3CKLA

Crystal structure of human cytosolic sulfotransferase sult1b1 in complex with pap and resveratrol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
289
Chain Sequence
DILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLGRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase family cytosolic 1B member 1
total genus 101
structure length 289
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2008-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cklA00
4KVGA 3VR6A 3VR3A 4FWTA 2CCJA 3IPYA 2EYUA 3QNUA 1Y3AA 4FCTA 4Q48A 3FHOA 2ASEA 2ZTSA 2QAGA 1NIJA 3KUCA 4ASUA 3K09C 4QGHA 4B3GA 2ZU0C 3THYA 4DLZA 3MWKA 1G21E 2RGNA 3CUEF 3AP2A 4D2IA 3TQFA 4LJYA 2VP0A 1R0XA 2YJTD 2OG2A 2NO0A 1FW6A 3UG6A 2ZYTX 2G83A 4DCNA 5AJWA 1E1QD 4ZCLA 1R6BX 1E2NA 3NDPA 5FI0B 1SKYB 1L8QA 1DELA 1HT2E 1ZC3A 5FTMA 4CGZA 2PZFA 5EXTA 2H92A 3QQ5A 4UJ3A 4PZZA 3X1XA 4CF7A 1Z0IA 5FBQB 2C96A 4HDQB 3LQRA 3IQWA 5CK4A 1M6NA 3RHFA 4C0JA 5HE9A 3RS4A 3X1YA 3TBKA 4KODA 4Y0AA 1S1CA 3A1SA 3B6EA 4WZBE 3IIMA 1BMFA 1YR8A 2V4ZA 5KNCA 1MRNA 1CLUA 2OAP1 2XJ4A 5EP4A 3G0HA 4QHYA 4KFTA 1W0JA 1GIAA 1KGDA 1J70A 1G41A 1TU3A 1VCOA 1W46A 3CRVA 4HAVA 4MYTA 1RJ9B 2WHXA 1Y63A 1TF7A 5JEDA 4TMWA 2BOVA 4NMMA 2DY1A 3QXXA 1WQ1R 1F2UB 5FTJA 2IF2A 2J7PA 1L4YA 3BC1A 3NG1A 2BJWA 4TWZA 521PA 3TE6A 2EFCB 3QKTA 3VKGA 2ZI9A 4AKGA 5C46F 4UJ5A 2F1HA 3FYHA 2W0MA 1LTQA 2PMKA 4FMCB 4A9AA 5SZHB 1RE0A 3K0EA 4NBSA 3UMRA 1M8PA 2QAGC 1BS1A 1II8A 2QPTA 1SXJA 2WIAA 4TMKA 3TW8B 4F92B 5JJLA 4XOIA 4EUNA 2EFDB 4KBGA 2QI9C 2IL1A 1II9A 1UM8A 2LCFA 2WWIA 3A4LA 5LB4A 1TAGA 1D9XA 1Z8FA 1XPOA 2ZE8A 5FOWA 4JLNA 5EP1A 3U44B 3K0FA 3LWNA 3P27A 5HTKA 1QHGA 4YDSA 2CHQA 2AWOA 4BLQA 4JL5A 2N46A 1DAEA 1IN7A 1X1SA 2QE7D 3EARA 5DLQC 1UAAA 1EFTA 1OT3A 2D7DA 4IFEA 2N42A 5LBIA 5JWOA 3ZVRA 2W6ID 1IOZA 3U3RA 1ZU5A 2QMEA 4M1YA 4MYCA 1ZM2A 2O8BB 1NLYA 4W9MC 1OSNA 1E0JA 4Q9KA 1NG9A 1NY5A 4OQFA 4DEYA 1KI1A 4RD3A 3OIUA 4NCIA 3LX5A 4CRWB 1KY3A 2XB2A 1BO6A 1S2MA 2XNSA 2ZRNA 3GLHE 4KBFA 5FL3A 1R2QA 1ZRHA 2ZUCA 2WJGA 2RHDA 5FBWB 4Q9LA 2XTZA 3QPVA 5KPDA 5CK5A 4AYWA 2YVUA 3H84A 3EWSA 1JI0A 2BVNA 1ZNWA 2AK3A 4EPRA 1E3MA 3FMIA 2V1UA 3ZH9B 3LXXA 2C99A 1BH2A 1TEXA 3E70C 3WY9A 1ZAKA 1ZP6A 2K5UA 3L0OA 4M9ZA 3E5HA 3AVXA 4TT3D 3W6NA 2AKYA 1E2FA 4HB4A 3BWDD 4HDOB 4NP6A 3NH6A 1RRFA 3CR7A 2O8DB 2PCJA 3A1WA 3AKCA 4DIDA 4IDNA 3JZAA 1YZNA 1U90A 1AZSC 1KK2A 2X8AA 3T5GA 1W4CA 1X8KA 2ZRCA 4PX9A 2PT5A 4NE2A 3RYTC 1N6IA 3AGQA 1PUJA 3UWOA 3R7WB 2AR7A 3O8RA 4G5SA 3FB4A 2FEMA 5DHFA 1DAHA 4F93B 1TF2A 1A1VA 2WWYA 5K8UA 4DCVA 2ZJ2A 5A0FA 2NG1A 4Q7JB 2IHBA 3EG5A 4M1SA 4OK6A 4TL8A 4B73A 4V0ME 1U0HC 3JVVA 2ZYUX 2GDJA 3B8HA 2VL7A 3KXLA 2QGZA 3REGA 3CB4A 3I8SA 4BECA 4DLUA 1G6OA 1NMYA 4FI3C 2ZVPX 3ZVMA 1JPNA 4HUTA 1W0KD 3JVUA 4WIAA 4MRNA 4IXNA 4B71A 1VG0B 4DLVA 3N5CA 5EE0A 2DBYA 1FNNA 1U9IA 5JWHA 1KSFX 2X2FA 3GLIA 5LD2B 1UF9A 5JS7A 1ZBDA 5KNBA 1KSHA 2B7BA 1Z6XA 1P9RA 3GLIB 3HU1A 3RLFA 1YR9A 4Q1FA 4D4KA 3OEHA 4IXMA 1JNYA 1R5NA 2E87A 1NBME 4HAXA 3SJZA 1KI6A 5TV2A 3W90A 2NO7A 1MO4A 1MABA 3AF3A 1XTQA 1IN5A 2PZGA 1XEWX 5HPYB 1NY6A 3BB4A 4MH0R 4YONB 3LO5A 2O8FB 1LF5A 4QL3A 5EXSA 3BXZA 2NGRA 1D2EA 1NVWQ 4L9WA 4UXIA 1W36B 4B47A 2AX4A 1X8JA 2GRJA 3KTAA 2ZETA 1KJYA 2WJJA 1ZCAA 5B57C 3R9WA 4AKHA 3KKMA 4IW3B 1U2RA 1KDPA 1NSFA 3ZIAD 4M9XA 5FOUA 1E99A 1SVWA 1AKEA 2DFTA 4LZZA 1L4UA 1XCMA 4GMXA 1E2JA 4B74A 2BWJA 5E7MA 1VCMA 5DIFA 5DISB 2OLJA 3X1WA 3HJNA 4EPXA 1XEXB 1K6MA 3WMEA 3CPEA 3N2IA 3BE4A 4Q4AA 1E2QA 4CEHB 4NH0A 2DPXA 1NN3A 3DPUA 1COWD 3W3AA 3TVDA 4IDQA 5M04A 2PL3A 4P0TA 1CEEA 1JQLB 2VP6A 3HR8A 2ZSAA 2BV3A 1T0HB 4IKEA 4TLEA 3SI7A 1PV4A 1RRGA 1E0AA 4RFVA 1F5NA 2ECKA 4H9GA 1TUEA 2ZRHA 1PVOA 2GKSA 3TH5A 2O8CB 4QNRA 4ZDKA 4B3DA 1SVSA 1E96A 3KX2A 2J7PD 1E2MA 1Z08A 1VPLA 4JJZA 4QC2A 1US8B 421PA 2JCSA 1YZUA 4AYTA 2XSZA 1SKYE 1NN0A 1RZ3A 3KFVA 3WHLA 5CJ2A 5CB8A 1YZQA 3R9IA 3THYB 4URWR 4TYWA 2W6JD 3THWA 3TSZA 3LQQA 3B85A 4A6PA 1JEEA 2X77A 1OH5A 4NCNA 1Z0AA 4A0HA 2PJZA 2WPDD 4URYR 4QGGA 5HKKD 4B3XA 4M21A 4UQOA 1OJLA 3RS3A 2G77B 4UXHA 2QQEA 1E6CA 2JDID 1M7HA 2ODBA 3BH0A 4V02A 1WB9A 2FZ4A 4OI4A 2C04A 5L3QA 1P3JA 2GXQA 3GEHA 3RRYA 2GXUA 1U0JA 2FOLA 1XU4A 2HJVA 1MRSA 4LX0A 4LI0A 2W58A 3QKRB 2JJ1D 2V6IA 4R2HA 2ORWA 3W8NA 3THXA 1QHHB 2QP4A 3RAPR 4RFSA 3FE2A 5FPTA 2VO1A 1E2GA 2DWPA 4FMDF 4B6EA 2F43B 4MUBA 4NL4H 4B3FX 5TMPA 1S3SA 4AURA 4C0KA 4PXAA 4US0R 1TF5A 3CO5A 1W2HA 3SZRA 4ARZA 1GNPA 5BN5A 4ARZB 2X1VA 2CLSA 1UADA 5FBLB 5C4GB 3KKPA 2G1KA 4BEBA 2WJVA 1CU1A 2H7VA 2A5FA 2O0JA 2ZIAA 4QGAA 5EE3A 5H70A 5SZKB 4Q9JA 1Z28A 3SJBA 2FN4A 1KO1A 1F2UA 1JJ7A 1NVXQ 4C7OB 2ZANA 4JJKA 3GFOA 1FMLA 3K70C 4JMPA 4IVPA 4LJ8A 1DAGA 4JS0A 2IUUA 1JR3A 2ZJYA 1T3SA 3RS7A 2Z5FA 2XSZD 2VTKA 2GAAA 1Q12A 1R8QA 2CK3A 4LHZA 3EXAA 3B9QA 2ZRDA 1H8HD 2ATVA 3MSXA 4NCKA 1KO4A 1O3YA 1KJWA 4B3CA 1RC8A 5C18A 5JECA 3TGPA 4OI0A 4QM6A 4I1VA 1E79D 1XWIA 3N70A 3W9YA 2YV5A 2GWHA 3SNHA 2BBSA 2AD5A 4MRRA 2DYKA 2BC9A 1R10A 2HEIA 3KKNA 3L0IB 2GVZC 3L8ZA 1HEIA 3LAWA 1SXJC 4G5RA 3BRWD 2QMHA 2Y8EA 3I73A 3GLFE 4JBXA 2J46A 3PXGA 1HT1E 1NP6A 