3CKXA

Crystal structure of sterile 20-like kinase 3 (mst3, stk24) in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
279
structure length
276
Chain Sequence
PEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase 24
publication title Crystal structure of sterile 20-like kinase 3 (MST3, STK24) in complex with staurosporine.
rcsb
source organism Homo sapiens
total genus 84
structure length 276
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ckxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ckxA01
3KVWA 3G6HA 1ZY5A 2HW6A 1WAKA 2G2HA 4C4GA 4NKAA 3W2PA 3SRVA 4D9UA 5JRQA 4XHKB 2IZUA 5EDQA 2V5QA 4E6AA 3PIXA 4QTBA 3F9NA 4EWQA 4BWKA 4ZJIA 3F7WA 4WIHA 3RI1A 4H3BA 5M57A 4CRLA 3KF4A 4OAVB 3MH3A 3NR9A 2R0UA 3DDQA 3A60A 4UYNA 5D7VA 2P3GX 4ZSJA 4I22A 4H36A 1YDSE 2PL0A 1H8FA 3E3PA 1O6KA 3GQIA 3ZRLA 3AXWA 2UVXA 5EW9A 5EM6A 2WQOA 3V04A 4S31A 1PW2A 1WCCA 2GNJA 5EKNA 5IPJA 5B2KA 4FTNA 1YXXA 2XIYA 2W5BA 4MTAA 4HVGA 3BYSA 4EK8A 3I0QA 5AUUA 5L2WA 2XNMA 3EQCA 3Q2MA 3L8VA 3BELA 3OW4A 3R00A 1KOBA 4NM7A 3TIZA 5E8WA 2DUVA 1A06A 4G6OA 4F9WA 4KKEA 4RX9A 3ORZA 5L6PA 4HZRA 4QTEA 4A9RA 4OT5A 1H08A 3F2NA 3F3WA 2W1EA 2BFXA 4PTCA 4A06A 4O6LA 4TZRA 1DS5A 1UU3A 3COHA 2ACXA 1KV1A 5A4TA 5FLFA 4FSQA 4WHZA 3QQHA 3I60A 4DTBA 2CDZA 3T9IA 4NCTC 2QU5A 4BY9E 4GKIA 4A4OA 3QBNA 3UOLA 4O7RA 4CYIA 2OI4X 3QZHA 5DIAA 4HVDA 2YWVA 3DNDA 5IKWA 4JR7A 4LFIA 5M53A 2BRBA 1Q8ZA 3DK6A 3M42A 5EQYA 3BI6A 3BCEA 3QWKA 5AADA 3FBVA 4IJPA 1W98A 5EQPA 5DFPA 3Q4TA 4TYHB 3PVBA 2I7QA 4QT1A 2YISA 1GZOA 2C30A 5AR2A 1GNGA 4ASDA 4HCVA 3RBWA 4ASXA 3OXIA 3P79A 4RC2A 5CWZA 5AUXA 1OI9A 4FG9A 2ITXA 2YABA 1XQZA 3DFCB 3GQLA 5EHOA 2VAGA 3H9RA 4LGGA 4PDPA 2Y6OA 5AP3A 3JYAA 3RKBA 3DQXA 2HXLA 3HAVA 4M69A 5CU3A 2R0IA 2ZJWA 3KMWA 4FVQA 2XIZA 3IK3A 5HI2A 1QPCA 1Q3WA 1Q8UA 