JB 5CK5A 1NSTA 2IYSA 1DO0A 1DAIA 3GJ0A 1AQYA 2V8OA 1YR7A 4O25A 3T5DA 5EE1A 3G0HA 4HLUC 2J7PD 1P9NA 1MR3F 4GOXA 4A6XA 3QG1A 2BWJA 1NVWQ 3JVVA 4MYCA 5AJVB 1Q3TA 4B47A 1HT2E 2GK7A 2GBLA 2VRWA 4B34A 4OHZA 1OH8A 4M9SA 4BEBA 4C0QC 2JLSA 3DKPA 3G82C 3RRYA 2EWWA 3U60B 1G8HA 4JT2A 2QI9C 2IWHA 2AFHE 2WAYA 4LJ8A 2V6IA 3BBPA 3ZGXA 1CU1A 3PUVA 4Q7LA 4A36A 3W5IA 4V0ME 1MO3A 4CIDA 3EC2A 3KJHA 1RC8A 2ZTSA 2CVFA 3QKUA 2ANCA 4LRWA 2CLSA 3QENA 3WMGA 5G3YA 4KODA 2KWIA 1TEXA 2FX3A 4KVAA 521PA 1RRFA 2YWHA 2GTPA 5E7MA 2PEZA 4A0RA 2XZPA 4CRWB 1S3SA 1T8UA 3RDPA 5FBVB 1UAAA 1XTIA 3WRYC 3KQUA 2GDJA 2J0QA 3DMDA 1E1QD 2PJZA 4V0KA 4C0HA 3K0CA 4OJQA 4DCVA 4US2R 1OFHA 2I1QA 4BZPA 4CEJB 1ZAKA 2GZAA 3KKQA 3GQBA 4A2QA 4RFSA 4YDHB 3I1FA 4B3FX 5B64A 3H4MA 2GBLC 3QKSA 4AKGA 1YZUA 1KDPA 2ZJBA 1P4SA 1Z3IX 2H7VA 1N6PA 4LBYA 5AJWA 1IN7A 5FOSA 3K0AA 1QDEA 5AR1A 2GF0A 2C8VA 4FMCB 1KI3A 3B8HA 4AKEA 3EA0A 2R65A 5FI0B 2OAP1 2NG1A 4EKDA 4H1UA 2RAPA 1W48A 5L3RA 2QAGA 3K70C 4B2PA 1DEKA 1KNQA 3CR7A 3IIKA 4IFEA 4AC9A 2AL7A 2C5LA 1NVXQ 3AKYA 2CHQA 2P3SA 2GCNA 1PLKA 3MMPA 3TUZC 3OE7D 3GLIE 4RD6A 4B2IA 2D2FA 2W6ID 3ADDA 3QIAA
chains in the Genus database with same CATH superfamily
2B4QA 1YKGA 5LYJB 1SRRA 1YI0A 3A04A 3SPXA 3FB1A 4NQRA 4FR0A 4ZT2A 4Y98A 3ROXA 1M83A 4BNYA 1GT6A 1FTWA 4I1RA 4CQNA 3CONA 4AZ0B 1ZI9A 4ZT4A 1F1BA 3QMPA 4LDRA 2C0PA 5EWJA 2I55A 4HH0A 5TJHA 3UN1A 3LY9A 4UEKA 4ZQFA 2A9PA 1B8UA 1E2IA 1F38A 1XNHA 2PZEA 2PA3A 2C00A 4HMOA 2H48A 5LA6B 4KQWA 2ZI4A 2H2AA 4C3ZA 1UJMA 3OQIB 2DBRA 2C8KA 4NJEB 3TX6A 4RE6A 1V7PC 3KJIA 4Y7DA 1YVRA 1W94A 1G17A 2ZU6A 3QXGA 4IXTA 2NW6A 4IIYA 2OUKA 1GRQA 2E55A 4FFRA 3L0ZA 3HCPA 1K7XB 4DSNA 2B2CA 2YOHA 4YNBA 3R5KA 3MNFA 4PQFA 4DCUA 1ZI6A 2HU7A 4MDHA 5JNTA 2Q5FA 1EFVA 1I8TA 1RJWA 1R0BA 3K72B 2V5AA 2GK6A 4OKSA 3LUDA 1FNCA 1QWOA 3CPEA 1GA4A 1H94A 1PI3A 4LYFA 4OAPA 4OXKA 1KY3A 2H2GA 3D2AA 1MOZA 1IL0A 4OLBA 3CZQA 1JR3D 2O0LA 4L15A 3A1WA 4BQEA 3BWVA 1L5FA 2IC5A 4H1VA 2WWTA 1L5WA 3FSGD 3GJXC 3IDSA 4UUAA 4YBZA 4EG5A 3WC4A 3SSMA 1VB5A 2AJDA 2JI4A 2XRMA 3IBYA 5FA8A 5JECA 4CEHA 3STWA 2QLMA 4NCAA 3DTNA 3DB1A 3HVUA 4TV8A 5IBPA 4EZBA 1TYEB 2EJVA 2GTIA 1N6KA 4HY3A 2OFXA 3PNQA 4QNMA 2FF5A 3E03A 5AP9A 3C3DA 4YR9A 1HTBA 1WMSA 3N1UA 5CT6A 3S1SA 3AM3A 1QORA 2REQB 2R6AA 4R2XA 2CC2A 1ZU5A 2VDVE 2W43A 1AF4A 1G59A 1TFRA 1YZLA 4PG8A 3NWPA 3RKSA 4D0LB 