3T12A 4Q9HA 4L15A 4BZPA 3NEJA 2OAQ1 2ZPTX 3GD7A 3ZZTA 1IXRC 2GJKA 2FNAA 1SQ5A 2QGNA 2R6CA 2B8TA 3TUJC 2NQ2C 2VHTA 4E07A 2NPFA 3TQCA 1E1RA 4PSVA 4UXJA 2HF8A 5A5GA 5FL7A 1A5TA 5J4YA 1NMZA 1N6RA 2DR3A 5FPSA 1W5SA 1QBKC 3QI2A 2CNWD 4GNKA 5FPKA 2NO6A 4BGDA 2J0QA 3SHFA 4LY6A 3G82C 4A2PA 2AXPA 1RRCA 1KZ7B 4HB0A 1IM2A 1JXOA 5JJKA 1NL3A 2J9RA 1GVNB 3THOA 2CK3D 2KBFA 4DJTA 4M8NE 3AF4A 3QPUA 5JJIA 5AJYA 3OEHD 2WICA 5FUYA 3ZS8A 5KDDA 4G5GA 1G8FA 4GFDA 1UBFA 1SXJB 2ZE6A 2YWEA 4PSAA 4V0LA 4S2EA 3WNDA 2EFGA 2VPPA 3VR4A 1NG1A 3MUFA 2YOGA 5C2JB 1XF9A 4B33A 3BBPA 1P61B 2QRNA 2VP9A 3LBIA 4O25A 1KMHB 1K5DA 3I4LA 1JXMA 4U7DA 1NVUQ 3ND9A 4MYUA 1IN4A 3P26A 1S4QA 3CKLA 3SEAA 2O8EA 5E3HA 2BDTA 2A5YB 4Y0VA 2IYWA 1N5IA 1ZVQA 2CL0X 4JSYA 2KB0A 3T61A 3AUXA 1Z2CA 2W2TA 1GP2A 2C78A 1KO7A 3PUWA 2E9SA 2H17A 2KWIA 2V1XA 5BXQC 3GLIE 2QBYA 4EIWA 1IN6A 1OFIA 1OFUX 4E09A 1H65A 4EAQA 5AK0A 2EWVA 1KDOA 2ONJA 4EFMA 1W36C 4M1TA 1G5RA 3L2OB 1WCV1 4ZV4A 2MMGA 3PUVA 4MKIA 4PHTA 4L5BA 4WW0A 2LKDA 4DDVA 3L8YA 5K8TA 3T5DA 3LXRA 2WKQA 4TLDA 1NRJB 4HLCA 4DT1A 1Z0DA 2FF7A 1KI2A 4DXAA 1OF1A 1Z6TA 3EZ7A 3GMTA 2QA5A 2UZIR 2WWHA 1Z0JA 5KUTA 3HYRA 2B6HA 2WSSD 2JLWA 2IYSA 1G5PA 4RD1A 1OXTA 3WNBA 4KITB 1WP9A 3LVQE 1JQJC 3MWJA 4MITA 3IEVA 1SVKA 3CZQA 1OXXK 4OI1A 5DN6D 1YR6A 3CRQA 3EPJA 3IO5A 2WM9B 5P21A 1AJEA 3S1AA 2ODEA 4QBIA 4DLWA 1ZNZA 3CM0A 2GCOB 4XD7D 1AGRA 3CX7A 2B8WA 4G1UC 4M1KA 4Q7MB 1G3UA 2R6AA 4YXWD 2ZU6A 2YOFA 4GL2A 3ICQB 4DDUA 1DS6A 2GVDC 2QY9A 4Q19A 2AKAB 3OZXA 4TLCA 3HDTA 3DOEA 4Q18A 4EPYA 4WXPA 2XXAA 5LB2A 1KAOA 5TARA 2O8BA 2R44A 2OFWA 3MLEA 5HKKA 3GLFA 2QTFA 4V0OA 1U8AA 5D3MB 3CBQA 5B2ZA 1NLZA 2GF0A 1N6LA 1EFRA 1KAGA 3T35A 3V4FA 5TB5A 2GEUA 1QHNA 3UWKA 2GXAA 2D4HA 4DWJA 2QU8A 1KO8A 1SVLA 2D7CA 3I32A 4F7WA 3NDBB 4JYBA 1T4GA 3VFDA 5CLLA 1EXMA 3SQWA 1E9FA 2GESA 4HZIA 4TQAA 5GJCA 2QSYA 4GPTA 4PC2A 3MCAA 3KB2A 3Q3JB 1TPZA 1LNZA 1EFRD 2ZVQX 3KZ1E 4DBLC 1OHHD 3NBZC 4DT1B 2A5GA 5F3WB 2R6DA 3T1OA 3FKQA 3RS2A 2XB4A 5EP2A 4C0HA 4PFSA 4QOSA 2WWXA 2EW1A 1E2HA 1T6NA 4LCBA 1ZM7A 3K53A 4N1AA 5F9FA 2NTYC 2F1IA 2PJRA 1AQUA 4Z1MA 4XTCS 3WMGA 2ODNA 3OFNA 1NSTA 3PEVA 3QE0A 2NZ8A 3ZQ6A 5CITA 1NVVR 5E4FA 2OHFA 1NIPA 5K8IA 4V0MA 1OIWA 4Q4LA 3W5JA 1FQJA 4RFSB 4V0KA 1F2TB 4EDHA 3V4RA 1KDTA 4EPVA 5BQ5A 5CB6A 2Z83A 1WDTA 3W34A 4FW9A 4IOLA 1RPZA 3MMPA 4IOMA 3B1VA 2H16A 4LDJA 2OBMA 4OHWA 3SQXA 4R7ZA 3DL0A 4DDTA 2WWWA 5CYOA 4D4LA 3FFBA 2VBCA 2CE2X 5FR1A 2ERYA 3SJAA 1AS3A 5AUNB 4M22A 2IUSA 1Q3HA 1TQ4A 4DLSA 4DB4A 3BORA 2CEAA 3T1VA 2WJYA 1DO2A 3MFYA 1Q44A 1CKEA 4KFSA 2JEOA 5L3SB 3Q8XB 4G5QA 3OE7A 3BGWA 2A78A 3FMFA 1DAFA 2QSZA 1SZPA 4QBGB 3K0SA 2RGXA 2FH5B 3Q85A 4KAXA 3C41J 1E0SA 2QZ4A 3SBEA 2ZJ8A 2HF9A 2OUKA 1CULC 3KQUA 2IK8A 3WP1B 4OJQA 3RABA 1IHUA 4BFZA 3PUXA 2QM7A 4IHQA 4MDFA 2DCUA 3C5CA 3NTUA 1FTNA 4F4CA 3GLFB 4HZUA 4YQFA 3U3KA 1Z2AA 3B1XA 6Q21A 3VHXA 2XTNA 4QM7A 4IOKA 4OJKA 2BEKA 5J4LA 1U81A 1MO6A 2OCYC 2Z4SA 3TUIC 1MT0A 2YNMA 3KB1A 1N3BA 3GJ8A 1JR3E 3GCGA 1E2IA 5FUVA 3C7KA 3KUDA 1GWNA 2QMOA 3FFAA 3U44A 4PR0A 4TQUS 5DO9A 2IX3A 2H18A 2JJ8A 1L7VC 5CLQA 2VIIA 2REBA 2VQSA 2F9MA 3ND8A 4Q7LA 3QSYA 4OHXA 2GJSA 1S9HA 1W4AA 3BAFA 4MGIR 4PZYA 2OZEA 5EE9A 5HR5A 1N5KA 2JLSA 4LJ4A 1TTTA 3T06B 1OV4A 1T8UA 3NWJA 4OQNA 1IY1A 1M7BA 1VHLA 1KSJA 2OCBA 1X1RA 1VMAA 2QP3A 4U02A 1QVAA 4C2TA 4M2LA 2O8FA 2YWHA 5J47A 2CCKA 3A4MA 3M1IA 5FL7D 2R62A 3WRXC 2C5LA 1DO0A 1E94E 4K8OA 2LKCA 1KI9A 4JLOA 2FSGA 3GJ5A 5AWFC 1KTVA 2MSDB 4GZLA 3CWZA 4JT4A 2Q3HA 4QJ4A 1KI4A 3Q7QA 1W1WA 2J0UB 1XJQA 1IAQA 2FPMA 2N1BA 2CVFA 3AVWA 1HURA 5DYGA 1SGWA 3KJHA 3IEUA 4DC9A 3DMDA 4P31A 3PUYA 4QBFA 5KSPA 1OH6A 5FTNA 3QJYA 1MO5A 5BN3A 5IDVA 1V43A 4LHVA 1ZUNB 3MWLA 1WA5A 4M1MA 2BCGY 3RRZA 2ZAMA 3E1SA 1JECA 4Q9IA 5FOXA 4LGMA 5FOVA 1Q22A 4D0LB 3WBKA 1Q21A 4US2R 1XEFA 1G7TA 2QTHA 1GL6A 4DHEA 3UMSA 1YQTA 3AKDA 2GK7A 4W7SA 4XSGA 4A15A 3RC8A 1QDEA 4B44A 1E4VA 1UBCA 1UKVY 1ZD1A 3VR2A 1FNMA 4WXRA 1RIFA 1DADA 2GCOA 4DCSA 3UG7A 5B58C 5KNDA 1XXHB 5JCZA 2BKUA 3L82B 4NYJQ 221PA 4Z51A 3TMKA 2GZDA 2BEJA 1F48A 2JASA 3LVRE 2OFOA 5H8WA 1EFUA 3P32A 3P20A 4MKFA 4P4SB 4ZDJA 1UBGA 4LC1A 1UEJA 2LWIA 3QENA 4LJ7A 4CEHA 3V9PA 1M74A 1IN8A 1CJVC 4PPGA 4UNRA 2AFIE 1NJFA 1I2DA 1R5OA 4ZDWA 1XNJA 4TTQA 2JGNA 2GA8A 1NKSA 3QVVA 3M4YA 4GMDA 3BERA 1BYIA 2QN6A 3CH5A 3IPXA 3TAUA 4XD7A 1VG1A 3QY0A 1AA9A 3B1YA 5FR2A 4NONA 3D6TB 4UKDA 1JB1A 2OFXA 3EZ9A 3U6KA 3A58B 4RD0A 4MUAA 1XP8A 2A30A 4TL6A 2W6JA 2ZAOA 4BEJA 4DSUA 5JLJA 4Q4AB 3U7GA 4JL8A 1Q1QA 1S96A 4IOJA 4LYFA 3KQNA 4A92A 2CHGA 4W5WA 2IYXA 5G3YA 4IDHA 4HAUA 3GJ7A 2KSQA 3D31A 2O8EB 2HT6A 4IVRA 4Q00A 2IXEA 4FIDA 4CEIB 1O87A 1U98A 2ZYWX 2PEYA 1J99A 2B7CA 2J5XA 2CCGA 3K9HA 2GJ9A 1XCGB 2IS4A 4HSEA 1TQDA 5AR1A 3MRSA 3RRNA 5KSZA 4AG5A 4BFSA 5GADl 4PANA 1JPJA 4ZIRA 2NO1A 1R0WA 1AZTA 2FPLA 4HB2A 4HLQB 4KYIB 5J4KA 2IYLD 2XTMA 4D82A 2AFHE 1NNEA 3CW2A 2C95A 3A37A 5AJVB 1LB1B 5DYIA 2FFBA 1RJ9A 1Z63A 2P5TB 3AVPA 2A5JA 2OESA 3DOFA 2REXB 3BD9A 1PZNA 5C1BA 2NIPA 1VCNA 1PLLA 3CRRA 4GT1A 4LJ6A 2HV8A 2WPDA 4D0GA 1GL7A 2W83A 2O0KA 5HE8A 4PAQA 4KFUA 2IS2A 