3O0GA 4MBIA 5IEXA 3KRXA 5EW8A 2WTKB 2FB8A 3NSZA 4QOXA 4YZ9A 4LL0A 4MVFA 4EK5A 3ORMA 3SXRA 4FKWA 4GYGA 4IAZA 3CQWA 5CSPA 4MEDA 3KULB 3ZO4A 4EK3A 1R3CA 4M84A 1KE5A 1M7NA 4QQ5A 5HLWA 1H1RA 3WF8A 4G3GA 2XRUA 2YCQA 2DS1A 4TYGA 2R2PA 1H07A 3ULZA 2CGVA 4FUYA 4FEVA 3FY2A 5JN2A 5CQUA 5IQAA 3QTXA 4BCFA 4DEHA 3RAHA 4ERWA 2CNUA 4EOIA 2PVJA 3R63A 4CRSA 4BCOA 3LXKA 4M8TA 3R9OA 2BILB 5DPVA 1NW1A 2VWBA 4F9CA 1UU7A 3GU8A 3NW6A 3NUYA 3MH2A 4XOYA 2X1NA 5HD7A 4O7YA 5HLPA 4G5JA 3KN5A 2WOTA 4S2ZA 3LW0A 4BTKA 3NVMB 4FTOA 1IG1A 4KS8A 3BWFA 3PWYA 5BVNA 1AQ1A 3SXFA 3PLAE 1WBSA 2ZMDA 1AGWA 3BYUA 3R28A 4DG0E 3WI6A 5EDPA 3HUCA 3POZA 4YHFA 4BCQA 2YM6A 4H1JA 3HA8A 3PDTA 3EN6A 5IQHA 3RPRA 5HG8A 5LVOA 1J7LA 4BWPA 3IW7A 1H24A 2PU8A 2J0IA 5D41A 3R8PA 4RWIA 1PXOA 2QD9A 4JIAA 4F99A 3UNKA 4DTAA 3ROYA 3WZEA 4O2PA 2QO9A 2VWUA 4FSWA 3EQRA 3Q4ZA 3R71A 2CHLA 3ATTA 4MX9A 3S95A 2F4JA 3KKVA 1GIHA 5DOSA 3AD4A 3FMDA 5FEDA 2CKPA 2PVRA 4GK2A 3MA3A 4ZTQA 1AD5A 3NCGA 4I0TA 4FG7A 1FGKA 3QD0A 1IR3A 4RJ5A 5F4NA 5C1QB 3ELJA 4D55A 5CSWA 2OFVA 3MI9A 3OW3A 4XX9A 5TOZA 3ORTA 4L67A 2O0UA 3BWJA 2VTMA 2W4JA 3R7GA 4O84A 1IA9A 2NPQA 3A7HA 1MQ4A 3PA3A 2XM8A 4AQCA 3Q4CA 3O23A 3V5QA 2R7IA 3ZHPC 4DGGA 3CS9A 3FMJA 3F5GA 5IMEA 1Q5KA 4UMQA 2C6TA 4FKIA 4OAUC 5IG1A 3LXLA 3OY3A 5G1XA 3OBJA 4UMPA 5TT7A 4RGJA 4E1ZA 2PK9A 4FEXA 4QPSA 5JGAA 3WILA 3AC4A 5D12A 2W5HA 3C13A 5DG5A 5CAOA 5CEPA 3FZRA 3IDBA 5LARA 4DEDA 2OG8A 4YBJA 4FT9A 4I5MA 4X7QA 2I0HA 4XLIA 5A14A 3D0EA 1P5EA 4FTUA 4C4EA 4LYNA 3BU5A 5FDPA 2EXMA 3B2WA 5CXHA 2YIQA 3NMUF 1OPJA 5EM5A 3BE9A 5CAPA 1VYZA 5EOBA 3TTIA 2B9JA 5CSXA 2IO6A 1GOLA 2ETRA 3HNGA 4JBVA 3LOKA 5IA0A 3W2CA 2UZDA 3DAEA 3FMMA 2O64A 5M06A 4XG3A 4IM3A 4U45A 4PQNA 5D10A 3PXZA 2R3JA 2J0MB 4BDKA 4JOAA 3TT0A 2DWBA 3RWQA 2XRWA 2R3IA 4G1WA 5BUIA 2BIYA 2W1GA 3I6UA 