3CKXA

Crystal structure of sterile 20-like kinase 3 (mst3, stk24) in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
279
structure length
276
Chain Sequence
PEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of sterile 20-like kinase 3 (MST3, STK24) in complex with staurosporine.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase 24
total genus 84
structure length 276
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ckxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ckxA01
1XH5A 4RGJA 4NM7A 4RWJA 3W10A 4R5YA 3QU0A 3ENHA 4R8QA 3WF9A 4RX8A 3ZBXA 2ITZA 4YTIA 3WILA 5AAGA 2IZTA 1GOLA 2W4KA 2YIWA 4YUQA 3F5UA 2ZMCA 3FPQA 3VVHA 2YITA 2XJ0A 5C4LA 3JS2A 3F2AA 1OB3A 3ORPA 1R0EA 3I1AA 4DEDA 5HO6A 2HIWA 3MY5A 4G16A 4EOKA 3L9PA 3NGAA 4RIXA 1R78A 3HYHA 2C5VA 4RIWB 5EI6A 4HZRA 1KE7A 5D7AA 5HESA 3A62A 4GEOA 4RIWA 4UYAA 2GS6A 2I0VA 4AG8A 1M52A 2R3RA 3ULZA 4L8MA 4C33A 4O7WA 3B2TA 4R7HA 4P2KA 2W9FB 4XEYA 2OJ9A 3MN3A 5DMZA 2W9ZB 2UVZA 2Y4IC 2BZJA 2VWZA 3LCSA 2QD9A 4FVQA 2O5KA 4ACMA 3BHYA 2PE0A 3AT2A 4P90A 4QMLA 4BZDA 5EHOA 3QHWA 5D10A 3ODZX 2FSMX 4LGGA 2BDWA 5CLPA 5BVOA 4ZMFA 3L8SA 3QCQA 1ZYJA 4Y83A 1UWJA 4IJPA 4JI9A 5IMXA 3KVWA 1H1QA 3NS9A 4W4WA 4CFMA 4G3FA 2YJSA 3G9LX 4PDOA 5IA5A 4XV1A 4X2GA 2OLCA 3LFFA 2GNFA 1ZYLA 2G01A 1H08A 4R3RA 5CT0A 5A14A 5LQFA 1K3AA 5DLSA 2A4LA 3R9DA 4B7TA 4Y73A 2NP8A 4I41A 5CU6A 3EH9A 2UZWE 4E4MA 4XCUA 4F1TA 4F9CA 2WMVA 4AW1A 5IZFA 3LCDA 5M44A 4U45A 5L8KA 4CD0A 4LMUA 4BCQA 3A2CA 1H07A 4CMOA 1QL6A 1E9HA 1HCKA 4U3YA 5HVJA 1P5EA 4Y95A 3A60A 5IA4A 3Q4TA 5ANKA 3RI1A 4K11A 4JG7A 3BE9A 2HENA 3D5XA 3NSZA 3NUUA 3RZFA 4FIJA 3C0HA 4P4CA 4UZDA 4YJTA 3Q96A 3DXPA 3D14A 4TYIA 4EOPA 4YSMA 4ZJIA 4G3EA 3PIYA 3KK8A 3QKLA 5LXMA 3FMJA 4HVGA 4FSUA 1OIUA 5FXQA 5K3YA 3KRWA 5M4IA 1QPEA 1G5SA 3V5LA 3MY0A 2QI8A 3DPKA 2REIA 3COHA 3RPVA 2OZAB 3MFSA 3FI4A 3OVVA 4LRMA 4MH7A 5CSXA 3VAPA 3PG3A 1Z9XA 3I0OA 3OMVA 3OROA 4FKSA 5E92A 5DOSA 3ZFXA 4D2TA 1H1RA 5BMMA 4CV8A 4D9UA 3LFAA 4QP1A 5GIPE 4JX7A 5CSWA 2ERZE 4IH8A 2JBPA 4IADA 4E6AA 2CNUA 3TZ8A 3SX9A 2I6LA 3BYOA 5HLNA 3AD6A 4C61A 4F6UA 4OTPA 2C5YA 2P55A 4G9CA 2FUMA 4C7TA 3ID6C 3E8DA 2ITYA 4O96A 3H3CA 3CPBA 3FI3A 4FSYA 3GCUA 3NYVA 3UIUA 3VUDA 3W8LA 2JDOA 4EOOA 3T8OA 2RG6A 2JIVA 3C0GA 3FL4A 3L9MA 1PKGA 3JY0A 4KSPA 1R1WA 5HCYA 4GIHA 1H1SA 4EH8A 4D1XA 1WZYA 4EBVA 5K4JA 1HOWA 4WD5A 4WNPA 3VUIA 3QZGA 2P33A 2VD5A 2YAKA 3DQWA 4LV5A 3EQRA 5EYMA 4S34A 4IAZA 1SVGA 3MWUA 3NIZA 3WI6A 2XCKA 4ACGA 1WFCA 1GZOA 2PUUA 3NZ0A 4FV4A 5GJGA 2YA9A 4WKQA 1KOAA 3A7JA 3R02A 3THBA 5BMSA 3P08A 3PJ1A 4KUJA 3F5PA 4O84A 4B0GA 3BQRA 4XV2A 3B8RA 5L4QA 3AMBA 4L7FA 3WZDA 4L7SA 4PQNA 2VNWA 2W06A 4AU8A 2RGPA 2YJRA 3VS3A 4X21A 5C01A 4MAOA 2PUPA 1ZYSA 4OT5A 3WIKA 3FUPA 4KS8A 3ZS5A 4AN2A 3QUDA 3EN4A 4G5JA 4MBIA 4D58A 4G5PA 4GRBA 2V7AA 4RIXB 3ELJA 3KXZA 4E4XA 2C4GA 5ANGA 3QL8A 3NW6A 4JRVA 5I0BA 3P7AA 4PY1A 3D7TB 2IW6A 2VU3A 4APPA 5DEWA 2PHKA 5FDXA 3HMNA 4J52A 3A4OX 3R63A 4I21A 4RMZA 5TO8A 3WBLA 5TF9A 4M7IA 4QMUA 3G15A 4DG3E 4YHFA 3F3WA 3FMKA 3OEFX 1KWPA 1IEPA 4X7QA 2XF0A 1J3HA 1Y8GA 3QYZA 4MWHA 3KXNA 4FV5A 2BIKB 3SRVA 4GS6A 4UWCA 1FOTA 3G90X 1YWVA 4MK0A 1YI6A 4CVAA 5JZNA 4F65A 2WTVA 4IBMA 5EW9A 3UMXA 3PIZA 4FX3A 4N6YA 5DE2A 2NNWB 4RFZA 3V8SA 2OJIA 1UU3A 2R3FA 3O8TA 2X6EA 4FEVA 1RE8A 4Z9LA 4JOAA 5FWKK 2EXCX 4RJ6A 4BDAA 4BTJA 4W8EA 2XIXA 3MA3A 4TY1A 4A9YA 3NVMB 3DKCA 3ZH8A 2HCKA 4FT3A 4YC3A 4ZSEA 4CT1A 5AV4A 5IEXA 4IWOA 2XKDA 4FBXA 5HGIA 1WBVA 2DS1A 4CMUA 4EOQA 3KN6A 1YKRA 2ITQA 2I0YA 2UW3A 3BYMA 4LOQA 2XBAA 4QYEA 2OH4A 4P5ZA 4WIHA 5BQ0A 5CALA 3SA0A 4U5JA 3NMUF 3QTWA 3ZC5A 3C51A 2J0LA 3ET7A 4EHVA 3KGAA 4PF4A 4C58A 5HX8A 5KX8A 3A4PA 3M2WA 5ETCA 2J9MA 1Q8TA 3PXKA 2BPMA 1ZAOA 4IM3A 3W32A 5HTBA 3U9NA 4QQTA 4OTRA 3UP2A 3I60A 3VS6A 5AAEA 1Q4LA 3DTWA 3LMIA 3A7HA 3LM5A 3F3UA 3V3VA 3MPTA 4PNKA 5EQPA 2W0JA 4FSWA 3BHUA 4DGOA 3EN5A 1B6CB 2HZNA 4O27B 5CENA 5FD2A 2HXLA 5JGDA 2V22A 2X0GA 4GCJA 1VYZA 4DYMA 3KRXA 3OBGA 3UBDA 2C6KA 3VJNA 4AN3A 5FQDC 4GSBA 5E8UA 4QYGA 1M17A 3RAKA 4IMYA 4L3JA 4C34A 1F5QA 5EDRA 4U0IA 2XIRA 1PXPA 2XNBA 5B2KA 4AA5A 2GNJA 4S31A 3QHRA 3R7YA 4DITA 3QTSA 2UZVA 3S3IA 3GU5A 3LMHA 4K33A 4JAIA 5AUVA 4PPAA 2JDTA 4GFMA 4BGQA 3GOKA 3IW8A 5C8MA 4IW0A 3KN5A 2VN9A 5CQUA 2XNPA 4EUUA 4O7TA 2BRNA 4J97A 1Q3DA 2E9VA 2H8HA 5IA2A 4BCOA 4EHGA 4RIYA 1VJYA 2BR1A 3PA5A 2J0JA 4NIFA 2XUUA 2SRCA 4QMWA 2WTKC 5ANIA 1J91A 5GINE 1OZ1A 2PZYA 5JRSA 4FTCA 3SDJA 5FEDA 4X2FA 4HGTA 5C8NA 3NNUA 3LFEA 1PW2A 4J7BA 1JBPE 4YURA 5CVGA 2QONA 3HP2A 3ORIA 2BZIB 4L46A 3N51A 5HG7A 3VBQA 3LE6A 4KKGA 5HCXA 1Q8YA 4QMYA 1YWNA 2VNYA 4IB5A 3GQIA 3OT8A 5JSMA 2JFLA 3NUAA 3TDVA 4CZUA 2RFSA 4EK3A 2UW4A 5CI6A 4YO4A 2R3OA 3V6RA 2PYWA 4ACDA 2X4ZA 4FKOA 4WO5A 5EHYA 4U6RA 2CDZA 3FZRA 4LGHA 2X8IA 4KB8A 1PXOA 4ACCA 4ITIA 4EH4A 3NW7A 3GU7A 4PDYA 5CYIA 5DN3A 1O6LA 2IZRA 2PE1A 3KEXA 3QCYA 4NM0A 4P7EA 5ETFA 2O64A 1QPJA 3NNWA 3EQCA 3DJ7A 2XA4A 3COMA 1CDKA 4R77A 4OW8A 4ZTMA 2P4IA 2G9XA 4FKLA 4ZOGA 2WZJA 3ORMA 2YIRA 3OD6X 1A06A 4XG7A 5HG8A 4F08A 3VNTA 3WYYA 4RZWA 3MA6A 3QTRA 1H8FA 