3CKLA

Crystal structure of human cytosolic sulfotransferase sult1b1 in complex with pap and resveratrol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
289
Chain Sequence
DILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLGRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase family cytosolic 1B member 1
publication title Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 289
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cklA00
5GVRA 2QMUA 4D82A 2FSFA 4FMDB 3DM5A 3FOZA 1G5TA 2JA1A 4BLSA 1OXTA 3IIKA 3SJZA 4BFUA 5BN5A 4JKYA 4NCIA 4BECA 1HE1C 2OCBA 3N70A 1E79D 3NDPA 5FTLA 1E9DA 4OKSA 5G3YA 4OI0A 2ZRLA 1Z0KA 3OZXA 4GMXA 4PHTA 1NN0A 4GP7A 4IVPA 5EUMA 2JJ2D 1DG3A 3NEYA 2IYTA 2QMHA 2AKYA 2ZYUX 1HH4A 2SHKA 3SQWA 4BQSA 3SI7A 2PX3A 1YZNA 2OO7A 2ZE8A 3MRSA 4IOLA 4Q7MB 3U7EB 1RRCA 2C95A 2GBLA 3WYFA 1Q20A 2OBMA 3QF4B 3TSWA 4W9MC 2WBLC 4CDGA 1MO6A 2GRJA 4LJ9A 3GPLA 2HXSA 4C0KA 2YWEA 4ZIRA 3QKSA 2XXAA 3K0EA 2ZR9A 5FUXA 3I72A 4MYUA 3G0HA 1OYWA 2O8EB 2QNRA 1N6LA 4QJ4A 1HUQA 1MO4A 1PZNA 1J8YF 2FN4A 1Z6TA 5D3MB 1XD2A 4EPVA 1QVRA 4HAXA 2F43B 1P9NA 2OCYC 1G1MA 5FTMA 1NIJA 4YQFA 3EWAA 1KI9A 1OXXK 4LJ5A 2WKRA 3THYA 1FPMA 4RCZA 1N6KA 1HEIA 3ZQ6A 2HYDA 4OQLA 2WWFA 5E7IA 5FBWB 5IK2A 4B3GA 5EE5B 2MMCA 4MRPA 2PEZA 3V00A 3EPJA 1I4TD 4F92B 5LDDC 2GWHA 1P75A 5H1YA 3I32A 3I3SR 5F9HA 3O8DA 1CXZA 4CVNA 1FW6A 1N5JA 3RRMA 3T1QA 4C0AC 1TPZA 4X8OA 4CRWB 4TTPA 1N6OA 5AK0A 1I2MA 2X8AA 3C16C 5DYIA 2F3TA 3C7KA 4RD6A 3SS8A 4JYBA 3KUDA 1HY3A 1GTVA 1JPJA 3GP8A 3VHLB 1L2TA 2H5EA 2XJ9A 3KKOA 4XJXA 5JJLA 1XMSA 4IVQA 5GJCA 4DJTA 3Q5DA 1KOFA 1SXJD 3EARA 2WSSA 2VLIA 4NZYA 4PC3A 3ND8A 1N6IA 4V03A 4A4DA 3C5HA 1KI8A 3GFTA 1U94A 3A4MA 3ZS8A 4KLNA 2ZRDA 3AVXA 4US1R 4B76A 2QTVB 1CR2A 3NBXX 3VNVA 2PEYA 1UDWA 4C7OB 621PA 2BMEA 4GZLA 4HZUB 3SQXA 1G3RA 1DPFA 4JL5A 4LCBA 1COWA 2ZJZA 3PEUA 3RHFA 3QSYA 1ZCAA 2CE7A 3TAUA 3BFXA 4IXMA 3A1VA 2IC5A 5KTYA 4JBWA 2NO6A 1IY1A 4R71A 5G53C 2QGZA 1F48A 3CH5A 2VEDA 4RCYA 4M22A 4NP6A 4UJ3A 5G40A 2IYUA 5L3SA 4DIDA 3P20A 2A5YB 2AX4A 4ON9A 2QPAA 4DDWA 3IBYA 2VRWA 2WWIA 3AP1A 4BFVA 1A82A 4P4TA 4POAA 2Q3MA 4FN5A 4ESHA 1ESMA 3CUEF 1W4BA 3C41J 4EQ6A 3BD9A 1R5BA 1BKDR 2ZPTX 3B78A 2BV3A 5CITA 3QEJA 2ERYA 4QM7A 3IEVA 3PFIA 3EC1A 3EIHA 4TYWA 4WIAA 5FOSA 4NCJA 1P73A 4KODA 3TW4A 1FQJA 4LV6A 1XPOA 4DXAA 3U6KA 4I1VA 1Z63A 4C2TA 2GJKA 3QPVA 3SZRA 4Z1MD 4ZCMA 3SU8A 3D31A 2A2ZA 2GAAA 4TZ0A 5J47A 1US8A 1ZNYA 5DE3A 4DCVA 1N0UA 4NCNA 2DB3A 4OQNA 1KO1A 3KXLA 2AK2A 4NBSA 2V7QA 1BOFA 2ZI3A 3DO6A 4GSYA 4PSVA 3DPUA 1XCPA 3I4LA 4P4UA 4PSAA 2DYKA 4M1YA 3NG1A 3JZMA 1Z5ZA 5E7MA 1BMFA 2ZYWX 1MRNA 2B8WA 2OLJA 3L8YA 1KYIA 4Z8XA 2CHVA 2GVDC 2R6FA 1W0JA 2WJJA 2O8BA 1KI6A 2VYFA 5F98A 3K1JA 1OH7A 4LHZA 1R0WA 4FD2A 3AF3A 1XD9A 4PQFA 4TL7A 1HYQA 3GJ7A 2C96A 2KB0A 2JIZD 4M1OA 3HP1A 3FHCB 2C2HA 2YC2C 2ZJAA 1IN5A 4QBIA 2PT5A 5DSZA 2H92A 1RYHA 2XSZA 4UXJA 3VHXA 2BBOA 3E2IA 1F60A 3MFYA 5C4MA 3FMPB 4C4PA 1SVWA 1G64A 2Y8EA 1Q1QA 1G291 3GD7A 3HYTA 4KXFB 2PZEA 2ZUBA 3FYHA 3ZH9B 2AK3A 3HDTA 2J7PA 3M4YA 4Y0VA 1G9XA 1IY2A 2GKSA 4Q4LA 5FR2A 4Q4JA 1G3QA 1Z8FA 5P21A 4CGZA 3AUXA 3RAPR 4JT4A 1RW4A 4BLOA 3R9WA 2OFWA 1UDXA 2NO1A 2R62A 3GMTA 4NE2A 1XTIA 1OFIA 3VKGA 1FMJA 3OIWA 5FPKA 3WMEA 4OHYA 4L8GA 2FZ4A 3UK6A 1GRNA 4YXWA 4F4CA 1Z6GA 3ZJYA 4JJZA 3X1WA 4O25A 1I2DA 2ZANA 2O8DB 4B34A 2AR7A 1JQLB 1XBTA 3O8CA 4TLBA 2ZSEA 1S2MA 3Q5EA 4MH0R 4UQOA 3OE7D 1NJGA 4A82A 4TLCA 1D5CA 2QE7D 4G5OA 4TQUS 1WQ1R 3UG7A 5UKDA 1T9HA 4TSFA 1NRJB 2QT1A 1KO5A 3C14C 3KJIA 5G41A 3E70C 1J2JA 5FFMA 1RE0A 2WJHA 3BFVA 1EFRD 2JDIA 5FL7A 1JALA 2DFKB 5FPSA 4GOXA 2Q0HA 4HLQB 4QHSA 5DI3A 5J4HA 3NH6A 4URUR 4JIMA 2O8CA 4HZIA 1KI2A 1ZC4A 1WA5A 2BBWA 1DVRA 1F2TA 3ASZA 4HDOB 1U90A 5SZHB 3ZDQA 2BM0A 2FFBA 3A4NA 2PZGA 4BUJA 1GL6A 2IBMA 3SN6A 2REXB 5CB8A 1N6RA 2PL3A 1G5RA 1XJQA 1S1CA 2W0SA 1ZD1A 3X1YA 5BWMA 1E1QA 4F93B 1KTVA 3B9PA 1W44A 3SYLA 2J7KA 1UBEA 3B82A 2G9NA 3U61B 5GJWC 2ZM5A 3OF5A 2IA5A 1AA9A 1DEKA 1DARA 2X2EA 4FCVA 4TTQA 5KPDA 4JBXA 1TTTA 1FUUA 1W48A 2IEYA 1F2UB 4MGIR 4FWTA 1CR1A 1KAGA 2GZDA 2F1HA 2WTUA 2X77A 4E5UA 4ZDWA 3Q85A 4LHVA 3NH9A 2YWHA 2AL7A 4KVAA 1KSGA 3WXMA 4F7WA 5FUWA 3KB1A 4PC1A 2YWGA 3R20A 4GMDA 4KBFA 1N25A 3RRYA 3PUYA 3GLGA 1RIFA 2EYUA 2OSBA 1DOAA 2VSFA 4FW9A 1VG9B 3I8XA 5AUOB 1YRBA 5KSYA 3DDCA 2C9OA 3EIEA 4TYQA 2YOHA 3GLIA 1HT2E 1GNPA 1JXMA 2D2EA 3MUFA 4U00A 4YDSA 3LRPA 3BAFA 1E2PA 5IK2D 4I1OA 1XPRA 1PUIA 1AQUA 4MITA 4DCUA 1NVVR 3KDSE 5TVKA 1V43A 2W83A 4AKIA 4RD1A 4OK6A 3SR0A 1ETUA 2PJZA 4QKQA 1YU9A 2GZHA 4RFSB 4BEJA 3MWKA 3OHMA 2YYZA 3KL4A 1KJYA 2A78A 3LFUA 1CRPA 3IGFA 3W8NA 3SHWA 3LVRE 2DHRA 5LBIA 1RKBA 4W5WA 3EZ9A 3RS4A 1LW7A 5SZJA 5AJYA 4LV5B 4PO9A 3Q7QA 3SJAA 2YHSA 2HXYA 4WAUA 2FE4A 2GJ9A 1JECA 2WSSD 1IQPA 521PA 1KMHB 3BB1A 4V0ME 4OJKA 2AWOA 2QZ4A 4CW7A 1W36C 3T12A 1HE8B 1G41A 4FIDA 1CR0A 4HLCA 1RJ9A 3T35A 1VG8A 3QI2A 4C0JA 2CNWA 2ZS7A 3VR5A 2IYLD 1U8ZA 2JLVA 2GA8A 1M74A 2ERXA 2HV8A 3EX7C 1OH6A 3NBYC 4L9WA 2P67A 3C8UA 4LOAA 3SYNA 4URXR 2BMDA 2DPXA 4JL6A 1T3LA 1COWD 3THOA 1II8A 4HB2A 3OAAA 