3CKMA

Lpoa (yram) c-domain from haemophilus influenzae, a regulator of pbp1a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
318
structure length
318
Chain Sequence
SQIGLLLPLSGDGQILGTTIQSGFNDAKGNSTIPVQVFDTSMNSVQDIIAQAKQAGIKTLVGPLLKQNLDVILADPAQIQGMDVLALNATPNSRAIPQLCYYGLSPEDEAESAANKMWNDGVRNPLVAMPQNDLGQRVGNAFNVRWQQLAGTDANIRYYNLPADVTYFVQENNSNTTALYAVASPTELAEMKGYLTNIVPNLAIYASSRASASATNTNTDFIAQMNGVQFSDIPFFKDTNSPQYQKLAKSTGGEYQLMRLYAMGADAWLLINQFNELRQVPGYRLSGLTGILSADTNCNVERDMTWYQYQDGAIVPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of YraM, a protein essential for growth of Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Biosynthetic protein
molecule keywords YRAM (HI1655)
total genus 101
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2008-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ckmA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ckmA01
3N0XA 2PUCA 2E4ZA 4OBBA 4WZZA 5EWMA 3DGFC 5PNTA 4DADA 1TJYA 1K68A 4EVRA 3VNAA 5B3JC 2MYNA 3FMVA 3IPCA 3KSMA 5KQMA 1DZ3A 3OM1A 3KS9A 2GWRA 5EWLA 3CHYA 3CS3A 3GWGA 3QEMB 5IUNC 3L6UA 2IYNA 8ABPA 1EAYA 2IPAB 3RVJA 1RZRD 1APBA 4YCSA 4W5QA 4WXMA 2GX6A 5C5CA 3BREA 1JWLA 4MS1B 3EGCA 4YP9A 4MR9A 1XHFA 2ID7A 2R25B 1U8TA 1YK1A 1TMYA 3MA0A 1XWWA 3NBMA 1GCAA 4FE4A 4WT7A 1YTUA 3RVPA 4F3TA 2E4XA 4N47A 1J56A 2H0AA 1BDIA 2A9QA 1BDJA 1QP0A 4GNRA 1KGSA 4ZYLA 1Y1LA 5GOTA 2F8TA 3URMA 1JLKA 1DP4A 3VNBA 1JH9A 2JCGA 4MQFA 4CBVA 2QSJA 1GLGA 3HDGA 1AB5A 1GUDA 3TX6A 3O21A 1I3CA 1XHEA 2WMYA 3OLVA 5T7BA 1Z15A 4IMIB 2PL9A 1D4ZA 4PEVA 2GKGA 3OQNA 3HXMA 5JNTA 1L5ZA 4Q7EA 4XASA 2LP4Y 2FW0A 1QO0D 2R4QA 5TQJA 2HSGA 4Z4FA 3LUFA 2RJOA 2NT3A 3JVDA 1RXEA 4H60A 3UUGA 1PNTA 1PUXA 2QVGA 4YGXB 4EVQA 1LJLA 4Z4IA 3LKBA 4HNSA 2IKSA 3QLVA 3P9YA 5HKOA 3GT7A 3LUKA 3Q15C 4YLEA 5TQ2A 4EYOA 3JTEA 2RGYA 5CNMA 1EHCA 3EAFA 5JNSA 3H1EA 4KFCA 2JRLA 3HUUA 4LE1A 4IMJB 2E4UA 3HDVA 3RVRA 4E7PA 5IEBA 1NY5A 3JPWA 3GYBA 2FLWA 4RKRA 1USKA 2FN8A 3KYIB 2A9PA 5IUJC 2QU7A 3HJFA 2FVYA 3OO1A 5HM6A 3C6QA 3N6VA 3QX9A 1YK0A 3H5VA 5FWXA 3H5TA 2Q5CA 3SY8A 3TD9A 1NXVA 5E3JA 4JB0A 4MS3A 1ZN2A 5KWSA 3E61A 1Z18A 5GQSA 1P6UA 2FKAA 1D2AA 3T95A 4ZJPA 2X7XA 4F8JA 1JFTA 2FEWB 4RZSA 2FQXA 3O1IC 3LFTA 1EWKA 4YS6A 6ABPA 2YHBA 4MYRA 1RZRA 3RH0A 5FWYA 5IEJA 3D8UA 3O74A 5CNIA 2A9OA 3NNDA 5KQPA 4KNYA 1NATA 1P8AA 1OXBB 4LZLA 1AB6A 5BQ3A 1JYFA 2HJ9A 3KHTA 3O75A 1FQWA 4HYEA 3L49A 4L85A 2VUHB 3IPAA 3RQIA 4O5AA 3HZHA 4YRZA 3SNKA 4E7OA 5I4CA 1EWVA 2JVKA 4YV7A 1SD5A 4JA2A 4F12A 5F64A 2L18A 4OLAA 4FE7A 3NHZA 1E6MA 1ABEA 5EWJB 1JFVA 4KMRA 3ROFA 3HVRA 5IBQA 1NXTA 4N0PA 1VKRA 3ILYA 4MR8A 3OO0A 1DRKA 5TQ2B 3QX8A 5DLEA 3CG0A 2PUDA 2E4YA 4IGAA 2GI4A 3KTOA 2J48A 5TPWB 1ISSA 4MLCA 3G1WA 3LUDA 2R47A 2PMCA 1C4WA 2I6FA 3H5LA 1ZITA 4KVFA 4G0YA 3IP9A 3LUAA 4EUKA 1S8NA 2PE5A 1YS7A 4KRFA 3QLUA 3C3WA 2L19A 3Q9SA 2FLKA 4G0MA 3GBVA 2FSPA 1Z16A 3M9WA 2JB9A 2QVCA 3N0WA 4OTZA 4EVSA 4EY3A 1DCFA 1JBEA 2CHFA 2MYPA 2TMYA 4G0XA 4JP1A 4PZ0A 4RXMA 2LPMA 1U2QA 2FMHA 4MGEA 1Z12A 3EULA 1JF8A 4MLDA 3TMYA 3F6CA 4GPAA 3H1GA 1RXIA 1A2OA 2GBPA 4Z99A 5HSGA 9ABPA 2M1ZA 4TLLB 3CNBA 5TPZD 3RVNA 4MPTA 3OLWA 4D6YA 3QLVC 1QKKA 2CHEA 1USIA 1JYEA 3T6KA 1DCMA 2KYRA 4OG2A 4LE2A 1MB0A 3OLXA 1W9HA 3O2JA 4MQEB 4JOQA 3C97A 2FQWA 3BILA 3CZCA 3CZ5A 1DCKA 4G0QA 2VK2A 1SRRA 4ETMA 2PJUA 2PKXA 4YWHA 4KV7A 3LKVA 2HQBA 4EYGA 2OQRA 3KKEA 1BDHA 3NHMA 5TPZA 1YVUA 4LE0A 1JHZA 4FB4A 1JDPA 4RK6A 2FQYA 3HEBA 4RK7A 3QLUC 1QP7A 3QK7A 4MQEA 2VUIB 1ZESA 3DGEC 2E4VA 3I45A 5JNRA 2IPMA 4Q6WA 1D5WA 4IF4A 2PUFA 3N75A 4JB2A 4MR7A 4ETNA 4IRXA 4W5RA 4EGSA 1GUBA 3EODA 4L4UA 4TMYA 1VPWA 2P9HA 1M2FA 3QELA 2FEKA 2NZVG 4RK1A 3O2QB 3KG2A 1R8JA 4MR8B 1MAVA 4QPJC 5IUKC 1NXOA 2B4AA 1F51E 3EQZA 2RJNA 4RU1A 4Z4HA 2HQRA 5EWJA 4KPYA 4S04A 3IP5A 3JY6A 4N76A 1EFAA 3LUJA 3LUGA 5B3JA 1QQAA 4LDAA 5TQ0A 4Q6BA 4EYKA 1DBWA 1DBPA 4G0ZA 3A0RB 3TO5A 3N8IA 5KC9A 3RVQA 3T38A 4D74A 1DC8A 1JX6A 1PHRA 2LIVA 1U0SY 4RK0A 5BRAA 4RV5A 1BA2A 3FFWA 3Q7SA 3F6PA 3FFTA 1A0OA 4LRQA 5T3YA 2F8SA 1MB3A 2NUBA 4RS3A 4S05A 3CFYA 3MMNA 3I09A 4MS4B 1DG9A 3QEKA 2FXIA 4NICA 1USGA 3GL9A 4OLBA 3TB6A 4NQRA 1SXHA 1CYEA 4UHJA 4WXEA 3OM0A 3JPYA 4QYWA 6CHYA 3SAJA 1E6LA 5HQJA 1E6KA 2IOYA 3OLYA 2NZUG 3KJXA 4RDCA 5FBKA 2WWVD 4F11A 3DLBA 2PUBA 4G0PA 1FFWA 1PEAA 3RVLA 3GRCA 2MSLA 1ZY2A 1URPA 4MAAA 3F73A 2HPHA 2FMKA 3OQMA 4RKQA 3B2NA 4JASB 4ZPJA 2IPNA 1D1QA 3RVSA 4XXHA 3Q7RA 1ISRA 1LBIA 3A0UA 3MQ4A 5CNKA 1QP4A 1RPJA 3DZDA 1P2FA 3G85A 3O1HB 4KK4A 4M88A 3LOPA 4PICA 3CRNA 3MM4A 2QXYA 3NNSA 3NNNA 1WETA 3M6MD 1Z2EA 1BAPA 2FEPA 4ML3A 3R0JA 3SM9A 1M5TA 4G97A 5JS1A 4MRMB 4WWHA 4RY0A 1CEYA 1P6QA 2JK1A 3D02A 4O1IA 2E4WA 5EWLB 2JBAB 3HS3A 1FFSA 5TQ0B 4HNRA 4Z4CA 4JAVC 3OQOA 3I5AA 5TPWA 5C5EA 1W25A 5TE9A 1QMPA 2PLNA 2R48A 4XFKA 4DN6A 2M98A 2JBAA 2IPLA 5IULC 4IILA 3FGZA 1ZAYA 1DJMA 2HQOA 3DBIA 2DRIA 3EDCA 4TLMB 4NCBA 3HCWA 1VRVA 4MRMA 3H75A 2CD7A 2QR3A 5JNUA 3C3MA 4NCAA 5JNVA 3UK0A 1JL3A 1Z13A 2QV0A 4Z9BA 1QQBA 1CHNA 1KRWA 3W9SA 3H6GA 1NXSA 2MYUA 1ZGGA 1PNRA 4HNQA 1TVMA 3KCNA 2L17A 1TM2A 1QO0A 2AYZA 1LK0A 2VYCA 3E3MA 2QW1A 4XLTA 4RK5A 5BR1A 1OXKB 1L5YA 4RY8A 