1P14A 4OBOA 2PVMA 4GYIA 1PMUA 3LM5A 3CE3A 1Z5MA 4AX8A 3EFJA 4OTIA 3VF9A 4EZ3A 4QMLA 5GJDA 4N4SA 4GEOA 3SDJA 3FWQA 2VUWA 5HORA 3UQFA 3I0OA 3U6HA 4F6UA 5EI8A 4XUFA 5BVOA 2WMBA 4K0YA 4C8BA 3UOKA 5HTIA 2HXQA 3DAKA 5AMNA 2G2IA 2ITUA 3R1QA 4FIEA 4ITIA 2OJFE 3WYXA 4CFXA 2JIIA 1ATPE 2IZSA 1Q3DA 2Q0NA 1UNGA 5EI2A 4ZEGA 2QU6A 3PIYA 3SAYA 5ANGA 4ANLA 5ICPA 2VTIA 4EOPA 2UZUE 4GG7A 5H3QA 3E5AA 2IVUA 3GC0A 5EYMA 5IMXA 3PXYA 4PY1A 3TZMA 1OKYA 2XKDA 1H25A 3GU7A 2R3PA 5E1SA 5BVEA 4C3PA 3FMKA 1OECA 1U4DA 3TG1A 5L4QA 2EUFB 3WE4A 3GEQA 1Z57A 4IX3A 4BCNA 4O27B 3UNZA 4CSVA 3LJ0A 1YDTE 2G15A 3KCFA 2OXYA 2YAKA 4QMOA 5CLPA 3MGYA 5CT0A 1STCE 4YBKA 4MXYA 2PMIA 3FJQE 2XNNA 3VS3A 2FVDA 2P4IA 4YTCA 3O2MA 4FGBA 4BYIA 1BUHA 4CGAA 4YZMA 1NXKA 1IAHA 1ZYJA 4FT7A 1UNLA 4GH2A 3G9LX 1VZOA 2Z8CA 5HVKA 4NWMA 4TPTA 4I0SA 1MUOA 1ZXEA 2VO3A 3AGLA 5JZJA 2UZWE 4QMYA 5DHJA 3TUDA 4MF1A 4ZSEA 3OWPA 5M56A 3VBXA 5KNJA 4F65A 3HGKA 3MJ2A 5D7AA 2BZIB 1H28A 3GCQA 4DFYA 3LLAA 4N57A 4PMSA 3EKKA 4XMOA 3NVKI 3LM0A 2JDVA 4QMPA 5EKOA 4ZTSA 4GRBA 2ZM1A 3EWHA 4DTKA 5M08A 3H9OA 4L44A 3TXOA 4E26A 3TV6A 4EK6A 4XYFA 4ZSAA 3CQEA 5IH6A 2WMAA 3MTLA 1ERKA 2HWPA 4J71A 3DBEA 5L8JA 2LAVA 4C36A 4CCBA 5KMJA 4NFMA 3QCXA 4JS8A 2OJGA 3LFFA 4IDVA 4PL5A 4ITJA 4PF4A 4F7LA 2R3RA 5KMKA 3EKNA 2JBPA 4P5ZA 3BGQA 2H9VA 4HYSA 4OTDA 4PUZA 2P33A 3TZ7A 3AT3A 3IQ7A 2R64A 4OTWA 1Q8WA 4IANA 3MV5A 1H4LA 2F49A 3EH9A 4FG8A 1YOLA 3FMHA 4H1MA 4RJ3A 1ND4A 5F95A 3ZBFA 4L8MA 5AAFA 4R7BA 4IFGA 4L7FA 3WZKA 4L68A 2WB8A 5L6OA 3TZ9A 3K5UA 1FVRA 4RSSA 2C5XA 3FI4A 3TJCA 4JDIA 2QOOA 4QP1A 3FLWA 1U59A 5HO8A 3PE2A 2JC6A 1NVSA 3PJ3A 1H26A 4GL9A 4GW8A 4R3RA 5D1JA 5DA3A 3OHTA 3EQFA 3NYOA 3VS7A 4B0GA 2R5TA 1CSNA 4P7EA 4S33A 4Q9ZA 3Q32A 3UZTA 2BAQA 3HKOA 3REPA 4BN1A 4EKKA 4CXAA 3QRTA 3NPCA 2OIDA 1WVWA 4H3PA 5TR6A 