2JJ2A 4JZKA 5CIWA 1GM5A 1N0VC 4GSYA 2FA9A 3ZZUA 4E22A 3EAQA 1G5TA 3R7WA 4BFXA 2ZITA 2ATXA 3IIJA 4WVFA 3KDSE 5FOTA 1QHYA 2REOA 5CM9C 4HLDA 2QENA 5IK2A 2V9PA 4NTZA 4MQBA 2WSMA 3UATA 3ZD7A 2ZUBA 5DSZA 1T3LA 2VLIA 4TL7A 4M53A 1XPUA 4F91B 2ZE7A 3VNVA 1OXVA 3LW8A 1G3MA 1D2NA 1DPFA 4KO8A 2FE4A 2OSBA 2WBLC 4NDZA 4BFVA 5BWMA 3CPJB 4Q1CA 4YXWA 4HATA 2Q0HA 3B1WA 4MGKR 3THWB 4OHZA 4XTRA 2G0TA 3E2IA 2RGGA 1GKYA 2EFEB 3B82A 4UNQA 3VAAA 3FHCB 1HUQA 1DAKA 2CL6X 1C1YA 4FMCF 2B21A 4PC6A 5L3SA 1E2LA 2BJVA 1CS4C 2WSSA 3KTAB 821PA 5AJZA 1P5ZB 2PCLA 1IBRA 3IHLA 2V3CC 3ZLJA 2BIFA 4A6XA 2YOHA 3KL4A 3QVUA 4DB2A 1D5CA 1VDZA 2OV2A 2GEDA 3DM5A 1Z6AA 1CJKC 2BMDA 5EP3A 3CF6R 3CH4B 1Z3IX 3PITA 3U2QA 2AWNA 3HWSA 1T8TA 4BWYA 1OXSC 1YJ5A 5IHPA 4J0QA 1ZUHA 1MABB 2ZE5A 3U6BA 2GHIA 2BM0A 4QGFA 3AVQA 5DH9A 2KI5A 4Q1BA 2ZM5A 2TMKA 5G53C 4URXR 4D25A 1XTRA 3PIRA 4C0LA 2OLKA 2VH5R 1P2TA 5G3ZA 3AEZA 1M1YE 1C9KA 1B23P 1DE0A 2PH1A 2RGCA 5G41A 4XSHA 1AS2A 3DZDA 1CIPA 1PLJA 1QG2A 5ELXA 3KXIA 1FX0A 3GJXC 4NKRA 1T5IA 3I61A 3WYGA 5FUXA 1XJCA 2GXSA 3DDCA 3NC1C 1XMIA 4LBYA 1WRBA 3Q5DA 1Z5ZA 3CR8A 3TVTA 4MYHA 4C3ZA 4BLSA 4NHOA 2L0XA 4RZXA 3QPWA 3ZJYA 3QXSA 2OE2A 5UKDA 3GP8A 1Q0UA 1XD2A 1EK0A 1ZMXA 3SC3A 3VQTA 2AL7A 4HB3A 4MRPA 1T91A 1DARA 1W2GA 1S8FA 1SULA 1ZNYA 2VP5A 2ZS8A 3BFXA 4KLZA 4NYMQ 1N0UA 1TU4A 1XB2A 4Q01A 1J8YF 4CEIA 4CEJB 4B48A 4P3YA 3LLMA 1S1MA 1ZW6A 1NLFA 1ZINA 1JR6A 2YINC 4JBWA 2R6FA 3OE7D 3TRFA 2P6UA 5J4HA 1X3SA 4IDOA 2ZQ5A 1NVVQ 2DFKB 1E2EA 4MRVA 1G8GA 4TQ9A 5BYJA 4PC1A 2RKOA 5B30A 4QJ5A 3KQKA 2IT1A 1GNRA 3OIVA 1KSGA 1G7SA 4DUGD 1OB2A 2J3EA 1KDRA 1ZCBA 4IDPA 2HDNB 4A36A 1FUUA 2DWOA 5BYKA 2QE7A 2CLCX 5JSZA 4OYHA 3UIEA 2VP4A 4D4JA 4LJAA 3QXCA 2QP9X 2D06A 4P4UA 2VF8A 2ZJZA 2ORVA 1F3OA 2YWGA 2HCJB 3RNLA 3I8XA 2WIBA 3EZFA 1BOFA 2ZREA 3QG5A 3VHLB 1E9AA 4MGZR 1R7RA 2YHSA 3IO3A 5JWRA 3R8FA 1Q20A 3VNUA 2V7QD 4TMVA 2FFQA 1P7CA 4Q1DA 2D3WA 1XCPA 4XVQA 1ESMA 4IEIA 3CF0A 3MJHA 4RZUA 4JVSB 1HYQA 2F9LA 3QXJA 1ZYUA 4M4SA 3ASYA 4QXAA 1YE8A 5SZIA 2QNRA 5GJBA 2FG5A 2ZI6A 3K8YA 4P4SA 3U3JA 3GJ3A 5A4JA 4G01B 2ZR0A 2R2AA 2GJ8A 2PEZA 4N3NA 2PX0A 3PV0A 1XD8A 1A82A 1OXUA 4AG6A 1DAMA 3C8UA 1GG2A 3CZPA 1BMFD 5JHHB 4KSCA 1XTSA 3U3MA 2GEVA 5DI9A 2IBMA 4BZXA 1H8ED 1RVDA 3AKEA 4NPHA 2GBLC 1U99A 4RZ2A 1I4TD 3WHKA 2OILA 3SBDA 2FWRA 3WYAA 2JLUA 1YR7A 2FMXA 3I1FA 3N2EA 5EUQB 1CR0A 5FTLA 3BIFA 3Q72A 4NCHA 2UKDA 4ESVA 3FMPB 1GTVA 2H5EA 4WA7A 2UVQA 3U3OA 3WP0A 3UMFA 1FQKA 3SFVA 3B5JA 4GZMA 5CDFA 3W8RA 2IEZA 5JCPA 2XGJA 1VYTA 3X1ZA 3WNCA 3BJIC 4NCJA 1R0YA 4HLUC 3A1UA 3QF4A 1DAIA 2IF0A 2JIZD 121PA 621PA 3DKPA 1ETUA 3K70D 3GEIA 4P32A 2W0SA 2HXSA 4LK2A 1KK1A 2OXCA 2C98A 1N2CE 1XRJA 4IRUB 2RGAA 5HZHA 2WV9A 1ODFA 1HE8B 2ZJBA 4KV9A 1W0JD 4QHTA 4YC7A 2A7QA 4HAZA 5DN6A 2GTPA 3P4YA 2J1LA 2BMJA 3PFIA 3KXKA 5J40A 2PZEA 2XZLA 2F43A 4KXFB 1ZUIA 3SE0A 4QNMA 3H0KA 3IGFA 3I62A 2G1JA 4UNPA 5EE1A 4BLOA 2VHJA 1GILA 2CXXA 2D74A 3R9XA 3LW7A 1LV7A 4C9BA 1JALA 1MOZA 2FSHA 1E9EA 2P2LA 2MSCB 1G7RA 1TL7C 1G8YA 1SVIA 1MO3A 4ZI2A 2CJWB 1XZPA 3MG9A 4WZ6A 4YMWA 2V54A 2W00A 2OXRA 4DSTA 3GPLA 3FHTA 3KKQA 4C0SA 3CX8A 3D7MA 3F5FA 1CXZA 3B60A 5L3VA 1XEWY 3KFXA 4BRWA 1Z0FA 2Q3MA 2XJ9A 1ZIPA 4JL6A 2HYIC 3ETLA 1JAHA 1FP7A 2ZI4A 3FPAA 1T3HA 1T0JB 2OO7A 3KQHA 4O2RA 3KJEA 5LD2C 1CJTC 3CRMA 2EYQA 1E32A 4TSFA 2KE5A 1XEXA 4FXPA 3H4MA 2IEYA 4A1FA 1G6HA 1CRPA 1MR3F 3LRPA 4NYIQ 1W49A 3SJCA 5JFGA 1EWQA 1Q1ZA 2Q9AA 2YYZA 5DI3A 1E2DA 1G3QA 2QT0A 1CR4A 1GRRA 1JJVA 3SS8A 3OIWA 5KPJA 1UKZA 3K0CA 2D2FA 3W6PA 2RGBA 1KMQA 3DHWC 1T9HA 3DO6A 4GI7A 1M2OB 2C2HA 4OI2A 4OHYA 4LYAA 1R4AA 3PG5A 4PAMA 4RZ3A 1GL9B 4XVRA 5BW8A 3OF5A 1J90A 1G1MA 1XTIA 2R8RA 5F2EA 4B2LA 2G9NA 1GRNA 5IF9A 4ERNA 2EVWX 1YHNA 4BASA 2V6JA 4WBSA 2ZR9A 1VKJA 3W6OA 2J45A 3H1TA 4DLYA 4US1R 3JZMA 3W5IA 2JLRA 1P73A 4JIMA 4L16A 5FTKA 4LJ9A 4TTRA 2JLXA 1WF3A 2BKEA 2BHRA 3MWYW 2IWHA 1SVMA 4QHSA 2CNWA 2VYFA 3C16C 4AC9A 4H1VA 5F9HA 3HYTA 3FKSD 2WOJA 1F60A 2JAQA 4OL0A 5EXPA 1GZSA 3SYNA 4S35A 2FZLA 2QL6A 3L0SA 4URVR 4LHXA 3FVQA 1LS1A 2JJ2D 4TZ6A 1SHZA 2WZQA 3CNOA 3B7GA 2FJUA 2YZ2A 3RDPA 3NC0C 5KU1A 1GKUB 1PLKA 3EASA 1RYFA 3ADDA 4DZZA 3KQLA 3VX4A 4TMTA 1F2TA 3AF1A 5L8VA 2YC2C 1E9SA 2WWGA 1XPRA 3Q9LA 4DLRA 3OESA 4EQ6B 4NU0A 1OW3B 4OBEA 1KMHA 1KI3A 2JJ1A 2G6BA 3WXMA 1A7JA 2WAYA 1P72A 4JKIA 4DLXA 2ZXUA 2QM8A 4JLDA 2QEQA 1YZLA 2X19A 3BFVA 1P4SA 1J7KA 3TK1A 2WOOA 4M9SA 5D3MA 4B75A 2WMOB 3IHWA 4JKYA 3CX6A 3TW4A 4UNNA 4B32A 3GEEA 2RB4A 1JR3D 4Q02A 4ESHA 2J7KA 4AIIA 4TMXA 3AF0A 4GDFA 1OB5A 4LYJA 3RS5A 4FCWA 2OEPA 1Z6YA 4JYCA 4HUQA 3ZQJA 3EIQA 3WYFA 1YRBA 1RKBA 2FV8A 3LBNA 4LOAA 2BBWA 5ANRB 5GVSA 1QVRA 4TYNA 1HQCA 4RD2A 2PX3A 3SU8A 3QBTA 4EFNA 3RVBA 1CBUA 1J8MF 2GZHA 4E5UA 3U7HB 2HCBA 2WKPA 2XXAB 3FDIA 4HAWA 2XOKA 2CVHA 5L3RA 3ZS9A 3NBFA 2PBRA 5JHGB 2DFNA 2ZRKA 4BRUA 2F7SA 3TR0A 1US8A 4JLMA 3LA6A 2Z4RA 3OIYA 721PA 5GJVC 3K9LA 1U9IC 3EIEA 4LV6A 4ZPXA 1N6NA 2VF7A 2JDIA 2WKRA 1COWA 3NBXX 3CWQA 3RRMA 1D8TA 2IYUA 1AK2A 2JATA 3QEOA 4B43A 4XIGS 3CNNA 2E1RA 4X8LA 5F98A 5J4VA 4PHFA 3U5ZB 4KHZA 2F1RA 4GRAA 5LDDC 