2PAFA 2WRZA 1FSPA 1NXWA 1C0EA 2JVJA 2QZJA 3MF4A 4Z9AA 4RK4A 5FBHA 2RDMA 3K9CA 4B09A 3CLKA 4N41A 1IIBA 4H3KB 3HV2A 2PL1A 4P1ZA 3S99A 5FWYB 7ABPA 1DRJA 2LUOA 2WJAA 5KQLA 1VLZA 2ZWMA 3LUCA 2W42A 3DLHA 4RXUA 4ZMSA 2NT4A 2H3HA 3RVOA 1U2PA 1DC7A 5D2CA 3JS5A 4MR9B 3FFXA 3BBLA 3C3KA 2PUAA 1D1PA 1Z25A 1KRXA 1JFSA 1T34A 1NXXA 2MSKA 2IDMA 5DCLA 1EWTA 2OENG 4YR7A 1YIOA 5DTEA 1DBQA 2O20A 3IDOA 1ZGZA 3BRQA 3N53A 4G0OA 4KZKA 3H5IA 2LBPA 3H1FA 3OMWA 2FMFA 2ZAYA 5FWXB 4O1HA 4W5TA 1ZVVA 3IP7A 3KYJB 4WUTA 1KMIY 3MIZA 4XARA 4MS1A 3T8YA 1Z17A 4OATA 1YMUA 1ZHHA 4D6XA 3QLTA 4ZMRA 1ZH2A 3O2SB 4MS3B 4N0QA 3IP6A 1LBHA 5ED4A 1Z2DA 2MYTA 4LX8A 1A04A 3UKJA 4RXTA 1MVOA 1HEYA 2B1JA 1RNLA 2FN9A 1U04A 3F7NA 4EYQA 1ZDMA 5KQGA 2MSWA 2P4UA 3QEMA 3FDFA 3H5WA 5BRJA 4Z4EA 4Z4GA 1ZH4A 3HUTA 3KLNA 3ROTA 3A10A 3K4HA 4PE5B 2BGGA 3ILHA 1E2BA 3GV0A 4RSMA 1M5UA 4Z0NA 3OLZA 4QYMA 1B00A 4KQ9A 3Q7TA 3O1JC 3N0RA 4F06A 2WB4A 3LTEA 4XAQA 1ABFA 3LUHA 3JVIA 5DKFA 3QELB 5CNJA 3RVKA 1H9CA 3HM9A 1TLFA 5CHYA 4Y9TA 1BVHA 3Q41A 4H3HB 1NTRA 4MR7B 2WJWA 3HSYA 1FFGA 4NV3A 4UHKA 3SQNA 2CWDA 3I42A 2JVIA 3CG4A 1GCGA 1YMVA 1QPZA 1YS6A 1UDRA 3M9XA 4W5NA 1K66A 5IC5A 1NXPA 1LJUA 4ETIA 1SXIA 3H5OA 4LDZA 3GA5A 4MS4A 5JNWA 3EJWA 3OMXA 2WY2D 4KK3A 3HK2A 4PYRA 2ID9A 3LMKA 4MQFB 2YHAA 5ABPA 3H6HA 3MYYA 4N03A 3HO1A 4W5OA 3SG0A 4DQDA 5KC8A 1QNLA 1Z26A 1F4VA 3A3KA 4RWEA 5EWMB 2PUEA 2N9UA 4G86A 1PEYA 1M2EA 3CTPA 3EQ2A 2AYXA 1JDNA 3KLOA 4RY9A 2PUGA 3CU5A 2L2QA 2A9RA 5KI6A 3CKMA 1SXGA 2V0NA 2FTKE 3GBPA 4P98A 5IX8A 2FMIA 2XDYA 5JS2A 4YO7A 3BRSA 4KQCA 1MIHA 5DGCA 4KREA 4QICA 4TN5A 3RVMA
chains in the Genus database with same CATH superfamily
4OGKA 3ZBTA 4R5MA 3UJCA 3VO8A 4B34A 4X3PA 3OE4A 3OPYI 3OT1A 3GGSA 4MO9A 4FBMA 4MIEA 4OQZA 3W8EA 4CM4B 5BSHA 3LJKA 5IANA 1T9AA 1UM9B 3ANSA 4AG6A 3VYRB 3O4HA 4YXWA 1E2PA 3KS9A 4HQKA 1FB5A 2ONCA 2B82A 4O4IF 1IHXA 2PGOA 2PZ8A 3QEMB 3W6OA 7MDHA 2NIPA 1E98A 4RULA 1YRBA 2CE2X 4O4HF 3C3AA 2J6HA 4OAPA 1QG6A 3SD7A 4DHEA 1RZUA 3OBIA 1U2DA 4FP9A 2ETXA 4YCSA 3ZKAA 4ZYXA 1YDWA 1QGDA 1JECA 1Z47A 2C9BA 4GP9A 2V3WA 3DV2A 3G2QA 4RE5A 4E7OA 3EGCA 1PQPA 5JIBA 4Q15A 3MZ0A 3O4JA 1YTUA 1N3BA 3TTUA 3RC9A 2C04A 1R4AA 3P52A 1H6DA 2CK3A 3O8OA 2IH2A 3ICEA 4OAQA 3HKBB 4XPIA 2PNJA 3VKWA 5B3KA 4LRYA 3G7NA 1X7ZA 2HH9A 3EE6A 5M2QA 4CBVA 4F2HA 1MB9A 5CYFA 5E6UB 2AL7A 4FVTA 2QN6A 3VPCA 1P5HA 5HX7A 1HEIA 4GPZA 1EFKA 3PYLA 1XUOA 3CF4A 2WG0A 4I81A 1QH0A 4ENSA 5IASA 3BXZA 1O6BA 4QXQA 4D2IA 5JBQA 2ID8A 4JBLA 1LTKA 1PQUA 2ECPA 2UZIR 1EM8A 4QQNA 4Y2TA 5FTNA 2W6QA 4DCPA 3BB1A 1QO0D 2HWWA 4JP8A 2JGDA 4PF1A 1F60A 3SKVA 3KVRA 2QYTA 2NT3A 4G5OA 4D4MA 3WAKA 5LIPA 1CR4A 4CW7A 3P9QA 1W8DA 4I6EA 4E31A 2OE2A 4EMBA 3K0AB 1F4LA 3ZJYA 5DHUA 3RASA 3LUPA 4DRZA 3HCCA 1RQRA 3Q15C 4YLEA 1ZBDA 3DXXA 1DJOA 3D3KA 1H5QA 2NZ2A 2JH3A 4JX9A 1YR8A 1GOTA 3EYAA 4ENPA 3C48A 2ZP1A 4AXXA 1LJ8A 4DWOA 3VKGA 3EDRA 1MAWA 2J09A 4Q66C 2J3JA 2ZSKA 3TFQA 4ENUA 4AAYA 2R1UA 1UJ4A 1JFRA 3B3JA 2WSLA 4O2AF 4KX5A 2J59A 2YZ2A 3AF5A 1AIPA 1UJ5A 4DS3A 1XDZA 3PDUA 2O8DA 1ZW6A 4AS3A 4XB1A 2ZB4A 2CVQA 3OJCA 1U99A 3O91A 5FBRB 3S2EA 1I2ZA 4FN5A 1LCIA 2RK4A 1Q16A 2N47A 2VJCA 2QAGA 3D4BA 4IICA 3DKRA 5FA6A 3NBUA 1NC1A 4J7AA 2HWYA 3LCCA 4OI0A 1DO8A 2JI7A 3RHFA 3W06A 5AT1A 5KYXB 1ZCBA 4I1OA 4M0FA 5BT8A 3OCZA 1FRFS 1BYIA 3R9IA 2XF8A 1VBMA 2Z09A 3COYA 4EO4A 2P0EA 4NBWA 2PY6A 2YHBA 3RSCA 3WADA 3DMYA 1E32A 5B7QA 2I9PA 4RNCA 3FCAA 5FWYA 4KN9S 2YIVX 2Q99A 1G2OA 3SXUB 3EXG1 5K20A 2B61A 4K1LA 4LJ7A 4PQRA 5AJXA 1CG6A 2X0KA 2HMVA 2XODA 1I3KA 2ZT8A 2AN1A 3HCFA 2QM0A 4WY2A 1D6JA 3P0FA 2QN2A 2OLKA 1FQWA 3OZRA 4Q4LA 2C98A 4LPKA 3QENA 1G3MA 2NXWA 5JBNA 3Q7QA 3NLLA 1R4MA 3EZLA 5JVDF 10MHA 4M54A 1AN0A 1L4NA 3UAZA 4ARAA 4F12A 1BGWA 1FYDA 4LY9A 4C01A 1EUZA 2XNDA 2XBMA 2AI2A 2Q8QA 5I7RA 3GD5A 1NF3A 2C78A 1JTFA 1EE2A 1ND5A 1WPRA 3OC0A 2XGOA 4UEWA 2W58A 3MTEA 5D51S 1S3SA 4MQUA 5ICSA 2CLDX 4BO0A 3V42A 3MCTA 5TQ2B 2VWPA 4HUQA 5DLEA 1KFCB 2DC1A 5FYQA 4JP5A 1RLJA 1AMUA 1UT8A 2GLXA 4BVAA 4EG7A 2Q5OA 5IF9A 2IKQA 1D0VA 5DHRA 3T9BA 4M86A 4G0YA 4JK3A 3DOFA 3RRJA 2VDMB 3OPVA 3PFKA 3VR6H 4XX0B 1R0LA 2EJVA 3NRBA 4XEUA 2J5KA 2QRZA 4ZU3A 4WBNF 1TIKA 2FQQA 3GBVA 3R9KA 3TM4A 1BVUA 1NE2A 4CL0A 2D0OB 4UMFA 5GONB 3TL6A 2COUA 4CKCB 3GG9A 1NOKA 1P73A 4A9AA 1YZGA 5DHSA 1RP1A 1OFGA 4RXMA 2FCRA 1U2QA 3KEMA 3JQEA 1DMRA 4YI3A 3AERA 4XKJA 4WVLA 3CJQA 4BPRA 4BZXA 5CEFA 2W6CX 1B43A 2DU8A 1ISGA 1NT4A 2CHEA 3OCWA 3VJMA 2GZSA 5LQUA 2JIZD 3T3IA 2ZSBA 3MAGA 3CNEA 3P2OA 2QE7A 3X2FA 1GTSA 2WJIA 1A5SB 3ZHOA 2JG3A 1K7CA 1R0WA 4ND5A 4HRVA 1LW6E 3KQNA 5BV0A 4KBYA 4PSCA 5JANA 2XTMA 4G0QA 2FW8A 3BL5A 3VO1A 4IWNA 4Z0TA 4OF4A 4EYGA 3QUQA 3WX0A 5KQRA 3OLCX 2AOUA 4LE0A 1TZ2A 4URWR 1CZUA 5GV8A 2ZWVA 3ANXA 2NNLD 1U4OA 3D5EA 4F85A 5C32A 1US8A 1QZTA 3W6NA 4G5YA 4AMYA 4U2CA 2ERCA 2V65A 1WMSA 4X00A 4M0DA 1Y9AA 1TB4A 1YCDA 1D5WA 1M8GA 4FFVA 4M21A 1L5OA 1SOVA 4AN4A 6REQA 3EFHA 5LB4A 1FJGB 1BE1A 1KK3A 1V1MA 2NU7B 4FEEA 2AXQA 3T41A 1DL5A 1P2TA 2E49A 3TQIA 4BEBA 3EXIA 3EGWA 4XYGA 3ZE2B 1GSHA 3RBAA 1QQTA 1IBCA 1VCIA 2AZDA 2QTWB 5CTJA 3LLVA 3CO5A 3E03A 3HFSA 3VPSA 5HFJA 1DVRA 1M8KA 4DA0A 1FJXA 