2QAGA 4U02A 4XOIA 3CX8A 4I1UA 3LA6A 3W6NA 5LD2C 1QHGA 3C4JA 2IYWA 3FVQA 3RVBA 2IS4A 2J0UB 1P5ZB 5F9FA 2WWYA 1C9KA 1B23P 2A7QA 3IQWA 2IS1A 2Q9CA 2WJIA 3F3YA 4XD7A 5J40A 3TNFA 3THXB 1VECA 3RABA 2ODBA 3U44A 4O3MA 1Q3TA 2ORIA 2ONKA 1E98A 4HAYA 2FH5B 4TN1A 5JECA 1TUIA 2WKQA 1DAHA 1XRJA 3AF4A 2ZQ5A 2ZJ8A 4V0NA 2C03A 3LW7A 3WHKA 5AUNB 5BW8A 4G1UC 1E9CA 1GUAA 4IOMA 5KPJA 4CEHA 2PZFA 2YJTD 1Z0IA 2QY9A 1P60A 3CRMA 4ERNA 3ADBA 3CNOA 3WP0A 2NO9A 3DHWC 4M21A 4UNNA 4MRVA 3BOSA 4O2LA 4NTZA 3ZD7A 4Q19A 2CHQA 4RKEA 1T8UA 1S9DA 2RGBA 3L2OB 4A8JB 4QG7A 4MDEA 4L16A 1IONA 2HJVA 4KFRA 2WJVA 4PO1A 4WZBE 4JJKA 3QXHA 1LS1A 4MYHA 4DEYA 2VHUA 1SXJE 4AKEA 1DAFA 1CJMA 2D4HA 4PO8A 3UWKA 2V7QD 1OIVA 3QUSA 1E0KA 2QP9X 4IDPA 1D2NA 3X1XA 1ZUIA 1AGRA 4LJ4A 1QHNA 4B3FX 1ZJ6A 2OILA 2C9YA 1BO6A 2X1VA 3M1IA 1E9EA 4ESVA 2GVZC 2CEAA 1BMFD 4A2WA 1ZUHA 3TGPA 3K0SA 2AXPA 1W0JD 1GZSA 3OESA 2GCOA 4HLDA 2XZPA 2X2FA 2ZJBA 3ZVMA 4DSTA 4ACAA 1O3YA 1YZLA 2UZIR 3TKLA 2V54A 1R5OA 3QKRB 4Q1CA 1E2DA 1RYFA 3AVVA 4BFWA 3EA5A 2CL0X 3RNLA 5CDFE 4KFTA 3RANA 3U60B 1FTSA 4Z51A 3N2EA 4JLPA 4LUCA 4QRHA 2XSZD 4ZI3A 2G88A 2OXCA 1U0JA 3VR4A 1IHUA 4EJSA 1O87A 1XU4A 1H8EA 4TWZA 3CNNA 1JI0A 1UM8A 4DIEA 5KSOA 4BFZA 2P2LA 3AVUA 1ZU5A 3EW9A 2WWXA 1SVKA 3HPRA 2O5VA 2WZQA 4X8HA 1G8YA 2J7PD 1EFUA 3ADDA 3BWDD 3NTUA 721PA 3PUVA 4PHHA 1DAMA 4A15A 2FWRA 4EFNA 5KNCA 3EASA 3T15A 5IDVA 2F6RA 4Q47A 2BVNA 4DB4A 2XTMA 1VIAA 1ZD8A 4IJMA 5BYJA 5EXTA 1BH2A 2P6NA 4CEJB 1XTRA 4JT2A 1GIAA 4WA7A 5CLQA 2FGKA 3K0AB 4OQXA 1WMSA 1GKIA 3Q3JB 4RZXA 4YXWD 3R7WB 1G7SA 4AIIA 2HDNB 3U4QB 5TDHA 1CR4A 2ZJOA 2D7CA 2OLKA 3K0FB 2EFEB 1BIFA 3KKMA 2DY1A 3LVQE 2ECKA 1PUJA 3AVOA 3LQRA 3CZPA 4IRUB 1JEDA 2RHMA 2GXUA 2QMOA 3CWZA 3F5FA 4TSFD 2JLQA 4A0FA 2DBYA 4P32A 2NIPA 4JVNA 3RSOA 4HI0E 5EE1A 1XNJA 1TQDA 1Z29A 2XEXA 2JDID 2N1BA 5FL7D 2NZJA 3WRYC 2H18A 1KDPA 1EX7A 2ZIAA 1WXQA 5L3VA 5DNYB 4FCWA 1CJUC 4B73A 1CP2A 1NKTA 1T5IA 2CCJA 3LWNA 2G6BA 4LV8B 4ZDJA 5C2JB 4LX0A 2IW3A 3DVLA 4UNSA 2CE2X 2XTNA 4IOJA 2QN6A 3LXRA 4AWXA 3GLFA 1TQ2A 3GFOA 2WJYA 2FFQA 2FSIA 1NF3A 1ZMXA 4I99A 2BMFA 3DEFA 4LJ8A 4NL4H 3IIMA 4EPTA 5B57C 4B47A 1NI3A 4Q7LA 1Q21A 1NMZA 3PEYA 2J87A 3PXGA 1GM5A 2DWQA 1D2EA 1UKZA 2HF8A 3GLHA 1E1QD 3AVQA 3ZVLA 1Q22A 5EP1A 1Q12A 2WWWA 4DC9A 2Z0MA 4R9UC 3PIRA 4GOKA 1QHIA 5CJ2A 1W36D 2CCKA 5FL3A 1FUKA 4FCTA 3O8BA 5HCNA 3REFA 4EAQA 2FPKA 1E0JA 5C4GB 2V3CC 4AYWA 4R2IA 5H70A 2H57A 5EXSA 3GCGA 5HCIA 5KNDA 3RC8A 4TYYA 4Q4AB 5FPYA 4RZUA 1PLJA 1RRPA 3BORA 2UKDA 2CK3A 4MKIA 1KJWA 1XMJA 1QG2A 1HQCA 1M7GA 3TR0A 4EKDA 2W6JA 3CF0A 2ZRGA 3AH8A 4PHFA 2YWFA 1X1RA 1TU4A 4XSGA 1IXSB 4Y0AA 1XMIA 3CB4A 4G5GA 2VO1A 5E7JA 1Z3IX 2V4ZA 2XB4A 1T3HA 2C9CA 2OE2A 3MGCA 5JZVA 1YR8A 2FX3A 2QGNA 3TE6A 3THWB 1P3JA 3MSXA 1E2LA 4WXPA 5B30A 1VPLA 2FGJA 4M9XA 4NYJQ 5CM9C 3MWLA 2MSCB 1CLUA 2GK6A 1WF3A 1E32A 2J0QA 1W5TA 1NG1A 3QXSA 4DBLC 2JLUA 1Z07A 1VHLA 3BFKA 3FTQA 4D4KA 3IIJA 2BKEA 2EWWA 3AKYA 4TL9A 2OT3B 1R2QA 2HF9A 4Q21A 1VYVA 1BYUA 2AXNA 4LRWA 2JJ1A 4TQAA 4ZKEA 3OFNA 2ZXUA 2G1KA 3TSOA 2D7DA 4D4JA 1T91A 4HB0A 4TT3A 3TAHA 3IILA 2F1RA 1E2JA 1XX6A 1DAKA 1GILA 2WPDA 3WMGA 3TLXA 1GFIA 4Q9KA 1Q57A 3A36A 1KNQA 2DFTA 1OT3A 4P31A 4MGZR 4YDHB 3WY9A 2MSDB 3PITA 3WBKA 3R9XA 1N5IA 1XCGB 2GJSA 1S8FA 3TMKA 1XP8A 4HAUA 1E2IA 1U2RA 3SYKA 3V9PA 4CYMA 3AGPA 1YZTA 4W5JA 3RSLA 4DVGA 2VHTA 4G5RA 3RDPA 2RGDA 3ZIAA 3VKHA 1H8HA 4WW0A 4J0QA 3UMRA 2CNWD 1XJCA 1NJFA 2Q9BA 1QHHA 5KSZA 4ARZB 5IRCD 4QBFA 2J0SA 1PVOA 3H86A 4N0EA 2J45A 3QXJA 4NYMQ 5FI0B 2QBYB 1VHTA 5CJPA 2D74A 4S2EA 4EDHA 1TF7A 2WAXA 5FTJA 4B2PA 2OUKA 3OAAD 2QEQA 2JGNA 3A8TA 4GBMA 2IUSA 2Z6VA 2GAOA 4UXIA 3VX4A 3CRQA 4AYXA 3AP2A 2ZRMA 3V4RA 1ZUNB 1FFHA 4KV9A 2FPLA 3H4MA 4XD7D 4B43A 5JLJA 3H84A 3HYRA 2GF9A 3KKNA 2VSXA 5JI2E 1Z47A 4OK3A 2P5SA 3KQUA 1TU3A 1S4QA 1TF5A 3UMSA 2FEOA 3DZ8A 2KE5A 3B1VA 2GBLC 4PPFA 1GKYA 4RJLA 3UANA 3F0TA 2P5TB 1OF1A 2Q3HA 4EPYA 4JLOA 1QRAA 4BE7B 4B74A 1LVGA 1DE0A 3FMFA 4U7DA 3EWSA 4EFLA 4OJQA 3QF7A 5TMPA 3VU9B 2KBEA 4DSUA 4DZZA 3KQNA 1KO4A 4FXPA 2E9SA 1M1YE 4D0GA 1KO8A 3KX2A 3EPHA 2A9KA 3QQ5A 5AWFC 2WV9A 1N0WA 3WRXC 4CZ2A 4CEIB 2ZE5A 4KSCA 1OFUX 4PPGA 4H9GA 4QNRA 3AKDA 2AFHE 1GITA 2TMKA 2H8KA 3BE4A 3ZVNA 3EA0A 4MA4A 2VP5A 5J4LA 3DM9B 2YV5A 1SXJB 4RSGA 1HV8A 4DHEA 5EE3A 2PLRA 5L3QA 3QVUA 1E1RA 4PX9A 1W46A 3B1YA 2P3SA 4Q4HB 1NIPA 5IF9A 5KUTA 3WYAA 4FMCB 3ECCA 2QSZA 4MYCA 3TK1A 5TXGA 1OXSC 4WVFA 4OHWA 1JR3E 1FP6A 2ATVA 2RGAA 1TF2A 3J81k 2B8TA 4KFSA 2ZROA 1TL7C 2V8OA 3FFBA 3K0CA 3L0SA 5EE0A 2GXAA 3LBHA 3I62A 4OK5A 4V0OA 3KKQA 1KSHA 4QJ5A 5FPTA 5KDOA 4N0DA 2GXQA 1LS6A 4D26A 1VCOA 4V0LA 3QENA 2QSYA 2YOGA 3B85A 4D0LB 1MABA 4DLVA 3JVUA 4QC2A 1G8FA 4MRSA 5DYGA 1RPZA 3CM0A 1XD8A 4V0KA 4YMUA 4HUQB 5EP4A 5LPNA 2DR3A 1H8ED 1XTQA 1YZGA 1KDOA 2JEOA 2WWGA 3W90A 2VF8A 5C1BA 2JAQA 2VP4A 4LPKA 4MUBA 1FX0A 4E22A 4NYIR 3ZS9A 1CIPA 3RS2A 1T6NA 1SHKA 4MKHA 4JS0A 4X8MA 1GDDA 1DS6A 1IJFA 1CTQA 2AFIE 3BH0A 3BS4A 2VHJA 4K81B 2RMKA 1U99A 2R9VA 3MMPA 4TMXA 3UIEA 2PBRA 1LNZA 4LGMA 1ZINA 4Q66C 2BKUA 3FPAA 4TL6A 2OM2A 2WHXA 2IHYA 4LPSA 