2XITA 2VSFA 1S0UA 5D3QA 4DDWA 2JLVA 3DEFA 2GCPA 4CZ2A 1ZD8A 3DM9B 1C4OA 2QAJA 3A4NA 3GLGB 2QPAA 1ZNXA 4Q1AA 4CW7A 3GJ4A 3AB3A 3TSOA 4ZI3A 2IYZA 4BLTA 4FINA 2XAUA 3QKRA 3HP1A 5HCNA 5JMTA 2ZYVX 3OFND 1R5BA 1WBDA 1KKMA 4L8GA 5AUOB 3M6AA 2C9CA 2V7QA 3MGCA 4LPSA 1Z0KA 4OQLA 1NJGA 2J0VA 3Q7PA 4ABYA 1TQ6A 2PLRA 1VYUA 3EC1A 1OFTA 2DHRA 2J0UA 5JI3E 1TQ2A 3K0FB 1AKYA 1EESA 4HDCA 2ZUDA 1KI6B 1NI3A 5KSOA 1RRPA 5KHOC 4OKSA 4I1SA 4PQFA 1KO5A 1XTKA 3T1QA 4Q21A 2ANBA 1U8YA 1EGAA 2CL7X 3H86A 3T15A 2XZOA 3GLGA 4Q4JA 3ZGXA 3W3ZB 1KJZA 1GITA 4EJSB 1G19A 4LUCA 1MH1A 2C9YA 1OKKA 2ZRGA 3O8BA 4RD6A 4TLBA 4P33A 1EX7A 3V00A 4CIDA 5L3QB 3RWOA 4A2WA 2BMFA 2DB3A 1T5LA 4XJXA 1UKEA 3ZIAA 4BQSA 1UPTA 2JLZA 2XZPA 4LPKA 5FOSA 5JRJA 2V55B 4UNSA 2ANCA 1W4RA 4YLGA 3OEED 1A2BA 4FD2A 1ELOA 3BFKA 5EXXA 3D3QA 3ADKA 1G8PA 4HLUA 2FGJA 3WMFA 4ZKDA 1X8LA 3BH6A 4PHGA 2F3TA 1CP2A 4XVUA 4PAOA 5DE3A 3FOZA 5FFMA 3RANA 1QRAA 4G3XA 2P6NA 3A36A 1HQYE 3K9GA 3EZ6A 3KKOA 4GOJA 4GP7A 1E98A 3C5HA 2IW3A 1E2PA 1CF4A 3SDZA 1NF3A 2GNOA 1HY3A 5EZ5A 4C2UA 2CDNA 4D81A 3M0EA 2XNDD 1HH4A 1NKTA 1ONBA 1EFCA 2WJIA 4TZ0A 1R8SA 2ONKA 2ZJAA 2Q9BA 2GETA 3FTQA 3PR1A 4FCVA 4OK5A 5JI2E 2AHOA 4PPFA 3ADCA 1VTKA 4BFTA 1MKYA 1OYWA 1RYHA 5JBQA 2WJHA 3IUYA 3LD9A 2FEOA 5BN4A 2WAXA 3QF7A 4N0EA 2H1LA 4XWKA 1WBBA 2G0NA 2ORIA 3LY5A 3B1ZA 4DLTA 1VECA 5J5CA 3SFZA 3BB3A 4Q4HB 4ZCIA 1EX6A 2QQ0A 3TKLA 4AKIA 3VKWA 2ZROA 1LFDB 4MGYR 1UDWA 3A8TA 4OK3A 2GF9A 4D4MA 1HA3A 4JSTA 2F3RA 2Q6TA 4TMZA 1N0WA 1P2SA 4BLPA 1KI8A 2HXYA 2J0SA 2QUZA 4YDHB 4OQXA 1G291 2VP2A 1QF9A 3CRW1 3BOSA 5DGXA 5E7JA 2ZSBA 5H1YA 3TR5A 1FOEB 5SZJA 2R65A 3MD0A 2DFLA 3OAAD 1WMSA 4D26A 3VTKA 4LSGA 5KDLA 1GFIA 3A1TA 1E9CA 4O2LA 3BB1A 1BKDR 3BK7A 3BS4A 4CVNA 1W44A 1FFHA 4M1WA 1XD2B 2ZRIA 2QBYB 1WE2A 4Q5IA 4L9SA 1W47A 2RMKA 1OIVA 1DEKA 2VRWA 3NVAA 3AP3A 4Z1MD 5CIQA 1FPMA 4C0BA 3ZYCA 1GUAA 4TN1A 4LJ5A 2ZI5A 1JEDA 3DMNA 2BBTA 3UKDA 1F6BA 1UJ2A 2W6IA 3CPHA 2H57A 3OEEA 4V0NA 3RWMB 3U60B 1E9RA 3G5UA 3ZZ0A 2C8VA 5IK2D 4I4LA 1QHHA 3HPQA 1VIYA 5H68A 2NPIA 1UKYA 2QRZA 4URUR 3AVTA 3P4XA 3U4QB 3D8BA 1VG9B 1Q3TA 3CONA 1GKIA 4PSKA 2AK2A 1S3GA 2ODWA 3FGNA 3QEJA 2O52A 1Q1EA 1EWRA 3ZVNA 1LVGA 1D6JA 4BUJA 4EJSC 1CJMA 5B64A 2O8CA 3EX7C 1D9ZA 3GQBA 3KJGA 1OIXA 4HZUB 1N6HA 4YMUA 2P0EA 1IJEA 1HV8A 4I1UA 4JVNA 5AUQA 3AF2A 2FFHA 2BMEA 3I5YA 2QROA 2QORA 2FU5C 2J41A 3MJRA 3QKSB 1NMXA 3VR1A 1E1QA 1A2KC 4BE7B 1W48A 3CF2A 4EPWA 2IXGA 2R6GA 1U0LA 1N6OA 2ZSFA 2QG6A 1A4RA 4E03A 5FBVB 5IT5A 1OH8A 3PENA 2C77A 3F0TA 2IYTA 4KSBA 5CJPA 3SOPA 3AVUA 1H8HA 1FMJA 1YZTA 3LDAA 4N0DA 4JBYA 3UANA 4PPNA 1XD9A 1ANKA 4B76A 5KTYA 1TMKA 4AY2A 2ZSDA 4P4TA 4Q4JB 1VG8A 4ZKEA 2NMVA 3BH7A 3J81k 3LNCA 5EE5B 4TL9A 5AJXA 3X1DA 3P1JA 1NBMA 1II8B 3QKUA 4MKGA 1K8RA 1AQYA 1YRAA 2A5DA 1M34E 2A3RA 1TEVA 4LYHA 1HTWA 4JVMA 1G16A 4TYQA 4HAYA 1UBEA 3C4JA 3SYKA 4ZIRB 1YU9A 3QXHA 1SVOA 5LPNA 3HU3A 4ZO4A 4BZQA 1IXSB 4FWIB 4JLAA 2IA5A 3H2YA 1G20E 3TSWA 4EJSA 1FZQA 5KDOA 4CT4B 4KYUA 3PCRB 4ITRC 2F1JA 1VCIA 2XOKD 1YVDA 3EA5A 4HYYA 4AK9A 2JIZA 3QUSA 3C14C 3PVSA 3VX3A 4W5HA 3CIOA 4ILEA 4B2PA 1RFLA 5TVKA 1VHTA 2VSXA 4OHVA 3IILA 1E2KA 1SHKA 4NYJR 4D0NA 2PLFA 2NZJA 2J59A 5HZKA 2EU8A 2ZRPA 1IONA 1H8EA 3AVYA 5IRCD 1Z22A 2EQBA 3FKSA 1ZJ6A 1FP6A 1GDDA 4QJ3A 2XX3A 3NH9A 3NXSA 4AWXA 2MSEB 4KJZA 1D2MA 3IBGA 4H1UA 2QMUA 4LBZA 2R9VA 1EG7A 4AI6A 1FL9A 2HLDD 1LY1A 4RKFA 1P9NA 2JLYA 3B13B 1ZC4A 5KYKA 1J2JA 1DTSA 1JBKA 5G40A 1KOFA 3PJRA 1DVRA 5DHAA 3WBJA 4Z8YA 1TUIA 3LBHA 2Q21A 4IVQA 2O0HA 1I4LD 3LX8A 4O3MA 2WWFA 2J87A 2VA8A 1G3IA 4C4PA 3O8CA 2RHMA 4PPQA 5JS8A 1OLOA 4HUQB 4ZCMA 4LRWA 2IHYA 2ZSEA 1QHXA 3S1AB 1GSIA 1FUKA 2BM1A 2FFAA 4JLPA 1ZM9A 2GCNA 4QBHA 2ZR7A 2P6RA 1IJFA 4DKXA 4KFRA 1XMVA 2EWWA 3T34A 4DVGA 1KY2A 1TADA 1Z29A 3DZ8A 4A8JB 4K81B 4RY2A 3U7FB 4XWOA 2QTVB 3HU2A 2IYVA 2HT1A 1W5TA 2KJQA 2OBLA 4IFBA 4ACAA 2GJAA 2FGKA 1QZXA 1XMJA 3AM1A 3QOFA 1W0KA 1AS0A 3EA0A 4XWAA 2CE7A 1E0KA 2I1QA 3K0AB 4K46A 1AIPA 3AVVA 2YWFA 1P62B 4Q47A 1E79A 1DG1G 3EIHA 1G18A 1M7GA 1P60A 2X2EA 1CRQA 2ZS9A 4LC0A 4MKHA 1XFAA 2P5SA 2D62A 4PO9A 4R9UC 2AN9A 4PC3A 4JLBA 3A6PC 3GLGE 3VMFA 5EUMA 3B78A 3PUZA 5HCIA 4LBWA 4GP6A 1G17A 2H8KA 4D6PA 4EPTA 1X86B 1SXJE 4EQ6A 1P2VA 4GOKA 4DRZA 1RW4A 3F8TA 4MRSA 3IBYA 2CMKA 2OCAA 1G8HA 4PC7A 4MDEA 2V8OA 1G64A 3AUYA 4DSOA 1E4YA 2P3SA 1U94A 1KIMA 4L4UA 2P67A 2XNDA 4TT3A 4F4JA 4TSFD 1TNDA 1AN0A 1IXZA 3QG1A 3OAAA 1EFHA 1BIFA 3MAAC 4LV8B 4CT5A 3ZD6A 4PO1A 3C15C 4YMVA 4A0FA 4R98A 1KNQA 2O5VA 1OFHA 5EJEA 3SHWA 3RC3A 3PQCA 3B2EA 3ECCA 5TDHA 3B9PA 3K09A 4U5XA 1P9WA 2QPOA 2GILA 2W2XA 3KJIA 1XDBA 5FPYA 4BFUA 2RGNC 1G3RA 4WZAE 5E7IA 4M9QA 2FSFA 2Z43A 4RJLA 4B35A 2OT3B 3LFUA 2ZRFA 2CLDX 1G9XA 2NOAA 2BBOA 4A0RA 4C0QC 2ZRLA 3TNFA 2Z6VA 1AGPA 3VR5A 1XJ0A 2ERXA 3GFTA 1LF0A 4Z8XA 1K5GA 4Z54A 2JLQA 2ZRBA 1SKQA 4AYXA 4C0AC 3GJ6A 2CHVA 2XEXA 3EPKA 4X8HA 3TAHA 2EFHB 3K70B 1VIAA 4JLKA 4B34A 4RCZA 1OKKD 2ZI3A 2IWRA 2IYRA 3EC2A 1OH7A 1XZQA 3RSOA 5E95A 3PEWA 1IQPA 5FI1B 4JLJA 8OHMA 2QT1A 2FX3A 4Q1EA 3EPHA 4QRHA 1SXJD 4W5JA 3DVLA 3WRYC 2CJWA 5DI3B 4YMTA 3AGPA 