4MX9A 5KE0A 1OL1A 3HAVA 5AR2A 3ZZEA 3ZLSA 2WPAA 3ANQA 1JNKA 2OIBA 2ZMDA 2QR8A 2VWBA 3F3VA 3FBVA 4G34A 3UJGA 4CTBA 3ENMA 5KMIA 3LIJA 4ZY5A 4O6EA 2CKOA 5H3QA 4FV6A 3D15A 1Q8WA 3COKA 4FKQA 3MTLA 4X3FA 5EW3A 2HWPA 4D1ZA 5A54A 4ORKA 1YWRA 1BMKA 4FZFB 2XJ2A 4YNEA 2BZHB 3OWPA 2UW7A 5C27A 3ZLWA 1Y8YA 3R7EA 3S4QA 3QRIA 4BDBA 4RT7A 5HX6A 4TYGA 4EOJA 5J9ZA 3SVVA 2CHLA 5DPVA 3QC4A 3EQGA 4PTEA 3EL8A 4WSYA 4CEGA 3FSKA 3S1HA 3BYUA 2XEZA 2C1BA 4G9RA 1GIIA 1H01A 3GUBA 3PVBA 3IK3A 4BICA 1BLXA 4G6LA 4RJ8A 1PRYA 5KMKA 4IJ9A 5I9WA 2YCRA 3PXRA 3OY1A 4JJRA 4RX9A 5CNNA 4IE9A 1R3CA 3TL8A 4GVJA 4H3QA 4NEUA 3R9NA 4BCGA 4L52A 4FTJA 3DK7A 3RNIA 2J51A 3LFQA 4FTRA 4RFYA 4C2VA 3AXWA 3QWJA 4BCPA 2PMIA 2UZDA 5K9IA 4C38A 2YACA 2WQMA 4EZ7A 4AOTA 1U4DA 4XP2A 5I3RA 4LM5A 5EDQA 3V04A 3SXRA 3JVRA 4CFVA 3O7LB 3RAIA 3DT1A 3OHTA 3TG1A 5E8YA 1AD5A 2YDIA 4GYIA 5D41A 4ZJJA 5TT7A 4EH2A 2V5QA 3BWJA 3QRUA 1ZMVA 4TT7A 5BYLA 4YR8A 3V5TA 3DA6A 3BGZA 5E90A 3UZTA 3MESA 1F3MC 3HV3A 3R83A 5JGBA 5BUEA 2YM6A 1DM2A 4RIYB 5ITAA 3GNIB 2C0IA 2B4SB 4FV1A 4X2NA 5C9CA 5I9ZA 2IVTA 2IO6A 2WIHA 4JAJA 2ITPA 3EJ1A 4GG7A 4LYNA 4XLIA 1OL7A 3MYGA 4QP7A 2BTSA 4EH3A 4OTIA 3SG8A 4YTHA 4XP3A 3RWPA 3H10A 4DFXE 3HVCA 2Z7SA 2BALA 3DBDA 1YVJA 4YGAA 4RC3A 4MXAA 2XK7A 3HV5A 2BTRA 3DTCA 4EONA 3EN7A 3NAXA 2I1MA 4XP0A 2JFMA 3D7TA 1YDRE 3E62A 4FIEA 2C6DA 2B9HA 2XIZA 4WSQA 5AUXA 2GS2A 4EQMA 4RQVA 4EKLA 2C1AA 5IEVA 4EOMA 2HZ4A 3ZHPC 3GBZA 2O2UA 3DK6A 1JWHA 3R9RA 3MVHA 4GK4A 4MXOA 3LW0A 5HG9A 2F7XE 3VBXA 4PTGA 5GZ9A 4GYGA 2PVNA 2OZOA 1UU7A 2YM4A 3VF8A 2VWVA 3KKVA 2CLXA 2ZV2A 4QMNA 4GK2A 4ZP5A 4HVIA 3Q9YA 4AT5A 3RBWA 4BCIA 4BR3A 2XYUA 3AMYA 4EL9A 1H00A 4JQEA 4XUFA 4BCNA 4QMPA 3RINA 4EHZA 4EC8A 3R30A 4TKSA 3RALA 4B4LA 3FI8A 1V0BA 3QC9A 4AFEA 3KREA 2OU7A 1SYKA 4DBNA 4F99A 3BBWA 3KU2A 1GAGA 3CSVA 3UOLA 4EH5A 1OL2A 4NW6A 5GNKA 1OUKA 3VHEA 3VS4A 2YZLA 5L2SA 2XKEA 3HV4A 2BRBA 5HTCA 3NNXA 3OTVA 5HNBA 1B39A 3I7CA 2IWIA 3SRVB 2XNGA 1KE6A 3DB8A 5CT7A 1ZWSA 2BDFA 2J50A 1X8BA 4JRNA 3TZ9A 4ANLA 3UYSA 1BI8A 4JIKA 4IEBA 4BKJA 3BI6A 2P0CA 3LOKA 2WMAA 5A6OA 2PZPA 1M2RA 3U6HA 2WFYA 5CXHA 3FZSA 3RTPA 3NR9A 2VTMA 4OGRA 5FTOA 2VZ6A 3HRBA 4FSMA 4DFUA 5BVFA 4IB3A 4PMMA 2XNMA 1M2PA 2C3LA 4QP2A 5IDNA 5L2WA 4W8DA 3C4XA 5L8JA 5CQWA 4YLJA 4K1BA 4AN9A 4UMRA 4YC8A 5LMAA 3EQPA 2NO3A 4NUSA 3E5AA 3DZOA 2C3KA 3G2FA 3FQEA 4UXQA 3W18A 2PMLX 5K0XA 3OW3A 3IW4A 4IX3A 4QP4A 4YLLA 1S9IA 2EU9A 4JX3A 4B6LA 2QG7A 2ITXA 4UWBA 4QMMA 2X2LA 5BVEA 2JD5A 4AT4A 5ANJA 5DFPA 3GI3A 4PUZA 4D28A 5HBJA 4O21A 2YHVA 3G6HA 5I9YA 2OWBA 5EDPA 2WTKB 3FLZA 4YZ9A 5GJFA 3UPZA 1CKPA 4DCEA 3QTZA 5HE2A 4TNBA 3C4EA 3VF9A 4ZTRA 2QO2A 5BYYA 5I9XA 4PTCA 3QZHA 1OM1A 2HYYA 3HDNA 3L9LA 4X0MA 3DNEA 2ERKA 3I5NA 5CVHA 4LGDA 1SVHA 5T6KA 1T45A 2PULA 4I6BA 1WMKA 3VIDA 2YIQA 3IDBA 2F9GA 2XM9A 2J0IA 5DR2A 4V0GA 3PVWA 4O0VA 5JQ5A 2VO6A 3WYXA 2XM8A 5DT0A 2ZOQA 3MIYA 4D2RA 5CXZA 1YOMA 3T3UA 3ZRMA 4U79A 1TQIA 2QOFA 4NCTA 1ND4A 3QTQA 4IB1A 4C4JA 4DGGA 4J1RA 2GFCA 3ZRKA 4AW0A 5DHJA 3F2NA 4MF0A 3VC4A 1WBNA 3CD3A 3FLQA 4J98A 4KAOA 2BKKA 4MWIA 3FV8A 4NT4A 2W1EA 3QQKA 4WT6A 2Y4PA 4U3ZA 4U43A 1CKIA 4ZZMA 3TV4A 5G1XA 5F1ZA 3R1NA 2JKKA 2F7ZE 3V5WA 3QZFA 5L6PA 2PK9A 2RG5A 3BLRA 2OW3A 3E8EA 3WE4A 3TUDA 4XX9A 5EM7A 4NW5A 5M09A 2CKQA 2R3KA 4MTAA 4ZSLA 3D83A 5CEMA 3ORTA 3QGYA 3B2WA 4FT9A 5E9EA 4EQUA 3DDQA 1HCLA 3LQ5A 4Y5HA 3ZFMA 1ZY4A 2RIOA 3HEGA 3EN9A 4L3LA 4O7VA 4BTMA 4DEHA 3PSBA 4YZCA 1ZY5A 2X7FA 4RIOA 4FG7A 4F09A 3Q2JA 3H9OA 2C68A 1ZZLA 2WTWA 4Q9ZA 5M06A 5GZ8A 2JGZA 5CAUA 5E8WA 3R8PA 5HBEA 1F0QA 4LMNA 3HV7A 5J1VA 3FLNC 4KWPA 3HMIA 1UWHA 3EL7A 4U42A 2QQ7A 3UO6A 2F2CB 4IAAA 3BX5A 4RVKA 4BDKA 3E88A 2WOUA 3KULA 1MRVA 3AC1A 4D55A 5AP1A 4FKWA 3UNKA 3PZHA 3T9TA 2J5EA 5AWMA 3LLAA 3FY0A 3UQGA 4XG2A 4U8ZA 4YZNA 1YXXA 5AUZA 3O7LD 4ACHA 5K4IA 3TWJA 3WZJA 3PJCA 4BDGA 3KCFA 4FGRA 2A2AA 3PP1A 4CQEA 4YHTA 1KE8A 1YOLA 2VX3A 3VO3A 4EJ7A 2XRUA 3BPRA 4YMJA 3IOPA 4GK3A 4KD1A 4RG0A 5CU0A 5LMKA 4YTFA 3DKGA 5D9HA 4DLJA 4PDPA 3G0EA 3PJ8A 3R1SA 2WTJA 4PV0A 3CIKA 3KA0A 1QPCA 4XS2A 4QO9A 4BGGA 4TYHB 5AP5A 3P79A 4IVDA 3CQWA 4CRLA 3AT3A 4PPCA 3K3JA 2PY3A 3FAAA 5HLWA 4FSQA 3BGQA 4TNDA 4QTDA 3GU8A 3HA8A 3MV5A 4YJVA 2RFDA 4QTAA 4ID7A 3WE8A 4C36A 5EKOA 2V55A 3F7WA 3FMDA 3DQXA 4FKRA 4V05A 3GC9A 2BIYA 3ORXA 3UQCA 3POOA 2V7OA 4JDHA 4QT1A 4QP3A 2JDVA 4A7CA 4BB4A 2ZDUA 2C5NA 4PWNA 3RCDA 3K3IA 2Q83A 4TWPA 2PPQA 3FC2A 4MXZA 4OTFA 2ZM4A 5KMLA 2W99B 4FV2A 3GQLA 1E1XA 3UOHA 5KKRC 5HQ0A 3DBQA 4RA4A 4NZWB 2GHLA 4I5MA 2ZVAA 4MQ1A 4AAAA 5CASA 3HAMA 1W83A 4C35A 5CSPA 3CKXA 2UW6A 3JYAA 3ZFYA 3LMGA 4BZOA 1YOJA 4C3FA 3Q32A 3OCSA 2UZNA 3ZO4A 1YXTA 1ZOHA 5GIOE 3GFEA 3QLGA 5LWNA 5FRIA 3PWDA 2CNQA 5ANOA 1ZZ2A 5CF5A 3CCNA 3UP7A 4FT0A 4DA5A 4YZDA 3U54A 4F64A 4F7LA 3TKUA 3FWQA 4DH3A 3DZQA 3VUMA 4OBPA 3Q9WA 2FYSA 4A4LA 4WBBB 5HE0A 3D2KA 4IAFA 4O7SA 2PVJA 4BDEA 3BYSA 3PRIA 3C5UA 5DEYA 3ZONA 1NVRA 3EZRA 3QA8A 1JKLA 1YHWA 2X2KA 4I23A 3WF7A 5HI2A 1NVQA 1M7NA 5HIDA 4JBOA 2VGOA 3M11A 3QX2A 3IONA 3LM0A 4FTNA 4J71A 5EYKA 4B9DA 3TIZA 5B2MA 4FR4A 5KZIA 4MCVA 1OKWA 1AQ1A 4B8MA 