1P1JA 1JHOA 2GEFA 3BGOS 5AD1A 1EWYA 1NKTA 3T3EA 2VDMB 3VAYA 3WL6A 3N6VA 1RKBA 1JIUA 1T2CA 4JP5A 3ZWPA 4FR2A 4YX9A 2PRJA 5C18A 2XW6A 4JOSA 3C70A 1RI5A 1H22A 3BILA 4CR7A 3PEWA 3NHZA 2ACVA 3GCXA 5ALRA 3SDZA 2FG6C 3WS7A 3O4HA 4DDTA 2XVMA 3HZOA 4JJ8A 4QDJA 3UCXA 3RTAA 3RG2A 4QXAA 1U4SA 2R5FA 3I01M 2C9BA 3QWIA 5E3IA 4C43A 1N57A 4PFKA 3K70D 1UXKA 1II9A 3S2SA 4QBHA 3Q9SA 1D0IA 2OHHA 4ZP1A 2HXSA 4Q1BA 3AYZB 5EP4A 3PSHA 5AVJA 4AX4A 1Z4OA 1GZVA 1P39A 1G8YA 2IYEA 3AZOA 1K75A 1WX1A 4B9AA 2C8LA 4DJDC 1JFSA 4H4EA 2M32A 2VDJA 3DDOA 5BSGA 3ZLVA 2J0SA 3IIJA 3ZDAA 2HH9A 3IODA 1KP2A 1E4VA 1TZMA 4AG5A 1TCAA 4A6DA 2GF2A 3ESBA 3M4ZA 1JVSA 5HS4A 1EEHA 2BGJA 1KP9A 1UWCA 1EG7A 2HBRA 3HVIA 4JT8A 2X2OA 2XUFA 4RLSA 4TXMA 2OGWA 4NU0A 3ZEAA 4B6QA 5KQGA 1A5BB 4FKBA 4Y18A 1NXVA 3HN6A 5MHTA 1HOXA 4DLNA 3TUJC 4U6SA 3LHIA 4U3JA 5EIBD 3OZUA 3AZPA 2FA9A 4B4OA 1SXQA 3F5MA 4Q48A 2Y76A 2YHUA 2M6KA 5BW5A 2CMDA 4ZHQA 3ZVMA 4RS3A 4NZNA 4ENRA 1V71A 2QL9A 3M0EA 4KH0A 4OF4A 4YMLA 1V8ZA 1W93A 1H1LB 1QH8B 3K2BA 1Z8HA 2WUVA 3OM1A 2NADA 3DEZA 1N0VC 3LQQA 5EUQB 1C9JA 4CKCA 4F1WA 3GGCA 4YV7A 2J4FA 1R50A 4MR8B 1E3MA 2GPWA 1WPRA 1BXZA 1Z6GA 4J75A 4QBKA 5C7IO 1OOEA 4ZVNA 1G8KA 3W1EA 1LI4A 1SC1A 1WG8A 5HFAA 4UHBA 3AL2A 3P0JA 3TKYA 2GZ3A 4I6EA 2V8BA 4QQFA 1UCFA 5U9CA 2CLKB 1RQRA 3MTQA 4JGBA 4LDJA 4LNHA 1DG1G 3G2IA 2FKAA 3M9WA 4M88A 3M1LA 1AHPA 1EUZA 2L82A 3AH8A 5C1PA 2AUNA 5B5SA 2QGFA 4BUZA 4QNRA 2W48A 4GM1A 1WZIA 1XZCA 4CV0A 3K70B 4IMPA 2F90A 2Y6VA 2F43A 5L4NA 4JXKA 1SUSA 3FCXA 2VNAA 3BCUA 3OSUA 1Q91A 4X97A 1Y8ZA 4AJLA 4NE2A 3W2TA 4WERA 5I47A 1VIVA 4OOEA 1SKUA 2HWUA 3ABRB 5FOQA 2A1UA 3I04M 3QJGA 3X43A 2ZQZA 2QR5A 2G1AA 4FXPA 1UT8A 4JB3A 1ONSA 3L84A 4RACA 1EB9A 2BGTA 1RWPA 1K5HA 1MX9A 8OHMA 3GA5A 3NHPA 4RMGA 1ZK3A 3ZK7A 4BQNA 5I8ZA 1TLFA 2ANBA 2BSAA 3OZIA 4QUJA 1RLIA 4YJHA 4R8VA 3GLQA 1KDOA 3UVEA 2WYOA 2FEAA 1SBYA 1WUKS 2BRUA 3L6OO 4M9RA 1F9AA 1DUVG 1NBAA 3L4BA 3NTUA 3QKSB 4P31A 4XGRA 1KBZA 1JIIA 5KYVA 4LOLA 1NGSA 1NF2A 3TJZA 4OTZA 4OYLA 2HHJA 5DH9A 2PZFA 5E1MA 4DW8A 3DOOA 3GRYA 3D6TB 3DLPX 1IY2A 1T2VA 4N5IX 2XXJA 3D6FA 2ZTLA 2IYWA 1FTGA 3QP9A 1X1CA 4FOOA 4XW2A 2CVOA 1D5CA 4N8SA 3RIGA 2YZ7A 3CRQA 4FBGA 1QC5A 3WHLA 1G21A 4PX3A 1TMKA 4XSGA 2HK7A 5FULA 1LXCA 2O3UA 1H4SA 4B74A 4DR4B 1PSDA 3E35A 3B5EA 4LCJA 3MXOA 4FNAA 2YMLA 1M1NA 4W7HA 2QG4A 2IU0A 1M1YB 2OXTA 2HQBA 2WFZA 