4II7A 4LV5B 4A4DA 1Z06A 4TTPA 1II0A 3RS0A 2IUTA 2F6RA 3QKSA 2KBEA 4KVAA 2YC4C 2RCNA 4V03A 2GAOA 1W4BA 2QAGB 3TJZA 2VEDA 3U61B 3X2SA 1UFQA 2GK6A 4TYYA 1BYUA 1OHHA 1P75A 1ZM4A 2MMCA 5EQTA 4F38A 3TLXA 4F4IA 3F3YA 1N6KA 1XXHA 1YZGA 4A8JC 1Q1BA 1KNXA 2IYQA 5C4MA 1IY2A 3EW9A 1ZU4A 3ICEA 4BLRA 4PTLA 4Q03A 1N5JA 4ON9A 3R20A 1QHIA 1NN5A 4B3BA 3DKVA 4JVLA 2Q9CA 1DOAA 3NHBA 3EPLA 1R0ZA 3IKJA 4PO8A 1W36D 1GOTA 5JRZA 4HI0E 2RH5A 1N25A 1FX0B 2HJGA 2IC5A 2PMDA 2WMNB 5FH9A 4NYMR 1Z47A 3I72A 4JT2A 1E9DA 3OHMA 1Q57A 5TY0A 1KYIA 1KZGB 5K8LA 4AD8A 4BFWA 4MA4A 4RVCA 1N5LA 2Z0MA 5CYPA 2VHUA 2ZRJA 4RCYA 3AH8A 3O47A 1LW7A 4ACBA 1XBTA 2Q3FA 2PT7A 3CNLA 2G88A 4Q4HA 2VHQA 2WTUA 1N6PA 5KSYA 1LS6A 3AP1A 1UEIA 2OBNA 1GNQA 4ZDIA 2IS1A 5GVRA 2A9KA 2OM2A 4I99A 5AUPB 4DUGA 5KOYA 3K0CC 1CR2A 1X6VA 3I92A 4WAUA 4R2IA 1G4UR 2VHCA 1L2TA 1OE0A 1QHSA 1XMSA 2FDCA 3IQXA 4U00A 2RGEA 1W7AA 2B92A 1V5WA 4KLNA 1ESNA 4A0GA 5DNYB 2ZEJA 4LBVA 4A8JA 1DG3A 2FPKA 3L43A 4C30A 3RSLA 3ZVLA 3TUZC 1PJRA 3IDQA 4Q7KA 5JZVA 1ZD9A 1G4AE 5CM8B 3I3SR 1KKLA 3SR0A 2RGDA 4AKEA 4A2QA 4KU4A 3ZDQA 1ZIOA 4M1OA 3ASZA 4RD4A 1XXHE 1Z07A 3GLHB 2I3BA 4QFMA 1AM4D 4QKQA 1OPXA 1GRQA 2O8DA 4ASUD 4R71A 3GLHA 4M0LA 1YKSA 2OCPA 4LWZA 1KHTA 4YMSA 3K1JA 3K0AA 1JAIA 3SN6A 3VU9B 5JEEA 4HEJA 3VU9A 3IIKA 1VYVA 3NKVA 1NN1A 4G5OA 4A82A 2WVJA 3QIAA 5FBRB 2HUPA 4FMBB 3A1VA 3R8CA 1Z6GA 4Q66C 2G3YA 1I2MA 1YZKA 2JA1A 4BFYA 3UK6A 2IS6A 1OYYA 2D2EA 2UZ3A 5TXGA 2DWQA 4TLAA 1KK0A 4OQMA 4DCUA 5GJWC 4WOPA 2ZI7A 1CTQA 3NHAA 3Q5EA 1KI7A 2AD1A 3NIBA 4RSGA 1TX4B 3LLUA 1IY0A 4POAA 5KO2A 4CEJA 4PHHA 4B2IA 5JSZB 2IYYA 3ADBA 3LV8A 3FWYA 4C7OA 4IEEA 4IJMA 4KI0A 1G7CA 3TIFA 3AV0B 3AVOA 2A2ZA 4FN5A 3GFPA 2VSOA 3HPRA 2HYDA 2SHKA 1WXQA 1CR1A 3UPUA 1E1RD 4FMDB 1GAJA 3FMOB 4KCGA 4PQYA 1U8ZA 3GJ0A 2I1VB 5FUWA 4URZR 5EZ6B 3U4QA 2ZJ5A 2AXNA 3AQ4A 1UDXA 4CDGA 1FTSA 3LH5A 1MV5A 3NBYC 4XH9B 4DSNA 3AKYA 1DBSA 2RAPA 4EFLA 4CYMA 3QF4B 2P65A 3T1TA 3QBVA 5CDFE 4X8MA 4QG7A 1Z83A 2C03A 1S9DA 4JLVA 3HR7A 3L0PA 4I81A 3K9NA 4RKEA 3REFA 4DCTA 1KK3A 4PZLA 4DIEA 4LHWA 4X8OA 3CLVA 1XTJA 3ONWA 1HE1C 4O0MA 2I4IA 4D80A 2GBLA 2ZRMA 4DEXA 4TYPA 1CJUC 3EWAA 4NZYA 2CBZA 3PEYA 2HLDA 4B6FA 4EKDA 2GZAA 3O8DA 3PEUA 4GBMA 2ZJOA 2ZS7A 2FSIA 3THXB 3VKHA 4NYIR 3EZ2A 4I1OA 2ZRAA 4G0NA 1I4DD 5FPHA 4BPBA 4GOXA 1E69A 1PUIA 1ZM3A 3UXMA 2W2VA 1P6XA 3I5XA 1E9BA 2BCJQ 4PQRA 1B0UA 1NBMD 4LHYA 2IXFA 1QG4A 1P2UA 3U7EB 3NEYA 1XX6A 3SYLA 2YKGA 2C9OA 2NO9A 2F55A
chains in the Genus database with same CATH superfamily
2Y27A 3VR6A 4FWTA 4GZ3A 1VFPA 2W6OA 2PDAA 1DQZA 2E3JA 1X14A 4FCTA 4TTAA 1JR4A 5DLEA 5ALUA 4NCAA 4L6IA 3FPSA 1QH1A 2WUGA 2I87A 5B1IA 4RY8A 4M6WB 2ZOSA 4CDNA 3OC6A 3OUTA 4EYSA 3TLBA 3S8EA 1K6XA 2HMUA 2P0AA 4UHEA 5FULA 3STYA 1UIMA 1S5PA 1G9TA 5EWLA 3UG6A 4GR9A 1U5BB 1M2WA 2IEAA 4FILA 3KR9A 1E6LA 2NZYA 4OYRA 5EZYA 4CTMA 2A0XA 3L8FA 1O0SA 1E2NA 1QE0A 1R6BX 2FDXA 3L7NA 3NDPA 2BISA 5HQJA 3WYEA 4CGZA 3F7NA 1ZJ5A 3DE0X 3IBTA 1GSOA 1NC1A 2WF6A 2H92A 2GF2A 4PIVA 5EXTA 1Q7GA 5ES4B 1Q0QA 3A11A 3QQ5A 2XUAA 4LCJA 3W4KA 5B2FA 3X1XA 3WYCA 2RBEA 2RHWA 2O3RA 3FMGA 4CKEA 1FIUA 3VZRA 5B53A 3LQRA 4C0JA 3SP1A 1HE5A 1Q7CA 3LUBA 4HRYA 1PVDA 3VPSA 1TYCA 2YUIA 1Z4IA 1BMFA 1FNSA 5DYWA 3SSNA 2J9GA 2H51A 1EVEA 1SQSA 2V45A 1T2DA 2C4NA 2A0UA 2XJ4A 1YI0A 3R8XA 4C7VA 2ZIXB 3ECSA 1PGPA 4YPVA 4QHYA 2I7TA 1F4PA 3FWZA 4HBGA 3ORSA 4KFTA 3TZLA 4WKPA 3VPHA 1KGDA 1W46A 1J70A 1G41A 1QGZA 4MYTA 4G65A 2G80A 1Z34A 2QM0A 5MFZA 3TE7A 4Z4IA 3AJ8A 3BYZA 3O3CA 4Q24A 1WQ1R 1Z4JA 2NQ8A 2Q9UA 4RZSA 3WWEA 2ZYSA 3Q6IA 1IK6A 4TZTA 2H07A 1WMEA 3INYA 1L5ZA 2BJWA 1WPXA 4MWDA 3TE6A 1U0OC 2GCIA 5HIAA 2ZI9A 3PXCX 1FLNA 4AKGA 3ILHA 2HPVA 4LY9A 1LTQA 5A71A 2JVIA 2EJUA 3BWVA 3T4PA 2HLNA 3ZU6A 5BURA 2RK6A 3IPAA 4UC0A 5IBCA 3TW8B 3IPCA 3BRSA 1JDZA 4C43A 1AF7A 2Q4OA 2KS6A 2LCFA 1MDBA 2FQQA 1TAGA 2BP7B 2RHRA 5FOWA 2FPGB 5DXAA 2JGIA 4JLNA 4O1IA 5H80A 3WICA 5L3QB 2E4XA 2JFHA 2WP0A 3COZA 2PYDA 3RQIA 3P27A 3ZWBA 1QHGA 3BMOA 4Z86A 3G0GA 2AWOA 2LTAA 5JAUA 3OJLA 1EXWA 2N46A 4FR2A 4CM6A 3S55A 2IODA 1VIMA 4K6GA 1T25A 4CQNA 2DT5A 3OCCA 4MPJA 4EI9A 1HYEA 2CXHA 4GE3A 3M1YA 1JAZA 4RKRA 3U3RA 3IBFA 4P80A 4U7GA 3JYNA 3WMRA 5KBYA 1LTHR 2EX4A 2B37A 3N2LA 5JISA 4JLUA 4FSDA 4H08A 1KI1A 3BMQB 2X8JA 3IVRA 2Q29A 4JZYA 3TINA 1NAIA 2EKQA 4N65A 4ONEA 2E49A 4EA8A 2XNSA 3GLHE 1ODSA 4KBFA 4N3BA 1WMDA 3GEPA 1WXDA 3G68A 3GHHA 3M6WA 4OBBA 4ENRA 1P77A 1XK6A 2RHDA 3DDSA 3GI1A 3N6RA 3QSGA 4NMWA 2QTTA 4Q9LA 5SV2A 4RTKA 1U0BB 4EJ6A 3QLVA 1Z74A 5BR7A 4RDCA 4FYVA 5FCDA 1IJKA 1P1RA 3EWSA 3DA8A 1MDFA 2R86A 3UMMA 1K4YA 5AESA 2V1UA 2I7VA 3PR2B 2C99A 4BS9A 4XKJA 5B7NA 1M6VA 5DK6A 2W7TA 3WY9A 1ZAKA 2M1XA 1KAHA 3GBSA 3VI3B 5HF5A 3DYBA 3GT7A 1MAUA 2Z8YA 3N0XA 3Q98A 1MXHA 4XQGA 1E2FA 4GPBA 1VXOA 4U7TB 3HU5A 4RH0A 3T3OA 5G4LA 2IIBA 4DIDA 5IZCC 3DXZA 2WSIA 1NZDA 1YZNA 2R48A 1WU7A 4JJIA 3T7IA 1U7HA 2VUIB 3AEKA 1ZD2P 4C7BA 1YK1A 1I32A 3RYTC 1JH8A 1T34A 1Y98A 3CS3A 1V25A 3UWOA 3R7WB 3O8RA 4L07A 3WB2A 1X2EA 2XYQA 1DAHA 4HH0A 3M70A 1TF2A 1SHTX 3EVCA 3MJTA 3DTVD 3GL9A 3MPOA 4HNRA 3RWBA 2PLNA 