3V8TA 4DG3E 2R7BA 3CCNA 3PG3A 4IAFA 5AR8A 3PSCA 1RE8A 5CVHA 2H6DA 4O2ZA 3SX9A 5KO1A 2B4SB 1PXMA 2WIPA 3KU2A 1UWHA 4KWPA 2B7AA 4MBJA 4MXOA 4M12A 4C4FA 3HV7A 3EN7A 4ANSA 2PHKA 3WZDA 3AG9A 4XBRA 2Y8OA 5LCKA 4EQUA 5KCVA 4DEGA 3RJCA 4TWNA 4HVSA 4RIYB 3UOJA 5IA5A 4MKCA 4AA0A 2X8DA 3NYVA 4KIPA 4YSMA 4D4VA 5CU2A 3F7ZA 3UYSA 3BU3A 5J9ZA 3BHHA 5M09A 5ANDA 2YHVA 2YEXA 2JKQA 4BDGA 3FZTA 4QRCA 5BPYA 5KMNA 3DBFA 3HAMA 3UC3A 2XK6A 5I0BA 1Y57A 4DFZE 5JMSA 3CD3A 4YPDA 3Q5ZA 4WNMA 3NYNA 3I7CA 2V22A 4JX3A 3UYTA 2E2BA 4DEBA 4R7HA 3DPKA 4QPAA 1YW2A 5C03A 3UNJA 3UPXA 5CU6A 4MXZA 4FV1A 4IZ7A 3CTJA 3D15A 3HV4A 2NRUA 3VBWA 5LJJA 3ET7A 1YOJA 4RIXB 3QFVA 2VV9A 4LI5A 3QWJA 3VBQA 4K8AA 3E92A 2WXVA 4D5HA 4ACHA 4CMOA 3RCDA 3NW5A 2V62A 4BC6A 2VGPA 3D94A 3F66A 3KK8A 4BKYA 3SLSA 2YFXA 4A9UA 3GCUA 4WOVA 4HGTA 2OSCA 4C0TA 5ETFA 4I93A 2YJRA 3JR1A 2FA2A 4WNOA 5E8UA 3QTZA 4EOJA 2ZMCA 5JFSA 3QUDA 2YLFA 3TEIA 1Y8YA 5M4UA 2OIBA 3VC4A 2VTAA 2WU6A 4AE9A 4BDHA 4Z3VA 1J3HA 5M4CA 2A2AA 3GGFA 3ZUVA 2O8YA 5GZ9A 1SVEA 4Q2AA 2FSOX 4KRCA 5B2MA 2CN5A 3NNUA 4C3RA 3SW4A 2IWIA 5JFVA 4F0FA 2BAKA 2ETKA 3H4JA 3I81A 4D1XA 2OXDA 4C61A 3QTSA 3DKOA 5EYDA 4AG8A 4BDJA 4GS6A 5H8EA 4Z55A 4C3FA 1O6LA 4IWOA 1HOWA 3MS9A 3E8DA 3I6WA 4ZZMA 3FPQA 2ZV8A 3U9CA 4BCGA 4YP8A 5HX6A 3PLSA 3U51A 3IECA 4MBLA 4MYGA 3VHEA 3WF5A 3QCYA 4NH1A 3A62A 1J1CA 2ESMA 3JVRA 2KULA 3PXRA 3PP0A 4FKTA 3TKHA 3JVSA 3KCKA 3PP1A 4I5HA 4LV8A 4FV9A 1EH4A 4J99A 5F20A 2WU7A 4AN9A 3D7ZA 2Y4PA 4X21A 5HG7A 4UMUA 1FQ1B 2PVHA 5M44A 3QQJA 4IC8A 3ZXTA 2RGPA 3R30A 4PDSA 2VO6A 1ZYDA 2XJ1A 3DTCA 4M67A 3E7OA 2R3NA 4QQCA 4CMTA 5HTBA 2C0IA 5IQIA 3P0MA 3OUNB 3OS3A 4OTRA 4KIKA 5E8ZA 3NEWA 4FTMA 3I4BA 1A48A 4DH1A 4UMRA 4LGHA 4FEWA 1W0XC 4WUNA 3EJ1A 4ARKA 3CJGA 2Y9QA 4X2JA 1DM2A 2GS7A 1WBNA 3NUXA 3ZLYA 4D28A 2HOGA 4II5A 3PJ1A 