2XE6A 5KTPA 3LQ1A 5C8DA 1L2TA 2GZMA 5T8KC 1U5AA 3QX3A 1W8IA 3F6EX 3TCXB 4UARA 3OX1A 3IB3A 4UXHA 3MK31 3A1DA 5EVJA 1UBKS 1LF5A 4Z0PA 3NIGB 5AW5A 2XNJA 4D4JA 5EZYA 2OSBA 3ABOB 5DK4A 1L7AA 2V3WA 4Q7KA 1F2UA 3QLEA 5AM1A 1GQFA 1LPAB 1DIAA 1HMPA 2EJCA 4TUYF 1KJ9A 4PQYA 3OOYA 4M6WA 1RPJA 1XLWA 4JI2B 1Z18A 4Q4JB 2DCMA 5C34B 2PZJA 3BCRA 1Y3AA 3QW2A 1YC2A 1YHZA 3CEJA 4NL4H 1TZCA 5AVYA 1DQZA 5BURA 2Q4OA 3W4IA 3KZVA 2QBYA 4B4UA 1XD2B 2SKEA 4NY1A 3K0BA 2QG6A 4M53A 5H3CA 4B79A 1K8RA 4JBGA 1CUYA 4MUNA 1F48A 5EWMA 3IQDB 4M36A 2Q9CA 5K99A 2HSJA 4TMWA 1N9KA 3U3KA 1CNFA 1I1OA 2K2QB 1Z0AA 1CTQA 1QRTA 1E0KA 2Y9MB 3M4YA 1BVRA 4IFTA 3S2EA 4K0KB 1P91A 3GIDA 1ZHFA 3K8QA 1TU0A 4BCCA 4DYHA 1GGHA 5CDYA 3WBKA 5JDCA 1EZ1A 3DLTA 5HP4A 1JSLA 2RJNA 2REBA 4ESHA 3FZNA 4M8IA 1PFWA 4XWYA 3WK6A 1ILEA 3OE1A 4K6OA 1ZJYA 3WR5A 1C3VA 1C4OA 4QWMA 4YDRA 5T4EA 1E2KA 1PNVA 1F8XA 3E22B 4JOQA 4RLQA 4LE0A 5K0NA 1DCFA 3RRJA 3FB4A 1X2BA 4I9FA 4ND5A 1XZJA 1ZISA 3IAM1 3WK4A 1F4PA 3GDGA 3K94A 4JB8A 1IE3A 3OESA 1E7RA 4ZDIA 1ESMA 2XQIA 2LBPA 3OX2A 4QDXA 2RGGA 3UHFA 1OB5A 3HGQA 4HEJA 3GFSA 3FPEA 3H1GA 3M6UA 1O6BA 4DA0A 3A3YA 3T5PA 2FPGA 3P9RA 3VPSA 2NM0A 3CEPB 5FWYA 1USUA 3N3BC 1OAOC 2GLXA 1N0WA 1PAUA 2GN4A 5DLQC 3IPLA 3G8YA 3EMVA 4RZSA 3O7WA 4CTJA 2ZT7A 3O73A 1XAIA 2Q07A 2ZUEA 1JNYA 5CDHA 4HMQA 2GB4A 3AJAA 5IM5A 1PYDA 3EXHB 3ZQKA 2PH7A 3WYGA 4X8OA 3KKPA 1EFPB 3U5TA 1DIOB 1P5FA 3K4QA 4F7WA 2RJ3A 2VDRB 1L5MA 4CQJA 4YUAA 4NG4A 4BVJA 1Z83A 2QLBA 1IB0A 1TNDA 2H1VA 2WU0A 3CH7A 1K86A 3PFCA 4I1IA 4P0TA 2HF8A 3ZIAD 2ILVA 2CBGA 2H57A 3BQ9A 3FPAA 3HV2A 2XQJA 2DKFA 4ZVOA 5HVNA 1DUIA 1FDOA 3CUUA 2B9VA 4HI0E 1PEKE 5LD2B 2XLCA 4UTOA 3LAWA 3RV3A 4BKMA 4Q3OA 5EPUA 5F1OA 5H8WA 1WABA 3ZY5A 2YXNA 3JR3A 1E1RA 1LSUA 1GPMA 3F67A 3FFTA 1KEZA 1Q1ZA 1XLUA 2HJGA 5TF4A 3FIJA 4WHMA 4L6CA 4W9RA 3TR5A 4L78A 1LLCA 1NUSA 2I3DA 4MQLA 5FQOA 1DCMA 3RRNA 3LGAA 2EEPA 2X0RA 2ZJYA 3DPIA 1UOQA 3G0DA 3L7BA 1BRTA 1KRHA 4HB0A 4RSMA 4EUKA 3UG6A 2YJZA 4S05A 3IE0A 4IJ6A 4QDZA 2IU3A 3JQ8B 1W1WA 1P0QA 2YIDA 3CLSC 3FJOA 3NW9A 1U3GA 2YV3A 2CFCA 3CX6A 2QROA 5JG7A 2A5LA 4M0LA 2LW7A 4TUYB 5BMVA 4HWKA 3EIQA 4LHWA 1P7CA 3MJSA 1PBNA 4PYNA 2VLBA 3BHIA 4ND8A 1SB8A 4FB5A 4RK0A 1LX6A 1RE0A 2VJMA 2NXEA 3WLRA 2YXBA 2JLCA 4HH3C 3QPDA 1E6WA 1WXQA 2DWQA 4KLNA 3W8RA 2ZTVA 2XYRA 1KQFA 2AE2A 2O5EA 1T10A 4IUCS 2QUJA 1E3TA 5IN4A 