121PA 1OJLA 3BC1A 3BK7A 4Q18A 1W47A 4JVMA 4D0NA 1R0ZA 3W5IA 2IF0A 3S1AA 1T0HB 4IKEA 2ZSDA 4HYYA 5AUQA 2CJWB 1FL9A 4P33A 5DGXA 3IPXA 3W6OA 2WM9B 4JZKA 2NMVA 1RZ3A 1ANKA 4DCSA 3LQQA 3RLFA 2IYXA 2GHIA 1R0XA 1G4AE 1VYUA 2RGXA 2CL7X 3U5ZB 1KZ7B 1OKKA 1B0UA 2ZSFA 3BB3A 5KO2A 1HA3A 1R0YA 2A5DA 3BBPA 3EZ2A 2FSHA 1ELOA 2GEDA 4GPTA 4XVRA 3AQ4A 3LY5A 2I4IA 4D4MA 2VHQA 5JJKA 3LW8A 3TRFA 3K0CC 4BZQA 2W2XA 2O8FA 1J70A 1E4VA 3FFAA 1XEXA 4LHWA 5BN4A 4RFVA 4DLRA 1JBKA 3WYGA 1LB1B 2IL1A 3I8SA 1JXOA 4WXRA 4Q9LA 3D6TB 4K46A 3P32A 5JSZA 2RGEA 3CBQA 5TARA 1E9RA 3VMFA 1KK0A 1V5WA 3EG5A 3IHWA 1UPTA 2G0TA 1K6MA 4OHVA 4DT1B 1WDTA 4GL2A 5B2ZA 4PPQA 3U7HB 1D8TA 3ZZUA 3RS3A 4PC7A 2IEZA 2QP3A 1E2QA 2WVJA 4B2IA 4PC2A 2EFCB 4CT4B 1KI1A 1QDEA 3QBTA 2KI5A 1IN4A 2ZR7A 3Q72A 5BYKA 2D3WA 1SQ5A 1J99A 4F4IA 4ASUA 3O8RA 4NH0A 3I61A 1MO3A 1VIYA 5KSPA 2CK3D 2FMXA 3B1WA 2UVQA 3LLMA 4LYFA 4D4LA 3DKPA 1KDRA 4B3DA 3DOEA 2W6JD 3IO5A 3KTAA 3NHAA 1Q3HA 1E96A 2RCNA 3CH4B 4M9QA 5ELXA 4DKXA 4XSHA 1DTSA 3EIQA 2C77A 1F3OA 4P4SB 1DADA 3SJCA 4FMDF 3FKQA 2YOFA 1M6NA 4C3ZA 4KYIB 4PHGA 4LBWA 4URWR 5JJIA 1R7RA 3O47A 5JCPA 1G7RA 2ZUCA 3KJHA 4LC0A 2VQSA 5HE8A 2FF7A 4AYTA 2H1LA 1Q1ZA 4NONA 4O2RA 2QAJA 4CT5A 3I5YA 4GDFA 3CPHA 1E6CA 3FHOA 4LWZA 4OHXA 1TAGA 4LZZA 3VQTA 4BFTA 4DLTA 3AVWA 4BFSA 4B48A 2BJWA 1XXHB 3U7FB 4A2PA 1EFCA 2JJ1D 2ZRAA 3D8BA 3L43A 3OFND 3QXXA 3CX7A 1JJ7A 1TEVA 1UJ2A 1QG4A 4TT3D 3QF4A 3BGWA 2F9MA 4DLUA 2WPDD 4JSTA 4JVLA 2C04A 2KJQA 4C0SA 1M8PA 1U9IA 4BZPA 3NC1C 1TQ4A 4LYHA 2YINC 4XWAA 1TEXA 4Q7JB 2O8EA 1Z6AA 2IHBA 3C15C 1TUEA 2VH5R 2V1UA 2AKAB 5AUPB 3ZIAD 4BGDA 5D3MA 4IEIA 1H8HD 4E07A 4OL0A 3SNHA 1ZM3A 1UF9A 2F43A 3SC3A 3TUIC 2V6JA 3FHTA 2OZEA 1KAOA 1EWQA 1D2MA 5AJWA 4PZLA 4YMSA 4NHOA 3GJ6A 3AGQA 1P2UA 1CJTC 1OW3B 4LYJA 1G3IA 2V55B 5ANRB 5AR1A 4V0MA 4ZIRB 1U8AA 3QKSB 2XXAB 4MUAA 3WNBA 1OLOA 1NBMA 1WE2A 1MO5A 1J8MF 1JAHA 1HTWA 4M9ZA 3W9YA 2HCBA 4A0GA 5SZIA 4US2R 2RGCA 4JLAA 2OAQ1 4MQBA 2CLDX 5DHFA 5CLLA 4DRZA 5DLQC 3HU3A 3K9LA 1XD2B 2XOKA 1NSFA 4Q9HA 3KQKA 4BPBA 2D06A 2R6CA 5EZ6B 3T1OA 1HT1E 3THYB 4PAOA 4Q48A 4Q9JA 4DLYA 3CR7A 2REBA 2PH1A 4X8LA 1IAQA 4I1SA 1L7VC 2NZ8A 5BXQC 1SKQA 2ZR0A 1LY1A 2A3RA 2IYYA 4M4SA 3K53A 2B7CA 4LY6A 2XGJA 4B44A 4D81A 2AN9A 2J41A 1U81A 2VP9A 2P6UA 3JVVA 1ZIPA 2IXFA 2CLSA 3QKUA 4P3YA 2GF0A 5FUYA 4C7OA 2JLSA 4HB3A 1OPXA 4HZUA 2QENA 3HPQA 3P1JA 4A1FA 3K09A 4M1KA 5TY0A 1HQYE 1YRAA 2R8RA 4F4JA 4JBYA 5JEEA 2ZREA 1FOEB 2FDCA 4XTCS 1NLZA 2WIAA 4NPHA 4HUTA 1XTJA 3GEEA 3OEEA 1EFTA 1LV7A 3SFVA 4WOPA 3LV8A 4WZ6A 5JWHA 1E1RD 3FKSA 1YZKA 2JLXA 1NL3A 3VAAA 4KSBA 3GJ0A 2P6RA 2BEJA 1KSJA 2ODEA 4QHTA 1JEEA 1IY0A 3NC0C 4KO8A 4Q03A 5B58C 2ZAMA 3B5JA 3MG9A 2ZTSA 3U2QA 3HR8A 1U8YA 4BEBA 3X1ZA 3Q8XB 2EVWX 221PA 5DHAA 3FDIA 4D6PA 2B7BA 4B3CA 5JS7A 1L4YA 2W6IA 4BASA 2BIFA 3A37A 1FQKA 2LCFA 1ZBDA 4QFMA 1R4AA 3RRZA 2ZI9A 3RS5A 1Q1EA 2CCGA 5C46F 5JBQA 4ABYA 3F8TA 3SOPA 5JWOA 4URVR 2D2FA 4V02A 3CF2A 5L3SB 3WHLA 2IXGA 3EPLA 1KI7A 3GJ4A 3HWSA 5GADl 4KITB 4ZV4A 4Q1EA 3VR1A 5HZKA 1KJZA 2QI9C 1CRQA 5EQTA 1YQTA 3VR6A 4ZI2A 2XNSA 5CDFA 5EE9A 3FGNA 4DDUA 4EQ6B 2QRZA 2QT0A 2ATXA 5CYPA 5B64A 2VPPA 2OESA 4AC9A 3KKPA 1DO0A 3OEHA 1KHTA 2QAGC 3BH6A 3I1FA 4D25A 4QOSA 3PCRB 4L9SA 2R44A 2ZS9A 1XFAA 2ODNA 4DUGA 2W00A 3CONA 1W4RA 2HT6A 2RKOA 1Q44A 1G3MA 4JLMA 4N1AA 5C18A 1WBDA 4JSYA 4AY2A 1QZXA 2WKPA 4TLEA 3TUJC 3K09C 1GL9B 3QNUA 2OAP1 2ZS8A 1E2NA 3CRVA 3KFVA 3TVTA 1US8B 2F3RA 2J3EA 1X6VA 3UXMA 4EPRA 1AS0A 2AHOA 1Z83A 1K5DA 2ZRCA 2MSEB 3N2IA 4HAWA 3K70D 4TQ9A 4FWIB 4MKGA 1A4RA 2GEVA 4I81A 2JLRA 2RGNA 4IHQA 2IS2A 4HSEA 1OKKD 3ZQJA 1A2BA 3IKJA 2FEMA 5DN6A 4PQRA 2ZJ5A 2V6IA 3RRNA 4HDCA 1IN8A 4PFSA 4AK9A 4DSNA 3PJRA 1W2GA 4B6FA 4TZ6A 4MYTA 2C99A 1Z6YA 4IOKA 2AD5A 3V4FA 2EU8A 2O8BB 5TB5A 4PC6A 1KK1A 3AF0A 1KI6B 2VHCA 1BS1A 1GSIA 2GZAA 2HEIA 3U3KA 3C5CA 5FOUA 4B3BA 4GOJA 1OHHA 3DL0A 2BHRA 1ODFA 2O0HA 3CO5A 3LX8A 4TMVA 2CLCX 4URZR 4IDOA 5FTNA 1LF0A 2ZRHA 3AVYA 1OIWA 1M7BA 3AVPA 5E4FA 2E87A 4A6PA 1NNEA 4RKFA 2FSGA 1CJKC 4M1SA 4DEXA 3IO3A 2DFLA 1G18A 3B1XA 2VP0A 3I73A 1ZC3A 1K8RA 1E2HA 2RHDA 2VP6A 4US0R 5CK4A 5K8UA 4KCGA 3QEOA 1SGWA 4PR0A 3ZVRA 1R8SA 2BBTA 1N5LA 1S3SA 2FFAA 2O8DA 1OYYA 4TMTA 4FINA 1I4DD 2ANCA 4Q4JB 2C78A 2HYIC 2WMNB 1KI4A 1S3GA 4GNKA 3B13B 1ZRHA 2FPMA 1XEWX 4ASUD 5FH9A 2GEUA 1EESA 2H17A 3B1ZA 3PR1A 3NDBB 3ZGXA 4RD4A 5E3HA 3KUCA 1N0VC 2E1RA 3AEZA 1FMLA 3EZ6A 2OEPA 4EJSC 5JCZA 2EFDB 4BFXA 2W2TA 1KKMA 4Q1DA 1F5NA 1DAEA 5GJBA 5J5CA 1KSFX 3EZFA 2J9RA 1AS2A 1II9A 1J7KA 4M0LA 1G7TA 3MCAA 1XB2A 1E2GA 6Q21A 5JEDA 1GL7A 1C1YA 2WOOA 1NP6A 1XEWY 3VX3A 1NY5A 5DH9A 1DBSA 1PJRA 4C30A 4JVSB 2C5LA 5JS8A 5KNBA 1CF4A 1M7HA 2R6AA 2GNOA 3LBNA 1KZGB 4EIWA 1Z0DA 4LI0A 4G3XA 4LSGA 2NPFA 4IXNA 2FOLA 2ZVQX 3DZDA 3W3ZB 3U7GA 1ZM9A 4ZDKA 3RS0A 1UADA 2JCSA 4XVQA 3AKCA 4LDJA 4B35A 4QXAA 2H7VA 3IHLA 3LXXA 2IS6A 1LF5A 4EPWA 1FNMA 1AJEA 5DI3B 2CBZA 2W0MA 1XEFA 1AIPA 2V1XA 3GLFE 4B3XA 2O8CB 4H1UA 3ADKA 3HU2A 4QGFA 2CVFA 5FBQB 3TW8B 3KFXA 2C8VA 1F2TB 1F2UA 1NN3A 3N5CA 4UNRA 1X3SA 3BB4A 4NKRA 2P65A 4Q9IA 4C2UA 