5HG5A 3MFRA 2W7XA 4V0GB 4QPAA 3UO5A 4FNXA 1R0PA 4BY9E 1W8CA 4FV3A 5G6VA 2GS7A 1ZYDA 3HP5A 3QX4A 4ZLZA 4RJ4A 2F4JA 5IISA 1I09A 3PRFA 5M4UA 2FGIA 4MBLA 2X2MA 4J8NA 4BDJA 2W1CA 2XYNA 3IG7A 2WKMA 3Q6WA 4IM0A 4HOKA 3R7OA 4ZTQA 4AUAA 4CMTA 5LMKC 3KXHA 4UX9A 5IUIA 4RWKA 4Y72A 2CJMA 3SQQA 3O8UA 2GTNA 4IZ5A 4S30A 2PVLA 4NU1A 3S2PA 2QOHA 3FZPA 5DRBA 1URCA 4C8BA 5HZNA 2YISA 3GOPA 2YCFA 3HUCA 4AP7A 5BUJA 4GU9A 1YW2A 4I0TA 4O7LA 2X1NA 5EM8A 1PMNA 1MQBA 1BYGA 2ZB0A 4IB0A 4W4YA 4IX6A 2B7AA 4DFYA 3AQVA 5HD4A 4OTGA 4E5BA 3P7CA 4GT3A 3FKLA 4FZAB 4CCUA 4UXLA 1JSUA 3LPBA 2UZLA 3DAJA 5CU2A 4ZXTA 4QMZA 5M56A 3A99A 3W2RA 3ROYA 2HAKA 2BKZA 3LJ2A 4FSTA 3ATSA 2WMRA 4RFMA 4A07A 4K9YA 4C4IA 5JT2A 3OW4A 4ANBA 5ETIA 3DV3A 2YFXA 4XG4A 5E91A 4EQCA 5J79A 3F82A 1SVEA 1L8TA 3AT4A 2WMTA 3FDNA 2XEYA 4DAWA 2VAGA 1OPLA 3UNJA 2E9PA 2ZB1A 3MH3A 3HL7A 5LVOA 1LEWA 2G2HA 4ENXA 5M55A 2CMWA 5H2UA 3QRTA 2GQRA 4PL3A 4NKSA 4QTEA 1VYWA 2EXEA 4YZMA 4BCFA 3W2SA 5LVNA 2F57A 4KBAA 3I5ZA 4WNOA 1H24A 5M53A 3FLYA 3BU5A 3GC7A 3TJCA 4ANSA 4K18A 4FL1A 2CN5A 3UIXA 5L8LA 1UA2A 4X2JA 3F5XA 1QPDA 4QRCA 2LAVA 4NYEA 4HVHA 3E3BX 2HZ0A 4FKTA 1H1WA 4F7SA 3TM0A 2Y8OA 2XK8A 3QD0A 4QMXA 5I3OA 1GY3A 3FHRA 4USFA 3POZA 5JN2A 4K6ZA 4E6CA 4XRJA 4Z16A 4ASZA 1PJKA 3ODYX 4E7WA 4LRJA 2JEDA 2PSQA 1XH4A 4YJOA 2VTJA 1JLUE 3CGOA 4CSVA 3UZPA 1VZOA 1S9JA 3E63A 2QODA 3ZM4A 4KBKA 1IAJA 2C0OA 4UN0C 2R3NA 5E8XA 3SAYA 5JEBA 5LVPA 4X3JA 1LP4A 2R0UA 3C4FA 1OIRA 3MW1A 4LUDA 5GJDA 2PTKA 4FL2A 4MBJA 3R8LA 4G3CA 2FSTX 2VWUA 3QGWA 4TYEA 5AEPA 3HMOA 2WMQA 4G31A 5KMNA 4RSSA 1CKJA 4AZFA 3CXWA 5CAVA 5HU3A 5EQEA 3BHTA 4FK6A 3NLBA 3Q4ZA 4RVTA 4D4YA 4XNEA 4ASDA 4O7YA 4AA4A 1CSNA 3BV3A 3SW7A 4DF3A 2W5BA 4QMTA 4A4OA 3DBFA 4UB7A 3NDMA 4FKUA 3FEGA 2WEVA 3CJFA 5KMJA 4FV0A 3AC3A 2PZ5A 4I5CA 4J53A 4FUXA 3UVQA 4GFGA 2XZSA 5I9VA 4ITJA 4HYUA 4FEXA 3U55A 5CZIA 2VTLA 4Q2AA 5L2TA 1IA9A 4HGEA 3F3ZA 5FM3A 2BCJA 5FBOA 4U9AA 3VS7A 2WMXA 3HLLA 3NNVA 2B55A 4GU6A 2J5FA 4GMYA 3TTIA 4C0TA 2G15A 3TCPA 4IAKA 1REJA 3CP9A 4N57A 4A9UA 3TNHA 3KRJA 3LAUA 4RWIA 3M42A 4FZDB 2QOIA 3NIEA 1OUYA 4RLKA 4F0IA 4ANMA 4LG4A 3FMEA 3WOWA 2XP2A 2UZOA 3KK9A 2KULA 3QQLA 5KCVA 1OPJA 2YLEA 1UKHA 4KBCA 3TDWA 3HGKA 4JS8A 2ETMA 2HWOA 4EZ3A 5JFXA 4M0ZA 3Q4CA 2YDKA 3P9JA 3BHVA 4O7RA 2B53A 1PKDA 4G2FA 4U41A 5HVKA 5FEEA 4GJ3A 4YBJA 3U4WA 3LCOA 4EOSA 5LMBA 3ORNA 2A1AB 3R0TA 3G33A 3DB6A 3TZ7A 5LJJA 1Y91A 4ENYA 1P4FA 4RC2A 2R3PA 3AMAA 2C6IA 4FTUA 4FKVA 4PMPA 3W1FA 3O23A 3BV2A 4X6RA 5DIAA 4FKPA 3HMMA 3Q5IA 1U59A 3Q6UA 4FVPA 4NKAA 3W2CA 4AWIA 1E1VA 1LPUA 4M69A 4CNHA 3U6JA 2ZYBA 3KF4A 3QQJA 4MD9E 4C37A 5JRQA 2B52A 2EUFB 2IW8A 4YTCA 1WAKA 2R3LA 2YM3A 3R7VA 3G5DA 5DVRA 2PMNX 5ICPA 3C7QA 5IG1A 3QTUA 3EFKA 3C4CA 1Z57A 4YPDA 4WNMA 2OIQA 5A4EA 3VULA 2E9OA 4J8MA 5H8EA 1ERKA 3UC4A 1G8SA 2ITUA 4QMSA 2VUWA 3NUSA 1MP8A 5I9UA 1V0PA 4J99A 4CLJA 1JSVA 4M97A 4WA9A 2PVYA 2OXYA 4BI0A 4FIGA 4QMOA 4ZLOA 5D1JA 3FSFA 3MBLA 5HCZA 4E4NA 1PXMA 3W8QA 3QAME 5AP4A 3MIAA 3I79A 4ZEGA 2JC6A 5M07A 2OFVA 3EQIA 3JXWA 4BCKA 5FG8A 2J90A 3MI9A 4JDJA 1DI9A 3GB2A 3CTJA 3PVGA 3HECA 5AAFA 2BFYA 3ZLYA 3MH1A 4E4LA 4AA0A 4HYHA 4I6HA 1KOBA 5CSHA 3DDPA 2O3PA 3GCPA 4LOPA 2OXXA 3MS9A 4IX5A 4K0YA 3R2YA 1J7UA 4FOCA 4XH6A 4CFNA 4DG2E 3ZRLA 2WTCA 3DLSA 3JPVA 2QO9A 2GNGA 3NPCA 3NYOA 4AXAA 4IM2A 2CCHA 4TZRA 4F7NA 1ZOEA 5TR6A 3OP5A 4FTTA 4YJSA 4U81A 1YI3A 3R8UA 4FIIA 3FMLA 4H58A 4G6NA 5DA3A 4UYNA 2KTYA 4MQ2A 3QQFA 1P2AA 4GUEA 1WCCA 4I5PA 2WTDA 3FI2A 4LL5A 4NTSA 5FEQA 4E1ZA 5BPYA 2QU5A 2Y0AA 3SOCA 4FIFA 1ATPE 1J7LA 3ALNA 5LARA 4CG8A 4I0RA 4NL0A 4ZSGA 3Q53A 3V5QA 4BWPA 3ZEWA 4UMQA 4FSRA 3QCXA 2JBOA 3EB0A 3Q9ZA 1UKIA 2GNIA 4TWCA 1FVTA 3F3TA 3MH2A 3Q2MA 4GG5A 4I20A 4XV9A 3KXMA 2RL5A 2C6LA 4K2RA 5B7VA 2YIXA 4DHFA 2Q0BA 3RM6A 4BIEA 2RFNA 2XKFA 3OUNB 4DLIA 3A7IA 4IHPA 2QOKA 3BQCA 4M12A 4HW7A 2BRMA 3O96A 3EZVA 2OI4X 1GNGA 5CY3A 1XH9A 2WHBA 3FQHA 4FT7A 1GZ8A 2IVVA 3DKOA 3IS5A 3NW5A 3RPSA 4WG4A 3VQHA 5BVDA 1FBNA 3VBVA 3LFCA 4BTKA 2IJMA 1OBGA 5IQBA 2QOOA 3QTIA 3LCKA 5IUGA 3KXXA 5LVMA 3FPMA 3PWYA 5CNOA 2ACXA 3CJGA 3PPJA 4C4FA 4TYJA 1LUFA 4JQ8A 2CPKE 3RPRA 4FODA 3LXNA 4R1YA 3D4QA 1JKSA 4YLKA 4EOLA 3EYGA 3PY0A 3E93A 4E5WA 2XNEA 2AUHA 4FSNA 4FUYA 3R01A 4KIQA 1IAHA 3C0IA 2ZV9A 4EK6A 5K5NA 5L3AA 4TPTA 2GFSA 3ZZWA 3QA0A 3OZ6A 4H3BA 3F88A 3OEZA 3HZTA 4AZSA 4GVAA 4AW5A 4RVMA 2AYPA 1H4LA 3OXIA 4I1ZA 4W9WA 4XOYA 3A8XA 4BRXA 4QP9A 2WOTA 4MHAA 1UU9A 1OL6A 4O82A 3B8QA 4F7JA 4JG8A 1U5QA 2ITWA 2QOLA 1WBTA 1PXNA 3PY1A 3PSDA 4QYFA 4BWXA 2ZV7A 2O8YA 4M13A 4PP7A 2GPHA 2QO7A 3DJ5A 5IH5A 3DFCB 3PP0A 3FZTA 3P78A 3IPHA 2FB8A 3C4WA 3N9XA 3GCQA 1UNHA 5J1WA 3ZTXA 5CF8A 3LVPA 4RQKA 4RC4A 4BI2A 3SG9A 5IU2A 4H05A 4BYIA 1Y6BA 2PZIA 2XB7A 2QOCA 3NRMA 2XVDA 3ULIA 3D9VA 2OSCA 2OXDA 4FZ7A 4AE9A 1KUTA 3RVGA 3CTHA 1PXJA 5HE1A 4A9SA 2WB8A 5DG5A 3DCVA 3MY1A 1UU8A 3NX8A 3H4JA 4O83A 3L8XA 1WBOA 4NH1A 2B9FA 4E6QA 4JR3A 3IOKA 3QXOA 3RHXA 5D11A 3REPA 3BLQA 3WF8A 2B9IA 3PXFA 3OY3A 4GW8A 1XBBA 2W4OA 4XRLA 5AP3A 5AX3A 2B54A 4IACA 4IDTA 3SW4A 1H1PA 4DTBA 3BIZA 4AZWA 2X7GA 5DT4A 4RA5A 1YDSE 4XG9A 