5CCDA 2I65A 5T64A 4DMUB 3QSYA 5TR9A 2II6A 3EDMA 3GJ7A 2R85A 3GZTB 4YT5A 4DQDA 3EA5A 5JMWA 2ZTUA 3A4MA 5TRTA 1MOQA 3AU8A 3ROGA 5CFZA 3U4AA 1E9EA 3OY2A 3AB3A 3ZX5A 1I7LA 2Q29A 3H1BA 3QK7A 3G1UA 4UBMA 3O38A 1UJ4A 2XCUA 4RTQA 2Z4SA 1Q7GA 1UDCA 3JQRA 3CF6R 4FHZA 4PQEA 4D80A 1PWXA 4IEFB 3H99A 4KMRA 2OKGA 4DT1A 4CNBA 2D3TA 2PL5A 1WCWA 4NONA 4UNNA 3VSAA 1B8NA 4R0MA 1N75A 5IDVA 1N4DA 4KPEC 5HKKD 4ROSA 1I4DD 1PZNA 2CB0A 2QLNA 3WMXA 1XMIA 1Y3HA 1Y42X 3ZBQA 4A2WA 3FHTA 1SZDA 2OHOA 3S6JA 5EXPA 1L6RA 3HP1A 2V6MA 3M5WA 4BV9A 3C4JA 4DJAA 1UOPA 5F5XA 1IOZA 1SK8A 4XWGA 5D6OA 4A82A 3BXGA 1UPAA 4EFLA 1S9DA 1I94B 4RQUA 4DB2A 5GVSA 1Q83A 5EJ2A 2ZUUA 1L4HA 2BSXA 4RHYA 3PWZA 1JL3A 2RCNA 1T8PA 1OI4A 4BKOA 4TQGA 2GLTA 2GBPA 3FPGA 1CIVA 3FHLA 3KL2A 2FPPB 2I71A 1V48A 1CQZA 2PRYA 1U8AA 2YJ3A 1UK7A 2B1IA 1SBNE 5D85A 1JLLB 1OIXA 5KTRA 3RU2A 2YY5A 3IMEA 4Q9DA 3G9ZA 3C74A 1K1EA 4KPUB 5KC9A 3PZRA 5HE9A 2EL7A 3JYOA 2GYUA 2XMRA 3RQSA 1AIPA 1T9GR 3ELYA 3LT5A 3QYPA 1VKOA 4S35A 5ICMA 4QICA 1C7QA 4M86A 3B1YA 2VP2A 4TYWA 1T0JB 2JFOA 3U39A 2Z8YM 1SU8A 4PHGA 4BRZA 3TZHA 1CLEA 5JH7A 4MYDA 5ELLA 3KQVA 1MVNA 1TD1A 4IV5A 3WQRA 3CG0A 3NWOA 3N9IA 1DC7A 3NHJA 1Y5LA 4N3NA 3CLSD 1VKRA 1UXHA 4P1ZA 2V7GA 5HJ7A 1VLVA 4AO7A 1BU8A 1R64A 4LHZA 3VU0A 3G2LA 2D62A 2W6OA 2CWDA 5BSTA 4QREA 5B1YA 3KR9A 1FFEA 2D1TA 2CE2X 4N47A 4D4MA 2IK8A 4A16A 4ZV4A 1IXZA 5TPWA 4PPGA 4FYWA 1U3WA 4MUKA 3GFFA 2FEMA 1B15A 1M2OB 3A4VA 3QHQA 1MJNA 1XTBA 3IUJA 3AI7A 3N2NA 4KUGA 2QRJA 5T5QA 1C9EA 5HG0A 5CD1A 1I1NA 2F3PA 5P8WA 1A71A 4RK1A 5AHXA 3PVCA 1NLMA 1VECA 4BNGA 4CN9A 4DJTA 2GR9A 3BEOA 4FHCA 2G8NA 1XPOA 3ADKA 5EJAA 5DTQA 2NTVA 1BQ3A 3BPSA 1BMFA 2C1EA 2ZRBA 3SQOA 4ZZ0A 1EQUA 1U7HA 4FX2A 1H9CA 1Z6ZA 2I22A 3GF4A 3OCXA 4YRDA 1A9SA 2WHPA 4MIEA 4G56A 4RZ2A 5ITVA 1NG9A 1R4AA 2PQ2A 2CNKA 1VFNA 3VGJA 4V0OA 5J40A 3BBLA 1KQPA 3LLSA 3FVQA 1APBA 1R6UA 2P9ZA 1XFAA 1B23P 1CUAA 4OHPA 4HUTA 4MDEA 3IHKA 2J0UA 5CT4A 3BMOA 1SOMA 5IHXA 1CEYA 4WVLA 3TLKA 4MR9B 3KLBA 3D4IA 4GMDA 3FZYA 4Q6BA 3WL8A 1BH6A 4QPZA 1CZRA 3LUGA 3UGKA 3LRPA 3HUUA 2JFFA 2JDID 2W58A 4KR0A 2PKCA 1O57A 1NURA 2QX8A 5DLDA 3TR6A 3ZE2B 4PWZA 1A4UA 3MMXA 5AI9A 2O8EB 5FI5A 2ZI7A 4Y9TA 5CB4B 1T5BA 1GRCA 1T6XA 1HSZA 3A1VA 4XH9B 3KP1A 4CLHA 2YFHA 2ZS7A 3KJFA 5CFNA 5HF6A 5EHXA 1LJ8A 4WN9A 2JH8A 5ES3A 5JC1A 3KETA 3DAHA 2K7ZA 4FN4A 4ZI5A 2XIJA 1PBTA 3CRW1 