3S4YA 1A1VA 5A0FA 2PVCA 2FZWA 1DXYA 3PXEA 3JWGA 2SBTA 2BFEB 1P2FA 3OM8A 4V0ME 5HS6A 4AZVA 1PGNA 1FJHA 4IGEA 3R9XB 1U4NA 2ZYUX 3LGAA 2J30A 4ZC1A 1KP9A 2VL7A 4B1FA 5HUQA 4X1OA 4ARUA 4AMGA 3GC6A 3KKEA 3PC2A 3I0NA 4DLUA 2QX7A 2BSAA 4FI3C 2ZVPX 3ZY4A 3EN0A 4GMFA 4AS2A 3STTA 4F2PA 1VBFA 1U1IA 1SG6A 4MRNA 2H2DA 3JQRA 3PXBA 2PPLA 4I5GA 1VRVA 3QMMA 1PR2A 3WZLA 1MAAA 3USES 4HXGA 1U9IA 3PDIA 4AZ0A 5ABPA 1RM3A 2PPVA 3O84A 1XLTA 2X2FA 4JJAA 4NE7A 5IH3A 3TL3A 2YXDA 2A67A 1ZBDA 1MEOA 4P0QB 3RREA 3NAMA 5DWQA 3BF8A 2DOKA 3GB9A 2B7BA 1Z6XA 2JH3A 4UOEA 4D4KA 2QI9F 4IXMA 2E87A 3TTTA 4YX9A 3SJZA 3EDRA 3GXBA 1I3MA 3OZDA 4PZ0A 2PMEA 3O1HB 5TV2A 4DIOA 3U1VA 2BN4A 3TKAA 5HCUA 2ZRQA 3LMKA 3RV3A 1BEUB 1PJLA 1RJWA 4WASA 4RL4A 2PV0A 1VP9A 2F3UA 3BB4A 1IK4A 2IX9A 4YS6A 4YONB 4E7OA 2O8FB 2R751 5DX8A 4C4YA 4KH0A 5EXSA 2PD4A 3C39A 3BXZA 4GW3A 4GKJB 1D2EA 3CC8A 4HDMB 1D1SA 1LW6E 2GN1A 3RUHA 3E1KA 1NQVA 1ZKDA 3HI6A 4B47A 2AX4A 2GRJA 3KTAA 2H1HA 1NBHA 1KS9A 2HLPA 2Z1DA 1U2RA 1NOJA 1KDPA 2RH9B 3MTGA 1ZFNA 4XQ9A 4CLRA 1E8NA 1YFLA 2DFTA 1AKEA 1URPA 1SBHA 5ALJA 4E14A 5L51A 2YQZA 1E2JA 2PSHA 1NAHA 1P5RA 3GIDA 3OIFA 1AMUA 4LNUA 4B74A 4DV5B 3PPVA 5E7MA 3SHOA 1VCMA 5DIFA 1NYTA 2I55A 5J23A 1NMSA 1FFEA 2OLJA 1SUCA 4KN5A 1K6MA 3IA2A 3A27A 3UAVA 2OG1A 4WKOA 4Q4AA 5ECGC 3S2FA 4OYLA 1YIDA 4CEHB 4NH0A 1PL7A 5B3JA 4B17A 5FV4A 1NN3A 5IKPA 3SICE 3O5AA 3Q8KA 3HNPA 4IDQA 4L57A 1U2PA 2JPDA 3IB6A 4KWTA 4P0TA 1W96A 1JN0A 1FXWF 2BV3A 3SI7A 2OD9A 1GEGA 4PGGA 4RFVA 2FZCA 3R0ZA 4PZAA 1XA4A 4ZVRA 3FAZA 3GUVA 2VG8A 2Q6OA 4X94A 2Q2OA 1CUGA 4FJ1A 4QNRA 4B3DA 1SVSA 4AIRA 1E96A 3KYJB 3KX2A 2J7PD 4ZEMA 3LGXA 5CEEA 8GPBA 2Z8XA 1WZCA 1XAHA 1US8B 1JT2A 4I2NA 5ALFA 3VOSA 4B83A 2JCSA 1MA0A 1Q1NA 1YZUA 3GH3A 3L5OA 3PD1A 1SKYE 1NN0A 2C9DA 2ZT8A 1RZ3A 3KFVA 3VH3A 4AULA 3OZCA 3WHLA 2B5WA 2BFDA 5CB8A 2XECA 2EQAA 3TW6A 4OU5A 2H0RA 3THYB 4LISA 2GM9A 3WRWA 2W6JD 3R2JA 4JELA 4JNKA 5CA0F 1ZW1A 3I53A 4G9GA 1TAUA 2IHTA 1P74A 3THWA 1MZVA 1XROA 2VYNA 3PFGA 3G1WA 1PL6A 1H22A 1UC8A 3TSZA 4YR9A 4K1XA 1HM5A 1NMQA 3FUCA 4J2OA 4LWQA 1C9YA 4AP6A 1LSOA 1YRWA 4ERXA 4YLYA 4NCNA 1ML4A 2TSYB 2B4RO 2WPDD 4ECAA 4KK3A 3BD6A 4B3XA 1JTEA 3OKAA 1B73A 2FTKE 4FK8A 3RS3A 1PCXA 4UXHA 3IP5A 1T8SA 5COBA 1IQUA 4Y3UA 2Y9PB 2K2QB 1TJ3A 3OOWA 4M54A 4PNPA 4R1OA 1EVQA 1NULA 3GEHA 4MWGA 3ABIA 3GDGA 3PNPA 1U0JA 2FOLA 1K89A 3JSAA 2GM3A 2HJVA 3NDJA 4LX0A 4RXTA 4UVDA 1YJ8A 2GQ0A 3QKRB 2JEZA 1W94A 2ORWA 3LKDA 3LYUA 4EFDA 1Y4ZA 2QP4A 2GRAA 2GYYA 1U1FA 4RFSA 5IAGA 3AERA 2NM0A 1AV7A 1P31A 3VOBA 1M67A 4NAVA 2HV9A 3A0UA 4TUYA 1P4RA 3R0QA 3ESYA 3N05A 3FOWA 4NL4H 4YTEA 4K9NA 1EJ0A 4DARA 5TMPA 4H1HA 4C0KA 2H4HA 1KZ1A 1TF5A 3HNRA 2Q1UA 1NMEA 2UYQA 4WNIA 3ZWKA 4E70A 1WHTB 5LP6C 3KXPA 4K88A 3SZRA 1GNPA 2X1VA 2CLSA 1UADA 1S2NA 3PS9A 2O06A 1CLEA 3JATA 5FBLB 5C4GB 2IBTA 3AHIA 2XI4A 2FOXA 3G02A 1LC0A 3ZTYA 4Q9JA 3ONDA 1Z2OX 3CLSD 3UJAA 1F2UA 1JJ7A 3VISA 1BC5A 2ZANA 1T0UA 4BMXA 4F4HA 2GSWA 1I51A 4MUIA 2FZVA 3IOEA 1SZDA 3K70C 4IVPA 3U7IA 3NIWA 4JS0A 3UUFA 4TXJA 2ZJYA 2V7XA 1NXOA 1JVSA 1UWKA 4WCVA 2LBPA 2XSZD 4F6LA 2AUTA 4MI3A 5ALIA 3GRYA 3VUEA 5HOQA 5AK4A 3EXAA 1PHRA 2NVWA 4WN3A 1ST3A 5IJ9A 3KSBC 1EDBA 1G5QA 1O3YA 1Z5NA 2XF8A 2V3VA 3L1JA 5C18A 5JECA 3UJ9A 1BDMA 1YHZA 5A7GA 1E79D 2F3QA 4BKRA 3GLSA 3ECAA 3H1FA 4AZ3A 3W9YA 1C9NA 4UZSA 2BBSA 4GBGA 1T4BA 1R10A 4JEIA 2GVZC 1D0VA 1FU7A 3L8ZA 4UEJA 3OA0A 4PSUA 3WL4A 4QFDA 2VT3A 5FV7A 5A3SA 2ODTX 3BRWD 4R54A 2Y8EA 3I73A 1GPNA 4CV3A 1O5IA 3GLFE 1T1IA 2BFCB 2J46A 3E7FA 1HT1E 2WLTA 1E1NA 2XLBA 3A4TA 2VBIA 3HBJA 2P4SA 2OAQ1 2ZPTX 3GFFA 3PFNA 1SCBA 1BGWA 2WG2A 3T41A 3ZZTA 5KQRA 1DCTA 2QGNA 2R6CA 1NVGA 3QXGA 3TW0A 2ZSJA 5DTIA 4WN9B 1PGOA 2DH6A 3MGGA 2G17A 1A97A 3PGVA 3ER9A 1WUHS 3S2YA 1MB3A 4J4BA 1JWLA 3FTFA 1JE0A 1I5OA 1W5SA 1QBKC 2HPZA 1G5FA 2FZEA 4HO1X 5K99A 5K3SA 3KE8A 1HLFA 1VYHA 2W8BA 1TRKA 1JQBA 1H2HA 1I3KA 4IR7A 1KEEB 1EHCA 1SUBA 3AFNA 5C80A 4YBZA 5BN5B 4A2PA 3AHFA 3K4HA 1RRCA 1QGUA 3I2KA 1ISPA 1JXOA 1PSZA 3ZE1B 4V38A 5D5HA 2CK3D 1DJQA 4DJTA 3AF4A 2FVXA 3PXUA 4E51A 3OEHD 3LDUA 4TKUB 5FUYA 3ZS8A 4ZYXA 1G8FA 2G9RA 2ZE6A 3HL4A 4PSAA 3U49A 2HWUA 4HTFB 5ALDA 3VR4A 2YOGA 2YNMD 1P1CA 1RYEA 2AG6A 3D4IA 4TRNA 4C0WA 4ZDJA 3NTRA 3NRCA 2XBLA 1K86A 4O25A 3WMXA 1WDMA 4IV0A 1RYYA 1VMDA 1G20A 2XT6A 3EIFA 3QVMA 3MILA 2O7QA 3QU9A 1CZUA 3UJPA 2HR1A 1RWNA 1YBAA 3M3HA 3ND9A 4MYUA 1IN4A 3GPCA 3CKKA 3KWFA 4KTVE 3SEAA 2O8EA 5KC8A 4LMPA 2VKQA 4NCJA 2G6TA 3HVJA 1GP2A 1EKXA 3ZDZB 2FSUA 2H17A 4H7JA 1RAEA 1H3NA 4ZAGA 1YIOA 5AMXA 5KWJA 1D4OA 4EIWA 2JZOA 2AMYA 4LECA 3QE2A 1OI7A 4KYVA 5J2UB 4E09A 4EAQA 1U31A 2O8VA 2GBIA 2XQJA 4H31A 1C7FA 3WTBA 4EFMA 5CFPA 1R0CA 2EXXA 2PUBA 1G5RA 2B6NA 4R3WA 3ANMA 3IDFA 4BFCA 3NM6B 1HT0A 4P9NA 4ZV4A 2C29D 2R6JA 5K0BA 4NWIA 3RC2A 4EB0A 2CFRA 4OBXA 2EATA 4L5BA 1BXRA 4RDHA 4WW0A 5TQ0B 3W1VA 4BKQA 4DDVA 5K8TA 2JGRA 3T5DA 3LXRA 1Q7EA 4B79A 4PTYA 1JRLA 2JI9A 1L5YA 3O82A 4DT1A 2EG5A 3W0LB 1WXXA 1BVYF 3O92A 3O2QB 1TZKA 3ORFA 4JB3A 1MVLA 2UZIR 2RC6A 3HYRA 1B42A 3QOWA 4TWIA 3F67A 2B6HA 5CU7A 2W2KA 2WSSD 2IYSA 1P29A 4HGRA 1L7NA 