3MJHA 5FBRB 1W2HA 1YHNA 4TYNA 3TJZA 2GK7A 5A5GA 5CIWA 3VKWA 2OCPA 1MH1A 1YZQA 4AG6A 2N46A 1E3MA 3M0EA 1P62B 1TQ6A 1KK3A 421PA 4C0BA 1T4GA 3ICQB 4Q1AA 1A5TA 2LWIA 3PEVA 4A92A 1KGDA 4BZXA 2RB4A 4XH9B 1S1MA 5L3RA 1XXHE 2MMGA 2JLWA 3BRWD 4URYR 5KHOC 1W36B 5D3QA 4GFDA 3BXZA 4M1WA 5BQ5A 4YC7A 4FI3C 2XJ4A 3K9HA 2Z4SA 1MV5A 1JQJC 1NKSA 4ZCLA 3JZAA 1S9HA 1RC8A 1VG1A 1ZM7A 4NDZA 4FMBB 3SFZA 3T1TA 5A0FA 4QL3A 3AKEA 4JYCA 4OQMA 2WICA 4RFSA 3PUXA 4RZ2A 1NBMD 1G6OA 1XF9A 2Z83A 3MD0A 2HLDA 3HJNA 3P4YA 4ILEA 4EPXA 3GLGB 2IYZA 3KQLA 4MGKR 1UFQA 2OXRA 3ZZTA 1VG0B 5LD2B 2QP4A 1SVMA 2EW1A 3TSZA 4B2LA 2XOKD 1P2TA 2Q3FA 3GLIB 5JRZA 1X8LA 5EUQB 2HT1A 1R6BX 1N5KA 4G01B 2FG5A 1IBRA 4KYUA 5HKKA 3NEJA 4KFUA 4QHYA 4IEEA 1A7JA 4AD8A 1L8QA 1N6NA 3W8RA 2C98A 4LHYA 3GEIA 2IYSA 3RS7A 1KMHA 1N3BA 2QROA 3A1TA 1CULC 2VA8A 4QM6A 1FP7A 4A2QA 5HR5A 3OIYA 2PMDA 2VSOA 2O0JA 2FNAA 3KJEA 1X8JA 3WMFA 1Z6XA 1G3UA 2LKDA 3AV0B 2ORWA 2FJUA 1ZIOA 1W5SA 2BC9A 2CVHA 1EK0A 1VYTA 2WAYA 1A1VA 4DLSA 1P2SA 5HTKA 3QKTA 2EWVA 4EFMA 1NVWQ 4IDHA 3R9IA 1E9SA 1T0JB 1CEEA 1TMKA 1Z06A 3GJXC 3WNCA 1NSTA 3OEED 3BJIC 3IEUA 3MAAC 3TVDA 4W5HA 3NKVA 2RH5A 1EXMA 2J0UA 3FKSD 3D7MA 5JWRA 3X2SA 1XJ0A 2VTKA 1NG9A 2QL6A 2QTFA 2VP2A 3T1VA 1L4UA 3T06B 1ZU4A 1RJ9B 1GKUB 2ZAOA 4N3NA 3THXA 2K5UA 2NTYC 1M2OB 4HAZA 2G83A 1GP2A 2NQ2C 1EGAA 3PVSA 2W6ID 4ITRC 4GRAA 4LK2A 4KU4A 2NGRA 3PG5A 3LD9A 1II8B 2DWPA 2QAGB 3K9NA 3L82B 2JJ8A 1G5PA 4KHZA 4U5XA 1AZTA 4MGYR 2FA9A 2ZI7A 1VCMA 5F2EA 5JHHB 3M6AA 3IQXA 3HU1A 1JR3A 3A4LA 1ZCBA 4A8JA 1NVUQ 5HE9A 1CU1A 4L15A 4AKGA 1IXRC 2XNDA 3U44B 4IW3B 5CB6A 1VCIA 4S35A 4CEHB 1TX4B 2GCNA 1ZAKA 1R8QA 3GJ3A 4XTRA 2WWHA 1NMYA 4ZDIA 1IM2A 1XTSA 3OEHD 4WBSA 3NIBA 1LTQA 3REGA 1G7CA 1BYIA 3SE0A 2QM7A 4DUGD 2PMKA 1XMVA 1IOZA 5K8TA 5HZHA 3A1SA 4Q1BA 3QPUA 2XX3A 3P26A 5FUVA 2QPOA 5EXXA 3BERA 5K8LA 1IN7A 1E2FA 1EX6A 2QU8A 2GCPA 4LJYA 2PT7A 3QKRA 4LBYA 1OXVA 1AK2A 2IYQA 2ZRFA 5FI1B 2GETA 1X8KA 3U6BA 1ZNWA 3B7GA 1X1SA 2B92A 3PENA 4RZ3A 2IF2A 4G0NA 2GXSA 1YR7A 1FZQA 3QOFA 2YC4C 3LX5A 4C0LA 2F55A 3AUYA 2FV8A 2G0NA 5DN6D 1ZP6A 2CXXA 3GEHA 4NU0A 1TADA 1VMAA 5AJXA 1P61B 2G3YA 5E95A 3G5UA 4H1VA 3PUZA 1Z08A 2QUZA 4JLJA 4JLKA 2Q9AA 4JKIA 1D6JA 4M1TA 4AI6A 1CS4C 4ZCIA 1Y3AA 2JATA 2IT1A 4UJ5A 4GP6A 2GCOB 2HCJB 4Z54A 4IDNA 4G5SA 1E0SA 3CPEA 5TV2A 3T61A 1OB5A 3QBVA 1SHZA 1VKJA 1OHHD 2OCAA 5SZKB 3PQCA 2ASEA 1XDBA 1H65A 3IUYA 1Z22A 2ODWA 3QVVA 4A8JC 2NO7A 1DAGA 1JAIA 1JB1A 4UKDA 4Q00A 4CEJA 4LC1A 3QIAA 4EJSB 4ZO4A 3T34A 1P2VA 3K0AA 4NCKA 1KY2A 4AURA 1EWRA 4M2LA 1E4YA 1E9FA 1S0UA 4BLTA 1W4CA 3R7WA 1U0LA 4HEJA 2FFHA 2W2VA 4B32A 3U4QA 4A36A 2F1JA 1ZVQA 3K0FA 3R8CA 4AG5A 3KJGA 1MRSA 1P72A 2ZYVX 1RRFA 3CNLA 2EQBA 3BIFA 1ZM4A 4LJ6A 4NCHA 2QMEA 3EZ7A 1W4AA 3G82C 3VFDA 4C0HA 4M9SA 1GG2A 1W0KA 2J59A 3VR3A 2XAUA 3GJ8A 2BMJA 5GVSA 4PSKA 4QGAA 4QBHA 4R98A 3U3MA 3WBJA 4JLVA 3WP1B 2QQ0A 3TH5A 3EC2A 2R2AA 5EXPA 5A4JA 2BEKA 2BCGY 2ZSBA 1SVOA 4OYHA 2ONJA 4D2IA 2QPTA 2AD1A 1QHYA 3SDZA 1OFHA 4LHXA 4BRWA 3CKLA 1MKYA 1SKYE 1ZD9A 3KXIA 1IN6A 4YMTA 2BWJA 5G3ZA 3L0PA 3X1DA 4DCNA 2A5GA 4Q01A 4B71A 1NLFA 5FOTA 3LO5A 5EZ5A 1G6HA 4HAVA 3IBGA 1VTKA 1E69A 4PPNA 3KQHA 1YE8A 2J5XA 5JI3E 3T5GA 3L0IB 2R65A 1AGPA 5FBLB 2RGGA 2QG6A 1EG7A 3EXAA 3K70C 3GLFB 3CRRA 1RVDA 3PV0A 1AQYA 2YNMA 4M53A 4O0MA 2QORA 2ZEJA 4Q4AA 5GJVC 2P0EA 3ZYCA 3GJ5A 1R10A 3LNCA 1OSNA 4M8NE 3CIOA 4OI2A 2IWHA 3NXSA 3SHFA 3ICEA 1AKEA 3GLHB 4LBZA 4AKHA 1W1WA 3QPWA 1SZPA 1LFDB 2QA5A 1FTNA 5DO9A 2IUUA 3UG6A 3UPUA 4NYIQ 4YMVA 4KVGA 1GOTA 4MRRA 2O52A 3E1SA 1FNNA 3CRW1 4JL8A 3I92A 4QJ3A 4MKFA 1W7AA 1YJ5A 1GNRA 1KIMA 1II0A 2PCLA 4HDQB 4II7A 3THWA 1X86B 2EFHB 5EP3A 4CIDA 1E0AA 1T8TA 1DAIA 4OI1A 3AF2A 3MLEA 4TLAA 4XWKA 3FMIA 1PLLA 4E09A 3B60A 3FMOB 4L5BA 1OH5A 1JNYA 1C4OA 4UXHA 2EFGA 1QHSA 2HLDD 3DMNA 1PLKA 4BLPA 3PEWA 3KZ1E 4RD0A 2VF7A 1OFTA 1WBBA 3AF1A 4PZYA 3HR7A 5K8IA 1PV4A 1Z2CA 4DDVA 3H1TA 1G8HA 4HATA 1ZYUA 4QNMA 5HKKD 4LJ7A 1YR9A 4QGGA 2UZ3A 2GTPA 2ZE6A 4OBEA 821PA 2HJGA 1G8PA 3UKDA 1RFLA 4XIGS 2I1VB 5JFGA 2XZOA 3DMDA 1E79A 1ZNZA 2X19A 1UAAA 3CZQA 3CX6A 1UKVY 4C0QC 2L0XA 3FE2A 3P27A 1TNDA 3RWMB 3GLGE 3K9GA 1P9RA 2GILA 2OBNA 1Z0FA 2JJ2A 1Z0AA 4IFBA 5J4VA 3A1UA 1T5LA 4ARZA 3UATA 1DG1G 2JLYA 2IWRA 2RAPA 3A6PC 1KK2A 2OHFA 2ZU6A 4OHZA 3WNDA 2QBYA 3GLIE 2ZI5A 2EYQA 5DIFA 2KBFA 4BWYA 4NMMA 1G21E 3U3OA 4DDTA 3W34A 2NPIA 1KY3A 1E2MA 2BBSA 2JASA 1U0HC 3K8YA 1QHXA 2WIBA 1KDTA 8OHMA 4JLDA 4A0RA 3B8HA 1NVXQ 4Q7KA 1OE0A 4JMPA 4OQFA 3UWOA 4BRUA 4PANA 1AZSC 4LYAA 2PLFA 1XPUA 2NO0A 1YR6A 1QHHB 4L4UA 5H8WA 4YLGA 4RVCA 2HUPA 2A30A 1WB9A 3H0KA 1CKEA 4JLBA 5FOVA 1OB2A 1YKSA 3FWYA 1GNQA 1Y63A 2ANBA 1ZM2A 1AS3A 1NN5A 1NBME 2IYRA 1XZPA 2F9LA 2N42A 2W58A 2ZRKA 4HB4A 1ZNXA 2V9PA 1UBCA 1VCNA 3CLVA 3CPJB 4I4LA 2ZRIA 1U9IC 2OV2A 2Z4RA 3KB2A 2Z5FA 2FZLA 3T5DA 4GT1A 3W5JA 3W6PA 5IT5A 4TTRA 2NOAA 1DO2A 4B6EA 1AN0A 2PX0A 3VU9A 1U98A 2WMOB 1XTKA 4JLNA 1JJVA 3FB4A 2DCUA 3QE0A 2B21A 2QM8A 1GWNA 1JR3D 2AWNA 3EPKA 2J0VA 4GI7A 3U3JA 2A5JA 2BOVA 2XNDD 1ZW6A 4BLRA 4CEIA 1E9BA 1XCMA 3SJBA 4DLZA 1J90A 4BLQA 