1GRCA 4IJKA 3IO3A 4P80A 3AB3A 1EFRD 4YRKA 3AFMA 1S2NA 4ZPXA 3DQQA 4C0QC 3LA6A 4C7BA 3NTOA 4E12A 3PQ2A 4X64B 4RPGA 4GRAA 4CLXA 4TM7A 1BFUA 2AFVA 1A1VA 5CURA 2NVOA 3BIWA 3FZNA 4OA8A 4JJ8A 4EELA 4KH0A 3UJ9A 5C1DA 4NZNA 2VNAA 1JNXX 3VPHA 1DU4A 1FLVA 4A82A 2AZXA 2J0QA 4MRRA 4YUVA 4RTKA 1PHRA 1JDVA 3X1WA 4KYVA 3KXLA 3LG2A 1HORA 1I6WA 3G9ZA 1NRWA 3GLQA 2BWJA 4CEHA 1CETA 1JP7A 3FFWA 1MQAA 3UXHA 2H1SA 1P9WA 1RHMA 3F9IA 1AF7A 2B25A 3HU3A 4MWEA 3TSYA 5IBPA 4FI3C 3N7TA 2WNHA 3GJQA 2G1KA 4CHGA 2XIJA 4EG5A 3B7WA 1NYLA 2HSWA 2QX8A 3N8DA 4UZFA 3L40A 3AV0B 2Q2NA 1BMFA 4WXEA 3S2GA 4MW5A 1Y7PA 2QI9C 3K9HA 1NKSA 1T0PA 2O05A 4BJHB 4BMCA 4RA6B 1CF4A 3L7AA 5JD5A 1FX1A 1M1YB 1ONNA 1PUIA 4G81A 4KTVE 4MI6A 5M5BA 1NV8A 3VZPA 5GIPE 3DLBA 1LZKA 1FFWA 4W7SA 2JGJA 4MIKA 5IAEA 3ZZNA 2UXBB 3WL3A 5TB5A 4I8XA 5FBLB 1Z36A 3ADOA 4PG4A 3E2MA 3F9RA 3KQSA 5FXMA 3C6BA 3IIJA 1ZI9A 3OEHA 3QF7A 2OXRA 5FV7A 4M1ZA 5HNKA 5LYJB 3AHHA 5CNKA 4UVDA 3V7UA 2QM7A 2CJWB 4X3OA 3WK5A 5IJ9A 3VRHA 3UT5A 2O8CA 4WXHA 5K0EA 1WLSA 1NFQA 1KZ7B 3ZK8A 1R6TA 1KI3A 3WYNA 5EJEA 3M6MD 1Z0ZA 1AT1A 4PYJA 3KR9A 2VHUA 2XIQA 1Z4NA 2GYWA 4G97A 4MPRA 2Y0EA 4PLHA 3TQHA 5KOIA 3BPSA 5IN4A 3H0CA 3FUTA 1Y4DE 2IPXA 1FBTA 2EXXA 1N2EA 2R8ZA 1ECFA 2ZTHA 3ZGLA 2A9JA 2PZGA 4ZI3A 2QPAA 3R3SA 1QH9A 1W25A 2F17A 4R8VA 3HXTA 1YD7A 4M1KA 2QJTA 3TXXA 1WKCA 3ZCXA 4EGCB 1A9YA 2DJIA 3AF4A 6LDHA 4NCBA 3N2LA 4PX9A 4RPIA 4WECA 4URVR 1AHPA 2C1ZA 4O4HB 3QWHA 4I4NA 4XYMA 1Y3CE 4KXVA 1FDSA 4UDXX 4H15A 3UCFA 1EAMA 3TBFA 4DIOA 3EA4A 3VYTB 3BE6A 1Z4QA 1PJ2A 5DXAA 5EN4A 2GEVA 2J07A 3E7FA 2GDZA 2JI9A 3E7PA 5CR9A 2VDUE 5TSDA 1Y6ZA 5JPCA 1WKVA 3B2QA 2ZYSA 3IMKA 3VR2D 3U7QA 1L5YA 1DX6A 2H4WA 3SDBA 1U8FO 3GJZA 4D02A 4B2YA 1QHIA 4TKUA 4BO3A 1A5AB 1U0LA 4D0SA 3THYA 2F9FA 1IWOA 2AD1A 1A9TA 1EUCA 2NV0A 2QQGA 5AW9A 5KYXA 2QNRA 3KTAB 3AJRA 1G3QA 2J32A 3IIKA 5F76A 3RBXA 4YLYA 4N41A 1E5XA 4J94A 3LO5A 2C2HA 4Y2YA 3VYUB 2EBWA 4BNWA 1OV4A 2XYPA 3PXEA 1GQRA 4B6SA 2EZ9A 2JC3A 3FNQA 3VNUA 2G77B 3RVOA 3C5EA 4NE7A 4ZICA 3LK6A 3GC6A 3D0RA 3LLMA 4TYQA 5DX0A 1FBNA 4Q47A 3JCZA 3K15A 1BS1A 4RF4A 3MFQA 2NZWA 3FR7A 3F6RA 4JLBA 4PPYA 3PE4A 1SHUX 3TUIC 3VU8A 4A0QA 1DQZA 1NF8A 3NWBA 5K1ZA 3UUEA 5C37A 1EUQA 3LLUA 1ZGZA 1C7RA 4YPFA 2YQZA 4HFRA 1IWBB 3GT3A 3U7RA 1XG5A 2IIQA 2DECA 5F3WB 2ZI5A 3L92A 5DYIA 1JHXA 4ZZ3A 4UOEA 3DE3X 4J16C 3DWFA 2E85A 2R7AA 3M1YA 4JSYA 4YPOA 4ZDKA 4UFOA 2B98A 1UBOS 5L3SA 3E22A 1G5RA 1E7YA 4QREA 4LRWA 5BN3B 3EIFA 4DSZA 1E2GA 1EBFA 1KQPA 1KAGA 1QYIA 2AMVA 1U0JA 2R68A 2A2ZA 3JAMA 3HTXA 4KQEA 4IRUB 2EFYA 2JAHA 3TX2A 4JR2A 3EFEA 2W8BB 3AM1A 3K4HA 2LWIA 4KBFA 2ZIZA 2IS4A 3HU2A 4WI1A 2W2PA 4AKTA 2WZDA 4GLOA 1JXAA 1M1UA 2EFHB 2LZ0A 1XZLA 4OYHA 1BD4A 2VWGA 4Q93A 4AZ3A 3O3MB 3WWPA 4NOJA 1QU3A 2WB4A 4LVNA 1EK2A 3N8NA 4DA6A 1SZCA 3CH7A 1KH1A 4XAQA 1P74A 4RA9A 4BFYA 1YR1A 4EI7A 1NSFA 2WEKA 3VR3A 4YRFA 1CY8A 2VOEA 3PXBA 4Y9TA 4IIYA 1E94E 1X92A 3KJEA 4IUBS 4JL8A 3IVXA 2ZS8A 4ALLA 1M34E 3FLBA 3CLRC 1NW3A 4UHKA 2QS9A 3KV1A 4W7IA 1XK6A 3RO7A 3U17A 2XHEA 1VXOA 4LSWA 1XXHE 3HBJA 3KETA 2FR0A 1H2RS 2XGJA 5GZ3A 4YRSA 1WY5A 2VI5A 2ZKIA 2X0FA 2DPHA 3R7LA 3VYSB 3BZBA 4ETIA 2P7IA 4WNAA 4JLAA 3OIYA 1RRMA 2XE8A 2YFYA 5HIKA 1O5TA 1VFNA 4CL3A 2OK7A 3CUVA 2BEUB 5JLJA 3MYYA 4L6AA 4W5OA 1CRLA 4HEJA 2B99A 4A1OA 4PO3X 5BSWA 2PUEA 3R7WB 4ZC1A 1JW9B 3GRAA 3HY6A 3W04A 5F5NA 3CE6A 5CBPA 1IUNA 1U0GA 1XLWA 4A0SA 5EE3A 2D8MA 3N7AA 4P98A 3TYXA 4Z4QA 2A5LA 4NBNA 1T3ZA 3BC1A 4TV8F 4OP3A 1P7YA 3B5EA 4E2YA 3L93A 4UHEA 1A88A 2F3SA 4HDMA 2GFQA 1X7XB 3CUUA 3ISVA 4X84A 3UJDA 1DV1A 5DHAA 3AC0A 4BBAA 2H7XA 4R69A 3DGFC 5EIXA 2P2ZA 2AYYA 3V9AA 2XH8A 2G7MC 3BMCB 3OU7A 1E9FA 5MN5A 2AHOA 3ECSA 3EDMA 1LRKA 4CM8A 4G4JA 1SUEA 1V8FA 1WQ4A 3L9WA 3PUZA 2VHCA 1Z83A 2NU7A 4DIUA 4JVSB 2WB2A 4YRIA 4WLUA 4LSZA 3OCYA 2B83A 1WRBA 5CDUA 1TD9A 2B92A 5JNLA 1P1IA 2OLJA 4MGIR 4M7WA 4Y6GB 2WZQA 1ESZA 1T5SA 2JGDB 3HDQA 1J49A 1DQNA 2BGLA 2Y1OA 3AK4A 3QA3E 1P0PA 1N2CB 3QUTA 1SEPA 1CJSA 3IAS6 3ENZA 3LPCA 5AOVA 3UANA 3GLFB 3O47A 1JZSA 3ZEAA 4D46A 5LIRA 1UOEA 4KPUA 2HCFA 1A9SA 3K9NA 3R20A 4P86A 3NBMA 4POAA 3RFUA 3RROA 1EA5A 2H0AA 3LHDA 3ZDZB 1PJ4A 5E6UA 2VF8A 3CT6A 4YIHA 2BUBA 1KGSA 5HRCA 3Q3IA 3GFFA 3CNLA 2PH7A 1FA9A 1UDXA 5A03A 3VNBA 3F47A 4DQVA 2CB9A 1Z4KA 3JYPA 5KJEA 3RB8A 4FKMA 1DSSG 3CISA 3UXYA 2C84A 1D8TA 1F8FA 1D4ZA 2HJRA 4XUDA 3ZNPA 5EIFA 3HCBA 1MEJA 2FY8A 5ANRB 3U1BA 4Y1RA 1T4BA 1OE0A 1X80A 3I3OA 4B17A 4B87A 1KJJA 3Q3CA 2NQ8A 4QQ8A 1Y9EA 3ZWCA 5LSAA 5K8VA 4QLOA 4YEDA 5THQA 3ZR4B 1BW9B 1PUXA 2CHUA 2P40A 2Z2ZA 3UWDA 1RI4A 3JQBC 2K2WA 1B8VA 4B5LA 3K92A 4MI9A 1WUTA 3L82B 4EG6A 2IHZA 1DHTA 1DUIA 3K9QO 5KPDA 1O0CA 4AQYB 4CF3A 1JAIA 2ZAGA 4MNTA 2BW0A 1DAEA 1R6DA 4IMJB 3V7WA 2O8DB 1CQZA 5AUQA 3G2MA 3VTZA 3LRPA 4YMVA 4E7PA 4H17A 2V96A 3E9MA 5JDCC 4EMUA 1XWFA 4JI4B 4P4SA 3H1BA 5TVKA 2Q9CA 1X1TA 2PRJA 4FMCF 1UDCA 4H7DA 4OQMA 3SR4A 4BZZA 2GCGA 2QVLA 1Z88A 2YOHA 4RV9A 2D5BA 1NWHA 1Q0QA 4LYYA 1WDWB 3H5TA 2AG5A 4EABA 5C8DA 4HDOB 8AT1A 3TVYA 1DAOA 2ATIA 4PYMA 5HTOA 2R00A 4HYQA 1HBJA 1KDYA 4RTPA 1PT5A 3BWEA 2M9MA 3U31A 5LDDC 5GQSA 2FKAA 4UMVA 3L4BA 4TV8A 5BQ5A 4X91A 3PEFA 4QU8A 