4GOMD 6NULA 1YTUA 1BSVA 1TK3A 1WP9A 2RHLA 4FW8A 3TNDA 5IYZB 3NVKI 5JFOA 4R8RA 4OI1A 2MINB 2X0IA 3JAWB 4BIIA 4BQQA 4C6TB 1D2RA 1AJEA 4WY5A 5K2OA 4DLWA 3CM0A 3INGA 1QGOA 4XUCA 2AZXA 3ICWA 4Q3OA 2H48A 2IDJA 3CX7A 3EUEA 4KNVA 2FETA 4EHDA 2DPHA 1G3UA 2PA3A 2L19A 4YXWD 3PNKA 4KWCA 1NWCA 2R5WA 4IXWA 1MGPA 2QLFA 3K94A 4DDUA 2IJGX 2QY9A 3BPSA 3M4NA 3HDTA 3DOEA 4L5YA 1XRNA 4EPYA 1UBJS 2D00A 4WXPA 5LQKA 1JDBB 1A2OA 1XYVA 4FUTA 3TDNA 3KJXA 4N5NA 4QELA 2IZ0A 3K4QA 4V0OA 3PQ7A 3CBQA 5B2ZA 1JDTA 1NLZA 1Y4UA 4KQHA 1QVWA 1Y1TA 1RVV1 1KAGA 4ROTA 3T35A 3BJRA 5TB5A 1R4NB 3EG9A 3L7OA 4PFKA 4TSKA 2P9JA 1S02A 3GLGB 1Q91A 2QU8A 1SVLA 2QYHA 2YZ7A 3VBEA 4TWBA 2FMIA 3DOUA 2PUGA 3NDBB 1XVVA 3VFDA 2J4DA 1SOVA 1Y89A 4JEMA 4PLHA 4PLWA 3CUTA 4TQAA 4PLFA 3SQWA 2AOUA 3ESBA 1MGOA 2BP7A 4FEEA 4GPTA 4J1NA 5TX7A 1PSWA 4D9IA 3K2EA 4TOIA 2QT9A 4D41A 5IVIA 1EFRD 1QTNA 3RYHB 3OT1B 2XUIA 5BMVF 1KEEA 1XALA 1U3TA 1FSSA 2JGKA 2PQMA 2R6DA 5F3WB 3UM9A 3FBGA 2EWMA 5K5EA 4PCVA 3HWRA 3MWEB 3ONNA 3Q40A 3DLTA 4HVTA 1HYBA 4D0RA 3M49A 4BVJA 2I2CA 1VE7A 2ST1A 2WWXA 5B37A 1HSOA 3ZIUA 1V1RA 8MHTA 4Z1MA 3I1YA 1V5IA 3P9NA 3WMGA 2C07A 3QE0A 5CNMA 2NZ8A 3ZQ6A 4YPOA 4PWYA 4AJIA 5F2OA 3WO0A 1DUVG 1F8YA 3O95A 3PWSA 1A72A 3MB5A 2QVXX 5I7EA 5EJ7A 2AKEA 2WFAA 1BD4A 2O2CA 4V0KA 3V4RA 1IEXA 4EPVA 1ESEA 1XTBA 3L1VA 5EIAA 5CB6A 2Z83A 1R4ZA 1B16A 4IOLA 4AJ1A 2YIMA 3TRJA 5HKBA 4OB7A 2FE1A 4DPLA 4LDJA 1XDDA 2NSDA 1NLUA 3LWDA 5ELMA 4DDTA 1JHMA 3CSDA 5TT1A 5CH5A 3FFBA 3H9BA 3DVAA 4NULA 3D2AA 1DX6A 2GM5A 2ERYA 1U8XX 1NVBA 4WSOA 5AUNB 5EN4A 3ML1A 4BMPB 4CMBA 3ITDA 3K0BA 4BO7A 3I12A 5DBHX 2WJYA 4BU1A 1C0LA 4MDHA 4XRRA 3NKLA 2OHOA 4M9CA 4ZWNA 4L4SA 1AKNA 2YVKA 4QEZA 1I9CA 5DBEX 4EVQA 4QUHA 1MPTA 2JFZA 5DMXA 2A1TS 1H94A 1DAFA 1BXGB 1JKFA 1HF3A 1NFQA 2Z2XA 3F96A 3OQBA 4QBGB 5B1HA 3H9GA 5F3RA 3D02A 3Q85A 4KAXA 1F0KA 2MR6A 4Z99A 1CULC 2XZTA 3EQ2A 2IK8A 4OJQA 4ZU1X 2DCUA 3H11A 3C5CA 5AQEA 5D87A 1L1RA 2ECOA 4TXHA 3P2OA 5JZMA 3QYPA 1G5HA 4D9KA 3GLFB 1Z4QA 4M98A 2CLFB 4EF4A 3ZDXB 3B1XA 3GJTA 3PL1A 1P1BA 1MU0A 1J0DA 1I3LA 1ORIA 2CFOA 4NU6A 1L5GB 1Y34E 3VHXA 5F5LA 3ZBPA 1NP7A 1U6KA 3G7SA 3MCWA 4OJKA 4GPEA 2PSFA 2OSVA 4LOJA 1STOA 1PX0A 3AHGA 4OH1A 1AKMA 3GJ8A 4KMRA 4PLPA 3DGEC 2P35A 3B1JA 4FGUA 5SY9A 3U26A 3K5IA 1T4DA 2EZUA 2G1AA 1GWNA 2HCFA 2QMOA 2DPYA 2UVPA 3C7KA 3FFAA 3I28A 3JAKB 4IL5A 4IVNA 5DO9A 2XVAA 3W5VA 3CLTC 2Q8NA 2DF8A 3DXYA 1C1XB 2H18A 2CNLA 4FBLA 1L7VC 4BGEA 4R69A 4CXMA 4Q7LA 5A5VA 2EJBA 4OA5A 1S9HA 2FX5A 3BAFA 4MX8A 1IUOA 4MGIR 4IH1A 3WQRA 3O1IC 4MUHA 2F1KA 1KOJA 1EHIA 4ALKA 4JWKA 4L7QA 2BF4A 3FGZA 3WWCA 2NU8A 4LJ4A 5A9SA 1KEPA 4ZHQF 1TLLA 3I6BA 3WV5A 4HDMA 1T8UA 3P52A 4D9HA 5CGZA 1F6WA 2QR3A 1TD9A 2ZSKA 1KSJA 3N2ZB 3NCHA 3CE6A 3H1EA 1VMAA 4FZRA 3U31A 1PQ4A 1M6YA 3OTIA 4C2TA 1MV8A 2YWHA 4C6RA 4X54A 5J47A 4Z4FA 4B7XA 1J39A 5FL7D 5LXTB 3HUDA 3IUJA 1DRVA 1IM5A 1Z0SA 4MQEA 3T7RA 4IIUA 4WINA 1X80A 1KI9A 2ZB3A 1KTVA 4GAEA 4MLDA 3A1CA 1MVNA 5REQB 3LY8A 1X19A 3K9WA 1H2AS 1FJGB 3MXOA 2PXAA 2PZKA 4CKCB 3R3JA 4P22A 3FNHA 3MELA 4XUDA 4B81A 3LCMA 5KS2A 1AC5A 1IAQA 3OZWA 5IAOA 4OV6B 4AJEA 2E4AA 2X1HA 3AVWA 2ECQA 5DYGA 2BFFB 1CRWG 2O57A 3E05A 3UMBA 3TWOA 3SJUA 4PPYA 1UAGA 4QBFA 3ZNPA 4EHKA 1OH6A 1MO5A 4J76A 2O3TA 1RACA 4LY3A 4O2AA 3E9NA 3KVRA 5TQ2B 2CHUA 2BCGY 2D5AA 1H42A 4UVIA 1P80A 2FEXA 1DBQA 1ZSNA 4MV1A 1Q22A 4D0LB 3KBBA 1QDUA 3DVQX 2ACVA 3B70A 3HCDA 4HGNA 1JLHA 4KQCA 3AKDA 3HDQA 2P6OA 1UBCA 1UJ5A 1ZD1A 2OR3A 2RG1A 1U5CA 3DE4X 1FNMA 3HACA 4WXRA 4ZRMA 3VR2A 4A2CA 1RIFA 3L8GA 1DADA 4W1QA 1XP5A 3N7AA 1YKFA 5KOJB 3GZNB 2GPNA 3UGKA 1YAJA 4HDAA 4X64B 3Q8MA 4OB6A 3BXGA 1WABA 2D0IA 3PPYA 3A31A 1UBNA 4Z51A 4Z0TA 1OGJA 3FVRA 3PQ6A 2JASA 2ZKLA 3TMKA 3BGDA 4RY9A 3ZLVA 1EFUA 3P20A 4QUEA 5BSVA 1DKOA 1BTOA 2LWIA 3RCBA 4CDMA 1JIUA 2JGAA 4RTPA 3NM4A 4PPGA 3T8YA 4ZAFA 4UNRA 2AFIE 3AB8A 3A0RB 5DGDA 3IRVA 4O4JB 4F3NA 4CR8A 3NUQA 2OV6A 1EGHA 2PXHA 1U28A 1ZIDA 5KJCA 3CZMA 3A6KA 1MENA 4CLRB 3D7KA 2OXIA 5AM1A 1AKWA 2GHQA 5EJ4A 4AY4A 4OSOA 1AVTA 5FR2A 4FN4A 2YWCA 5FBZA 3D6TB 5IAAA 1T4CB 4UKDA 4JBHA 4IIJB 1WCYA 2WG0A 4N7MA 3RIYA 2OFXA 3A6GA 3A58B 4DXHA 3MJDA 2RG7A 1Q7TA 3JATB 2YYYA 3L0CA 4RS4A 4TL6A 4BEJA 5ALLA 4ZJUA 3B2NA 1XZKA 5BSMA 2C2ZA 3JASA 4M87A 3RSFA 4YCMA 3K8QA 2IYXA 1CC1S 3DE3X 4NS1A 3EVDA 4IDHA 5E6RB 3D31A 2H9YA 2HT6A 2IXEA 1M34B 4TKMA 4EG3A 4MCAA 1GUZA 4J91A 1U98A 4I1IA 1QGYA 4X6YA 3DMFA 1G55A 4G8JA 3ZC3A 4ODIA 1JYFA 1Y8QA 1TKCA 1GTRA 1ILEA 4AICA 4AG5A 5FQOA 3D0KA 1UJNA 4ZIRA 1ZN7A 4AP9A 3WK9A 3A9CA 1SKUA 4HB2A 4KYIB 5IX8A 4BTLA 3QHAA 1S8OA 5J4KA 4MLZA 2XTMA 3WBFA 2O2JA 3FZYA 1EX9A 4BLWA 2EJCA 4II3A 4E1BA 5TSDA 1NNEA 2BGJA 2FFBA 1IY8A 3CA8A 3Q3IA 1A5ZA 3HR4A 3DOFA 4WRRA 1PZNA 5BOVA 5C1BA 1VCNA 4GT1A 4EG7A 2HV8A 3L7LA 1UWVA 3KYCA 2PKQO 1EGQA 2WU4A 4E5MA 2O0KA 2CJXA 3UJCA 5HE8A 5IDWA 1U1EA 2IS2A 1Y1SA 2JJ2A 1GM5A 3JQBA 4GSYA 5KNDD 4QVKA 5EG5A 2OKGA 3ZZUA 2VDPB 4WTOA 3ETJA 2ZBQA 3H19A 1G5TA 4G5YA 4AZTA 4YAEA 3GDWA 3H8WA 2ZITA 3FTPA 3OZBA 2LCQA 3IIJA 1O94A 1WKBA 5HG0A 1QHYA 2REOA 2X2PA 4HLDA 4WN9A 2C31A 4UVEA 2ORED 3TD6A 