1UKEA 3MWYW 1UBGA 4LBVA 1Q0UA 4MRNA 1GAJA 3SBEA 5KDDA 5KOYA 5CM8B 3DKVA 1SXJA 2R6DA 1XWIA 1K5GA 3RC3A 4DLWA 4FMCF 1NMXA 3QY0A 1P9WA 5CIQA 3QJYA 4Q4HA 2ZSAA 3ETLA 2VBCA 2VIIA 4TMKA 3RWOA 3CWQA 5LB2A 2O0KA 3LAWA 4B75A 1S96A 5FTKA 3QXCA 2Q21A 1CJVC 4Q5IA 2XZLA 1N6HA 5FR1A 4P0TA 1G8GA 1SULA 3P4XA 4PTLA 4KAXA 1KKLA 1OXUA 2IYVA 3ZZ0A 4DLXA 1D9XA 1OV4A 4IDQA 1E99A 2CMKA 4MDFA 1CBUA 5M04A 1KO7A 5FOWA 1AM4D 1SVLA 3VNUA 1NY6A 4XWOA 3D3QA 2GJAA 4ACBA 5L3QB 4R7ZA 2KSQA 1GVNB 5KU1A 1QBKC 1OIXA 3SBDA 3LLUA 4HUQA 1G17A 1NVVQ 2ZITA 3ONWA 2ZETA 1MOZA 4DB2A 2F1IA 1WP9A 3TQFA 1P4SA 2KWIA 1WCV1 3LBIA 2F7SA 1KMQA 4RD2A 2WOJA 4TLDA 1F6BA 3TBKA 2OBLA 2G77B 5JHGB 4A6XA 1R5NA 2XTZA 3SEAA 2WSMA 3AB3A 3NBFA 5LB4A 2OFXA 4PZZA 2ZI6A 3VR2A 4F38A 1G4UR 2VL7A 3A1WA 1JPNA 3KXKA 2H16A 3ADCA 2ZUDA 2J46A 1N2CE 1UEIA 1MABB 4IVRA 4TYPA 4TL8A 2IXEA 3NWJA 1E2KA 1KNXA 2R6GA 4R2HA 5DI9A 3AM1A 1E9AA 1VDZA 4Z1MA 4QBGB 1E94E 4KBGA 2CJWA 2Q6TA 1FX0B 1UBFA 4EUNA 1NN1A 3I5XA 1MR3F 1SXJC 4QGHA 1ESNA 4XVUA 1OH8A 1E2EA 3L0OA 4IFEA 3CF6R 5FPHA 3TR5A 4D80A 1XZQA 2CDNA 4UNQA 5CK5A 2ZJ2A 1AKYA 2IUTA 1SVSA 3BH7A 4HLUA 2QQEA 4NYJR 3AVTA 3ZLJA 2ORVA 1N6PA 3TIFA 2NG1A 4Q1FA 1WRBA 3U3RA 1W0KD 4TMZA 2BDTA 3Q7PA 5AJVB 2J1LA 3PUWA 4DSOA 1UEJA 3NBZC 4DCTA 2PJRA 3S1AB 1GRQA 2G1JA 3CW2A 4G5QA 3ZD6A 2ZRJA 5J4KA 2B6HA 2ZRPA 4M1MA 3LDAA 3MWJA 1Z2AA 4KJZA 2ZI4A 3K70B 2IK8A 4F91B 1YZUA 2JIZA 4C9BA 2A5FA 2DFNA 2GJ8A 5L8VA 2ZRBA 2YKGA 3MJRA 2GESA 3QG5A 4WZAE 3DOFA 2BJVA 5JMTA 4DT1A 2XITA 4KLZA 4UNPA 4ZPXA 5EJEA 3TUZC 4Z8YA 4PQYA 5AJZA 1SKYB 1P6XA 1GRRA 1NLYA 2ZRNA 5JRJA 2I3BA 4PAQA 2PCJA 2O8FB 3OIUA 2ZU0C 2YZ2A 3CR8A 3QG1A 3H2YA 3B6EA 1Z0JA 2ZYTX 1XEXB 1P7CA 4RY2A 3EAQA 1RRGA 2FU5C 1A2KC 2GDJA 5JSZB 4NYMR 3GFPA 3LH5A 4K8OA 1KI3A 2WJGA 1DELA 3W3AA 1G19A 2QRNA 3GQBA 1G20E 2LKCA 2ZJYA 2RGNC 5KYKA 5F3WB 3ASYA 1MT0A 2Z43A 2ZE7A 5EP2A 1D9ZA 2CHGA 5KDLA 4KI0A 4Q02A 5HPYB 5J4YA 4A0HA 2DWOA 3NHBA 2IX3A 4E03A 1Q1BA 3A58B 5CYOA 4CF7A 4HLUC 1HURA 2BCJQ 2JLZA 2REOA 4P4SA 2BM1A 2OG2A 3B9QA 3B2EA 4A9AA 4TMWA 3NVAA 2I1QA 2OFOA 1SVIA 1T3SA 4DWJA 4YMWA 3OE7A 3RYTC 5DISB 1ONBA 1JR6A 2QTHA 1IJEA 2QE7A 3E5HA 1QVAA 5H68A 1IXZA 4ZKDA 3IDQA 3IPYA 1UKYA 3Q9LA 4OI4A 4BFYA 4W7SA 2YVUA 2D62A 1EFRA 3L8ZA 1QF9A 1YVDA 4B33A 3UMFA 4GZMA 3GLHE 3KTAB 2CL6X 3TQCA 3R8FA 3ND9A 4LJAA 1M34E 1XXHA 5IHPA 5BN3A 4PXAA 2ZVPX 4RD3A 5FOXA 4YONB 1EFHA 3OIVA 3VTKA 5FBVB 1Z28A 3AP3A 1G16A 4PAMA 2XB2A 1W49A 1I4LD
chains in the Genus database with same CATH superfamily
1U3UA 3UM9A 4MUMA 3KPYA 2UZ4A 5BR4A 2JA1A 1GUFA 1OXTA 5F3RA 1IDOA 2ZJ7A 4R0VA 2V6MA 2ETVA 1O96B 1V5GA 2CBXA 2QTMA 4WWHA 3WYEA 4DTIA 5AI6A 3QZUA 4DIDA 4CLXA 4AO7A 5JD5A 1N3IA 3NDPA 4IH4A 2RK6A 2Z04A 1E9DA 1L5OA 1RJEA 2REQB 5I7RA 2ZRLA 1MNQA 1Z0KA 1LSOA 3KLMX 5IH7A 5EUMA 2JJ2D 3NEYA 3L92A 5TJHA 2IZOA 4AXXA 3OH8A 2GPWA 4QIHA 2ATEA 1M67A 3ML1A 3SI7A 1FFSA 2PX3A 1G9SA 1E63A 4IOLA 4M36A 4XIIA 1QVWA 2H4WA 3UY4A 1RRCA 3Q5GA 2C95A 2O3RA 4BYGA 1U8EA 4I50B 3QF4B 2ID8A 4ER5A 4EF4A 3M6UA 1IEWA 1PZHA 1YR3A 1ACLA 2GRJA 1CD5A 3UFXA 4XQGA 5C0OE 2VYVD 4C0KA 3O4GA 2YWEA 1KP3A 3QKSA 1SBYA 3P2OA 4BVAA 2GVNA 3I2GA 3TTXA 1M0TA 1HLFA 1PCXA 3KRTA 2L82A 2FLWA 4BQEA 4EUKA 1VC2A 1N6LA 2JI7A 4QJ4A 3AEKA 3JQGB 1CC1S 1P7VA 1MO4A 4BFCA 1ZK0A 2ZJ6A 1Z6TA 5D3MB 5DNWA 4A8TA 4AJHA 4N41A 3U9TA 2WHQA 2H1IA 3PRJA 3WRXA 3S8YA 4F96A 1RLUA 2IH2A 1CJCA 4A26A 4EW2A 2D1QA 1SR8A 2D5BA 2MT9A 2QL5A 1H94A 3RSCA 1EE9A 1OXXK 2WKRA 1FPMA 2E6KA 3DONA 1N2SA 4TV9B 1RT9A 5E7IA 5TC4A 1FJ2A 3UT5A 4TM7A 2JFZA 2XMDA 3MMXA 2FPIB 3KAPA 3SVTA 2B2XA 3KZXA 1DP4A 3ONVA 1U0SY 3DEYX 4LXHA 1Y6ZA 5JDCA 2H48A 3DAGA 1CXZA 4TN5A 4CVNA 4ND8A 4RTSA 4WGFA 3IR7A 2Z2KA 3VAYA 5CHEA 1RCFA 4ISBA 1YB4A 2L18A 3PDUA 3F2VA 3T1QA 4L07A 4C0AC 4QSMA 4TTPA 1AF7A 1EX1A 5AW7A 4DCJA 3NBUA 3PICA 1Y6GA 1ECCA 4D0SA 5K0FA 2GH1A 4GPZA 5SY9A 3C16C 1NW9B 2UZ1A 2WLTA 3I1JA 3C7KA 2MSKA 4MJLA 3RHSA 3UJ6A 4AXBA 5MHTA 3JQBC 3G79A 4YJ3F 3RF6A 4C43A 1CZKA 4ZEMA 4B9AA 1B8UA 2HNBA 4KW7A 3GP8A 3T52A 4TS4A 2I7XA 4C7XA 3VHLB 4DQ0A 4IYJA 1TPYA 4XJXA 2ZVDA 3U4GA 3DP9A 4O5AA 4X93A 2KQUA 1KOFA 1FYWA 3VC7A 1BA2A 1PT8A 1EFPB 4CIAA 2VLIA 4I46A 3CCCA 4N5NA 3ND8A 1F14A 1N6IA 3NM4A 5H3HA 4V03A 5JISA 5MDHA 4G0PA 2H3HA 3C5HA 2QZZA 1FFBA 2B5OA 3NEAA 1KI8A 3TM5A 3E3AA 1JU3A 3ZS8A 5AIAA 3TX6A 3VU1A 4B9EA 4YRQA 5LQNA 3T5PA 1EVZA 4ONEA 1KP9A 4MWZA 4US1R 4GLOA 2X8JB 3R24A 3T7IA 2ODAA 4NZZA 4ENRA 3AR7A 4EATA 1BD4A 3EQ9A 5EKUA 5LPNA 1KFJB 4ZEXA 2IZ6A 4CMIA 1G3RA 5M3BA 4JL5A 1IULA 1GADO 3NAMA 3DVAA 2OSVA 3H04A 4GPEA 4LCBA 4UU1A 1ZCAA 3TAUA 2WQ6A 4OMDA 1R6AA 1D4OA 3BFXA 1UPBA 2XV1A 4IXMA 5EPUA 1U0OC 2IC5A 1K98A 2G80A 2NUAA 3P9YA 1IY1A 1E5VA 3QWHA 4R71A 1ABEA 1ZJYA 2PFKA 2QGZA 1X42A 1UAYA 3AWIA 4M22A 3UUEA 1LPMA 2NXNA 2IYUA 1TB4A 3ZY5A 3QTBA 1ZJ4A 2JK1A 3PDCA 1CYDA 2WWIA 3AP1A 3AK4A 4OL9A 1A82A 1NW3A 1BWPA 3I6BA 2ZYAA 4POAA 1QP8A 3KJFA 1M0SA 1XQVA 4FN5A 3QUQA 3OFJA 4V1CB 5LIPA 1JZQA 1ESMA 3KWLA 2CXTA 3KQMA 3LMKA 3D4BA 4J1TA 4A7PA 3TLJA 1RBQA 1BKDR 2ZPTX 3C39A 4ZAZA 2NAFA 3B78A 1SUIA 1QP7A 1SBNE 3SQDA 2J4FA 