2QD2A 4TXLA 1ZJJA 2Y1GA 3CXUA 4DR3B 3ZQ6A 5JYBA 1SIOA 5K4AA 4LEIA 3K2QA 1VE3A 1GLVA 3RT7A 2WSSA 2H16A 3NCTA 4IRMA 3AKZA 1K5GA 1VTKA 4AW9A 2I66A 2G67A 2ZT7A 4MRSA 5DHQA 4NWIA 3RRYA 1DJNA 2I76A 2ZM5A 4OHYA 1JZQA 1PT9A 3OWXA 3Q7IA 1VKJA 2Q7OE 3TAUA 5KQPA 3IVGA 2B37A 3V55A 2ZDGA 1M6VA 1WSBA 1G20B 1WPGA 4IHJF 4PONA 2IEZA 4JLSA 4LZLA 2DY1A 3LP5A 3ONVA 2H08A 1J0CA 1Z0JA 2TSYB 1JYSA 1LV7A 4QD3A 4XDYA 4EM6A 3ED1A 2HJ9A 1RRKA 1NHGA 1KO7A 1PR3A 5AD1A 1QIKA 1GSOA 2I1WA 5LZ8A 4O5AA 5E0KB 2X76A 2FXVA 2I6UA 1FNDA 3EFOB 1GR1A 3QSGA 4AZ0A 1Y42X 4D6PA 3D5TA 3CVWA 1ZX1A 1KYXA 4PPFA 1WOMA 1KOGA 3ETDA 4P54A 4M99A 4I1PA 4P3YA 3B9QA 4JXXA 4DLLA 5TV2A 1C9NA 2IUUA 3TJMA 1A82A 1CY4A 3OH8A 4FE7A 4FFSA 4WESB 4Q3DA 4R1PA 3G2PA 5AJZA 5EYPA 2Q1UA 2V5AA 3VX3A 1JFVA 4KMRA 4EPXA 2EKPA 1RAEA 3H4TA 2JBWA 4MR8A 1XNGA 2IHTA 4HB0A 3C14C 1XZEA 3DD1A 3O73A 2WIKA 3FJ1A 2PUDA 1E1DA 2RGGA 2GI4A 3KKPA 3PXAA 3BG5A 4WN9B 1NUQA 2CDNA 3FWYA 4L8WB 5JPIA 1J99A 1GRRA 1G8PA 1ZCAA 2BP7B 4CPDA 4DG9A 4MVJH 3K32A 3FCOA 3LT2A 2R6CA 5JZBA 1QVWA 2DULA 3UT6A 3RW9A 1GADO 1CERA 1H2WA 2IOFA 3JALA 1H4VB 4QOSA 4ARZA 2DFDA 4HNHA 2AS0A 4PZEA 1X3LA 3GO4A 1P4GA 3M82A 2O3SA 3PFGA 4ACBA 4DCJA 1TM3E 3KEGA 2IVZA 4C7KA 5K0SA 2CVOA 4JLKA 3EXHA 4XB2A 3EFOA 5BXYA 1T3SA 3F6CA 3N2YA 4K40A 3KXKA 3HP7A 2EFJA 4TZ0A 1HYBA 5CA0A 1N8SA 3H5RA 1S3FA 2ZRBA 2GO7A 3D6MA 3U0VA 2CFIA 4LYHA 3QEBZ 1DOZA 1G20A 3DNFA 3JARA 3RLFA 3ZLTA 4YRLA 3THRA 2HPVA 4H77A 4A73A 3LCVB 1Z6GA 1ACLA 2AIRA 3EZFA 1PYGA 5A2QA 3GI1A 2FSSA 3P71T 4NCIA 5DWVA 2XMDA 2HWUA 3NIDB 4IFIA 4Y6LA 2QRGA 2VK2A 1Z7YA 2NUPA 3B9BA 4REQB 5DEIA 3PQ4A 3GRFA 3WIBA 3JQGA 1J21A 4R2WA 1NJ8A 3U7GA 1GTMA 2XUPA 4JDPA 3DVQX 1K7XB 1JHZA 3ZWOA 2GXAA 3SQDA 1Y5LA 4RKYA 1A9PA 3AM5A 1TLLA 3Q11A 2XR1A 3TQCA 2ISCA 4PWYA 1MDBA 4KMOA 3X2EA 1OC2A 4C20A 4O8CA 1J8YF 2E4VA 5KOJA 2R6ZA 2X0IA 2AC4A 2PWBA 1QGUB 1ZC3A 2IWHA 5BN3A 5F33A 2C8KA 3OHSX 2H18A 4W5RA 3ICCA 2BEWB 1RQXA 1RT9A 4NHOA 3B1JA 4NMMA 4B46A 4CMAA 4TT3A 3S68A 2VRNA 1UZUA 4CM4A 1HL3A 4MWTA 1V5FA 4M87A 4GGPA 4HHEA 4XTCS 1P8JA 2EJCA 1Q0RA 3KJZA 4LF8B 3EC2A 3AF6A 3MWEA 3H2YA 1CD5A 3K73O 4G5SA 4RU1A 4K0RA 1ESEA 1OU4A 2J0VA 3DP9A 5LXTF 3JQCA 3ZU6A 2O59A 1G1MA 1QG4A 5ESRA 1E2UA 1EGAA 2C96A 1BE6A 1U3WA 4ZVVA 1JZTA 1RD4A 4DNXA 1JA0A 2H3EA 2JLRA 2RHCA 1EIZA 1JR3A 1P45A 1KU6A 3BMQA 1DBWA 1JUDA 1W59A 2ZJ1A 4G0ZA 3TFWA 5KVVA 1T3LA 5DNCA 3CX3A 4LVOA 5HS6A 3CLSC 1TW2A 4F1JA 1RQPA 1FYEA 1JX6A 4AZVA 2BL4A 5KAPA 2G88A 3HUDA 4G41A 4UU7A 5JSUA 2BFNA 2XVAA 3I6QA 1MC1A 4HTAA 2FDXA 2WVHA 1N57A 3L01A 4E51A 4IEFB 5T8KC 1TADA 4P8RA 4QECA 4WDRA 1BA3A 1MAUA 1ZIXA 1C8LA 2VUSA 2XRYA 4C2AA 3DC2A 4WJLA 1WUKS 1XZHA 2VNIA 1M34B 3D6HA 2OXCA 4DV4B 2JHAA 4LFAB 4YC7A 4M8LA 1HWYA 4O2BF 4J1TC 2ZRCA 1E6KA 1HUQA 1NG1A 2OV6A 1QGOA 5GM1A 1SUSA 1F0PA 2WJYA 4L5BA 4UHCA 3TW6A 2JEZA 4QDZA 2VJOA 1E3SA 3FWKA 3MUFA 3R3YA 2VVTA 2ZK7A 5FUBA 2MSLA 1SELA 4MAAA 4BNVA 3ADBA 1PR9A 5E1DA 1DC3A 1Q6YA 2I3AA 2CVZA 3P9KA 2R1TA 4RZQA 4ZZ0A 4KR6A 2HRBA 1H2YA 5DX8A 2H6EA 1K97A 1SOAA 4XWOA 2HNAA 4ZVTA 3DZDA 4BFLA 1P2FA 1YE5A 3CF6R 1PF7E 4G4SP 4LHVA 1SK8A 1UBHS 4TRJA 1SPBS 2I4OA 2FOLA 3SX4A 5BSEA 5KJ1A 3SM9A 4F45A 4TL6A 4MRMB 3B6MA 2KSQA 1A76A 1XA4A 1U1FA 2O6LA 1WP9A 4QJ5A 4DUZB 2AN3A 3SKYA 4UHDA 1GQYA 3GZJA 3KTDA 1Q6ZA 3IAXA 1O94C 5EJFA 4CR7A 1J5EB 2NLOA 3EASA 4G5GA 5CPBA 5TPWA 4LTMA 2A0KA 2PUTA 1B8OA 3NIWA 1HURA 2JBAA 4NAVA 3NVMB 1BS9A 3FGZA 1H93A 3ZXYA 1V3TA 2JFNA 3WGHA 3DBIA 4H7FA 3QU2A 3T4XA 5ALTA 3DMRA 1AH2A 5LYJA 3VU0A 3NEPX 5JO9A 3CVVA 2QJWA 2YV2A 5C1BA 2OCIA 4PG8A 4FCCA 4LC1A 2B0JA 3N0TA 3ET5A 4LJ9A 4JLMA 3ED5A 5AW5A 1G20E 2X2FA 1P2DA 3VH2A 1RKUA 5JZOA 2GN1A 4HAIA 4OJMX 2H4YA 4J1TA 1RHKA 4ZYTA 4ZEOA 4DIMA 2YH2A 1C8KA 4FEGA 1XZPA 4PHFA 1MVNA 4UE3S 1HETA 1OKKD 2IHJA 2W0SA 3AF3A 3JYHA 5AP9A 1UBJS 5CB6A 2NTYC 2G8LA 1A9ZA 1N1DA 1C50A 3EVTA 3MEQA 3PZBA 4QODA 1RR6A 4L4RA 4TT8A 3HWSA 4CDNA 1EFHA 3ORQA 1CUVA 5BNWA 2BZGA 4FZVA 5DBFA 4Q39A 4YQFA 3WP0A 1M6NA 3U4QB 3WTCA 4J91A 4C9BA 1JWBB 3P7MA 4BMYA 2SCUA 4UHHA 4G0VA 4I08A 4XVCA 5CIQA 2SBTA 5CA0F 4ZMSA 3L0OA 1BXZA 3W5VA 3H9CA 5ICEA 1FFXB 1VDZA 3JS5A 3PRYA 4AYXA 5J43A 4CIVA 2GCPA 4OAOA 1Y5NA 1KS2A 1U7HA 1PGNA 2JHFA 2Z1DA 1UT5A 1Z62A 1NE7A 3SXPA 4B35A 4BTLA 4GFDA 1W1IA 5ESDA 5HM8A 1YIOA 1DBQA 5JYCA 1KK0A 3I53A 2Q5FA 3NYIA 4Z54A 1XTTA 3BSWA 1ZOLA 4LN1A 3WICA 4LJLA 1T2NA 4HFJA 4PZLA 5DOZA 5E6RB 1DTWA 2C07A 2OGTA 2ZUBA 4DCTA 4KOAA 4OHVA 2JFWA 3OY7A 4ROSA 4MLZA 3D1JA 1BIFA 1IM8A 4N0QA 4YDHB 1X8KA 5HF5A 2GBLC 3PNSA 4N3GA 3WRYA 1Z0DA 2DWOA 2JIMA 3QKSA 4ISCA 6REQB 4K9PA 3N5CA 2IITA 1X8XA 4N3CA 3N86A 4UDNA 4CEJA 5C9ZA 3SQXA 3WIUA 2P5UA 3ZYCA 3EUEA 4JGIA 5I6DA 1FFYA 2RGNA 2QXUA 3UGQA 1Z08A 1CJKC 2XQFA 4GKVA 1B73A 2F1JA 3PA8A 2EQBA 3RFFA 4K9QA 1G98A 1OBOA 3KYBA 1ZJ5A 4FLFA 5K99A 4Z0NA 1P3Y1 2QWXA 3OLZA 4W1SA 4R01A 3L0PA 1OZ0A 2ZVQX 2KPOA 2HU8A 3BDVA 4E5UA 1JJFA 3GP3A 1CQWA 1R0SA 1ZA2A 4F06A 4CU2A 2A5DA 3IOBA 4H27A 1RE0A 3NVKI 4AKIA 2I7TA 1SUIA 1ZSYA 1QTQA 3BTOA 3LUBA 3DMFA 2ZBEA 1R2QA 3LT5A 5A4AA 5AJHA 1CB0A 1NW4A 1H2FA 3RODA 5G0UA 1FRNA 3DDZX 1XF1A 3HNRA 2A1TR 3FDZB 3ZK9A 2G83A 1B0ZA 2XOEA 2XNKA 