3S68A 4U63A 3F9IA 4CWAA 2E4WA 3K16A 1XQ9A 2WHRA 4HBGA 3QTBA 2XZTA 1ZVVA 4L6IA 2G7MC 3VSEA 4KL8S 2GGSA 3FYDA 1ZGHA 3HMQA 1FPQA 3ZHYA 2O6HA 5D51S 3F6YA 3IIMA 5CITA 5KHLB 3U0VA 1QHSA 2Z3ZA 2ZP1A 3I9FA 4JEHA 4UM9D 3OLWA 2HTEA 4QTTB 4E5MA 5JO9A 3T3DA 1ZHOA 2EGUA 4GMKA 1TM4E 1UJNA 1J5EB 2Q3LA 1JSCA 1LLFA 1IUKA 3LSYA 2VSFA 3NX4A 1WULS 1ZW6A 5CW1A 4YP9A 4CQLB 4KRFA 3IEXA 1LLUA 3ZTWA 3RJZA 2BGUA 3FAZA 4NCXA 2EFEB 1G66A 1DOZA 2QN1A 4PYLA 3ZIUA 4CXMA 3ZWQA 2PVPA 3RJTA 1DXOA 4D43A 2HREA 4KO4S 3F6RA 4FIDA 1A4IA 4J0DA 3T4PA 4YCMA 2HGZA 3VHXB 2O23A 5IMBA 3VR6H 3CRZA 5E2IA 2IXEA 3Q5DA 5DWQA 1RZUA 1XEXA 3BFKA 1E5DA 1RFLA 4EFKA 2H2FA 1L7PA 2RHRA 4KQMA 4MV3A 1U5CA 1W1IA 3E5NA 4PZUA 3ZNQA 4E2WA 1VBFA 4RZ3A 1HC7A 1CEQA 2A57A 5LDHA 4ARCA 3HU2A 4XD7D 4EKIA 1KZ7B 1C1DB 2YN4A 4W1PA 2QN6A 1P5JA 4M1SA 4UBOA 2EP5A 5HZGA 2C2ZA 1SVMA 1D09A 1D2EA 4FOPA 3U0BA 3MVEA 2V4UA 2QYOA 2P35A 2C04A 3LA6A 4M9UA 1L5NA 2BLNA 4FM9A 3U81A 5KC8A 3MWJA 2OTCA 3LOUA 4M3NA 4YRAA 1OI7A 5FPPA 3SR3A 4K40A 2PUAA 2UAGA 1ZD8A 2V59A 3OJ0A 3U09A 3WNVA 3EVDA 2YZGA 1HURA 2PEYA 2XMBA 1H3FA 2RI0A 4QO7A 2C3UA 3BMNB 3CNLA 4JLJA 4BMZA 4B83A 4LJLA 5JRZA 4RY0A 2EBWA 4GYYA 4QODA 4R3UC 2QBYB 2R5WA 4OUDB 2BKLA 1D2RA 5EKDA 5LL6P 3GEHA 4N0EA 4YMSA 4JI1B 1YMUA 4ID9A 3U4DA 3A7DA 3GAFA 4UBIA 2FSIA 4Y2SA 3ESAA 4ZAZA 5EJ6A 5GZ1A 1FDRA 3GMDA 2G9NA 3BC1A 4GPTA 3FJYA 2NVWA 3GVXA 2AOUB 2ISCA 4MW6A 4UM9B 4U9HS 4EYGA 3VU9A 5K6AA 4I5EA 2W2LA 2ZRPA 3LTEA 5JALA 4WX2B 4C7JA 3D3NA 5BUZA 2HWXA 2X76A 4BKPA 3VPHA 5HPYB 5G41A 4HL6A 1BEZA 4L57A 3QF7A 4JBIA 4FJ0A 4A0FA 1OC4A 5KSPA 1XP8A 4P8RA 4HQKA 2IUSA 3MOGA 2FZGA 2IOQA 4GUAA 4K9NA 4S1TA 1H8EA 4AJOA 1Y6QA 2IYAA 5FRDA 1ARZA 2LTAA 3K0FB 3ZGVA 5B6IA 5JROA 3S8EA 4MPJA 3S1AA 4EQ6A 4RADA 3R44A 2JLZA 1JW9B 4BY9E 3W5HA 1E79D 4HYQA 1RZRA 1JAYA 4JBLA 4BO0A 4PCAA 1B1AA 3JTEA 2QR2A 4Q5IA 2WM9B 1YR1A 4PZZA 3A25A 3BGWA 1UQUA 1IPEA 3IEIA 1QF7A 3PR2B 5GJBA 3LX4A 3LUJA 2JGKA 2VC2B 1O6FA 1BQ4A 2JCVA 4Q9LA 1BWPA 1GNSA 1X3LA 2IZ6A 5CCEA 3RSLA 1DGQA 3DE7X 1U0RA 2GX6A 1XN4A 1P4AA 1SXIA 3LCCA 4BZZA 2D0OB 4CM5A 1XT6A 4JJ7A 1KDZA 2P7IA 1N32B 3LFHA 1T8RA 2BJWA 3YASA 3K9HA 5A04A 1SHLA 4F3NA 3IHLA 3GDOA 1MT3A 3IDQA 4M7PA 4P3XA 5KINB 1RCFA 4XX1A 5LWQA 1H6DA 3VPCA 3FKSD 3VH1A 2H2HA 5IC6A 5ALGA 1FVFA 5A5EA 1HLGA 3H9BA 2QQ5A 1QJ4A 4KYTA 1E2DA 1BOFA 1T1JA 1SHTX 2R1ZA 3DEKA 4UTXA 1T8WA 