2OGTA 3QEJA 2ERYA 4QM7A 2PXHA 1SG9A 3EIHA 3I3OA 3AR3A 3EF3A 3ZWMA 5FOSA 3LL7A 4E13A 4TYWA 4EYKA 4M89A 4KODA 1S89A 4CTOA 1FQJA 5EHIA 4EB8A 3IV9A 1QIDA 1T9BA 2VAWA 1H3FA 4ZYUA 5BP7A 4FGKA 1G8SA 2ZT8A 4I1VA 4K9OA 3QPVA 4QASA 3RADC 1M0WA 3SZRA 1MT3A 2I71A 3KT0A 4Z1MD 3SAJA 4MAFA 1CUAA 2RJOA 4TZ0A 2YV2A 4UHCA 1TAUA 5J47A 1US8A 4Z7JA 5DE3A 4DCVA 2PGAA 4P7KA 3K4PA 4F3RA 4N6GA 3AHDA 2DB3A 4OQNA 1JKJB 3A1NA 1GPUA 2AN4A 1BOFA 3G8CA 4JMLA 2AVNA 4NBSA 3DO6A 4GSYA 2JFUA 3TNDA 3HXTA 3DPUA 1W94A 3QMPA 4F84A 3EC7A 4ZQBA 1E7WA 1POXA 3QE4A 4M1YA 2QD4A 3TQIA 4BATA 1S02A 3E9ZA 1S2NA 3L8YA 1KYIA 2CHVA 2R6FA 3NT5A 2AG1A 3GZ4A 4M7RA 1ULTA 2WJJA 3VKVA 3VPCA 3D0RA 4CF4A 4KMRA 1KFCB 2NUBA 3HKCB 4OQYA 4WCFB 4G2NA 3U7RA 2QRKA 1ZK4A 2BEUA 4CI9A 2HA0A 4M1OA 3GI1A 3NYWA 2BFBB 3RT9A 2R1UA 3HP1A 3GZJA 2C2HA 2YC2C 4KWIA 5DYWA 3QYFA 1K89A 2J48A 1QTIA 3KVRA 1RYHA 2XSZA 2ZJ0A 3RT7A 1FB5A 3WWOA 3HA5A 4RV9A 5C4MA 2XVYA 4R41A 4U2BA 3QOXA 3GMSA 3GD7A 3NX4A 1P1BA 2WVGA 3OHPA 2XYHA 4KXFB 4RJTA 3VOAA 1FS4A 3EVCA 4J1TC 1N7HA 1YA6A 1U3GA 3HDTA 4AMUA 1L5HB 1G9XA 1IY2A 3MVEA 3RAJA 1B6TA 3QE9Y 2WKWA 1Q6ZA 4BX3A 1A8HA 1G3QA 3RVLA 2X2PA 4CHTA 4QU8A 3U81A 1F06A 1H9CA 1MDFA 4JT4A 4HNVA 1JHOA 3BJMA 1N9ZA 3E22A 4PFJA 4DY4A 3R9WA 2XRMA 1A50B 3U40A 1XTIA 1FLNA 1M76A 1OFIA 2XUJA 2ZBFA 4HEA1 4IXDA 4JT9A 4UHHA 4XVCA 5LYJB 4OHYA 2JLBA 4IWYA 4GOOD 2SBTA 2ZT7A 3JSAA 4NZPA 4IGAA 1GGJA 3U7IA 1YVUA 2FZ4A 2IEIA 1GRNA 1EFAA 5CURA 4QVIA 1JSXA 4NBVA 5AW3A 5DN9A 3PQ3A 4O4IB 1VJTA 3G5AA 5E0OA 1LK7A 1JQLB 1PE0A 4QRIA 3CINA 2ZDQA 5F73A 4RMNA 3OE7D 3BFJA 4R16A 3PK0A 5F23A 2R2GA 4UAJA 3M6VA 4HNAB 1WPXA 2AQ8A 1D1TA 3LQKA 4ROSA 1P3DA 5UKDA 1MB9A 4TSFA 4O4LB 3USCS 3RYFA 4D9MA 5LQJA 2BHLA 1KORA 1GQ2A 1WABA 1RXIA 1TD9A 1ULUA 2MYTA 2RK4A 2WJHA 1USGA 2LP4Y 3BFVA 2BPOA 2DFKB 2YXNA 1AQLA 2Q0HA 3W1WA 2DECA 2H29A 4JP2A 3GRAA 1KYTA 1T9GS 3DW3X 4LZOA 2B36A 4JIMA 5BR7A 3TQQA 3HI4A 4WOJA 2P2GA 5LOVB 1QKKA 2D0IA 4CMEA 1F2TA 3EVEA 3ZDQA 3F8SA 4L1KA 1OYOA 2FFBA 5CVUA 1E6LA 1TU0A 3BGOS 3UAVA 2E21A 2Q1XA 2F67A 4BUJA 3CW9A 4FYJA 4K0KB 2Q6VA 4GBJA 2IBMA 2NZWA 3IUJA 4W1SA 1E62A 5CB8A 4HFMA 1G5RA 3AX6A 1RYZA 2W0SA 1ZD1A 3EZLA 4JI1B 3X1YA 1IG0A 2RG1A 1V8DA 3A25A 3GUUA 4MINA 1TRKA 2AQIA 2R8XA 3GH3A 4LZWA 2QJTA 4MQEB 4RXTA 3B82A 4OP1A 1CZNA 3RKUA 5J2TF 5A03A 8ATCA 1HX7A 1HLGA 1R18A 1DEKA 4FCVA 2CFCA 1J1IA 3MS4A 4DMHA 1Z37A 2B25A 4D74A 3H9EO 4D41A 4X85A 1RABA 1A9YA 1JDJA 1CR1A 2WTUA 1IAVA 4R9NA 4H1TA 4F97A 4ZDWA 3QU7A 5C4IA 4XYMA 3RQSA 1EP3B 3WXMA 2AL7A 2DZDA 4KVAA 1OC4A 3KR1A 2HRQA 3SS9X 1G59A 2NP7A 4PC1A 4W9NA 1RAHA 5F21A 1P4RA 4BWFB 4YJ2B 1LWOA 2VWQA 5LL6P 1WPQA 4GD3Q 3COZA 5AW9A 1U0FA 7ADHA 5JJBA 1VFNA 3AC0A 2Q3BA 1CHDA 1RIFA 2QR5A 2OL4A 4KQFA 3RFFA 1VG9B 4W7IA 4ZAGA 2C9OA 1K2WA 4E5NA 2YOHA 4PIPA 3L05A 4E5DA 2OECA 2VC2B 2CXPA 1HT2E 2OD7A 4PNPA 1PFWA 1NONA 1G21A 3LRPA 2HPZA 5CB4B 4EB6B 1RQLA 1TO2E 4I1OA 4W5QA 1XPRA 1QKJA 2IHNA 3I6IA 1CUGA 1YD7A 1NVVR 4MITA 4O2AB 1XZEA 1UQUA 4YTEA 5TVKA 3JCZA 3SR0A 3OTGA 4OK6A 2PJZA 2C3MA 2Y77A 1E92A 1YMUA 1JFFA 1X7HA 1K9VF 3A7DA 3OHMA 4BEJA 4BN5A 3DD1A 3D6UA 3ZY6A 1FLDA 1TZKA 2FPWA 2O2XA 2RI1A 5ALKA 1IIBA 2JGEA 5K0GA 1Y9AA 2A78A 5EG5A 1CRPA 3IGFA 2I2WA 2X0RA 2FR0A 4U1RA 3R7NA 4AECA 4D8VA 2DHRA 1EK2A 2NVUA 5K51A 2XCRB 1T1SA 3IB3A 2CV0A 2WFLA 1DUIA 3D6HA 1FJGB 3MS7A 1LW7A 4O1MA 2I3DA 4LV5B 3PXCX 2BE7A 5DGCA 3AL3A 3DCJA 5FHQA 1AXEA 2NXCA 1S2GA 3SJAA 1EXNA 1A69A 2FE4A 2YZMA 4DGSA 4JC4A 4MV4A 3DL7A 1CWUA 2B69A 3BB1A 4REMA 4ZO6A 1GTMA 3FPSA 2QZ4A 4E70A 3T12A 2H2GA 1U9CA 2RHTA 2K6GA 4HSGA 4RK7A 4XD2A 3THSA 3T3HA 3QYPA 4HPJB 2Q99A 3QI2A 4GGPA 4KQWA 4OP3A 5CUQA 4Q3BA 3VR5A 1Q7TA 2IYLD 1P6QA 3NHPA 1IB0A 5ALTA 4PV7A 1Q91A 4IS2A 4KLCA 4FYYA 3EX7C 4BE9A 3I39X 1R0RE 1Z4NA 2FQYA 1GGEA 3BRCA 3EHEA 1R6TA 2WUWE 1M2GA 3G0GA 3N86A 3QVJA 4LOAA 3CX3A 2QL7A 4RMHA 3IPCA 3VOTA 3J80A 1T0IA 2ZXFA 3THOA 5JQWA 2FMTA 3OAAA 2JFVA 2FEKA 1FY2A 5EHNA 5H59A 1KA9H 3W6NA 3KLPX 4J7UA 1C50A 3QITA 2QTWB 4YY3B 3CVXA 2I4RA 2IYWA 4OFBA 4RLHA 2EFJA 1ADYA 1CRWG 1J56A 4QQNA 1L5MA 2DFPA 3H9UA 4OQ4A 1C9KA 1WSBA 1ZRMA 5BSMA 3R0ZA 1VJ5A 2JB9A 2QUBA 2R6R1 4KUGA 3O8QB 4YIHA 1RAGA 3W8EA 2JVIA 3THXB 3IRVA 3KQYA 2ZIEA 3WMRA 3WV5A 2EV9A 1MXHA 5AKYA 2ONKA 5B4UA 1TAQA 4OXKA 4TN1A 5DBFA 3OTWA 1UXKA 4Y1RB 1DAHA 1FLAA 2VUHB 2X6TA 2H5IA 1VL0A 5E6SB 2FXIA 5BW8A 5FJJA 4G1UC 1E9CA 8LDHA 2O54A 1MV8A 2QUKA 2QY9A 1BW9A 1KC3A 2W2QA 3AR8A 4ZGWA 2WJ3A 2QX7A 3B6KA 3I0ZA 3LXMA 1MENA 1KZ6A 1VQ1A 3ADBA 3WP0A 2NO9A 4QLAA 4TWBA 4OX9Y 3GRPA 4RHEA 5BNZA 4M21A 2IQ5A 1C3JA 1JQEA 3PP8A 4JOSA 3BOSA 1D07A 4A0QA 4MVJH 4CIYA 2YIJA 3K6SB 1ZGJA 3RFVA 2CB9A 2D5AA 4Q19A 2CHQA 2HHLA 3VZDA 1DRKA 1S9DA 4MDEA 5LP6C 5ABPA 5AO9A 4N0PA 1IONA 2HJVA 4K6CA 3ZWPA 2WJVA 3MCZA 4IY1A 2K7ZA 4L75A 3GCDA 1H6CA 5FLKA 1RQ2A 4MYHA 3NATA 4WN9A 4DEYA 4HADA 1N8NA 4AKEA 5IXSA 1DAFA 3CPSA 3TOXA 5IKXA 3FZGA 3WICA 3UJCA 5DB4A 1CNFA 2QYTA 3B53X 2QP9X 3X1XA 1ZUIA 1AGRA 1V9LA 2HQSA 1QHNA 4B3FX 1ZWLA 4NRDA 5G4LA 2A92A 3RTCA 4JA0A 2OILA 2GTIA 4RVSA 4ESVA 1E9EA 1PIWA 2CEAA 5DK4A 3OQ6A 1CDZA 2DR0A 2XRYA 