3BHIA 3GFQA 3NALA 3R9WA 3IPYA 4AUNA 5AOBA 4AKHA 4CG1A 4K9SA 3R3ZA 5IU6A 3G8BA 3G8AA 4NBUA 3C70A 4PPNA 5DJ5A 5ALYA 5FO1A 5CFQA 1YKSA 1HNZB 2XXAB 4KUEA 5H82A 4EKGA 5JXJA 3E5NA 1WF3A 4TV9F 3O1LA 3DO6A 2V6JA 2ZR8A 4N49A 1IMOA 1JT9A 1R64A 4X63A 4ZZ2A 3JWPA 2UUBB 2BUCA 1XTJA 2W22A 1QB8A 3QZUA 5TMPA 3OZSA 5LQAA 1ZISA 4M7OA 1UK7A 2CDAA 3FRJA 1E3DA 2PX3A 4JVOA 4D9GA 1MX1A 3DHEA 4F38A 2XCRB 1R00A 4U5XA 4BP9A 4AP5A 1CUZA 4N6OA 1N2OA 4XOUA 4YAJA 4GRDA 2FMIA 2FR8C 2XDYA 5FOWA 4GI7A 2JAUA 2XXBA 4FDTA 4TS9A 3H87A 1NQTA 1VPEA 1D4AA 4EHHA 1R0ZA 1MIHA 4JLWA 1DTWB 1QGUA 3LS2A 2XHZA 3SGLA 4L78A 2GPSA 4GZ5A 5FPHA 4I3HA 5JY6A 1JLLA 2FN3A 3GDWA 3QFHA 2NTJA 4ESVA 1TK2A 2VDRB 3S1SA 1CKEA 3LPLA 4FYYA 5B3JC 1XEXA 3EGXB 1YZYA 3VM6A 3L7IA 4JKYA 2XAUA 1Y1PA 2V54A 1YTLA 5E6SA 3RU2A 5CCXA 1ECBA 3WDSA 4DDKA 2MOKA 1IRIA 3CEMA 3GWGA 5IP5A 5JSHA 4XE5A 5IJ9B 4B3TB 3FHLA 1G7TA 5IARA 3IH5A 2IUFA 3JQFC 3QTLA 4NEHB 1DINA 1OU0A 2PXHA 1IJBA 3SSMA 2ASVA 3L4KA 2FAXA 2QYHA 1JQLB 3Q8LA 3D54D 1CWUA 4ADSG 2WVJA 4FE4A 5F3DA 2DUNA 1TU0A 1XCMA 2BELA 1OMOA 2C9CA 2A9QA 3COZA 4L57A 5BN4B 4EW3A 3S2YA 4II3A 4UAUA 2A0FA 3NHRA 5JJLA 2A6PA 5AK6A 2VAVA 3BHJA 1WP4A 2JS7A 1DZIA 1PCXA 3AFGA 3EXHB 1RVDA 1C4KA 4IHQA 4RLFA 3RG8A 1XAHA 1UMBB 1X1CA 3TX6A 2HK6A 4DC9A 5LU8A 4YJFB 4HP8A 4KOEC 3UQZA 5JCJA 1L8AA 3K1JA 1V8DA 5L7YA 3KV3O 2PKRA 3RTBA 1U98A 5DBIA 1U0FA 5JSZB 2QNIA 5IZCA 1RLOA 4GXQA 1MO4A 4IJUA 4JQOA 1AKWA 2HSGA 3LUFA 4PIVA 1B6RA 3WRXC 1IHPA 3DAPA 4KUHA 4DDVA 2C4HA 3PE6A 4H60A 4A8JC 1E2MA 3VDQA 2FEXA 1TKCA 4DPMA 2OK8A 5FEMA 1RWVA 4DXAA 2F1IA 4CEIB 3YASA 1FMCA 3DPSA 3ZEIA 1OYOA 1EHCA 3EAFA 1ZD3A 4O2BB 5KSPA 2WYWA 4LZAA 2OAGA 5EOVA 3UK2A 2XUJA 4E2WA 1N33B 1PGJA 4LE1A 3T99A 4X7PA 1ZK3A 1J9GA 2Y9MB 3H3JA 3N28A 3SF0A 1FUKA 5A05A 4B4KA 1DEOA 2FJ0A 4MP3A 2H00A 1USKA 2QYOA 1CLUA 4IHJA 4B85A 4LRTB 2C2KA 3A2LA 4S2EA 1WAMA 4TQUS 4UCFA 5FIUA 4WA8A 4XQ0A 1TA4A 1XD8A 4UUAA 3Q8WA 3DEAA 5JXWA 4BTVA 3ZE6A 1DCTA 4OJKA 4DQ0A 1UQTA 5EAIA 1QJCA 3QX9A 3NONA 1CP3A 2Q5CA 1K3FA 1N2IA 2I4TA 4DOMA 4P9NA 4L5AA 4PZ9A 3RK1A 3GUYA 4BUJA 5BWNA 3MVEA 1DRVA 5LQMA 4LF9B 2FUNB 1HTWA 5F23A 2YW9A 2AKAB 3EGDB 3SSOA 3KXIA 4R7GA 1GLNA 3QJYA 5CVJA 4ZKEA 3ZVKA 1Z4PX 4AB1A 3C8UA 2OR3A 5DCWA 2XD9A 2EW8A 3DZHA 4JI0B 1ESCA 4D8VA 4KIFA 3QVSA 5DOVA 3H0EA 3Q7PA 4KLCA 2AJTA 3RH0A 5JAUA 2IXAA 1Z82A 4O2AA 1GRQA 4H7HA 3ETNA 3IMGA 5CNIA 1IZYA 3T7TA 4CKEB 3KOOA 4JYMA 4K3VA 2O2YA 1M10A 1LWNA 2XLCA 4II7A 2HBQA 2O2IA 2W0MA 4ZOBA 5ER9A 4K6HA 5KB3A 2Y2UA 4PLYA 5BQ3A 1TKRA 3GR6A 5JI3E 1GFSA 5IM4F 4L95C 3GNLA 4Q12A 4R84A 4X93A 3ZWDA 1EDOA 1QQ7A 3I5XA 1VBKA 2JJ1A 1EGMB 3UGKA 1LU9A 3A4TA 3WP1B 2C7GA 2YN0A 2Z4RA 4I5GA 1Q84A 1MJNA 1WJGA 3I3SR 3PT9A 3R3WA 5H68A 4DJFC 5CTAA 1H5UA 4PZCA 4OLAA 5M04A 2D0PB 4JLOA 2O8EA 1W1WA 2P9FA 3EZGA 1WXEA 1HE4A 2GD2A 2WP8J 1XLTA 1QAMA 1F06A 3ORYA 4OHKA 1NM5C 2ZUFA 2A88A 5GINE 4ASUA 4DMFA 3JQ7B 1DFIA 2C4VA 3NYWA 3K5HA 1UBSB 4M9XA 1SZPA 3QX8A 2F7SA 2VPPA 1PYDA 2FWRA 2BMVA 1H22A 3AF2A 3SYMA 4BFUA 2RAUA 3G17A 3KQVA 2V4MA 1TYBE 2D1QA 1EFRA 1D9ZA 3D64A 4W1QA 4YQZA 2WWIA 3TLBA 4CIAA 2Q3BA 4BZQA 2R47A 3MUOA 3PNVA 2R97A 3Q9UA 4KVFA 3UZUA 3WO0A 1EH5A 1K3UB 1ORWA 3D3WB 2GN9A 5AVUA 2PRIA 4HGQA 1VIDA 2PE5A 4X1YB 1Y7IA 6NULA 2IYUA 5A1JA 1NQOA 3OEYA 3OZDA 3HLTA 2O0LA 4O29A 4B74A 4G0MA 1ZK2A 5A4JA 1J06A 3UOWA 3ZLBA 3CV3A 1Y6JA 4JZYA 4MWCA 3DV0B 4LSMA 4LXXA 1OX4B 4E5NA 2CHFA 3AQIA 4GXTA 2OZVA 4P0TA 4X24A 1TAQA 3QPUA 4EAQA 3TMYA 1XZDA 3LDUA 3VR3D 2PUBA 1UODA 1NFRA 2J30A 3SZUA 4UFPA 3AY6A 1AZLA 3H2IA 3E8SA 2B7CA 3CNBA 3KM0A 4RMNA 5D3MA 3QWIA 4XB6B 2PSHA 5TPZD 4AIRA 1K6MA 1B6TA 4DMGA 2HGSA 1QOPB 3QPAA 3SLKA 4D25A 1KA9H 2CWWA 1JYEA 5AIAA 4C2TA 4BFXA 3T6KA 1UBKS 1VDMA 2GTHA 4KGDA 2V8OA 2XVYA 4LS3A 2NO1A 1JMKC 2HWXA 4GX5A 4RS4A 4JOQA 2FQWA 1Q1BA 4LGCA 3BEOA 2I8AA 5DT9A 2FPIA 5EHGA 1LRLA 1TMGE 2P5TB 5CVDA 1JI3A 5ALWA 4GMHA 4WBNA 3K1AB 4MX8A 1L2TA 4DIBA 5B64A 3AFNA 4C0XA 1Y1KE 2ROQA 3AP1A 3NBYC 1Y7HA 3NANA 3LT0A 4YJGB 4AUEA 1A8UA 3FRIA 4ARZB 3V8VA 4RNDB 3QVGA 2Q4RA 2ZKLA 2IZZA 5BQFA 3L7LA 3K0SA 2QM3A 3FCYA 3QLUC 1T0JB 3TNYA 1AOXA 1KNXA 2O7QA 2XDAA 3L04A 2AFIE 1JE1A 1ZM2A 1C9KA 3MILA 4S0XA 2XKAA 4G5RA 5HEKA 3TSWA 1PX2A 3ENKA 4MV5A 1JEQB 2OB2A 4M2LA 4BIIA 4PC1A 1WBJB 3I04M 4MDFA 4EO7A 3CMCO 4LJAA 2JIBA 4CCYA 3IR6A 1TD1A 3VHXA 1T25A 3I04A 2PSSA 4A6XA 1P4HA 2PS3A 1HNNA 1U1GA 1R8JA 3GJ7A 4ND3A 1LC3A 2Q6TA 3MBIA 4MR8B 3EG9A 3EPPA 3KQWA 3RT9A 4I14A 3IQIX 3Q72A 2O0HA 3ZDCA 2JAQA 2ZUWA 4LNAA 2XTNA 1XQWA 3IDQA 3SCZA 1Q95A 1Y8AA 4NECA 2CEAA 2PLRA 2AN9A 5J47A 3CX6A 4EKYA 1UXGA 3AIOA 4TMVA 1YASA 2QVZX 1G9TA 2QMUA 4CKZA 5CLQA 3LC7O 2WKPA 4JLNA 4U02A 4KE7A 5I5EA 4CTMA 3INRA 1H69A 1TC2A 5EIHA 2WTEA 3RYIA 2P90A 1PJQA 4HJRA 3I23A 4HL6A 3UB4A 3JZAA 1CULC 1W6RA 1PWEA 5B53A 4ZIRA 2TYSB 4I46A 3FNGA 1CQXA 1HDIA 1IHOA 4QYSA 3U61B 5B4UA 1ZLXA 1FNBA 3MMPA 3PB3A 3PI6A 4RV5A 1JKJA 4WCFC 2JJ2A 2AJDA 5CXXA 4ZVNA 3ZW9A 1NBME 1NAHA 2PM8A 1RKXA 3A6DA 3ZY5A 1DC6A 5J4YA 2PDAA 4UHFA 3HE3A 4GBJA 3GAFA 5CXQA 1Q2XA 1V8BA 4NHEA 3QEAZ 1NLFA 4CE6A 4DPKA 5LP1A 1QV6A 1TJNA 5K0NA 1L4EA 2I5PO 3VPBA 1L7EA 1UF9A 4JHXA 1QK4A 4F4FA 2BKUA 