1PMEA 4GT5A 3QD3A 3RMFA 2GSFA 4YPSA 1XKKA 3COIA 2YWPA 5HICA 3DU8A 3WZUA 1CTPE 2JAMA 3ORKA 3QD2B 4OTQA 4ZTHA 1G3NA 4DT8A 3GGFA 3QRKA 1R39A 3D5WA 4DTAA 2VTNA 2OH0E 2X4FA 5KKRB 2NPQA 5A4QA 4IIRA 3CY3A 3AC2A 3MVLA 3T9IA 1Y57A 1NY3A 4FEQA 4AS0A 2BZKB 5ANDA 3UTOA 3LCTA 4L00A 4DH5A 3TUBA 3QUEA 3KFAA 2YABA 3UVRA 4UZHA 4Z55A 3RNYA 3R73A 1LEZA 3R8VA 2VO7A 3VHKA 4ANNA 3UDBA 2GDOA 3NAYA 3MGYA 3PE2A 3QUPA 3SLSA 2UUEA 3OXZA 3L8VA 3QQHA 5EYCA 4D1SA 4ITHA 2IZSA 4FKJA 1I44A 2W5AA 3MJ1A 3ZUVA 3Q9XA 5BUIA 3BKBA 2R3HA 5E1EA 5KZ0A 5A4TA 3QYWA 3H0YA 3QTXA 4C62A 2YIYA 3A8WA 2XK4A 2ZV8A 4CT2A 4ZSAA 1OI9A 2GTMA 3FKNA 4NTTA 2UZBA 2YDJA 4FICA 4K8AA 4HJOA 4OTWA 2OJJA 3CE3A 5BYZA 4DGLC 4Z7HA 5IUHA 1A48A 4M84A 3R71A 4C57A 2P3GX 5AMNA 4QD6A 5CANA 4L67A 3RGFA 3FYJX 2W1ZA 3OBJA 4E20A 2ZDTA 3ZXZA 5EOLA 4EZ5A 2I40A 2XS0A 5TE0A 3LZBA 1DAWA 4FL3A 1H28A 1M2QA 4D4VA 4C4HA 3NWWA 4G17A 3BYVA 4X3FC 4P5QA 4K77A 1AGWA 4L44A 2JKMA 3F66A 3IO7A 3P7BA 4J96A 4KNBA 5IPJA 3PLAE 3ERKA 4MF1A 4FTQA 4EWQA 3LFBA 5AR4A 2WAJA 5CSVA 4RX5A 4RX7A 3V8TA 3GEQA 3ZSHA 2HOGA 2W05A 4V01A 2ONLA 3VS2A 1PXKA 2AC5A 4I0SA 4KA3A 4FTLA 1A9UA 3VUHA 4OBOA 1NA7A 4FA2A 4R3CA 2WU6A 2IW9A 2W1DA 4QYHA 4NIFB 4NFMA 4HPTE 4A9TA 3VQUA 3A7FA 5B2LA 2NRYA 4GUBA 4RWLA 3TN8A 2H6DA 3U8WA 4FV7A 2CGXA 4FTMA 4EJNA 3UODA 4D2SA 3F69A 2R7BA 4JVGA 4RJ3A 3FKOA 1PYEA 3IECA 4RPVA 2BHHA 3TEIA 3GU6A 3FLSA 3QLFA 4CFWA 4MD8E 3OF0A 4HNFA 1OIYA 4UMPA 3TT0A 4EOIA 1FVRA 3DBEA 1W0XC 4IZYA 5CAOA 5CX9A 2QURA 3KF7A 4M69B 1OL5A 5KHWA 3E7VA 4XV3A 4M14A 4BBFA 4BKYA 1JOWB 3R8MA 3D94A 4FEWA 3BGPA 3P23A 4HGSA 5M4CA 2ITTA 2LGCA 3OWKA 4C3RA 3KY2A 3PZEA 2F7EE 5EYDA 4FI1A 1OBDA 5AFVA 3ZO1A 3QQUA 2PVHA 2PUIA 3UG2A 4O38A 2YZAA 1QCFA 2VWIA 4G3DA 1K9AA 2YM5A 4MVFA 5AJQA 1OGUA 3RM7A 4EI4A 3UQFA 1P14A 3EQDA 4WUAA 4I5HA 3N4VA 2WXVA 4AOJA 4BDIA 4GV1A 2G2FA 3G9NA 3NUPA 3OOMA 3O8PA 4CFXA 4XG8A 4DGNA 4CFFA 2HK5A 2UZEA 5CU4A 5CEIA 1ZLTA 4L43A 3V51A 3DY7A 4DT9A 4USDA 3H9FA 3NYNA 3ORZA 2EVAA 3AD5A 5K5XA 2QNJA 5IQIA 3WIGA 1FGKA 2J0KA 2VTAA 3PXQA 1FMKA 4XLVA 3W33A 3GU4A 5D7VA 3K2LA 5JMSA 1IA8A 3HMPA 4AGCA 4E26A 3OCGA 5KBRA 2ITVA 3G6GA 3Q52A 1JPAA 2X39A 3IDPA 3KL8A 4H39A 5CTPA 4GL9A 4H1JA 1OKZA 3PIXA 4FVRA 4IVAA 5AP6A 2WMWA 3ZUTA 4BCHA 4BL1A 3UOJA 3BBTB 5FM2A 2ONLC 1BL7A 1ZRZA 1Q3WA 2W5HA 4MNEB 4DINA 2WU7A 5L6OA 5DT3A 3DBCA 5JK3A 3KXGA 3KVXA 3MDYA 4C2WA 2Z60A 3UGCA 4M67A 4OAUC 2Y7JA 4IFCA 4R7IA 4R1VA 2PZRA 3CQEA 3FZOA 3W16A 4O22A 5J9YA 1PYXA 3VS0A 3PY3A 4KIPA 3AD4A 5HO8A 4RVLA 4JT3A 3OC1A 3V01A 1SZMA 4FTAA 3I4BA 1DI8A 4YBKA 1JQHA 5HBHA 4CFUA 2FSOX 2OO8X 2GQSA 3KRLA 4JBVA 1EH4A 2GHMA 3DLZA 5KHXA 4KIKA 5CWZA 3MH0A 3VS5A 3DFAA 5JQ8A 3MPMA 4AT3A 3L9NA 1H27A 5IQGA 3TIYA 5AM6A 4N4SA 5IH4A 2CGVA 3UIMA 4CGAA 2DWBA 1JVPP 1FVVA 3Q4UA 4E73A 3HRFA 2V0DA 4ZSJA 4F1OA 2GQGA 5CEPA 3VW6A 4ONAA 5FXRA 4DCAA 4FZ6A 3CPCA 4MNEA 1TKIA 2O0UA 4TN6A 3RK9A 2J6MA 4E8AA 3EFJA 3R21A 1FGIA 4LI5A 4F70A 4HVSA 3QBNA 4EK5A 3F2RA 3VS1A 5AR7A 3OCTA 4Y5QA 1XO2B 3QKMA 4R3PA 5CEQA 1URWA 1GJOA 3R9OA 4R78A 1Q8ZA 3QF9A 1RW8A 3AG9A 4I6FA 5AM7A 5AV1A 5EKNA 5HD7A 5HVYA 4DBXA 4TW9A 4KIKB 4GT4A 4EEVA 4ZZOA 3E87A 4LV8A 2W1FA 3ZLXA 2Y4IB 3AGMA 1OECA 1OKVA 1U54A 5IQDA 3BHHA 1FMOE 4I6QA 3NCZA 3LJ0A 4FKGA 1H0VA 4O1OA 1MQ4A 3Q60A 1W7HA 3D2IA 4D2PA 5IQCA 4G3GA 5I4NA 3QALE 5C1QB 1YI4A 2XNOA 3PA3A 4W9XA 5FDPA 4JG6A 4D2VA 1YXSA 4DTKA 4EWHA 2Z8CA 4FNZA 1KV1A 3W2QA 2XCHA 3VUGA 4PMTA 2QHNA 3KCKA 5HEZA 3OT3A 4D5HA 4ZZNA 4XMOA 4DFLA 1WBWA 2Z2WA 3LFSA 1GZNA 2X6DA 2GHGA 4Y8DA 2WELA 1DS5A 2YM7A 3OTUA 3NUYA 4EH7A 2JAVA 2ITNA 5AUYA 2JIIA 3R1YA 4MKCA 3NEWA 2YAAA 4FC0A 3FXZA 2XIYA 4DFNA 4FE2A 4RJ5A 4AW2A 3ITZA 1V1KA 2VGPA 4L6QA 4C3PA 5HIEA 2GMXA 3EQFA 4D5KA 1W98A 5EM5A 4TXCA 4XHKB 3ZEPA 4GKIA 4O0TA 2CLQA 4FNYA 4O91A 4DFBA 2AC3A 4CZTA 2FH9A 2W1GA 5EOBA 4I22A 4F4PA 5HO7A 3EFWA 1H0WA 2BUJA 3ETAA 1IRKA 3KULB 3DKFA 4IAYA 3HKOA 4HGLA 5HE3A 5A3XA 5GHVA 1PXIA 4JQ7A 3TV7A 1H25A 2A27A 5EM6A 4L68A 3RCJA 2QCSA 2VTPA 2PVKA 1Z5MA 3Q5ZA 5LCJA 4IWPA 2DUVA 2JDRA 1PMVA 5JH6A 5KO1A 3FLWA 5D12A 5LWMA 3GC8A 1YXUA 4JNWA 3V8WA 5IQAA 3P0MA 3MVJA 1BI7A 1BX6A 3SGCA 2R3JA 4YP8A 2A19B 3RZBA 3UG1A 3DK3A 1XBAA 2WEIA 4ARKA 4E93A 2WNTA 3NUNA 1XHAA 4E6DA 2DQ7X 3EYHA 4L53A 2VX1A 5TKDA 4OAVB 2QLQA 4NM5A 2XJ1A 2CGWA 3HUBA 2UW8A 4JXFA 4O81A 4U40A 4PL5A 2R3GA 1Q5KA 4I3ZA 5CF6A 4M66A 4AZVA 4CYIA 1WBSA 4D0XA 1MUOA 2YEXA 2YWVA 5A46A 4YHJA 4O1PA 5FGKA 4O6LA 5HLPA 3HA6A 3SHEA 3U51A 3FY2A 3ACJA 4QOXA 1YXVA 3R8ZA 4GJ2A 3DAEA 2YLFA 4NCTC 2I7QA 2ETKA 4C59A 4FT5A 3PJ2A 2VO0A 3DJ6A 3E8CA 4I24A 4BKZA 5E8SA 1XJDA 3R9HA 2R7IA 1PMUA 1ZMUA 2ESMA 4WRGA 4F63A 3GENA 5A9UA 1YQJA 5DRDA 1J1BA 3TKHA 3I7BA 3TNPC 3PDTA 4RZVA 2YCSA 4ASEA 3I81A 4QQJA 4AGWA 3TKIA 4DFZE 4ZS4A 3EKKA 1H26A 2Y9QA 3A7GA 1PY5A 3ZBFA 3MPAA 2FVDA 4O2ZA 2G1TA 3VUTA 1WBPA 5AP0A 2UW0A 1YHSA 3OFMA 4L45A 5AP7A 3OXTA 5ACBC 1APME 3VRZA 3R7IA 4BHNA 2ITOA 2X9FA 5JFSA 5M51A 3QRJA 5T68A 3UO4A 1OMWA 2WMBA 2BVAA 1RDQE 4ZY4A 5FTGA 2WQBA 4L42A 2VX0A 5LCKA 4I4FA 2BDJA 5IQHA 3MSSA 5AV2A 3AC5A 2Z7QA 4C4GA 5JZJA 3IW5A 4W4VA 3VN9A 4EYJA 