3SQLA 4V0LA 4O4IF 4GNKA 4W5OA 2PUBA 1TYAE 4WNIA 3DHVA 3GPLA 1YTUA 1XTRA 1Q1BA 1CXZA 3CS3A 2GDZA 3DFUA 4I1UA 4I5FA 1HDRA 3B8EA 1MVOA 4H2DA 5HILA 4LRTB 3ZJTA 2BF7A 5DGDA 3OZCA 4KGXA 5EIAA 4EHDA 4G1CA 4Y1FA 2FMIA 1XEFA 3OKCA 4V0RA 4I19A 1OYYA 4YJGB 4UTVA 4NFSA 3JQAA 4OI1A 4JEIA 5BRJA 3GGPA 4P38A 5FWXB 5KQPA 3OPYI 3FUVA 3VNQA 1GUFA 1N5KA 4A8JB 4KDCA 2HIAA 3LCRA 4R1SA 3UYLA 3WADA 3I9V1 5BN1A 4Q1CA 5BNIA 3HXTA 3SQMA 2JBAA 2FSGA 3TNYA 1TJNA 2MR6A 5CIYA 2RE8A 5AKGA 5K0CA 1FSFA 5LQJA 4HYTA 3WK7A 2PZGA 4OFBA 4CKWB 1ECCA 2AW3A 4EYOA 4TQ9A 5EJEA 4OKNA 1RACA 5DULA 3PGXA 2XA1A 3AO0B 2DULA 3H0EA 3GAMA 4X1YA 1R8SA 4K1XA 4NWIA 4RM2A 1G16A 1BGVA 2RBEA 2IYOA 2YWEA 4Z0TA 3T5MA 5IABA 2W2QA 1XRSB 4OAQA 4BVAA 3F78A 2RHWA 1DX4A 3VQTA 2HA0A 4GLJA 3AY0A 1EUDA 4JP1A 4DCOA 2Q4TA 1Z6AA 4W8HA 2OL4A 3NM5A 4TLDA 3CHYA 4HN4B 5A3JA 3QRWA 5K5EA 1KI8A 3H0CA 2QMZA 1MAUA 5JSZA 5J23A 1O4WA 2WJ6A 1M3SA 3DNFA 4OHXA 4P35A 2CHEA 4YECA 2X2FA 3VZCA 4D26A 5K8VA 3I58A 4DJJA 4EW3A 1AO0A 4MYUA 1VE6A 3QUTA 5JV5A 1LI5A 2BGRA 1JYFA 2EYQA 3DB2A 3DV0B 3TD2A 2P90A 3RSQA 4YRMA 1TAGA 2ZI3A 3FROA 3OIYA 2XSZA 3IAS1 2ZCVA 1LFDB 3AUTA 2ZSDA 1FMFA 1SIWA 3MWEA 1QZZA 3LDAA 4M1ZA 5HFNA 4HWRA 2CXQA 3D5QA 1R66A 5FTKA 4EY4A 4MRAA 2AK2A 2O07A 3X1ZA 1JILA 2L17A 3GVPA 1ZIYA 1S3GA 2X5XA 3I0ZA 4S2EA 1ESNA 2AN4A 1KI9A 1LB1B 2Q1SA 1I80A 5FFMA 1VDMA 5A5DA 2RHBA 4EY6A 1XRJA 3BWXA 1QWSA 3ZNPA 5JW6A 3WGVA 5KYXB 3IE1A 4Q1VA 4RABA 1U2EA 3IUNA 4F6LA 4U7GA 1PLJA 3GLGE 4QVKA 1KYYA 4TZKA 1Y37A 2CJFA 1EFUA 1ZNWA 2VATA 4NZMA 4DKJA 2XUAA 5KDLA 1G4UR 1AH2A 1ZX1A 3BIJA 1AUQA 4BPRA 4R69A 3PC2A 2BD0A 4N5NA 3LP5A 3SEQA 3HKDB 1YOBA 4FK8A 3H4TA 1J0EA 4HRVA 3U40A 2OV2A 4D96A 4LJKA 5TNXA 3GP5A 2LXNA 2IZ0A 3MPUA 4ZCLA 3TO5A 4D9JA 5LOVA 4LXTA 1KAOA 2HU8A 5FDFA 1W2HA 2I67A 2YIMA 4ODIA 5ENVA 4F9GA 4O4IB 1V8DA 2W2NA 3TVDA 1IJBA 4MZDA 3WDMA 1VRVA 1OTHA 3PP8A 1N2BA 1SU6A 3LPMA 1YS4A 3OP1A 4MUGA 4E11A 5K45A 4YCSA 2YUIA 3D6VA 4LY0A 3SIXA 3VX3A 2GA8A 3QU5A 4N3CA 5K2OA 1VFPA 3PUXA 3DQPA 3AVOA 3EIEA 4JVLA 1RRKA 2BTQA 5KU1A 1KMQA 2QE7A 1CFJA 4TRNA 3SXUA 4EO4A 3G5LA 3GPBA 2ZJ8A 2KE5A 1RE1A 3HEAA 1XAJA 3N6XA 3P2MA 2JFUA 4FFDA 2A5DA 2N75A 2W98A 3IMKA 2E82A 4L2IA 4W7IA 5KO2A 1KJIA 2IP2A 2JH3A 2W6MA 1KZ6A 4YUZA 4EO9A 1BW9B 2UZAA 3N8NA 2FR8C 4G01B 5E3HA 4DNFA 4CQMB 2AQIA 3KR0A 5HOEA 4EJ2A 4XGKA 3GQBB 5CNIA 2AC2A 4L74A 