4JJAA 4IOLA 4XPIB 2BONA 3OF5A 5FI0B 1L4UA 3RARA 2I1VB 5G4KB 3D8TA 4UBNA 2HR1A 1P6XA 4LYAA 5HQJA 2IOYA 4MMXB 3SAJA 4Y6OA 3QF4A 2Z5VA 1C41A 2DGDA 1KXZA 4Y2PA 2FZ5A 2D1RA 3A14A 4HLUC 3QX7A 4M49A 1Z07A 2HJVA 4G0PA 3HVIA 3E5RA 1NFFA 5H80A 4NYIR 4RETA 3NV7A 3QV1A 3C4QA 4JEIA 4P4NA 2P35A 3OQMA 5LYJF 1Q0PA 1SXJC 3EEBA 3IHKA 2C9ZA 3MWLA 1T8TA 2XBLA 1XTIA 4LY6A 4UATA 1G21A 1M2GA 4YY3B 2AR9A 2ORED 2QMEA 2ZIUB 2PX4A 2ZYHA 3O1HB 3T5GA 1JDJA 1BH2A 3CTMA 2C5BA 3CRNA 3KKOA 4LHXA 1CDDA 4B6OA 2DR2A 3GJXC 3KU4A 2WJVA 1GGHA 4H6PA 5EE5B 1O7JA 4UM8B 2ZULA 1DC4A 3REOA 2C83A 2IH5A 4F1WA 1FSZA 1TVEA 3W5HA 4CUZA 1MA3A 1P6QA 2H1VA 1Y4AE 1F8GA 2ZSEA 3HS3A 1N34B 2QP4A 2OZPA 2NUTA 1DEKA 3DB1A 1QVAA 3DDCA 3UXEA 1Q3HA 4O8ZA 1QMPA 1O54A 4BGDA 5LJIA 1TQDA 1E7RA 3E5HA 2RONA 4IFBA 3L1UA 5F35A 3N1UA 2O0MA 5FR1A 4F4DA 2HHAA 2YYYA 5C52B 1F1JA 3W2IA 4BKQA 1Q1ZA 2FEAA 4MGHA 5EQFA 2QR3A 4CLRA 2V3CC 4NCAA 1JQBA 2ZZKA 2Z1MA 3DEZA 3MJRA 3RIXA 5KNDD 5DGIA 4AUMA 4BFVA 1KRWA 2DFNA 4R31A 2OCBA 3ENNA 5LL6P 3LVQE 2AX4A 1H0KA 4OK6A 3H6GA 3WFIA 5ITZB 3AHEA 3W3AD 3G5TA 1MRZA 3SHVA 3NJ4A 5C7LO 5FPKA 3KC2A 4BJ3A 2JAWA 1ECLA 1A9XA 2NZYA 3QNWA 4C04A 1T1IA 3GPIA 3STXA 1HOTA 3TNDA 4CN9A 5FUMA 3AVTA 4XQEA 4PV7A 3RAPR 3O8CA 2FK8A 1GXSB 1A27A 1TEZA 1MORA 2BKAA 1ZKMA 3EIOA 2WIJA 3PLAE 2VBFA 1VL1A 1EBUA 2VPZA 2CMKA 1ZQ9A 2R85A 1XKXA 4B84A 3DJFA 3JVEA 1M6HA 3TF5A 5EEHA 3NCHA 3UC5A 1Q7BA 3RC2A 4H3KB 3SDSA 3NGLA 4U0JA 4FYMA 1ZXXA 5AWFC 2H57A 1Z33A 2DJ5A 4G8DA 2ZYGA 1P4RA 2QORA 3AEKA 4PVCA 4B6EA 3GLGB 3I61A 1KDOA 4KWTA 4CKWB 3DLHA 2H3HA 1NN0A 2HJGA 1GPKA 2P6UA 4MKZA 1SVSA 2GT1A 2HGZA 2GH1A 1BOOA 2JJQA 1TYEB 1F3OA 3K8QA 3KELA 5LR6A 1QIMA 1M5RA 5CT4A 1RPAA 1CDOA 1SCBA 3KNZA 1I6KA 4LC0A 1B8PA 5ECGC 2P4HX 4OBXA 3GLHA 5DTEA 4EI8A 1FFAA 4LCEA 2V6FA 2QTVB 2EIXA 1H85A 1C7EA 1VHTA 2FMFA 5F2KA 1AXGA 3WYBA 2OZKA 3V2IA 4EJ2A 1F5SA 2BKVA 2FV8A 1CDEA 1OWLA 1CHDA 3C3CA 3HV0A 4KXNA 4N5MA 2IZ7A 2IODA 1ZC4A 3O3OB 3Q8KA 4OXYA 4M7PA 3RYFA 2PHZA 5JAMA 2YDXA 3OJLA 5DYGA 4GO1A 3LBYA 4Z51A 2MYTA 2DBRA 4H6VA 2I3ZA 3T5CA 2I3GA 2ZQZA 4BNJA 4E94A 4BV9A 4B3RB 4EG1A 1RNLA 4BC1A 4CKXA 1I7QB 4FMPA 5F77A 1TCCA 3GDGA 2VTBA 1KKLA 2ASEA 3FDFA 4Z4EA 1T2VA 3CBGA 4RTOA 3ON5A 4M6WA 4ZA2A 1OHHD 1UC5B 4R51A 4TTQA 4C76A 4ZHSA 3SFTA 5IT5A 2R1VB 1O94A 1YDMA 2D7DA 1M1YA 1II0A 4HQNA 4TYPA 3KOZA 2WUGA 4P84A 2I80A 3ZPXA 4BMPB 3KPVA 3WTBA 1TZKA 1KMHA 2P7HA 2IYWA 3C24A 3TZHA 4KWEA 4KXMA 2OAQ1 3HYTA 4KXWA 4DCUA 1JJ7A 5CNJA 5T5QA 4M7RA 2OT3B 1GDTA 3RVKA 5A1TA 4ENVA 5REQB 2WNSA 4FWIB 2BOVA 3D3QA 4EQZA 2NU6B 4K7JA 4TXHA 1KEEB 2ZTLA 2CWDA 3LC0A 4O2LA 1PLLA 3GVCA 3FPSA 4UUBA 3K16A 3VVCA 2ERXA 1C14A 2WG1A 2PMBA 1UDRA 4WQMA 1R6UA 3RJTA 4G1CA 2V7BA 1E0DA 3REQA 5E9JA 4IQ8A 3GAAA 3KD3A 4BB0A 1HDZA 1AQUA 4PC3A 3FHTA 4KK3A 1Z3IX 4M22A 4FYPA 3GCGA 2RGXA 1PSWA 1JG7A 1LNQA 3GT0A 1L1QA 3HYRA 4N03A 3RU9A 3Q5DA 5ALDA 3ZDQA 1U81A 4TTIA 3HO1A 2PZMA 5A5EA 5JWOA 3UV3A 1F4VA 3LDGA 3MJCA 5EWMB 2I54A 3R6DA 4BGIA 4GBMA 3KUKA 1IL0A 2J3QA 4BV3A 5JCJD 3ZGNA 1PVDA 5T8KA 1JMVA 3IDAA 3GBPA 3PNMA 2GJAA 1X7WA 1P72A 1V1MB 3AW9A 1V8OA 2RHJA 2YINC 3KT0A 4WK4B 4JUFA 4P5PA 1UQRA 4Q3EA 3O26A 4ZD6A 2RHRA 3VOTA 2NPFA 5IHPA 1GNLA 1OTHA 4HH0A 6GPBA 5I7FA 1PTKA 1CSEE 3ZY2A 5JXHA 3B6KA 1JVSA 1E5TA 1EEHA 1AKVA 4NPHA 5I8ZA 5KYUA 4CCSA 4GICA 4ITVA 4G8JA 2WYIA 3O95A 3NG1A 4KPGA 5IN5A 1XKQA 2BCEA 3AL3A 2CK3D 1M6YA 2FRXA 4FLMA 5AO9A 1GUAA 4KGZA 3V4VB 1F9AA 4L2IB 3VUFA 5A7FA 1TC1A 2X0RA 5ARBA 2ZUSA 3AETB 3IVRA 4I36A 1H2AS 1XL0A 3LYUA 3PCRB 1S8FA 4YMHA 3WGZA 5A6VA 2YMLA 3P45A 1UDAA 4X3CA 1QOQB 4DV0B 1L4KA 3LQ2A 5F7JA 4C78A 1TPYA 4BQIA 4CTNA 3BREA 4A5SA 1YVPA 1G5TA 4YP9A 2GK6A 4XW2A 2ZI4A 1XHFA 4XIJA 3VR1A 2CYBA 4BC0A 5KTYA 1WXGA 1G4HA 1OA0A 1YFZA 1FPQA 2W48A 3PT5A 4PR3A 2GCIA 4GNRA 4IVNA 4Y67A 3JQAB 2CDRA 2DPYA 4D45A 1C3OB 3ITKA 2A1UB 4KAAA 5BYAA 2BD0A 1ZRSA 2QPTA 3QVVA 1U8UA 1GUDA 2I62A 2DCMA 3VGJA 1E63A 1TO6A 5HDBB 2Q1SA 4BAZA 1CC1S 3C87A 4UQLA 1T3HA 1QYVA 1Z15A 2JBHA 3JZDA 1YDHA 3DM5A 4MXDA 1I6LA 5F21A 5HYVA 2FRDA 1FCJA 2UUOA 4LPSA 1IM2A 2OG2A 4DE5A 2QUAA 3DMNA 1ISPA 4U63A 3JQ6A 2FW0A 4PNHA 3ANNA 2FWJA 1EVEA 2CUTA 2GR9A 2OB1A 5KU1A 1KKUA 1KK2A 3WNZA 1SXQA 2IS6A 4WK6A 3JZMA 2FF5A 4EVQA 1PNTA 4OVKA 1U63A 2AOXA 2HUPA 2OV8A 1RYZA 2PBLA 3PUXA 4AY2A 2H4HA 3RTAA 2AZ4A 2N0SA 1C3LA 1HKUA 1S89A 2FZLA 4OKSA 3FKJA 4V02A 1OY1A 2BR4A 4OK5A 3TG2A 3WIVA 1T36A 1RM3A 4HPJB 3RSGA 2EF0A 2J5BA 2NSLA 1K75A 2JI4A 5DM1A 4AF7A 5CDFE 3DHNA 3JSXA 3R23A 4BUZA 4GVPA 4RF2A 2HRDA 3FJYA 2I78A 1VZ3A 4MDEA 5IEBA 3WQQA 1C9DB 3JQ8A 2UV8A 2QB5A 5AK0A 5ECYA 4L8LA 3MJEA 4WKOA 3L7NA 3RSFA 1TUEA 2PCLA 3WLTA 1IHDA 2V7QD 4Y0NA 3OVMA 2GJ4A 1V7ZA 2FPXA 3OZ7A 4I3FA 4QBFA 3UFXB 5AVZA 5HKAA 4FUTA 1JAHA 5JDIA 5JPDA 1I8TA 3UBMA 5KJ6A 1E2NA 2CXHA 2VT3A 3W6ZA 4FS8A 2XUAA 2HA4A 4PPGA 1RQ7A 3OTWA 4COKA 4CM9A 1A97A 1UWLA 2QTMA 3E61A 3VZRA 1N2XA 1FOEB 4FHZA 4W5WA 3VHQA 1NOJA 4AX8A 3LBFA 4DTIA 3ESZA 3HJCA 1SUWA 3ROZA 1L5QA 4EGQA 2PRYA 5J2TA 1HE3A 3MRTA 1KP2A 2XYHA 1OW3B 4AG5A 3O1IC 5EIWA 3R75A 4UKDA 4CT5A 6ABPA 1N9ZA 3D9QX 5J2UF 2JIRA 3F1KA 1YJQA 2B8TA 1DLIA 3QRWA 2RGAA 1SIBE 4B6RA 2B4QA 1ZPDA 3M4XA 