3F7ZA 4FG8A 4W4XA 3CY2A 2Y6MA 4QQ5A 1ZMWA 4M68A 3GCSA 5AADA 3FYKX 2XNNA 5KUPA 5L2QA 4IXPA 3OWLA 4M0YA 3EN6A 4F9YA 2PVFA 3GC0A 2X7OA 1K2PA 3JVSA 3V5PA 4BGHA 1NVSA 3LXKA 2WGJA 5F94A 3I0QA 3LKMA 3ANRA 2C6EA 4ZTNA 5H8BA 4GH2A 4Z3VA 3FQSA 4NFNA 4DEEA 3PYYA 2F2UA 2GCDA 2BAQA 3AGLA 4AOIA 4DN5A 3EWHA 4N0SA 5DGZA 1BL6A 1CMKE 5HU9A 2OK1A 2UVYA 2VTSA 4EK4A 1JAMA 1MRYA 1O6KA 3FMMA 3MB7A 4F9WA 5AP2A 4MEDA 4QNAA 4ASXA 4I92A 4OTDA 2FO0A 3RP9A 3N4TA 3UOKA 5CAPA 4C02A 2VWXA 4TYHA 3W2PA 2QR7A 4A06A 4DH1A 2F49A 4O86A 3ALOA 3CTQA 3WF6A 3ATTA 3AC8A 4S2ZA 4O0XA 4WBOA 3UNZA 4MNFA 3TJDA 1OPKA 4NJ3A 3RJCA 5FP6A 4QP6A 3H30A 3QD4A 2PL0A 4UV0A 3D5UA 4RRVA 4IDVA 3SD0A 3P1AA 4JIAA 4CTCA 2H9VA 4O0WA 1MRUA 2OJGA 2W1HA 2JITA 2YERA 3EHAA 4HYSA 2ZM1A 4UY9A 4NJDA 1XH7A 2OF2A 4FYNA 5B0XA 2Q0NA 4R5SA 3R7UA 4FTOA 3PUPA 4QNYA 2RSVA 2QVSE 4ZJVA 2J7TA 4ZTLA 3W2OA 1W84A 2R5TA 3MTFA 4O2PA 3U4UA 4CLIA 2R9SA 4YO6A 1UV5A 3PE1A 1P4OA 1UNGA 2E9NA 3V5JA 4MXXA 5AUUA 2CGUA 3MB6A 4YSJA 2OGVA 4U7ZA 4LUEA 2BAKA 3UMWA 5L2IA 3UZRA 2BRHA 1V0OA 5JGAA 4IWQA 3OWJA 4LQMA 2QOBA 2IVSA 2J4ZA 2Z7LA 4O0SA 3TV6A 2OICA 2OBJA 4M8TA 2PWLA 3Q3BA 2YN8A 1IR3A 3KB7A 3UC3A 2OKRA 4CV9A 2Y6OA 5HNGA 4NSTA 2XBJA 1DAYA 3TI1A 2HW7A 3BRBA 2OF4A 4QMVA 1XQZA 5HTIA 3O0GA 3DXQA 1Q61A 2WQOA 2EWAA 3F5GA 4XOZA 4A4XA 2BRGA 2VTOA 3CBLA 3C9WA 3LXPA 2G2IA 3ZO3A 1Q8UA 3FL5A 4ALWA 1XWSA 2VRXA 3T3VA 2GU8A 1YRPA 3K5VA 3FE3A 4HCUA 4X2KA 4PX6A 3RWQA 3EMGA 3TZMA 4ALVA 4D4RA 4E3CA 1TVOA 1YHVA 3EOCA 5F4NA 5HOAA 4XBRA 2VTIA 4BCJA 4GIIA 5IQEA 4IZ7A 4O0UA 5IQFA 5AV0A 4AF3A 2VTRA 2BHEA 2WQEA 2XKCA 4IX4A 5EK7A 5EFQA 4ZTSA 3CQUA 4PL4A 4WNKA 3ZYAA 3ZCLA 4YJRA 2VWWA 1OKYA 2OFUA 3GT8A 4FTIA 4FF8A 2BFXA 4IC8A 4BBMA 4IQ6A 3QXPA 4UMUA 3BLHA 3JY9A 3PTGA 4JL9A 5FLFA 5AUWA 5J5TA 3RAHA 4TWOA 2HXQA 1PHKA 4PMSA 1KE5A 4M3QA 3ZO2A 4XG3A 5HORA 4RBLA 3OOGA 4H1MA 3FC1X 4EKKA 2C6TA 2X81A 5FP5A 2FA2A 1ZARA 3FZ1A 3HDMA 3OG7A 4FMQA 4NK9A 5AIKA 4EH9A 1G8AA 4H36A 3VBWA 5J7HA 2PVRA 4O0YA 4F0FA 1U46A 1ZXEA 3RPOA 3F6XA 4X3FB 1JSTA 5IDPA 3KMWA 3MJ2A 3NVKI 3L1SA 4FEUA 4CYJA 3DS6A 1TQMA 5K0KA 4DE4A 4BCMA 3CC6A 3KC3A 5CU3A 1OITA 5HIBA 4DC2A 4MD7E 2DYLA 4QTBA 2W17A 4AQCA 3SC1A 2RFEA 3OCBA 3P4KA 4L01A 4LOOA 4OTHA 3LFNA 3PPZA 4WG3A 4MXYA 3S95A 5C8KA 5L6WL 1FQ1B 3PSCA 5E1SA 2GNLA 5IMEA 3QWKA 3PA4A 4WG5A 3BZ3A 4ANQA 4F0GA 4CG9A 5EHLA 4RJ7A 4EH6A 4LL0A 1NT2A 1YDTE 5E8ZA 1REKA 3EFLA 4KSQA 5AX9A 2R3IA 4KS7A 4S33A 4O7NA 3P86A 5EW8A 4V04A 5KMOA 4O0RA 3E92A 5J87A 4ERKA 2QKWB 3BEGA 2PUNA 3CGFA 4IVCA 1KV2A 2HY0A 4USEA 2J0MB 1ZYCA 1Q24A 4BIBA 4BYJA 4CKRA 3FJQE 2B0QA 3U9CA 5FTQA 5CEKA 2EXMA 3C50A 3QKKA 3ZU7A 2EB3A 5DI1A 2JKQA 2C30A 4YZBA 2PMOX 3DXNA 5EG3A 5H9BA 4CZYB 4ZLYA 4MXCA 2XK9A 5E4HA 1Y6AA 3SXSA 3TNQB 1W82A 3ZM9A 1JKKA 4IANA 3CD8A 4Q5EA 2R3MA 1BUHA 3IKAA 3QZIA 4PPBA 5J7BA 3N4UA 4FIHA 5IKWA 4ANOA 2R4BA 3RK5A 5AIRA 3TTJA 4NWMA 3TUCA 3BEAA 2E2BA 4JDIA 2CSNA 2IZUA 4FOBA 3LJ1A 2UVXA 1XH8A 3DOGA 4JR7A 4OLIA 4APCA 4BTFA 4O7ZA 3HRCA 2WIPA 1XH6A 3VBTA 4F6SA 2B1PA 5IA3A 5IH6A 1J1CA 3CEKA 3NYXA 1GIHA 4G1WA 4HVDA 4FTKA 3R00A 5E8VA 2A0CX 4N6ZA 2H96A 5FXSA 2UW5A 4Q5HA 3BWFA 3CS9A 2OG8A 2HY81 4UBAA 5KBQA 2C0TA 5H8GA 4EUTA 1IG1A 1KE9A 2O63A 3R2BA 5AA8A 1RJBA 2ETRA 5BNJA 2R3QA 4XG6A 4ZMEA 3CR0A 4YC6A 4U44A 3BU6A 5BVNA 3ZOSA 3DGKA 3ZDIA 1LR4A 4FK3A 2IPXA 2WMUA 4OUCA 3ZDUA 3EKNA 2C6MA 5CI7A 5FUTA 3TNWA 1KSWA 4KKEA 3RKBA 4U97A 2UW9A 2VWYA 4QP8A 1PXLA 5LOHA 4IZAA 4FKIA 4ZIMA 3VRYA 4DG0E 2O65A 2R0IA 3PLSA 3EQHA 1SM2A 5DWRA 3D7ZA 4BVUA 2C69A 3MVMA 4JBPA 5J95A 2C47A 3PJ3A 4UEUA 4AX8A 3VWAA 3O71A 3AOXA 2VO3A 2QLUA 1QMZA 2WTIA 4QQCA 3ZXTA 3LLTA 3VJOA 3D0EA 4PDSA 4BDCA 2I0HA 3CKWA 3II5A 3JUHA 5EH0A 2C3IB 5CEOA 5JKGA 3IGGA 5M08A 2H34A 4J95A 4KRDA 3BE2A 4BWKA 3E8NA 3G0FA 3I6UA 1M14A 1Q97A 4IC7A 2J2IB 4DH7A 5AR8A 4YJPA 5KMMA 4EC9A 1GIJA 3C13A 5DH3A 4HZSA 3WARA 2W1IA 4XBUA 4YJNA 3SKCA 3BELA 5JFVA 1XBCA 4BDFA 3TNIA 2CNVA 5CZHA 4H3PA 5AV3A 1O9UA 2JDSA 2XH5A 3BCEA 3OS3A 3GCVA 4KABA 5ANEA 3LXLA 5LVLA 3VBYA 2C6OA 4I93A 2V62A 3C1XA 4R6VA 4UMTA 2W4JA 4FV8A 2XIKA 3AC4A 1NXKA 2NRUA 2WMSA 4IVBA 4E5AX 2R64A 3FXWA 3O2MA 3TACA 5CAQA 3S00A 5C26A 3QQGA 2CKEA 4F1MA 4N70A 3UPXA 1SNUA 2B9JA 3EQBA 5T3QA 5BX0A 2UZTA 5GZAA 4AZEA 4CXAA 3LHJA 4WUNA 3E64A 2YM8A 5IA0A 2CKPA 4PNIA 4IFGA 1ZOGA 1VEBA 2R2PA 3PG1A 3O50A 4FYOA 5M57A 4WRSA 5DBXA 1GZKA 4BC6A 4CCBA 3PXZA 2QOQA 3KMMA 5EI2A 1WVWA 3R1QA 4AGUA 4WHZA 4ERWA 4CRSA 5I5ZA 1Q41A 3E3PA 2CCIA 2UZUE 3QFVA 3RPYA 4BDDA 4CQGA 4FNWA 2C5OA 3C4ZA 4I4EA 4NM3A 4YJUA 1SMHA 2VTQA 4MYGA 1M7QA 3H0ZA 4TRLA 3TXOA 1J7IA 3S0OA 4L3PA 4YNOA 4LRKA 2QKRA 2ZJWA 4GFOA 2XRWA 3O51A 4S32A 1U5RA 4CKJA 2Z02A 5KNJA 5A6NA 5M4FA 4B99A 2HZIA 3HNGA 2OJFE 4II5A 5AUTA 4TTHB 5EQYA 3FXXA 3CLYA 4FG9A 3C5IA 3A61A 3O17A 5C4KA 3WF5A 4BFMA 4DGMA 2BILB 4KINA 3RAWA 1IASA 4XJ0A 4RLLA 4OR5A 2EB2A 3MFUA 3ZSIA 3KMUA 4D9TA 3LQ3A 1UVRA 3SOAA 4AE6A 4JLCA 2YCQA 3W55A 3PPKA 4C4EA 1SNXA 3K5UA 3IW6A 1WVXA 3PXYA 4DEGA 4AFJA 2XMYA 5F9EA 2X9EA 2ZAZA 4QPMA 3Q04A 1OVEA 3FHIA 3DNDA 3PFQA 2WQNA 2VV9A 2RF9A 2WO6A 2GNHA 3U6IA 2IN6A 4KKHA 