4PANA 4DUYB 1VZ3A 3D6JA 4MGEA 1JWLA 2JI8A 4MW0A 2P41A 4TV9F 2ZDHA 3PXUA 1VBKA 1X7WA 2OESA 2FSUA 4ZAVA 4E2ZA 3F5FA 4FD3A 1RLJA 4GM0A 3ER8A 2OEPA 2CKDA 2PBRA 4HF7A 3O0TA 1C0IA 1QV7A 1VKNA 1Z0ZA 1SOVA 2ODNA 2Z30A 4HPWA 1BRMA 1M34B 1NG1A 1CG6A 3LLCA 4H3SA 4H0CA 1S96A 4MCJA 5EERA 4ZVRA 3W7VA 3GLRA 4BZWA 1G7CA 3W1VA 4BFWA 5HKAA 5DNUA 3CISA 1IOLA 2NTJA 2VL7A 3RRZA 4I9NA 3RLFA 1Q6ZA 4QJ3A 2H1OA 3R0JA 3WB9A 4MWTA 3M3HA 3OPYA 3LQRA 3KELA 4Y6PA 4YALA 4DDKA 1CP3A 3RYTC 1AS3A 4L0MA 1NJ8A 2DR0A 3DZFA 4WCDA 1DEHA 4KLRA 3R7AA 2YYSA 5LYYA 1T9HA 4I50F 3FYSA 4L0CA 2PKQO 4JNKA 4FSHA 2DF8A 1U8FO 3K35A 1A7JA 4ONEA 3O4RA 4BNNA 1GCGA 2OV6A 4YUVA 3RARA 5ICCA 4M21A 3HWSA 5CXQA 2ZCJA 5CH5A 3NTLA 2FSVA 2DH6A 3RHZA 5JHHB 4NJMB 3GL9A 2JCXA 4RVFA 5FPYA 6ADHA 4G0XA 3K6KA 4PIVA 3D9QX 3CLUC 1WO8A 2XR1A 4AZVA 2A8YA 3L0SA 4YDSA 3D3WB 3F3YA 3SYLA 1EDEA 3L8YA 2JEZA 5A1TA 4ZYVA 2OFFA 2WILA 4YMWA 5H7XA 1SC9A 3DWIA 4YCJA 2OZEA 2PVCA 3FH0A 1OJ7A 1P0PA 1UMBA 2J5BA 4PZLA 3NG1A 4LGCA 2ZRQA 1D04A 4NEQA 4NV1A 4CI0B 2IBMA 2RONA 3NBFA 4MICA 1P44A 5JFOA 3U56A 2HMUA 1G42A 1G1MA 4TS4A 1KXJA 3KKOA 1QIMA 1VKHA 4UAUA 3MB8A 4HB4A 4FCWA 4IWXA 4YROA 4EFMA 3NC1C 3DO8A 4BAGA 2VWPA 3EF3A 4MYHA 2N46A 5A9RA 2PLFA 4NENA 2QGNA 1TAUA 5E6UA 3M2TA 4Z9XA 4BNVA 2GWHA 5CRIA 4G8BA 3LFUA 1FMLA 4OMDA 3EPRA 4AVYA 1J24A 2PTHA 4X6YA 3T61A 1J2RA 3Q1LA 2ZROA 2O8BA 4ND7A 2DHEA 2QX9A 5DP1A 3TG8A 3SZOA 1WTAA 1DVRA 1T6ZA 2NUPA 1Y4UA 2W4IA 4M1YA 1IBKB 1OD6A 1VLHA 4JYMA 1P33A 4R2KA 1D7AA 1XXLA 1FLVA 2P4EA 2XNKA 3NGMA 5ESRA 4JDPA 1USIA 4RVCA 1F20A 3MGCA 4GNRA 1E9VA 1GCAA 2AJ8A 1RJ9A 2Q0HA 2MTBA 4BJ6A 5IJ0A 4BPBA 4R2WA 2R8BA 2ZBEA 2YJTD 4AF8A 4HX5A 2DZDA 2XZOA 1J0DA 1GRRA 2UZ1B 1DWQA 2ZUBA 1H66A 5G0TA 1YJXA 4ZEWA 4HEHA 4BB9A 1T5LA 3QEOA 3C24A 3MT7A 5JC8A 2NYVA 3PXCX 4H31A 1XTVA 2OCXA 3MPOA 5B1IA 2FJPA 2WJVA 5CT8A 3C3CA 1SXHA 4LRUA 4N8EA 3U7EB 4D8WA 1JIXA 2JLYA 3D7MA 4XGNA 3C1AA 1TQ4A 4UUPA 1T1IA 1PS8A 3DSRA 5D3MB 1IY9A 1AQUA 3VPBA 3VYRB 2BF4A 3E0XA 1WXHA 2Q5QA 5GMOA 2GO1A 1O0BA 2QE6A 3UHOA 4Z7NB 2ODBA 3H2IA 3LHDA 4BOYA 2YICA 4S1PA 3Q88A 4J9VA 3IQGX 3UJ8A 1AS2A 1GLVA 4FS8A 1GSOA 2ZRAA 4U2EA 1W581 1ZS9A 2QEQA 5BYJA 5HWSA 3WTBA 1Z6PA 3MQFA 4CKBA 3BMCB 1OB2A 1TZKA 2DOKA 1W0JD 3ZI7A 1WMAA 3B70A 1PU2A 3KZ1E 1FTQA 3DJYA 4IL5A 3ZWDA 4ZJUA 1SCUA 2M6SA 5ERGB 5EKTA 1R0KA 3IBSA 1E4OA 4R8SA 1Z0DA 2YV5A 4TLCA 