1N0UA 4D3ZA 2FSIA 3KZMA 1DIOB 4HPWA 2AFHE 5JQGA 3ZWQA 1GNVA 2GJ8A 4AN1A 2PL5A 3ZS9A 3OUUA 3H3XA 1O95D 1YUBA 4DJTA 3A3NA 2OZLA 4RFSB 4E6EA 2O7NA 1LW7A 3EFBA 4IO1A 4EMTA 1VRCA 1QR2A 1BX0A 2VJLA 4Q03A 1BU8A 1KZ1A 2JHPA 4EY8A 2CXNA 3A3YA 4Y30A 2NN3C 4YV7A 4PZAA 4CQMA 4L9SA 4DLZA 1OPXA 3FOEC 4NXNB 4IDDA 4IOMA 2GNAA 5KYWB 2Q5JA 3EZ2A 1IQRA 3JWJA 4L73A 1YAJA 1IUOA 2YDYA 1HSZA 4RD1A 4C5BA 2OCGA 3NP7A 2ZJ3A 2AFIB 3QKRB 4LF5B 2EOAA 1L7VC 4QU5A 2AXNA 2CFTA 2DWUA 2OC4A 3EQ7A 4TTTS 1GDHA 3D0QA 2JGEA 1Z06A 5HFAA 1VJDA 2PBFA 1CB7A 4TLDA 4YAIA 4YRNA 5GJBA 2Z57A 2RHLA 3MT7A 3BA1A 4GE0A 4DILA 2N46A 1E4EA 4IGAA 5IDXA 3G79A 1XJCA 1EP3B 3GVXA 4QUGA 5CU7A 3VDRA 5B58C 1WO8A 3DDWA 3LUDA 2X0DA 3ZCRA 4BNZA 2BGIA 4LZPA 1JAZA 1DBRA 2X5JO 5AXBA 4M60A 2B1RA 2HV9A 2JARA 3ACCA 3WYEA 4E03A 5C81A 1H42A 3GHHA 3L1HA 5E4TA 2I2DA 1CTQA 4GOJA 1T9DA 3Q9SA 4PYLA 1YBAA 5CH8A 4AULA 4YUWA 2AJCA 1PN3A 1NDHA 1LV8A 1M2JA 2O0JA 2B2NA 2X6QA 3WLAA 4E3ZA 4CDMA 3DAYA 1GPJA 5BQPA 4YMWA 3OQ1A 4EVSA 1GPBA 1ZBQA 2Z9BA 3E4CA 4ND2A 3W5UA 2CKDA 3CEJA 4JP1A 1ZHFA 1TAHA 3B8EA 4XCQA 3FDXA 2WT9A 3LLSA 1K2WA 3T7CA 4UTXA 1M34A 2B0CA 3C4VA 1JJIA 2HIGA 4MJ3A 1T3GA 2CC2A 1XCPA 4L5JA 3WLHA 4M9SA 5HXAA 1FC0A 4RMGA 2QNBA 3CX8A 1VOTA 2YHIB 3HN6A 2XW6A 1PR0A 1VB5A 2ZVDA 3Q7EA 4BV8A 3ZHTA 1RYHA 821PA 1GCIA 2WHRA 1NI5A 2XSZA 4Y6QA 4OO3A 1PL7A 2J7KA 2R8BA 3OEED 4GM4A 4O4LA 4OMFG 2WFMA 3FBTA 1E89A 2VBCA 3EQ8A 3L8FA 3C97A 2YXBA 3L7BA 1H23A 1U0NA 4WXYB 5DE3A 4V03A 5IJZA 1G38A 5FBVB 3SLGA 2OQRA 2V1XA 3NYQA 4NOKA 2GM5A 4PCLA 1BDHA 2HA6A 3KSUA 1X9GA 1SO8A 1Z5WA 1HT2E 4BE4A 1JHPA 5IT0A 4DSUA 2Y92A 3R7AA 3FUXA 1X7HA 4FJ2A 2VH2A 2BCGY 2UZ3A 5AW1A 1A4IA 4XZ3A 4FKZA 2YIMA 3TE7A 3S5UA 3FN4A 2PWAA 2XDQB 3UOGA 3ZYZA 1DJLA 1D8AA 1CS4C 2C61A 4R8MA 3ZWVA 2G1JA 2MIIA 4IEIA 5A5FA 3AEUB 3H2JA 1SBQA 2FSFA 2O7SA 4RWZA 4HX9A 5KNLA 2AVDA 1I4OA 4O59O 2QDKA 4XWYA 4B3HA 1Y8QB 5L6MB 4YCNA 3ZU3A 3KB6A 2VP2A 1AQIA 2OFWA 3DAOA 3ZIAD 5L45A 4X45A 4K6FA 5KYYB 2BR5A 2D2IA 2OFXA 3OIVA 4QPJC 2FOXA 3WOHA 5AHXA 2V4UA 3RTEA 5KTRA 3DAGA 1KR2A 1Y6FA 1NNEA 4K1XA 1J33A 1NQAO 2B6HA 1IPHA 3QOYA 4KVZA 1KDPA 1T4DA 4XRRA 4LJSA 2FE4A 5ITWA 1EB8A 3C1AA 4KKVA 4N5HX 3LUJA 4WE3A 3ROMA 4A36A 2RB4A 1KIFA 3H1TA 4S3MA 1P80A 2ZSHA 5KC9A 3PCTA 3A32A 3KZVA 4KTTE 2OOSA 3NHFA 3GUHA 1CDZA 1L7AA 3TZQA 5TJHA 4Y18A 4J3FA 3A1EA 4IVRA 2YJNA 4ESHA 4JLVA 3SYRA 3KP1A 3MGGA 1SEVA 1BA2A 1W73A 1X39A 3L1VA 3F6PA 4HFMA 3WNCA 3ADCA 1XZAA 5JQWA 1X8LA 4UARA 1RPTA 4U00A 5COAA 2A1IA 3PNBA 5KDDA 1T9ZA 2ZSFA 4IO0A 1VHLA 1AS2A 1RQGA 3CFYA 5I3CA 5LA6A 1UWVA 2FXIA 4ES6A 4AZWA 5MF6A 1G2PA 2NSHA 5AVQA 2IYYA 2P8SA 2CFCA 2WMOB 4H7KA 4TWZA 3WRVA 4RVDA 3T3EA 2A58A 4FFWA 1Y5MA 2QGNA 4M76B 3B53X 3E2IA 2FMTA 5HIIA 1G5QA 1LX6A 1HZZC 2NZUG 1KZHA 3MTGA 5F98A 2ZJ0A 1CIPA 2ON6A 2Y3IA 3FVQA 3MGKA 5FKJA 4LUCA 4F11A 1W85B 3AJ8A 1MEOA 1OYWA 3P9ZA 3D6NB 1YVRA 2I7XA 4ZQGA 5MN6A 1PKEA 4WERA 2Q2OA 4RGQA 1UBTS 2I65A 2EZTA 4BFZA 3OPYB 3N05A 1CJTC 1V9LA 2J9FA 3SMVA 3T15A 3ZHBA 3V4SA 1XJ5A 2AGVA 3Q3VA 3MUEA 3C7TA 4PICA 5TRTA 4OOFA 1KTVA 2JCBA 3O03A 4YP1A 3W5BA 2BKXA 1WETA 1E4OA 3QTTA 4L9RA 3VZDA 1V26A 4KQFA 3E48A 4BWVA 4YCLA 4L76A 2I4NA 3KO8A 2F9LA 2BTOA 5AKKA 4EFKA 3PYMA 4AICA 3RE1A 1GTRA 4ANFA 4BJ6A 3H4MA 5TQ0B 3RSHA 3Q6NA 2WVGA 4HNUA 4DR1B 4HNRA 2ZS7A 3E8MA 3UKOA 3VJKA 3FYCA 2CNOA 1XE3A 1CE8A 5ALFA 3V2UA 2PLNA 3TOZA 4FDLA 3ZGZA 1HI9A 4UUOA 4Z7NB 2IPLA 5IULC 2IJGX 1I4LD 1LFDB 2D7JA 4EBBA 4QQFA 3TTXA 1GVHA 3VMFA 2GKOA 1CBUA 3S44A 1C1YA 1LQTA 1O77A 4EHFA 2A3RA 1DKRA 3KKZA 1MZPA 2H17A 2R7KA 5BT9A 4A0GA 1EWRA 1JL3A 1EVKA 2EW1A 2QV0A 3QI2A 4GR5A 4YALA 1SA0B 1RQLA 5ALEA 1I3LA 2AFRA 2RC5A 1PW5A 1AS0A 1MXFA 3IV7A 3L05A 4D0RA 3AU9A 1Q0ZA 3K09A 2QPLA 4CIBA 1O95C 1XLTC 3T54A 2DBVO 4H6WA 4S1WA 1J7KA 2ZIVB 4C7OA 2QTTA 3PL1A 4RK5A 1SQ0A 1QQ6A 1Q20A 3UO8B 4F5EA 4Q1AA 5GADl 4J07A 4KR2A 5DPMA 1B6SA 2F64A 4IIUA 2GCOB 3HCOA 1HNWB 2XY4A 4U9UA 3M89A 1MNAA 2OHXA 1SHKA 2OWEA 3KVNA 2C5LA 4X41A 4A3SA 3M2TA 4D41A 3GMIA 1AU9A 1KAQA 4OX9Y 4X97A 4P0QB 3MS4A 2P0YA 2Q1YA 4TLCA 4KVAA 1GA4A 4O4JA 4HATA 4NTZA 1DB3A 1M2OB 1RHJA 3IEUA 1NZFA 1T2DA 3W77A 3OHMA 4ID3A 3I8XA 1ID8A 4KFSA 5FUWA 5L8VA 5KX5A 3TTVA 3HSSA 4UNIA 3NBAA 3L6EA 2VJMB 4PXAA 3IE0A 2EG5A 1Z25A 1I13A 1KGDA 4FXPA 2C7VA 4OQFA 3U3JA 2OV3A 2PVSA 3ILSA 2Q4DA 4P7FA 2NU8B 1L7RA 3F5MA 3LVRE 3B89A 3GJSA 5HZHA 1E0KA 3BUSA 3EGOA 3N53A 4G85A 4GW3A 5EHNA 4AWAA 2YJZA 3CY6A 2LBPA 4FD2A 5FWXB 4L72A 2VA8A 1YVDA 2ZI9A 4KRGA 3O7WA 5B57C 4ENWA 4U7DA 3KFLA 1YB2A 3F97A 3BE5A 3PNYA 4FD3A 3SEQA 2WMDA 4B47A 1ZHOA 3I62A 3GMDA 3LWDA 1VHDA 4B6QA 1Z2DA 4QHYA 3MN1A 5KNBD 4TKVB 3KJFA 1DRWA 4KAJA 3ZD8A 2O14A 4KWIA 2J5RA 2MSWA 1WR8A 3G0BA 5EIAA 3EQ9A 1NF9A 3H8SA 1V6SA 4RPCA 4P33A 3PNLA 2POQX 3CT4A 4AY6A 3EVZA 4P4UA 5KKNB 5HCNA 1KEPA 4LNHA 3UOAB 3FETA 1WB4A 4NJEB 2HFKA 4OREX 1PG2A 4BQQA 4F5DA 3DL2A 5AUOB 1S7GA 1QXSA 2XBUA 4V0NA 1LWOA 2J3EA 4EY4A 5E2AA 3K6SA 5E3HA 5CEEA 1L8QA 1HE5A 1Z5OA 2CMFA 3O92A 5ELLA 2OA0A 4G1EB 4N8EA 3TWOA 5BMOA 5DO9A 2PZLA 4KQIA 2Z8ZA 5ELMA 3LH5A 1GU0A 3S2FA 1YNSA 2CJPA 4LHYA 1TGYA 1HEUA 1T1SA 5HE8A 4A8JB 4CMGA 1EDZA 4K8RB 3WGGA 3N87A 