2BMCA 3K54A 4OBQA 3U87A 3NUXA 1NW1A 3F9NA 3UYTA 3ZUUA 2PE2A 2UV2A 3IQ7A 1XR1A 5CVFA 5A4CA 4TWNA 3M1SA 1STCE 4B8LA 2E9UA 5DR9A 5FBNC 5DR6A 4F9AA 4YU2A 3G51A 3KRRA 5HNIX 1CM8A 2RKUA 4KRCA 3PVUA 4DH8A 5DNRA 3SXFA 5IA1A 1WVYA 4HPUE 4EHEA 4QMQA 2JLDA 4BI1A 4AACA 5BVWA 3R04A 3ZSGA 4ZAUA 2VTHA 4G6OA 3P5KA 4HCTA 3KQ7A 1UNLA 4ZS0A 2Z7RA 4HCVA 4BIDA 4BZNA 2W96B 3OUKA 1RQQA 2BROA 2OIDA 4HNIA 4XYFA 2P2IA 4OT6A 4D2WA 4EBWA 4BHZA 4JBQA 4JDKA 4F6WA 4R7BA 1TQPA 5BVKA 4HYIA 4IAIA 2CN8A 4D4SA 3D5VA 2QG5A 5DYJA 1BKXA 3F61A 3IGOA 5CS6A 2JIUA 3JR1A 4UWYA 5F20A 4EYMA 4TL0A 3LFDA 4DEAA 2IVUA 3NCGA 5E7RA 3BU3A 1JKTA 4Z7GA 4QYYA 5IF1A 2OZAA 4FV9A 1O6YA 5C03A 4I94A 3GVUA 2IG7A 3R28A 4LFIA 2VTTA 4FGBA 3VW8A 4M15A 4BF2A 3R6XA 5TOZA 2XK6A 3ORLA 2X8DA 2C3JA 4F9BA 4PRJA 4YJQA 3R22A 1OIQA 4ALUA 1PF8A 3ACKA 5HHWA 5EI8A 2C5XA 5ETAA 3GP0A 4D0WA 5ACKA 3ZMMA 4QPSA 3UIBA 4L9IA 5CF4A 5J5SA 4PP9A 5J8IA 2QHMA 4ZK5A 3IW7A 3UE4A 4IWDA 3UVPA 3WZKA 1FINA 2WD1A 3LQ8A 5AR3A 5HKMA 4EK8A 1U54B 3L8PA 2ZM3A 3ZC6A 1FPUA 1Q62A 2PVMA 2XK3A 5AR5A 5F95A 4WOVA 2P2HA 1L3RE 2HW6A 2I0EA 2BAJA 2JKOA 3FMNA 5E8TA 2FSLX 4ZY6A 4CKIA 5AA9A 3E7OA 3I6WA 3WZEA 2QU6A 4KIOA 5JFWA 3IDCA 3QCSA 2QC6A 4X6QC 1VR2A 3FMHA 3GXLA 4GKHA 4AGDA 3GFWA 4BBEA 1Q99A 3RHKA 5IEYA 5A4LA 4DEBA 4DEIA 4EORA 2HELA 3MFTA 4QTCA 4Y85A 3SV0A 4BN1A 2PU8A 5J9LA 3R7GA 3HX4A 4U80A 3HV6A 1B38A 2X8EA 3ROCA 3H9RA 3RK7A 4UALA 4Q9SA 3EIDA 3VUKA 1T46A 4FSZA 4A9RA 4Y46A 4AZTA 4BDHA 3DAKA 3V6SA
chains in the Genus database with same CATH superfamily
1XH5A 4RGJA 4NM7A 4RWJA 3W10A 4R5YA 3QU0A 3ENHA 4R8QA 3WF9A 4RX8A 3ZBXA 2ITZA 4YTIA 3WILA 5AAGA 2IZTA 1GOLA 2W4KA 2YIWA 4YUQA 3F5UA 1TZDA 2ZMCA 3FPQA 3VVHA 2YITA 2XJ0A 5C4LA 3JS2A 3F2AA 1OB3A 3ORPA 1R0EA 1W2DA 3I1AA 5HO6A 2HIWA 4DEDA 3MY5A 4G16A 4EOKA 3L9PA 3NGAA 4RIXA 1R78A 3HYHA 2C5VA 4RIWB 5EI6A 4HZRA 1KE7A 5D7AA 5HESA 3A62A 4GEOA 4RIWA 4UYAA 2GS6A 2I0VA 4AG8A 1M52A 2R3RA 3ULZA 4L8MA 4C33A 3AKKA 4O7WA 3B2TA 4R7HA 4P2KA 2W9FB 4XEYA 2OJ9A 3MN3A 5DMZA 2W9ZB 2UVZA 2Y4IC 2BZJA 2VWZA 3LCSA 2QD9A 4FVQA 2O5KA 4ACMA 3BHYA 2PE0A 3AT2A 4P90A 2XANA 4QMLA 4BZDA 5EHOA 3QHWA 5D10A 3ODZX 2FSMX 4LGGA 2BDWA 5CLPA 5BVOA 4ZMFA 3L8SA 3QCQA 1ZYJA 4Y83A 1UWJA 3P5JC 4IJPA 4JI9A 4O4CA 3KVWA 5IMXA 1H1QA 3NS9A 4W4WA 4CFMA 4G3FA 2YJSA 3G9LX 4PDOA 5IA5A 4XV1A 4X2GA 2OLCA 3LFFA 2GNFA 1ZYLA 2G01A 1H08A 4R3RA 5CT0A 5A14A 5LQFA 1K3AA 5DLSA 2A4LA 3R9DA 4B7TA 4Y73A 3W0MA 4O4BB 2NP8A 4I41A 5CU6A 3EH9A 2UZWE 4E4MA 4XCUA 4F1TA 4F9CA 2WMVA 4AW1A 5IZFA 3LCDA 5M44A 4U45A 5L8KA 4CD0A 4LMUA 4BCQA 3A2CA 1H07A 4QEBA 4CMOA 1QL6A 1E9HA 1HCKA 4U3YA 5HVJA 1P5EA 4Y95A 3A60A 5IA4A 3Q4TA 5ANKA 3RI1A 4K11A 4JG7A 3BE9A 2HENA 3D5XA 3NSZA 3NUUA 3RZFA 4FIJA 3C0HA 4P4CA 4UZDA 4YJTA 3Q96A 3DXPA 3D14A 4TYIA 4EOPA 4QDEA 4YSMA 4ZJIA 4G3EA 3PIYA 3KK8A 3QKLA 5LXMA 3FMJA 4HVGA 4FSUA 1OIUA 5FXQA 5K3YA 3KRWA 5M4IA 1QPEA 1G5SA 3V5LA 3MY0A 2QI8A 3DPKA 2REIA 3COHA 3RPVA 2OZAB 3MFSA 3FI4A 3OVVA 4LRMA 4MH7A 5CSXA 3VAPA 3PG3A 1Z9XA 3I0OA 3OMVA 3OROA 4FKSA 5E92A 5DOSA 3ZFXA 4D2TA 1H1RA 5BMMA 4CV8A 4D9UA 3LFAA 4QP1A 5GIPE 4JX7A 5CSWA 2ERZE 4IH8A 2JBPA 4IADA 4E6AA 2CNUA 3TZ8A 3SX9A 2I6LA 3BYOA 5HLNA 3AD6A 4C61A 4F6UA 4OTPA 2C5YA 2P55A 4G9CA 2FUMA 4C7TA 3ID6C 3E8DA 2ITYA 4O96A 3H3CA 3CPBA 3FI3A 4FSYA 3GCUA 3NYVA 3UIUA 3VUDA 3W8LA 2JDOA 4EOOA 3T8OA 2RG6A 2JIVA 3C0GA 3O5AA 3FL4A 3L9MA 1PKGA 3JY0A 4KSPA 1R1WA 5HCYA 4GIHA 1H1SA 4EH8A 4D1XA 1WZYA 4EBVA 5K4JA 1HOWA 4WD5A 4WNPA 3VUIA 3QZGA 2P33A 2VD5A 2YAKA 3DQWA 4LV5A 3EQRA 5EYMA 4S34A 4IAZA 1SVGA 3MWUA 3NIZA 3WI6A 2XCKA 4AXCA 4ACGA 1WFCA 1GZOA 2PUUA 3NZ0A 4FV4A 5GJGA 2YA9A 4WKQA 1KOAA 3A7JA 3R02A 3THBA 5BMSA 3P08A 3PJ1A 4KUJA 3F5PA 4O84A 4B0GA 3BQRA 4XV2A 3B8RA 5BV3A 5L4QA 4AXDA 3AMBA 4L7FA 3WZDA 4L7SA 4PQNA 2VNWA 2W06A 4AU8A 2RGPA 2YJRA 3VS3A 4X21A 5C01A 4MAOA 2PUPA 1ZYSA 4OT5A 3WIKA 3FUPA 4KS8A 3ZS5A 4AN2A 3QUDA 3EN4A 4G5JA 4MBIA 4D58A 4G5PA 4GRBA 2IEWA 2V7AA 4RIXB 3ELJA 3KXZA 4E4XA 2C4GA 4FRFA 3QL8A 5ANGA 3NW6A 4JRVA 5I0BA 3P7AA 4PY1A 3D7TB 2IW6A 2VU3A 4APPA 5DEWA 2PHKA 5FDXA 3HMNA 4J52A 3A4OX 3R63A 4I21A 4RMZA 5TO8A 3WBLA 1OGYA 5TF9A 4M7IA 4QMUA 3G15A 4DG3E 4YHFA 3F3WA 3FMKA 3OEFX 1KWPA 1IEPA 4X7QA 2XF0A 1J3HA 1Y8GA 4DHZA 3QYZA 4MWHA 3KXNA 4FV5A 2BIKB 3SRVA 4GS6A 4UWCA 1FOTA 3G90X 1YWVA 4MK0A 1YI6A 4CVAA 5JZNA 4F65A 2WTVA 4IBMA 5EW9A 3UMXA 3PIZA 4FX3A 4N6YA 5DE2A 2NNWB 4RFZA 4MUQA 3V8SA 2OJIA 1UU3A 2R3FA 3O8TA 2X6EA 4FEVA 1RE8A 4Z9LA 4JOAA 5FWKK 2EXCX 4RJ6A 4BDAA 4BTJA 4W8EA 2XIXA 3MA3A 4TY1A 4A9YA 3NVMB 3DKCA 3ZH8A 2HCKA 4FT3A 4YC3A 4ZSEA 4CT1A 5AV4A 5IEXA 4IWOA 2XKDA 4FBXA 5HGIA 1WBVA 2DS1A 4CMUA 4EOQA 3KN6A 1YKRA 2ITQA 2I0YA 2UW3A 3BYMA 4LOQA 2XBAA 4QYEA 2OH4A 4P5ZA 4WIHA 5BQ0A 5CALA 3SA0A 4U5JA 3NMUF 3QTWA 3ZC5A 3C51A 2J0LA 3ET7A 4EHVA 3KGAA 4PF4A 4C58A 5HX8A 5KX8A 3A4PA 3M2WA 5ETCA 2J9MA 1Q8TA 3PXKA 2BPMA 1ZAOA 4IM3A 3W32A 5HTBA 3U9NA 4QQTA 4OTRA 3UP2A 3I60A 3VS6A 5AAEA 1Q4LA 3DTWA 3LMIA 3A7HA 3LM5A 3F3UA 3V3VA 3MPTA 4PNKA 5EQPA 2W0JA 4FSWA 3BHUA 4DGOA 3EN5A 1B6CB 2HZNA 4O27B 5CENA 5FD2A 2HXLA 5JGDA 2V22A 