4F2PA 3DOCA 1JMYA 4QRDA 4RORA 1GCAA 3K0SA 4LKRA 1OA0A 2R87A 4XFDA 1ODTC 3JRXA 2BZ0A 2I4MA 3RTAA 4G85A 2GCOA 3TE7A 4X20B 2XZPA 2HHCA 1GPAA 2X2FA 2ZJBA 3I5AA 3OLVA 5JNVA 3L04A 4ACAA 1YZLA 3EXFB 2AFIB 4YLYA 4F9EA 2COEA 4IJUA 2VRBA 3RYIA 4J0FA 4B4DA 1SQSA 4MV3A 4BFWA 3EA5A 2VWPA 3AETB 1C4KA 3D59A 1JG1A 2HCTA 3G8AA 3RANA 2HRRA 3TIXB 5JYDA 3WB1A 5KOIA 1JQDA 3W7AA 4AQDA 1FFAA 2XSZD 4JV5B 1IWOA 1U0JA 3S2YA 4EJSA 3UK1A 4BRSA 3FIUA 1XU4A 2PNJA 4OKNA 2G82A 5FPPA 5K7SA 2CV1A 5E4TA 3ZWAA 4AQ7A 6REQB 1J2TA 3OZVA 4WK4B 4DUYB 2XB8A 3MA0A 3V34A 2O5VA 3PHHA 3LKBA 4NHEA 2JIBA 2GZMA 4Y6LA 4S0ZA 4OP2A 3DD5A 1PR9A 1EFUA 1AXRA 3NTUA 3UGTA 5A1JA 3T1NA 4PHHA 3OJXA 5FNZA 3H87A 3H9GA 2FWRA 4B7AA 1R6UA 1JHXA 2VHYA 4UD6A 3T15A 1RRMA 2HNAA 3RJ5A 2GA9A 5IEJA 4FM9A 1E77A 4M38A 1HDIA 1VIAA 2QLFA 4J2HA 2GM3A 4MUIA 5B7QA 1OI3A 1SBHA 4BB5A 2EC5A 1BH2A 2P6NA 2P9TA 3FZYA 3IOYA 4J3FA 4KX5A 5A7GA 3JWPA 4DDMA 3O8LA 4GQAA 4CKXA 1GIAA 5CLQA 1GSAA 4RQAA 4WK6A 4FE3A 2DUUA 3A28A 2B0CA 5FB3A 2KLBA 3W77A 3DB1A 2XWQA 1X7XA 1WB6A 4RZXA 3C4VA 3LZ6A 4AIIA 5CJJA 3KB6A 3B3AA 5B6JA 1QU3A 1CV2A 3ESYA 4O4JA 1YK0A 3VYRB 5DM60 5EQJB 3K0FB 2GOYA 4HH4A 4CKWB 3BQ9A 3UAWA 3LVQE 3P2KA 3UB2A 4C4ZA 4MMYB 3TX2A 2FWIA 1PUJA 1I1NA 1T25A 3LQRA 3LKDA 2PKXA 1YC5A 3WDKA 1U1FA 4A0FA 4TSFD 4P32A 1B8VA 2JIDA 5EE1A 3TR6A 4F04A 2WUDA 3G2QA 3EIWA 2N1BA 4DA0A 3QM1A 4ENTA 1P2GA 5J1TB 1TE2A 2J9XB 5LZ7A 5DNYB 2IX9A 1RKXA 1Y5MA 3EMBA 3S29A 5KX5F 2ZCUA 4B73A 4TQGA 1P1FA 4HN2A 4RHFA 4U2GA 3FPJA 3PXAA 2ID7A 4HGNA 3UC5A 3PR3A 2C7GA 3I9FA 4OKIA 3DYVA 5MN4A 3GLFA 4RHYA 3GFOA 2VSNA 5HF9A 2FFQA 2W4MA 3FNQA 1QFJA 3HC7A 3QA9A 5LQMA 1GNLA 2DHQA 4DARA 2FDRA 2H7YA 2CJYA 2X22A 4EPTA 3IIMA 5B57C 1G2PA 1WW2A 1XZ8A 3OZDA 4B47A 5KYWB 1VA5A 3L0YA 3ZZ1A 4C05A 2NYUA 1F7VA 4RBNA 3PEYA 1N8SA 3ZU3A 5CYGA 4M55A 1H1TA 4P83A 1Y6JA 1X39A 4P4LA 3FTCA 5DCYA 3GLHA 1LW6E 1NJ2A 3ZVLA 4K9NA 1M34A 5G0WA 4MQLA 4GAEA 2OPBA 1BXGA 1L7AA 4DC9A 1J4AA 2ZWMA 3WDLA 2PUBA 3PIRA 1HOTA 2YWRA 3X2EA 2CCKA 3WG9A 3CUKA 2PZ8A 3NAZA 1T36B 4FSDA 1EFVA 4LXUA 4NVRA 1K97A 3G02A 2RAUA 5HCNA 4EAQA 2GTHA 5K20A 1M9NA 4GH5A 3GLRA 3ZHTA 3MWDA 1V6AA 5H70A 5EXSA 2JHCA 1WQ4A 4RDIA 1NLUA 3QVGB 1EVLA 1CB0A 2I2AA 2R6JA 3OLWA 1CY0A 1ZL2A 2R48A 2H1HA 3DEKA 1HQCA 1QC5A 1M7GA 3LUFA 4M88A 4AZ0A 3DSRA 4WY5A 2P0YA 3WMXA 1KRXA 1MZVA 1E1YA 1B6SA 1C8KA 4L8VA 1XOIA 4L76A 2J9ZB 3UOWA 4DDHA 3ZV6A 4L7VA 1QCCA 2RBKA 3OC0A 4XSGA 4DRYA 4DHWA 2HPHA 2I65A 3IP5A 1WZNA 3I5XA 2XB4A 1T3HA 1HE3A 5JZVA 4LRYA 1SD2A 1E2LA 4WXPA 5B30A 4K87A 4MHSA 2MSCB 4XDHA 3H3XA 2LUOA 4UZSA 1WF3A 2H65A 1KH1A 3EUAA 1NA5A 3O26A 2J0QA 5FUBA 1NG1A 4Q3OA 3WL7A 4L5IA 5DGTA 1OUMA 2AW5A 1SHUX 2PR7A 3TXAA 3BFKA 5ARDA 4D4KA 3FLAA 1VRWA 2DSTA 1NFFA 1WXDA 2J3JA 3NFRA 3NP7A 4FKZA 4Z49A 2OT3B 4Q21A 4NCBA 2RB5A 3IVAA 1BCSA 2AXNA 3GLUA 3RYHA 2CKDA 1WZCA 5HIAA 4LRWA 1QE0A 5JSYA 3JQFC 1TKBA 2G1KA 3DLCA 3TSOA 3P96A 5JV5A 3UA4A 3CUSA 3CY6A 2BRUA 4QDUA 4HKTA 1E2JA 2RJNA 1DAKA 4LVUA 3WMGA 3HZOA 4OD0A 5AQEA 1TZJA 1U7ZA 4LF4B 2FRDA 4RM2A 2MSDB 3PITA 2B4YA 4ZU3A 1R4ZA 3R9XA 2A9QA 2DOKA 2QD1A 4DGQA 3TMKA 2CUNA 4D8UA 2MINB 3V9PA 4DVGA 1BVHA 1YZTA 1XDZA 4W5JA 1Z38A 2VHTA 1EYZA 1AUPA 5ESWA 4YJFA 2PLNA 3K96A 4ALIA 1M6VA 3UUFA 1RI2A 3KYBA 3VR5D 4UQLA 4ARZB 5KSZA 1TZ2A 2PXCA 4QBFA 1QQBA 1K68A 1LV8A 2R1ZA 2VJBA 5TMDA 4H15A 2R96A 1GDHA 2J45A 1T5SA 4JODA 1HNZB 1VHTA 3GN1A 2CMFA 4S2EA 3KDAA 5CVTA 1FZTA 4TRMA 3MGBA 2DQKA 5F51A 4K6MA 2OUKA 3OAAD 1IBSA 2QEQA 1X87A 4QOFA 4LSWA 4Y6GB 2IE8A 1QHEA 3GYGA 3RBAA 1ZLYA 4J6EA 2Z6VA 2XNHA 2H85A 3LKVA 4NU6A 1QFXA 4AYXA 1QOPB 1FIUA 2GD0A 3NV7A 3OG9A 4ZAVA 1FFHA 5E6UA 1P0CA 5I7WA 1S8AA 4BLVA 3H4MA 5JLJA 4AF8A 3QP9A 4BNTA 3H84A 3T9CA 4XJSA 1HSZA 4AJEA 1DT5A 2DT5A 3FAZA 1SJ9A 3ZHZA 1KEEA 2P5SA 1S4QA 1R4MB 1WOYA 2FEOA 2WA1A 3DZ8A 1AA6A 1OI7A 2DXIA 4RJLA 1D4AA 1W29A 2FR8A 1REQA 3GT0A 5ICFA 4D46A 4XFKA 5EMMA 3ZJ5A 3N3AC 4B74A 2X6RA 1DE0A 2NSJA 2VNJA 3FMFA 4JU9A 4U7DA 4YCLA 3LRTA 1CNMA 3CJTA 1BX0A 3EMVA 4OJQA 5EMLA 3SBOA 3VU9B 1MAHA 4DMFA 5TMPA 1L7NA 3KQNA 1ENZA 2BFEA 2HQRA 5FQOA 1J07A 1R66A 4QLBA 5IJ0B 1P4GA 1M1YE 1U8FO 2B4RO 1KO8A 3R44A 4PTZA 2TMGA 1VKZA 1SKMA 1N0WA 2HIMA 4CEIB 4QFBA 1F0NA 2FRDC 3K1ZA 4KIUA 4KSCA 2PU7A 4QNRA 2BKAA 4JGBA 1GNTA 1K8YB 3I1IA 2XB9A 4CKBA 3BE4A 4JBGA 3M3PA 3EA0A 4MA4A 5K8JB 3E4CA 1TLLA 3UWSA 2XTJA 1E1RA 1MC1A 3KYDB 3TWOA 1M6HA 3QBJA 2RGYA 1UFOA 1WXEA 3JZIA 4KL8S 4OGFA 5F4BA 3AHJA 3ZXSA 3FNGA 3ECCA 4FKBA 4MYCA 1YIAA 4EENA 5CA1A 1ZHFA 3TK1A 4J91A 5TXGA 4XJTA 5DLDA 1IK4A 3FCYA 3TLKA 3VC2A 4CODB 3CVVA 2J8ZA 4J9UE 1FP6A 2ATVA 2RGAA 3NT4A 5KNLA 2FSPA 4UMVA 2V8OA 4MR8A 2AMLA 3FFBA 4G0QA 1F8YA 4WCDA 1OLXA 2A33A 1NXPA 4AU1A 3M1YA 4F4DA 4FYMA 2C3PA 2GXAA 7ABPA 3PQ4A 4HVTA 3FWZA 2FPSA 2YWDA 4FNMA 3ZWVA 4DQUA 3KKQA 3LP6A 1MJHA 4FJ2A 1NF9A 2CUTA 1KJIA 2E55A 2GXQA 2JGDA 3UTDA 1LS6A 2C59A 3LDFA 4G86A 4NDNE 4V0LA 2QSYA 1NNUA 3OZFA 2YOGA 4FDMA 1XZDA 4MRSA 5ALZA 5DYGA 3Q3HA 1MJ5A 5ELLA 3CM0A 1XD8A 5BSUA 2RHHA 5EP4A 3UJNA 5B2EA 7YASA 2DR3A 1YZGA 4KRXA 1KDOA 2VF8A 1EIZA 2JAQA 1NVMB 4EOGA 1KRHA 3M2TA 3PIIA 1P5FA 