3OTWA 5A2GA 5E6SB 1H6AA 1AXGA 4H18A 3ZEIA 4CHTA 3OKFA 2VLIA 4G8BA 3T3HA 5EVCA 4M53A 4LXTA 2UZAA 3NIDB 2HUNA 4V1CI 3NT2A 3QU4A 1UDBA 1YUMA 5T3UA 4LVUA 2I8CA 1U1DA 3DH0A 4DIUA 4KO8A 4YCAA 2OSBA 3WL7A 4BFVA 4FS8A 3H5VA 1SQ6A 4B87A 1HG0A 1L4KA 2PTHA 5DWDA 4OHZA 4ZYWA 5JS6A 5TS2A 2ZAIA 3K9CA 1GKYA 2EFEB 4UNQA 3I83A 2CLHB 3PP8A 4K0KB 1OLXA 1RWVA 1HUQA 1P7PA 4HP8A 3DV0A 1DAKA 5I8ZA 2O6HA 4HFRA 2WMYA 2QV7A 4FMCF 4PC6A 3EJWA 1E2LA 2PQ2A 2QVCA 4Z9FA 5ENVA 5JZOA 4MI6A 1CS4C 2I3ZA 2RIRA 3JZDA 3OU2A 2FQWA 2PCLA 1IBRA 1SHLA 1HBJA 4FUQA 2QW8A 4A6XA 3R6WA 1XWWA 3KL4A 4N5IX 1D5CA 3JQGB 3L7AA 4GDMA 3EZGA 2OB2A 1PNTA 3BXHA 2HD4A 3HWSA 2HA5A 3KYDA 2GT1A 3HBMA 4UD6A 1OXSC 4UW9A 4RPLA 3C97A 4MUYA 2GHIA 2P5YA 1C3OB 3KT0A 5ILGA 1VI5A 3KEQA 3V8QA 2QJOA 4MA0A 4KIGA 5FWXA 1JG2A 4O2BB 2BKAA 3FI9A 5B6JA 1S7GA 1T1JA 3UOGA 2C7QA 2NUBA 5IZ4A 1VJCA 1KBZA 2WC1A 2WFLA 1CQJB 2OLKA 3I6ZA 2PMCA 1SC4A 2NAPA 3AEZA 1C9KA 1PIWA 1O7JA 3D6VA 3MVEA 1DE0A 4PLZA 3UPTA 1B23P 3E53A 3DTNA 5JYEA 3GPBA 4RHXA 4XVCA 5G41A 5KJ6A 3F8SA 1XRLA 1WPRA 1J2RA 1AHIA 2HHHB 2FXVA 1CB0A 1IZ9A 1QG2A 1XWFA 2VK8A 2YVQA 4QTUB 4BRZA 3H9JA 3MA0A 5DM60 2R7LA 1YC2A 1M66A 2PD6A 1HDGO 5FUXA 3WYGA 5A3QA 3NC1C 3AOEA 3FY4A 4LBYA 2WYVA 4ZO6A 1Z5ZA 4HMOA 5I8PA 3CVVA 3PCTA 4TS9A 4MYHA 3T5BA 4DA9A 2E4YA 2I7XA 4RZXA 3QPWA 3QXSA 1QUFA 2ATCA 4RQUA 4AO6A 5EJFA 4D97A 4E31A 1E0AA 4AY5A 1EK0A 1ZMXA 1W29A 1BE8A 3M9XA 1W2GA 2L69A 3KIPA 1ZNYA 2YYSA 2FPWA 4UE2A 1RYNA 2JIPA 3HHPA 4Q01A 1KFKB 1J8YF 3PT5A 4CEIA 2RFLA 3PUKA 4EKYA 2BR5A 1T1EA 1V8PA 4DA8A 3SK0A 1ZW6A 1N77A 3EMKA 2OD7A 3UC5A 1EUZA 2CXQA 5JVDA 3ZUGA 3O4RA 2LV8A 3ZPXA 2R6FA 3OE7D 2P6UA 3MBKA 4X97A 1DXQA 1X3SA 4IDOA 4N9WA 3AZQA 4X60A 2ZQ5A 1E2EA 4MRVA 1G8GA 1J1IA 1MX3A 4TQ9A 2ZIFA 2RKOA 5DHQA 1ZCFA 2B0CA 2WE8A 1KU6A 2DRIA 1SM4A 3UA3A 4FFWA 4A91A 1GNRA 1G7SA 5TNXA 3QLUC 1DKQA 2OFPA 4UBIA 4LA4A 2ZBRA 3ZDRA 1N78A 1TD1A 2HDNB 4FLEA 2WMDA 4EG8A 4YRDA 3QU7A 4DPMA 2XHZA 3DT6A 3QVJA 5J2TB 1IB6A 1WV0A 2GCEA 3LDFA 4U2KA 1AU9A 2DQYA 2Q2VA 4P4UA 1OBFO 1UFRA 2VF8A 4II2A 5FPQA 2NQTA 2I0FA 1XZCA 2YJGA 1F3OA 4N18A 1ZLYA 5J1TB 3T5MA 1YFZA 1ZN9A 5B3LA 3EZFA 1IMOA 3NAQA 3MS2A 4PS0A 5H16A 1E9AA 3K05A 5TEVA 3O1LA 3VHLB 1QQAA 1W75A 5KYWB 1R7RA 1JSLA 1EWVA 2YHSA 3DCYA 4GKVA 1LBSA 2FFQA 1OBVA 3F98A 1J8FA 4RIFA 2QXUA 4Q93A 5BY2A 4P58A 1HI9A 4RZUA 2IP4A 1JLLB 2WDPA 3PF8A 5EHGA 3B5EA 4QXAA 4YAUA 5IT9A 3UOAB 5SZIA 1P0CA 2FP4B 1PR6A 2QNRA 4EELA 2VXBA 3FPLA 4P4SA 3ASVA 1ZK2A 1YI1A 2A7XA 2R2AA 4I36A 4AWAA 5LSAA 2PX0A 3AESB 3FR8A 1VDMA 2W2OA 2DT8A 1FFSA 1GXSA 3BMNA 1OXUA 2X3UA 2XRMA 2G7MC 3L1HA 1XZEA 1NM5C 2G5CA 3U3MA 1PAUA 3NXKA 5DNDA 5BWCA 1N36B 3JAWA 2YMQA 3IEMA 2GBLC 4P5EA 3UJBA 2HADA 4DV6B 1I4TD 1GNTA 2Y1CA 1I1OA 1YR2A 3QVKA 3SBDA 1EK5A 1YR7A 3CLUC 3I1FA 5EUQB 3UAZA 1KQ3A 3BIFA 5CCXA 4YY3B 3FMPB 4ESVA 2H5EA 2W6ZA 2UVQA 2AOTB 3U5TA 4GZMA 3IBSA 2IEZA 4KSYA 1JA1A 1VYTA 4XIYA 4P4LA 1T9GR 4D3ZA 3MTIA 2OC4A 3N0VA 3EGCA 3WRVA 2ECFA 2HU8A 3OZRA 3X2EA 4AS1A 2CMGA 4YREA 3QF4A 4XGNA 6GPBA 3WRYA 3BCHA 1OREA 2D0OB 4AW9A 3K70D 3GEIA 5C37A 4P32A 5JROA 3UFXA 1A5AB 2G70A 3AK4A 1VLHA 3SFTA 1W1IA 3REQA 3WKEA 4B6GA 4PRYA 1ENYA 3P9YA 2WJZB 2RGAA 2PQ6A 1D7OA 1M5UA 2PUHA 4LNHA 5HZHA 1Z4MA 3Q0IA 3L46A 1NPTO 1SIWA 3JWJA 1M2NA 3OLWA 1E5XA 2I29A 3DWFA 3MJ4A 2W2NA 4QVIA 1W0JD 4I9HA 2NT3A 2F62A 1FMCA 4FFDA 3AEQA 1RJFA 2J1LA 4BB0A 2PZEA 5EJ8A 3V1YA 4MICA 3BCUA 4IIXA 3DWGA 4E21A 1UC5B 1LLCA 1GEEA 2PUTA 3EXEA 2BGGA 4AJ9A 4DCCA 3MLBA 4UNPA 5EE1A 1NXXA 2K4MA 2OAGA 2WUFA 1LV7A 2BH2A 1MOZA 1OYOA 1OX4B 1Y5NA 4H3VA 1M1NA 1UMBB 3COVA 5FLEX 1G8YA 1MO3A 4DWOA 4BYGA 1XZPA 2FZGA 4OFZA 2BHLA 1TKRA 1RI5A 2QG4A 1KETA 1UBTS 2V54A 2LE0A 2OXRA 3GOHA 4FONA 4JGIA 4ND4A 4DSTA 3GPLA 4DRYA 4BP1A 4C0SA 4RABA 3WDLA 1N1DA 4R31A 1PTKA 3ZH2A 2QRMA 2ZSIA 1VSBA 2WLSA 3KFXA 3KP1A 3OBBA 4H7FA 4ALJA 5K6AA 3P0IA 4RLSA 3MWFA 3FPAA 3NO4A 1ADJA 5ALXA 2X86A 2RDMA 2JAPA 3PDWA 3ZUPA 4D9GA 4C5CA 2ZKIA 4KXYA 1UL1X 5LKRA 2DVMA 1QIGA 1E32A 1WUKS 2HU7A 3IOYA 4CLHA 4FXPA 4NABA 4AXBA 2C3OA 2AZMA 1UPUA 2IEYA 3I2IA 4A1FA 1CRPA 2J9XB 1GARA 2PIDA 2Q9AA 3ILVA 1RYDA 1G3QA 2QT0A 1G66A 5B7QA 1GRRA 3S40A 1K3UB 3FRJA 4RTRA 1UKZA 3T9BA 5TQVA 3W6PA 1THTA 1KMQA 3DHWC 4QWMA 1T9HA 2PSSA 4MUMA 1M2OB 3JZFA 3INRA 2C2HA 3EGDB 1F06A 4FNAA 1R4AA 4LYAA 1CE8A 4OI2A 4OLJA 2XDQB 4RZ3A 2ZWOA 3M89A 3TDMA 1XTIA 3VHQA 4B2LA 1GRNA 3JARB 4BQFA 2QMYA 3I42A 1L5RA 3EVBA 4I4NA 2G71A 2V6JA 1UC4B 3M6MD 4G2NA 1ZHOA 3M4XA 3UYLA 4I1YA 1LD3A 2P6PA 1SPXA 3CUUA 3TRIA 2GZ2A 4DLYA 2XUDA 4RYDA 5JSQA 1LDMA 4YR7A 3RW9A 4KMSA 2OCGA 3MWYW 2IWHA 2X7JA 4FHZA 1PJAA 2VDMB 4CG0A 1SVMA 3CCCA 2R0QC 2CNWA 2VDVE 2VYFA 4KJXA 2X8BA 4DMKA 5F9HA 5A4KA 1WSDA 3ZK7A 4S05A 1VC2A 2D8AA 3IAM1 4OOEA 2G8NA 3W6ZA 3SYNA 1CCWA 4EDFA 2FSVC 5AW0A 1QK3A 1U63A 1C81A 1J9ZA 1ZOPA 4WLEA 4WKGA 2ZDHA 3A25A 5JAIA 4C2BA 1L5QA 2PU7A 2CDCA 2JJ2D 1JU3A 3HCPA 3WLEA 1X1DA 3WGOA 1QIJA 2QYSA 3CJRA 2IOFA 3UFXB 1Z8DA 4MWBA 1J1ZA 1J25A 2ETVA 1Y7TA 5KU1A 4DE5A 3LZ6A 3SSMA 3IKMB 2VTDA 4PEVA 3EASA 1RYFA 2C82A 3HUEA 1NLMA 1ZICA 4LDAA 3AYXB 4R81A 3I5UA 2E0IA