2X0GA 4GCJA 1VYZA 4DYMA 3KRXA 3OBGA 3UBDA 2C6KA 3VJNA 4AN3A 5FQDC 4GSBA 5E8UA 4QYGA 1M17A 3RAKA 4IMYA 4L3JA 4C34A 1F5QA 5EDRA 4U0IA 2XIRA 1PXPA 2XNBA 5B2KA 4AA5A 2GNJA 4S31A 3QHRA 3R7YA 4DITA 3QTSA 2UZVA 3S3IA 3GU5A 3LMHA 4K33A 4JAIA 5AUVA 4PPAA 2JDTA 4GFMA 4BGQA 3GOKA 3IW8A 5C8MA 4IW0A 3KN5A 2VN9A 5CQUA 2XNPA 4EUUA 4O7TA 2BRNA 4J97A 1Q3DA 2E9VA 2H8HA 5IA2A 4BCOA 4EHGA 4RIYA 1VJYA 2BR1A 3PA5A 2J0JA 4NIFA 2XUUA 2SRCA 4QMWA 2WTKC 5ANIA 1J91A 5GINE 1OZ1A 2PZYA 5JRSA 4FTCA 3SDJA 5FEDA 4X2FA 4HGTA 5C8NA 3NNUA 3LFEA 1PW2A 4J7BA 1JBPE 4YURA 5CVGA 2QONA 3HP2A 3ORIA 2BZIB 4L46A 3N51A 5HG7A 3VBQA 3LE6A 4KKGA 5HCXA 1Q8YA 4QMYA 1YWNA 2VNYA 4IB5A 3GQIA 3OT8A 5JSMA 2JFLA 3NUAA 3TDVA 4CZUA 2RFSA 4EK3A 2UW4A 5CI6A 4YO4A 2R3OA 3V6RA 3BL7A 2PYWA 4ACDA 2X4ZA 4FKOA 4WO5A 5EHYA 4U6RA 2CDZA 3FZRA 4LGHA 2X8IA 1G8KA 4KB8A 1PXOA 4ACCA 4ITIA 4EH4A 3NW7A 3GU7A 4PDYA 5CYIA 5DN3A 1O6LA 2IZRA 2PE1A 3KEXA 3QCYA 4NM0A 4P7EA 5ETFA 2O64A 1QPJA 3NNWA 3EQCA 3DJ7A 2XA4A 3COMA 1CDKA 4R77A 4OW8A 4ZTMA 2P4IA 2G9XA 4FKLA 4ZOGA 2WZJA 3ORMA 2YIRA 3OD6X 1A06A 4XG7A 5HG8A 4F08A 3VNTA 3WYYA 4RZWA 3MA6A 3QTRA 1H8FA 4MX9A 5KE0A 1OL1A 3HAVA 5AR2A 3ZZEA 3ZLSA 2WPAA 3ANQA 1JNKA 2OIBA 2ZMDA 2QR8A 2VWBA 3F3VA 3FBVA 4G34A 3UJGA 4CTBA 3ENMA 5KMIA 3LIJA 4ZY5A 4O6EA 2CKOA 5H3QA 4FV6A 3D15A 1Q8WA 3COKA 4FKQA 3MTLA 4X3FA 5EW3A 2HWPA 4D1ZA 5A54A 4ORKA 1YWRA 1BMKA 4FZFB 2XJ2A 4YNEA 2BZHB 3OWPA 2UW7A 5C27A 3ZLWA 1Y8YA 3R7EA 3S4QA 3QRIA 4BDBA 4RT7A 5HX6A 4TYGA 4EOJA 5J9ZA 3SVVA 2CHLA 5DPVA 3QC4A 3EQGA 4PTEA 3EL8A 4WSYA 4CEGA 3FSKA 3S1HA 3BYUA 2XEZA 2C1BA 4G9RA 1GIIA 1H01A 3GUBA 3PVBA 3IK3A 4BICA 1BLXA 4G6LA 4RJ8A 1PRYA 5KMKA 4IJ9A 5I9WA 2YCRA 3PXRA 3OY1A 4JJRA 4RX9A 5CNNA 4IE9A 1R3CA 3TL8A 4GVJA 4H3QA 4NEUA 3R9NA 4BCGA 4L52A 4FTJA 3DK7A 3RNIA 2J51A 3LFQA 4FTRA 4RFYA 4C2VA 3AXWA 3QWJA 4BCPA 2PMIA 2UZDA 5K9IA 4C38A 2YACA 2WQMA 4EZ7A 4AOTA 1U4DA 4XP2A 5I3RA 4LM5A 5EDQA 3V04A 3SXRA 3JVRA 4CFVA 3O7LB 3RAIA 3DT1A 3OHTA 3TG1A 5E8YA 1AD5A 2YDIA 4GYIA 5D41A 4ZJJA 5TT7A 4EH2A 2V5QA 3BWJA 3QRUA 1ZMVA 4TT7A 5BYLA 4YR8A 3V5TA 3DA6A 3BGZA 5E90A 3UZTA 3MESA 1F3MC 3HV3A 3R83A 5JGBA 5BUEA 2YM6A 1DM2A 4RIYB 5ITAA 3GNIB 1XMLA 2C0IA 2B4SB 4FV1A 4X2NA 5C9CA 5I9ZA 2IVTA 2IO6A 2WIHA 4JAJA 2ITPA 3EJ1A 4GG7A 4LYNA 4XLIA 1OL7A 3MYGA 4QP7A 2BTSA 4EH3A 4OTIA 3SG8A 4YTHA 4XP3A 3RWPA 3H10A 4DFXE 3HVCA 2Z7SA 4QDVA 2BALA 3DBDA 1YVJA 4YGAA 4RC3A 4MXAA 2XK7A 3HV5A 2BTRA 3DTCA 4EONA 3EN7A 3NAXA 2I1MA 4XP0A 3W0QA 2JFMA 4DHJA 3D7TA 1YDRE 3E62A 4FIEA 2C6DA 2B9HA 2XIZA 4WSQA 5AUXA 2GS2A 4EQMA 4RQVA 4EKLA 2C1AA 5IEVA 4EOMA 2HZ4A 3ZHPC 3GBZA 2O2UA 4AAYA 3DK6A 1JWHA 3R9RA 3MVHA 4GK4A 4MXOA 3LW0A 5HG9A 2F7XE 3VBXA 4PTGA 5GZ9A 4GYGA 2PVNA 2OZOA 1UU7A 2YM4A 3VF8A 2VWVA 3KKVA 2CLXA 2ZV2A 4QMNA 4GK2A 4ZP5A 4HVIA 3Q9YA 4AT5A 3RBWA 4BCIA 4BR3A 2XYUA 3AMYA 4EL9A 1H00A 4JQEA 4DDIA 4XUFA 4BCNA 4QMPA 3RINA 4EHZA 4EC8A 3R30A 4TKSA 3RALA 4B4LA 3FI8A 1V0BA 3QC9A 4AFEA 3KREA 2OU7A 1SYKA 4DBNA 4F99A 3BBWA 3KU2A 1GAGA 3CSVA 3UOLA 4EH5A 1OL2A 4NW6A 5GNKA 1OUKA 3VHEA 3VS4A 2YZLA 5L2SA 2XKEA 3HV4A 2BRBA 5HTCA 3NNXA 3OTVA 5HNBA 1B39A 3I7CA 2IWIA 3SRVB 2XNGA 1KE6A 3DB8A 5CT7A 1ZWSA 2BDFA 1TFFA 2J50A 1X8BA 4JRNA 3TZ9A 4ANLA 3UYSA 1BI8A 4JIKA 4IEBA 4BKJA 3BI6A 2P0CA 3LOKA 2WMAA 5A6OA 4JMQA 2PZPA 1M2RA 3U6HA 2WFYA 5CXHA 3FZSA 3RTPA 3NR9A 2VTMA 4OGRA 5FTOA 2VZ6A 3HRBA 4FSMA 4DFUA 5BVFA 3UDSA 2A98A 4IB3A 2XNMA 1M2PA 2C3LA 4PMMA 4QP2A 5IDNA 5L2WA 4W8DA 3C4XA 5L8JA 5CQWA 4YLJA 4K1BA 4AN9A 4UMRA 4YC8A 5LMAA 3EQPA 2NO3A 4NUSA 3E5AA 3DZOA 2C3KA 3G2FA 3FQEA 4UXQA 3W18A 2PMLX 5K0XA 3OW3A 3IW4A 4IX3A 4QP4A 4YLLA 1S9IA 2EU9A 4JX3A 4B6LA 2QG7A 2ITXA 4UWBA 4QMMA 2X2LA 5BVEA 2JD5A 4AT4A 5ANJA 5DFPA 3GI3A 4PUZA 4D28A 5HBJA 4O21A 2YHVA 3G6HA 5I9YA 2OWBA 5EDPA 2WTKB 3FLZA 4YZ9A 5GJFA 3UPZA 4O4EA 1CKPA 4DCEA 3QTZA 5HE2A 4TNBA 3C4EA 3VF9A 4ZTRA 2QO2A 5BYYA 5I9XA 4PTCA 3QZHA 1OM1A 2HYYA 3HDNA 3L9LA 4X0MA 3DNEA 2ERKA 3I5NA 5CVHA 4LGDA 1SVHA 5T6KA 1T45A 2PULA 4I6BA 1WMKA 3VIDA 2YIQA 3IDBA 2F9GA 2XM9A 2J0IA 5DR2A 4V0GA 3PVWA 4O4FA 4O0VA 5JQ5A 2VO6A 3WYXA 2XM8A 5DT0A 2ZOQA 3MIYA 4D2RA 5CXZA 1YOMA 3T3UA 3ZRMA 4U79A 1TQIA 2QOFA 4NCTA 1ND4A 3QTQA 4IB1A 4C4JA 4DGGA 4J1RA 2GFCA 3ZRKA 4AW0A 5DHJA 3F2NA 4MF0A 3VC4A 1WBNA 3CD3A 3FLQA 4J98A 4KAOA 2BKKA 4MWIA 3FV8A 4NT4A 2W1EA 3QQKA 4WT6A 2Y4PA 4U3ZA 4U43A 1CKIA 4ZZMA 3TV4A 5G1XA 5F1ZA 3R1NA 2JKKA 2F7ZE 3V5WA 3QZFA 5L6PA 2PK9A 2RG5A 2XAOA 3BLRA 2OW3A 3E8EA 3WE4A 3TUDA 4XX9A 5EM7A 4NW5A 5M09A 2CKQA 2R3KA 4MTAA 4ZSLA 3D83A 5CEMA 3ORTA 3QGYA 3B2WA 4FT9A 5E9EA 4EQUA 3DDQA 1HCLA 3LQ5A 4Y5HA 3ZFMA 1ZY4A 2RIOA 3HEGA 2XARA 3EN9A 4L3LA 4O7VA 4BTMA 4DEHA 3PSBA 4YZCA 1ZY5A 2X7FA 4RIOA 4FG7A 4F09A 3Q2JA 3H9OA 2C68A 1ZZLA 2WTWA 4Q9ZA 5M06A 5GZ8A 2JGZA 5CAUA 5E8WA 3R8PA 5HBEA 1F0QA 4LMNA 3HV7A 3BLAA 5J1VA 3FLNC 4KWPA 3HMIA 1UWHA 4BJJB 3EL7A 4U42A 2QQ7A 3UO6A 2F2CB 4IAAA 4AXFA 3BX5A 4RVKA 4BDKA 3E88A 2WOUA 3KULA 1MRVA 3AC1A 4D55A 5AP1A 4FKWA 3UDZA 3UNKA 3PZHA 3T9TA 2J5EA 5AWMA 3LLAA 3FY0A 3UQGA 4XG2A 4U8ZA 4YZNA 1YXXA 5AUZA 3O7LD 4ACHA 5K4IA 3TWJA 