10MHA 1FDOA 3QPAA 2VJYA 1T6NA 4Y2PA 1LLFA 3B6JA 4ZCQA 3V32A 4FXOA 1R0BA 2WUGA 3OTHA 2LDXA 3LJKA 4GI3A 4HWRA 2DTDA 4K81B 4WASA 3ETGA 1RWKA 3PL1A 3SF8A 3ZY4A 3MMPA 2VJDA 2RHWA 3DZKA 5HMMA 1A72A 3UIEA 3H6GA 2HIAA 2PBRA 3O31A 2EEPA 1ZINA 4LGMA 3UV3A 4AP9A 4W5NA 4WJZA 1IUNA 4DWVA 2BFFB 2QLBA 3JVEA 3EIFA 1BE8A 4J0HA 1VKOA 4EKGA 3FPHA 2QRMA 3RE1A 3W5IA 2GLUA 2Q6OA 4BO8A 5GAJA 1T8RA 4IKEA 3S1AA 3TVYA 2OKGA 5AUQA 3NOVA 1RI5A 1R8JA 2CJWB 1FL9A 2PSHA 2QXTA 4TTSA 1LRLA 2NMVA 4WFQA 2WM9B 3IDZA 2Q28A 2NX2A 5CVJA 1F5SA 2YVQA 1NI5A 1RZ3A 2UVPA 2Q5IA 3BMNA 3LGSA 4JXKA 4PLPA 4UVDA 4DCSA 5A62A 4P5DA 4KWHA 1XQYA 4TLMB 1R0XA 2TS1A 2X1MA 4QOIA 3ZGYA 2IXTA 2CL7X 3U5ZB 4Z7NB 1KVRA 3VDXA 5KREA 1PQPA 3K2BA 5CPFA 3VGPA 4D4IA 1TO1E 1R0YA 3EZ2A 1C2TA 2P79A 1BEZA 1ELOA 2FJPA 4GLFA 3I2JA 3AQ4A 4GPTA 2I4IA 1GPYA 4XVRA 3SZUA 3NHRA 2JCGA 2V7BA 4KLAA 4F2GA 5JJKA 1GZ6A 1S2OA 3DR3A 1V0JA 1QKIA 4CUZA 3I2YX 4BO2A 2JGMA 3AESA 1LU9A 1XCBA 4FB4A 3PNLA 3EYWA 3DV0A 1XEXA 3GA5A 4DF3A 3ILVA 3N5KA 3P5SA 2IL1A 1KYWA 3ZR4B 2BGGA 3ERCA 1JXOA 4E32A 2VXBA 3ZJTA 3L79A 1EWKA 1C1XB 4C0XA 1LLDA 5BOVA 2PM8A 4K46A 3AFMA 3N2NA 2D1TA 4O63O 3OQOA 2Q0QA 1QOZA 2M1ZA 2OHIA 3U09A 1KK0A 4QXPA 1EH5A 1UPTA 4DMKA 3IP1A 5GIPE 3CNHA 1WDTA 4BNDA 4G63A 3QU2A 4QWMA 4TXJA 5B2ZA 4PPQA 3JQAB 1W96A 1R4NA 1D8TA 5JAMA 3LUKA 4RH0A 3ZZUA 3U7HB 3LDHA 1JE1A 2YTZA 1ADCA 2BONA 4PC7A 3U31A 2ESRA 4YMHA 1QR2A 3CLSD 4FX5A 2B78A 5K3AA 5L7YA 3H5AA 1XTTA 3K94A 1O08A 4AKTA 4NECA 3GAFA 1SXHA 2A1TR 3GVPA 2KI5A 3Q72A 3T41A 4BTLA 3DW1X 3KKEA 1ZVVA 1SQ5A 4REQA 4ER6A 4CUJA 2WW8A 4U7TB 3TZBA 4ASUA 4NH0A 2HJ9A 4UE6A 3VDRA 1YFJA 1EVJA 1RYDA 2GRAA 4J4BA 5KSPA 3QELB 4D6XA 4IQFA 1L7OA 4DA7A 1LX7A 2YRFA 3B1WA 4O4HF 3FCEA 4BO3A 2UVQA 3QU9A 5ILQA 3DV2A 1NSYA 4J0IA 3DKPA 1KDRA 4MYSA 4PM4A 4B3DA 1CVLA 3IO5A 1YGYA 3L8MA 4BDSA 4D3ZA 5FNVA 1Q3HA 2RI6A 3B7WA 4YLEA 1PFGA 4WY8A 3RODA 1QBGA 1G8JA 2W93A 3EIQA 2C77A 3VYTB 4ZJUA 2P5YA 4WKNA 3SJCA 3QA3E 4FMDF 4GIBA 3MHPA 3FKQA 3AEUB 4LSMA 5F7XA 2O7RA 5F35A 5GINE 1M5UA 5JJIA 1R7RA 3Q87B 3S55A 1TA4A 2CJPA 4LC0A 4PLVA 3UWMA 1GGVA 5C5CA 4HHEA 1XLUA 3ZDYB 4CQNA 1B26A 1M1XB 2A35A 3AWDA 4NONA 4O2RA 4R8RA 1ZJ5A 1NU6A 1AB5A 1KS9A 3I5YA 4TWJA 2I9KA 4CQMB 1VSBA 4GPAA 1RE1A 1ILWA 2X0NA 4OHXA 4BNZA 3DAOA 2REQA 3C1TA 4LZZA 1YRLA 4M1EA 3CLHA 1OFGA 5HILA 4ZXFA 2QZSA 3N2KB 3K7EA 2H08A 3JXEA 3TN7A 4V24A 4ZZ1A 3U7FB 1XVAA 2OQRA 4CTMA 3D8BA 5FXMA 1UFKA 3L43A 2KPOA 1A8SA 3PNMA 4HYTA 4TX1A 2NTEA 3CV3A 1Z6PA 5DRYA 1QO9A 4OAOA 3QOWA 2G9QA 1UJ2A 2C2MA 4XPIB 4Y7DA 3T7CA 1QG4A 4W5RA 4I50A 3QF4A 3UHJA 1P7WA 3WIOA 4FGLA 5B36A 3FZQA 2YXLA 1NYTA 1PJ4A 2DUWA 1U9IA 2I5PO 4BZPA 1L9XA 1V6CA 2TRSB 3ESRA 1NM5A 3UMVA 3UAOA 4Z9AA 5BN5B 2WEKA 3INTA 5DHSA 5K3DA 2QT9A 2CWDA 4Q7JB 2XUPA 2BAGA 2I87A 3JQGA 2VH5R 1XYVA 2AKAB 1YE3A 2ZKIA 2HJSA 4PLWA 4DMGA 5AUPB 3DB2A 5D3MA 4JCCA 4BGDA 4IAOA 1FUYB 3OZGA 1XZFA 2HF7A 2PIDA 3HY6A 3OOYA 3TUIC 3MB5A 4HGQA 2OZEA 1KAOA 3I58A 2P77A 4ENVA 1D2MA 3P9SA 5EQDA 2FMKA 4AL4A 4TV9A 1KH2A 3NMUF 3MT9A 3AGQA 2HY7A 5LZ5A 1MQ9A 1ABFA 2QJWA 3Q8MA 1Y4AE 1HDXA 1T2DA 2FPIA 1CRLA 1VSQA 1K27A 1U8AA 1YBMA 2E5WA 2YWBA 4MQ4A 2EGGA 4UMFA 1YB7A 4ZIRB 2C7RA 2AKEA 1WE2A 2WFAA 1A8QA 5EKSA 4M9ZA 3FWPA 3OUZA 1JVSA 3W9YA 2HQBA 2X4LA 1B1AA 2BY4A 2DQYA 4HDMB 3GCZA 5E4JA 4OA8A 3OJEA 1MUUA 2OAQ1 3JATB 4JLAA 4L4ZA 1ZNQO 1FFDA 4MQBA 4DRZA 5DLQC 1XD2B 4HEQA 2XOKA 5BRNA 2X7XA 1NUAA 2YIMA 3KQKA 5BUCA 2D06A 2IU4A 2R6CA 3OPMA 2VHVA 3PHJA 3F97A 1LCIA 5KU7A 1HT1E 1XZJA 3K5WA 4MB6A 3L8FA 1JR4A 3N6XA 4L22A 4OSPA 4Q48A 3THYB 2VBIA 3BWBA 4UARA 1UH5A 3F6SA 2VLBA 4U4AA 3TDMA 2F17A 3BFPA 1EFPA 1U7DA 1IAQA 1Z15A 2Q1YA 4YUAA 1J0BA 1VMKA 1SKQA 4JUDX 1Z2DA 2A3RA 4KR7A 2IYYA 2YFYA 3OBBA 1NW5A 2Y92A 2B7CA 1V4VA 3HEAA 3RGGA 2PMFA 4ES6A 2AN9A 3N53A 2XGJA 2FSUA 2YZNA 5HJ5A 3ACDA 1U81A 1FFCA 2WAMA 1UJ4A 1W581 2IXFA 3DP7A 3QKUA 3KCQA 2X8JA 4H7IA 5K05A 5FUYA 4A3SA 3JTEA 2HSZA 3FVVA 1XTVA 2QYOA 1NM5C 1JE0A 3BGSA 3HPQA 3P1JA 2NNWB 1L7RA 2RC5A 1P7PA 3D02A 1HQYE 1XJ5A 4M1KA 4BAZA 4JBYA 3H5OA 1X74A 1NLZA 2ZBRA 3JYQA 2VQFB 3ENNA 4NPHA 4PYRA 4HUTA 1KETA 1NW4A 3KKKA 3OEEA 3USES 6NULA 1GNVA 3LV8A 5A6VA 5JWHA 1E1RD 1P7YA 3DE2X 5GGYA 1N92A 1NL3A 1M1ZA 1C7EA 4Z1OA 3GJ0A 3OKCA 3GUCA 1DT3A 1KSJA 2ODEA 2FUG6 4NSNA 4QHTA 1IUOA 1XVLA 2P69A 4KVZA 4TTVA 5GGXA 3NC0C 2IXAA 3B5JA 2EJUA 1LDGA 3DZGA 3U2QA 1AUXA 1Y9EA 1P77A 3MAJA 5IARA 2DULA 3Q8XB 3VDMA 4LKOA 4C21A 3LFTA 3FDIA 2B7BA 4OYYA 1GPDG 1W2WB 1CSEE 2W6IA 3PHIA 5BSFA 4V1CA 4ALNA 2XXBA 5U9CA 1CUSA 2VJCA 1A5AB 3H83A 4Y7CA 1ZBDA 4DNQA 2ZIVB 3DULA 3H97A 3M1AA 1NDHA 3LPLA 4EVIA 2ZI9A 4QPPA 3RS5A 1H1DA 3AYZB 3I52A 5LMNB 4L51A 5I4CA 3HXKA 4DUPA 1YOBA 1KOJA 4DV0B 1LDEA 2D2FA 4NNPA 4OIFA 1TT5B 4V02A 3T0GA 5BMVF 4D3FA 2VHZA 4R2KA 1AUOA 3SGLA 4C87A 3EPLA 1XNQB 3WL3A 4CF3A 4WX2B 1KJZA 2QI9C 1I5OA 3HO6A 4H31A 4J7CA 3RAEC 2D0DA 1SU4A 4CTJA 2PHZA 3IA2A 1V8FA 2QN8A 3V1NA 3IAS1 1JKJA 4D9IA 4Q39A 2QT0A 5CYPA 3B38A 3AUTA 4EQ6B 2C4TA 1JLSA 2Z5VA 1G8KA 3H9CA 4R69A 2B1RA 2QAGC 4D25A 2YHUA 3PCRB 1ZY2A 3IDAA 5AVYA 3SHOA 2XLCA 4CL0A 5FUQA 1YR2A