5DV9A 4E09A 4MJ3A 2CDAA 3VR2D 4V3BA 4QA9A 2CYAA 2XTNA 5ITWA 3PQ7A 1OHHD 3MWYW 1NRXA 5ED4A 3CLUD 4MZXA 1G4HA 1P1IA 1E3DA 3K9QO 4I50B 4M8KA 1UK9A 2G0AA 2FWNA 4ZT7A 1G8AA 2G82A 2Y66A 2I8CA 4WMLA 1YNOA 3SN6A 3AKCA 4UEWA 2VNJA 3EXEA 1UDXA 3MWDA 3ILVA 3S4YA 1UMDB 3VYTB 2FRXA 2PUTA 4IR7A 4OU5A 4AZTA 5IJAA 2C54A 2BBSA 1C3EA 1DIHA 4RSHA 1B6SA 3FYUB 3THRA 1ISMA 1RI4A 4FSDA 2QZ4A 3D8SA 1NUPA 5HMLA 4LZLA 4GZ3A 3B6JA 4L8GA 4RFVA 4X60A 5EMLA 5TPZA 3FTPA 4DDMA 2HD4A 3LBFA 5LP1A 1SK9A 1QH0A 3FCAA 1ZRHA 2EHDA 1N5MA 4GXTA 4BO3A 3EPHA 2MYUA 3C45A 4YUXA 4A5SA 2VKQA 1N5IA 2WVJA 4YN3A 2D0IA 1L5SA 1HQKA 2DPYA 4GRAA 4KSBA 4QOFA 2VT3A 2WAOA 3ILSA 3QWAA 3HLKA 5MGBA 3M81A 1QGUA 2ATIA 3HYLA 1VSBA 4WGFA 1AU9A 1YB4A 3RIMA 4CCAA 2I87A 2CJYA 4Z1MD 3SR0A 3ZDEA 4WY8A 1M1YE 2JI6A 4A10A 2EW1A 3A14A 3PGKA 2AGVA 4K9SA 5G0SA 1V9LA 4DMFA 1CULC 2JFHA 4YCLA 4ZTZB 3LDHA 4IJQA 1G19A 1QH1A 1XYGA 2YRXA 5EZ5A 3EX7C 4F1KA 3HKBB 1XZHA 4TWZA 3SC4A 3ED5A 1X39A 3VNSA 2ECQA 3ICVA 1ZM9A 3C5VA 1W59A 2HMSA 4JD5A 3WDSA 4QGAA 2H52A 4BFUA 2NSDA 4IJ5A 5IF9A 4PAMA 4QRHA 2IDJA 3I12A 2NXWA 1V2HE 4DR7B 1AN0A 4TT3D 2A5YB 4DMLA 5LFAA 3ENKA 4CLEA 3G7NA 4N6GA 1ISSA 3W5JA 3WLFA 5EXXA 4Q93A 4KGDA 1NVGA 1ZJ4A 2CL0X 5TT0A 5JNSA 2B61A 2Z9CA 3IOCA 3E9RA 2RG1A 4LC0A 4OUKX 5BNFA 5IC4A 3F8WA 3E7PA 2PDAA 4G09A 1HLPA 1XAGA 2NSJA 3E9YA 4PX5A 3NXKA 3S1LA 1PG0A 2QRKA 1I4OA 1S0UA 4LMPA 4TKVB 1WETA 1J39A 1UKEA 2BHLA 5HM6A 1WA5A 1Q19A 4FE4A 3L8MA 4EHBA 1J2TA 1MRNA 2M6RA 3HB1A 4DBLE 4FILA 3DBIA 1JPNA 3NAMA 5E1OA 2WIAA 3VBCA 1M2VA 3N3AC 3TJMA 1K5GA 4DMGA 4XM2A 4B46A 1CB0A 3BICA 4D8XA 4KWHA 4WI1A 2ISSD 3LF2A 5AW1A 3QW4B 5I3CA 4P4NA 3DWEX 1GKUB 5EE5B 4FWTA 3I23A 2JFZA 3DMNA 1KSHA 1RI1A 3PF8A 4XDHA 2V65A 1RRVA 3JWHA 4F11A 5KUTA 1HNZB 3WGMA 2HPAA 1GHTA 3DPUA 3BK1A 5A0TA 1M54A 2RGCA 3AF2A 2Q7DA 3NH9A 4ZOCA 2FWJA 4XDYA 1QGOA 5LA6A 4DZZA 4UDXX 3DFFA 4C6RA 4NJEA 4P3YA 2JAHA 3LUHA 5C35A 5IKPA 1U3TA 1XXHB 2BCJQ 1WDMA 5JATA 4PRZA 4XSVA 4FI3C 1LWOA 1W4LA 4RZIA 2RB5A 3WKCA 3LM8A 2R87A 4P84A 5J43A 3EZNA 4GGPA 1OBCA 2VYVD 2NPIA 1DINA 3JZIA 5B55A 4V1CB 1WNFA 4R98A 1W6RA 4N41A 2V7EA 3HV0A 2BR5A 5A71A 4BC0A 1G38A 4YI5A 1NMEA 2PM8A 3KK0A 4NYMR 1BE8A 1HV8A 2Y8EA 1XYVA 1I5RA 2W2MA 3MW8A 4LGYA 5FNVF 3T4UA 3LFTA 3ZKAA 1ZAYA 3KJNA 3GLIB 2A0FA 4I5DA 1HT0A 3HUFA 3KLOA 3OJCA 2BFWA 3PC8A 1JHMA 1UPTA 5JYDA 2B94A 2QAJA 3WTCA