3WZJA 3PJCA 4BDGA 3KCFA 4FGRA 3VONA 2A2AA 3PP1A 4CQEA 4YHTA 1KE8A 1YOLA 2VX3A 3VO3A 4EJ7A 2XRUA 3BPRA 4YMJA 3IOPA 4GK3A 4KD1A 4RG0A 5CU0A 5LMKA 4YTFA 3DKGA 5D9HA 4DLJA 4PDPA 3G0EA 3PJ8A 3R1SA 2WTJA 4PV0A 3CIKA 3KA0A 1QPCA 4XS2A 4QO9A 4BGGA 4TYHB 5AP5A 3P79A 4IVDA 3CQWA 4CRLA 3AT3A 1VLRA 4PPCA 3K3JA 2PY3A 3FAAA 5HLWA 4FSQA 3BGQA 4TNDA 4QTDA 3GU8A 3HA8A 3MV5A 4YJVA 2RFDA 4QTAA 4ID7A 3WE8A 4DHIB 4C36A 5EKOA 2V55A 3F7WA 3FMDA 3DQXA 4FKRA 4V05A 3GC9A 2BIYA 3ORXA 3UQCA 3POOA 2V7OA 4JDHA 4QT1A 4QP3A 2JDVA 4A7CA 4BB4A 2ZDUA 2C5NA 4PWNA 3RCDA 3K3IA 2Q83A 4TWPA 2PPQA 3FC2A 4MXZA 4OTFA 2ZM4A 5KMLA 2W99B 4FV2A 3GQLA 1E1XA 3UOHA 5KKRC 5HQ0A 3DBQA 4RA4A 4NZWB 2GHLA 4I5MA 2ZVAA 4MQ1A 4AAAA 5CASA 3HAMA 1W83A 4C35A 5CSPA 3CKXA 2UW6A 3JYAA 3ZFYA 3LMGA 4BZOA 1YOJA 4C3FA 3Q32A 3OCSA 2UZNA 3ZO4A 1YXTA 1ZOHA 5GIOE 3GFEA 3QLGA 5LWNA 5FRIA 3PWDA 2CNQA 5ANOA 1ZZ2A 3AKLA 5CF5A 3CCNA 3UP7A 4FT0A 4DA5A 4YZDA 3U54A 4F64A 4F7LA 3TKUA 3FWQA 4DH3A 3DZQA 3VUMA 4OBPA 3Q9WA 2FYSA 4A4LA 4WBBB 5HE0A 3D2KA 4IAFA 4O7SA 2PVJA 4BDEA 3BYSA 3PRIA 3C5UA 5DEYA 3ZONA 1NVRA 3EZRA 3QA8A 1JKLA 1YHWA 2X2KA 4I23A 3WF7A 5HI2A 1NVQA 1M7NA 5HIDA 4JBOA 2VGOA 3M11A 3QX2A 3IONA 3LM0A 4FTNA 4J71A 5EYKA 4B9DA 3TIZA 5B2MA 4FR4A 5KZIA 4MCVA 1OKWA 1AQ1A 4B8MA 5HG5A 3MFRA 2W7XA 4V0GB 4QPAA 3UO5A 4FNXA 1R0PA 3W0PA 4BY9E 1W8CA 4FV3A 5G6VA 2GS7A 1ZYDA 3HP5A 3QX4A 4ZLZA 4RJ4A 2F4JA 5IISA 1I09A 3PRFA 5M4UA 2FGIA 4MBLA 2X2MA 4J8NA 4BDJA 2W1CA 2XYNA 3IG7A 2WKMA 3Q6WA 4IM0A 4HOKA 4LV7A 3R7OA 4ZTQA 4AUAA 4CMTA 5LMKC 3KXHA 4UX9A 5IUIA 4RWKA 4Y72A 2CJMA 3SQQA 3O8UA 2GTNA 4IZ5A 4S30A 2PVLA 4NU1A 3S2PA 2QOHA 3FZPA 5DRBA 1URCA 4C8BA 5HZNA 2YISA 3GOPA 2YCFA 3HUCA 4AP7A 5BUJA 4GU9A 1YW2A 4I0TA 4O7LA 2X1NA 5EM8A 1PMNA 1MQBA 1BYGA 2ZB0A 4IB0A 4W4YA 4IX6A 2B7AA 4DFYA 3AQVA 5HD4A 4OTGA 4E5BA 3P7CA 4GT3A 3FKLA 4FZAB 4CCUA 4UXLA 1JSUA 3LPBA 2UZLA 3DAJA 5CU2A 4ZXTA 4QMZA 5M56A 3A99A 3W2RA 3ROYA 2HAKA 2AEGA 2BKZA 3LJ2A 4FSTA 3ATSA 2WMRA 4RFMA 4A07A 4K9YA 4C4IA 5JT2A 3OW4A 4ANBA 5ETIA 3DV3A 2YFXA 4XG4A 5E91A 4EQCA 5J79A 3F82A 1SVEA 1L8TA 3AT4A 2WMTA 3FDNA 2XEYA 4DAWA 2VAGA 1OPLA 3UNJA 3W0OA 2E9PA 2ZB1A 3MH3A 3HL7A 5LVOA 1LEWA 2G2HA 4ENXA 5M55A 2CMWA 5H2UA 3QRTA 2GQRA 4PL3A 4NKSA 4QTEA 1VYWA 2EXEA 4YZMA 4BCFA 3W2SA 5LVNA 2F57A 4KBAA 3I5ZA 4WNOA 1H24A 5M53A 3FLYA 3BU5A 3GC7A 3TJCA 4ANSA 4K18A 4FL1A 2CN5A 3UIXA 5L8LA 1UA2A 4X2JA 3F5XA 1QPDA 4QRCA 2LAVA 4NYEA 4HVHA 3E3BX 2HZ0A 4FKTA 1H1WA 4F7SA 3TM0A 2Y8OA 2XK8A 3QD0A 4QMXA 5I3OA 1GY3A 3FHRA 4USFA 3POZA 5JN2A 4K6ZA 4E6CA 4XRJA 4Z16A 4ASZA 1PJKA 3ODYX 4E7WA 4LRJA 2JEDA 2PSQA 1XH4A 4YJOA 2VTJA 1JLUE 3CGOA 4CSVA 3UZPA 1VZOA 1S9JA 3E63A 2QODA 3ZM4A 4KBKA 1IAJA 2C0OA 4UN0C 2R3NA 5E8XA 3SAYA 5JEBA 5LVPA 4X3JA 1LP4A 2R0UA 3C4FA 1OIRA 3MW1A 4LUDA 5GJDA 2PTKA 4FL2A 4MBJA 3R8LA 4G3CA 2FSTX 2VWUA 3QGWA 4TYEA 5AEPA 3HMOA 2WMQA 4G31A 5KMNA 4RSSA 1CKJA 4AZFA 3CXWA 5CAVA 5HU3A 5EQEA 3BHTA 4FK6A 3NLBA 3Q4ZA 4RVTA 4D4YA 4XNEA 4ASDA 4O7YA 4AA4A 1CSNA 3BV3A 3SW7A 4DF3A 2W5BA 4QMTA 3PUFC 4A4OA 3DBFA 4UB7A 3NDMA 4FKUA 3FEGA 2WEVA 3CJFA 5KMJA 3W0SA 4FV0A 3AC3A 2PZ5A 4I5CA 4J53A 4FUXA 3UVQA 4GFGA 2XZSA 5I9VA 4ITJA 4HYUA 4FEXA 3U55A 5CZIA 2VTLA 4Q2AA 5L2TA 1IA9A 4HGEA 3F3ZA 5FM3A 2BCJA 5FBOA 4U9AA 3VS7A 2WMXA 3HLLA 3NNVA 2B55A 4GU6A 2J5FA 4GMYA 3TTIA 4C0TA 2G15A 3TCPA 4IAKA 1REJA 3CP9A 4N57A 4A9UA 3TNHA 3KRJA 3LAUA 4RWIA 3M42A 4FZDB 2QOIA 3NIEA 1OUYA 4RLKA 4F0IA 4ANMA 4LG4A 3FMEA 3WOWA 2XP2A 2UZOA 3KK9A 2KULA 3QQLA 5KCVA 1OPJA 2YLEA 1UKHA 4KBCA 3TDWA 3HGKA 4JS8A 2ETMA 2HWOA 4EZ3A 5JFXA 4M0ZA 3Q4CA 2YDKA 3P9JA 3BHVA 4O7RA 2B53A 1PKDA 4G2FA 4U41A 5HVKA 5FEEA 4GJ3A 4YBJA 3U4WA 3LCOA 4EOSA 5LMBA 3ORNA 2A1AB 3R0TA 3G33A 3DB6A 3TZ7A 5LJJA 1Y91A 4ENYA 1P4FA 4RC2A 2R3PA 3AMAA 2C6IA 4FTUA 4FKVA 4PMPA 3W1FA 3O23A 3BV2A 4X6RA 5DIAA 4FKPA 3HMMA 3Q5IA 1U59A 3Q6UA 4FVPA 4NKAA 3W2CA 4AWIA 1E1VA 1LPUA 4M69A 4CNHA 3U6JA 2ZYBA 3KF4A 3QQJA 4MD9E 4C37A 5JRQA 2B52A 2EUFB 2IW8A 4YTCA 1WAKA 2R3LA 2YM3A 3R7VA 3G5DA 5DVRA 2PMNX 5ICPA 3C7QA 5IG1A 3QTUA 3ML1A 3EFKA 3C4CA 1Z57A 4YPDA 4WNMA 2OIQA 5A4EA 3VULA 2E9OA 4J8MA 5H8EA 1ERKA 3UC4A 1G8SA 2ITUA 4QMSA 2VUWA 3NUSA 1MP8A 5I9UA 1V0PA 4J99A 4CLJA 1JSVA 4M97A 4WA9A 2PVYA 2OXYA 4BI0A 4FIGA 4QMOA 4ZLOA 5D1JA 3FSFA 3MBLA 5HCZA 4E4NA 1PXMA 3W8QA 3QAME 5AP4A 3MIAA 3I79A 4ZEGA 2JC6A 5M07A 2OFVA 3EQIA 3JXWA 4BCKA 5FG8A 2J90A 3MI9A 4JDJA 1DI9A 3GB2A 3CTJA 3PVGA 3HECA 5AAFA 2BFYA 3ZLYA 3MH1A 4E4LA 4AA0A 4HYHA 4I6HA 1KOBA 5CSHA 3DDPA 2O3PA 3GCPA 4LOPA 2OXXA 3MS9A 4IX5A 4K0YA 3R2YA 1J7UA 4FOCA 4XH6A 4CFNA 4DG2E 3ZRLA 2WTCA 3DLSA 3JPVA 2QO9A 2GNGA 3NPCA 3NYOA 4AXAA 4IM2A 2CCHA 4TZRA 4F7NA 1ZOEA 5TR6A 3OP5A 4FTTA 4YJSA 4U81A 1YI3A 3R8UA 4FIIA 3FMLA 4H58A 4G6NA 5DA3A 4UYNA 2KTYA 4MQ2A 3QQFA 1P2AA 4GUEA 1WCCA 4I5PA 2WTDA 3FI2A 4LL5A 4NTSA 5FEQA 4E1ZA 5BPYA 2QU5A 2Y0AA 3TMOA 3SOCA 4FIFA 1ATPE 1J7LA 3ALNA 5LARA 4CG8A 4I0RA 4NL0A 4ZSGA 3Q53A 3V5QA 4BWPA 3ZEWA 4UMQA 4FSRA 3QCXA 2JBOA 3EB0A 3Q9ZA 1UKIA 2GNIA 4TWCA 1FVTA 3F3TA 3MH2A 3Q2MA 4GG5A 4I20A 3W0NA 4XV9A 3KXMA 2RL5A 2C6LA 4K2RA