4Q4AB 3NM4A 3Q3GE 5DMHA 4NNJA 2ONJA 2GYUA 4EZEA 1C7QA 1OFHA 1L4MA 1JDBC 1E1CB 5DU2A 1DTSA 4M0UA 2Q0QA 4DF3A 2O5EA 3DYBA 3LY5A 1NXPA 4M0PA 1ONPA 4PSAA 4ZO8A 3NHSA 4D57A 8ADHA 3FYDA 1HLGA 4QXMA 2ODAA 4M8NE 3NO4A 3CXRA 4V24A 2EZUA 3OA0A 4D82A 1WB6A 4XM0A 4E13A 3FMIA 4DQDA 2GOYA 3AFOA 1V2HE 3JR3A 3WWCA 3A3KA 3D6VA 4RL4A 3ZVMA 1YB6A 2RAPA 4X6YA 1PEYA 4RCVA 1SVUA 4CTOA 1MO6A 1BRTA 2C0PA 2Y27A 3ABQB 5G2OA 5TJ9A 1ECCA 2FTKE 2FNAA 4JBWA 1UJBA 2Y4OA 2QTRA 3LQKA 1SBCA 3T52A 2C2OA 2K87A 4K87A 5EP3A 1OYVA 5BSMA 3BMOA 2CLOB 1HDOA 4DM7A 2QD3A 1WZCA 1NONA 4KREA 2O8VA 2YHSA 4XR9A 9MHTA 1TT5A 2V9PA 3K20A 4TVBA 1XP5A 4WZZA 1W8IA 1IOZA 3C7CB 2UVDA 1FP4B 2VJAA 4GF5A 1Q2UA 1TFUA 1FJHA 1THTA 1PTJC 3GFGA 1D0IA 3JATB 3GLIE 4GSYA 3UAXA 3IEVA 5JCOA 4YB8A 1X38A 4I9FA 5EE0A 5ADUS 4R6WA 1BXGA 5EJGA 3G2KA 5GP1A 3TGWA 1PQYA 2G1PA 1DGQA 3TK1A 1OILA 5CA1F 1AUVA 2IPAB 5AUPB 2VS1A 2JAOA 3EWAA 2B8JA 2EKZA 3QH4A 3G5LA 4BWYA 1K08A 1KEVA 4Q34A 4UZSA 2O8BB 5BVHB 1TO2E 1ZU4A 4G9BA 4CI9A 2C9OA 2C9YA 4FT2A 3PC3A 1UBLS 3HB7A 4H08A 2CFOA 4IYJA 4GKAA 3EY9A 3I2YX 4E07A 1BDJA 5LWQA 3AVOA 1MC5A 1AD2A 1Q57A 1F0NA 1BMDA 1U9CA 2O23A 2J45A 4HMQA 4UU1A 1TVKB 3EZ9A 3FAZA 1G9SA 3OZXA 5DGDA 4NU0A 2NYAA 1DMSA 1PJCA 2QN1A 5ICCA 1JH9A 2BZ1A 3N59A 4CL8A 4Q9KA 5K8LA 1RXYA 5FL7A 1XZIA 3TR6A 2F3PA 2WMYA 3TI7A 4FBLA 5T7BA 4BXOB 3ID6C 2PL9A 2YJ3A 2Z5LA 4NATA 3RUHA 1EJ6A 2DUUA 4JMLA 1WUHS 1Y5RA 4NBVA 1NBIA 3D8BA 1EVQA 4L8VA 4ZOLF 2FSGA 1J0DA 2EBUA 4GI5A 2J3MA 1JFLA 3G8YA 2W6IA 2WIAA 3GARA 3PVSA 1B3BA 1SOWA 3HMQA 3QMVA 2O2HA 4P3OA 4BX2A 5C5IA 3BHMA 4TZ6A 3DDUA 3GDFA 3O4IA 1GL3A 4TRNA 1Y3BE 1S9DA 2BHNA 2Q5QA 4PTLA 3GH1A 4DBVO 1GITA 4HG2A 3PSAA 2C82A 5B7GA 3O83A 2ILTA 3ZNOA 4DQLA 1MX9A 4HH3C 5JECA 1O0SA 2VP3A 1ZN9A 3DULA 4YMUA 3AHIA 1CNFA 4FR0A 4KO1S 4AN0A 4KCGA 5CK5A 1VCHA 3S40A 1L5RA 4CG0A 4EJ6A 3NX4A 4PBTA 3JQ9A 2PRKA 4RENA 4DLVA 4DR6B 4BQFA 1Z8NA 3RFTA 4DIKA 3JPWA 4RZ2A 3GYBA 4YN3A 4DCCA 3O90A 1QIHA 2E1RA 3EOBI 1UAYA 3DLTA 1TUGA 2FKNA 4YO8A 3EOZA 2AMYA 2PSDA 4HZUB 4PZZA 3DBHA 2QU7A 3KL4A 5K8JB 1UBMS 3B9PA 3EIQA 1G6KA 5D5HA 3H5VA 2B2CA 2W5UA 1RJ9B 2F90A 4P3KA 5J58A 1KC1A 3HNPA 2XYRA 3IKMB 4YJHB 5AKHA 1P6UA 1VLMA 3WNVA 5EXSA 1B74A 3ZNQA 4RJTA 4C7XA 4GMDA 5KJFA 2B9VA 3W0LB 4KNWA 4UXJA 5KVSA 2V7UA 4KAFA 1GDDA 3WKAA 4AY3A 4A7PA 4PN3A 1M7HA 2WPDD 4MYRA 4UOZA 2ECKA 1OLXA 2AW5A 2Y1EA 4C05A 4BVEA 4MJXA 7REQB 4RTNA 2G8NA 5IJXA 2B1IA 3A11A 4WNCA 4AK9A 3TEFA 4G65A 3BGIA 2FUCA 2YXLA 1G2IA 4H1WA 1OTXA 1WG8A 3V9PA 4DJAA 1GGNA 2GK7A 3W4IA 1XJWA 4ALKA 3E9RA 3IDZA 1ZNWA 4J0IA 4DSAA 4US2R 3E9DA 4MLPA 4L85A 5CB0A 4GOND 1THMA 3MRXA 1W35A 3SNKA 4LJ8A 8LDHA 4YVFA 3LGAA 4INPA 3IAEA 3QJ5A 3DZGA 1T91A 3W1EA 2GF9A 2LR0A 2VZEA 5IKXA 4HTFB 4HGYA 4BNGA 3B6IA 4EZIA 4PIPA 4CIDA 2Y1DA 3TQRA 4IDQA 3DQPA 5IYZA 1V1JA 1FU8A 1UWCA 1KC3A 2WKQA 2UYYA 5F2OA 2FG5A 2J3LA 2ZRAA 4NK4A 1L1FA 4BVFA 4V3CA 5JD6A 3AT1A 1BROA 4PX2A 3ROFA 4IEEA 5IBQA 1NXTA 4WNYA 1VKRA 3MB8A 1YCGA 5ERXA 2HU2A 2GARA 1R9JA 2I0FA 3LF1A 4MULA 4D99A 1G2QA 2B69A 3TKYA 3JASA 1FJ2A 4YP6A 5GTDA 1M7GA 3FLAA 4FR2A 4EBFA 4EJSA 5BW4A 2LXNA 3OU2A 1J5PA 5B1HA 3BWYA 421PA 2A86A 1R5JA 4NU6A 1XVUA 2PMWB 3D4OA 4O4LF 1IK4A 4HGRA 1BHJA 4MO2A 4X90A 3U5ZB 1N6RA 3BH0A 5ICGA 2IH4A 2Z5FA 5HF9A 2VHYA 5H7XA 3BXGA 5IAJA 3C8DA 4W1RA 5DASA 5KNDH 1R66A 3SHWA 1KI8A 2OKGA 1MVLA 2ZLBA 1S2DA 4PGMA 3OZGA 1YACA 5DXJA 4F6RB 4PZ0A 2DBQA 3EXFB 3PFBA 4FW8A 4GH5A 4Q4HB 3EULA 4LBWA 3U7FB 4PNEA 1KXJA 4GI2A 5CJ2A 3UPDA 4UNRA 3PUKA 3A6GA 5HSGA 3PUIA 2I9KA 2VWQA 3G9XA 4MPTA 4R7TA 4URFA 2IHYA 3F46A 1LS1A 1FL9A 3AYZB 5H02A 5L3VA 2VEDA 1USIA 5L7WA 1KI2A 5A7GA 3OCCA 3RUCA 2P9EA 4LDRA 2QV7A 2Q3MA 3KQPA 3Q3HA 5DXFA 4L75A 1SNYA 4AZTA 5KNBH 1T8WA 2YQ4A 4H1HA 2P2CA 2BFEB 4LWPA 3CIOA 3X3HA 2QJRA 2R9VA 1OXVA 2Z8YM 4R0VA 1S2LA 1MH1A 2P91A 1GAJA 1M54A 1MOPA 2ANCA 2ZB3A 3OETA 3PSHA 4GEKA 5D6NA 5HR5A 2C9DA 3DH0A 3L8DA 2BE9A 2XCTB 4K9LA 1XA3A 2I3BA 3ZHXA 1CZOA 4HYTA 1RM5A 1Z75A 2AMJA 5FFFA 5JVDB 1J20A 1W4RA 3KQKA 1QP7A 5JSYA 4D56A 4C4OA 3IBTA 1V3QE 4A6DA 4W1PA 4B3MB 1HLFA 5A7HA 3IQDB 4CGZA 2A5FA 3DO5A 2C4NA 4N5LA 2ZSJA 1ZOIA 3DVRX 3HCPA 3EBPA 3RYHB 2F43A 3W9BA 1YO6A 2FF7A 2FWBA 3F8SA 5L3QB 1WCV1 3RK4A 4MRPA 3R74A 5GGXA 2OHFA 1VJ0A 4OKNA 4HAWA 4W6ZA 1LRJA 2EKQA 3T9DA 3WMFA 3ZE1B 4D9JA 5F5XA 1F48A 4MH0R 3TRDA 3CPHA 2ZI3A 3M6AA 2I34A 3LQQA 4K3UA 2QTAA 1FNNA 4NRDA 4PSVA 4YK7A 2H63A 4ZQCB 1KYQA 4ZV4A 121PA 2O57A 4MIYA 4KLAA 2G9UA 1JRLA 4UBJA 3TG8A 3KKMA 3WK8A 2ILVA 4TL7A 3N2NA 1NJ6A 4EYKA 2QD4A 3A0RB 4R3UC 3AHJA 4DW8A 1U8AA 2BKLA 3K71B 5EQDA 3T38A 1QVRA 3IXLA 4PC2A 3V1TC 2XZLA 4HWRA 1DO0A 3B38A 3KDSE 1UC9A 3P19A 4HQ6A 3W7AA 4B31A 4C22A 3CRQA 3UUWA 5ALVA 1WZEA 1WE2A 4MA0A 1YB7A 5BRAA 5ADWA 5HJ7A 2ZYWX 2IFTA 4IAOA 4DCNA 4D9MA 1HYEA 2AX3A 4GIBA 4OGWA 4XYEA 5A5VA 5IABA 4I9UA 4EJFA 3TAXA 3N2KA 1H8HD 4AKEA 4X66B 2C9MA 2PKWA 4FMDF 3ZGXA 5MFPA 1UR5A 3V46A 3I09A 3C1OA 3GXBA 4PHTA 3S2ZA 3TLKA 4O2RA 5IDQA 1DKNA 4N3AA 2IK8A 1N7JA 4MWDA 5KHOC 4L50A 2PEZA 3CUWA 5FL3A 1L8LA 1ETHA 1P33A 1G5IA 1SG0A 1SKQA 4L6CA 2ODWA 1S1CA 3DS8A 3I1YA 2WU1A 2JRCA 3CR3C 1N6HA 4HAOA 4PLPA 1DQRA 2CDCA 2FWPA 1A5BB