4EOKA 2YIRA 3DZQA 4M97A 1Q97A 3HVCA 3MH0A 3SXSA 5F1ZA 2VX0A 4AGWA 4DFXE 3L8XA 5ANIA 4FSNA 1RDQE 4YHTA 2Q0BA 4O7NA 3HV5A 5FWKK 3F5PA 3UIMA 1PMNA 3BBTB 4CFUA 3LE6A 4DFLA 4J98A 4QMSA 3ULIA 3PA4A 2QONA 3BV3A 2G2FA 3E63A 3CQUA 3O8UA 4IBMA 4PNIA 1MQBA 4LRJA 4X3FB 5HBEA 5JZNA 1PY5A 3E64A 3BLRA 3QYZA 3PJ8A 1ZYSA 1UVRA 4RJ6A 3PXKA 5HIBA 3W55A 3MTFA 3OCGA 4BF2A 1OL5A 3P7BA 4RIXA 4IX5A 3VS6A 5K5XA 3AC3A 4QMVA 2JAMA 5LCJA 1WZYA 4AT3A 3QALE 1FINA 5E8YA 3R9NA 3RZBA 4AZTA 3FMLA 5JQ8A 2X8EA 4G2FA 2WOUA 4D4SA 4U5JA 1JKLA 2QKRA 2C1BA 3SRVB 5CXZA 5C4LA 2XJ0A 2VNWA 5E1EA 3OEZA 4I5CA 3VUHA 4BDDA 4Q5EA 4DYMA 3Q9WA 4KKHA 3SV0A 3OROA 2GNHA 2UZBA 3C5UA 3WOWA 3VHKA 2ZDUA 2PUPA 2HK5A 4DFNA 5AR3A 3R7OA 1UKHA 4O1OA 4B9DA 2YIWA 5BMMA 4MWIA 4R1YA 2VX1A 2QR8A 3PZEA 2GHLA 3PG1A 1QMZA 1P2AA 2BAJA 2X39A 2XA4A 3VW8A 2OLCA 5IA2A 3TWJA 4CLIA 4JBQA 1OZ1A 4X2KA 1WBVA 5BYLA 4LOPA 3O7LB 1Q24A 5DT3A 2FH9A 4YC6A 3PJCA 1SMHA 5EW3A 4YTFA 4K2RA 5IQCA 4E20A 4HNFA 4GIHA 2BDFA 4RVMA 3MSSA 4O22A 3IGOA 3LQ5A 4X2GA 1MRYA 2JFMA 5JFXA 2BFYA 4BZOA 4YLLA 5JFWA 3CTHA 4Y5HA 3DXPA 1XHAA 2SRCA 3DTWA 4O0RA 5HVJA 3E87A 3LFQA 4UWYA 5FG8A 2IW8A 3UO5A 3DLZA 3D5WA 3EQGA 3A8XA 4GT5A 2C68A 3EOCA 4M3QA 3H0ZA 1IA8A 4I23A 2WTDA 5L6WL 5LVPA 3FI8A 4WNPA 3E3BX 3KXZA 2VN9A 3ZM4A 4IC7A 5AFVA 3DBDA 1R39A 1PMVA 4JQ8A 4PMPA 4FNZA 4BDIA 1XBCA 3DKGA 4ZTNA 2OXXA 3DNEA 3RM6A 2GQSA 4JQ7A 4QYEA 4IB1A 4CLJA 4KAOA 5CEMA 1OIRA 1OKVA 4RT7A 2PZ5A 3SGCA 2WMXA 5CS6A 4CZTA 1PYEA 4FL2A 4HCUA 5IF1A 3FV8A 4YZNA 4IVDA 2GSFA 4FOBA 4PPCA 4E6DA 3FC2A 4EH6A 2GFCA 3BX5A 4NTTA 2X81A 4YC3A 3F2RA 2RIOA 3AMYA 4M69B 1SVGA 3SVVA 3MFRA 1XJDA 4KUJA 4E4NA 4E5BA 4L00A 3OEFX 2HAKA 1V0PA 5LOHA 3LJ1A 4AFEA 4Y72A 3G15A 4TL0A 3TDVA 3ORPA 4L3LA 2EWAA 1PHKA 3RNYA 2RG5A 2CN8A 2JDOA 3NAXA 2Q83A 2ITNA 4QMUA 4TNDA 2NO3A 2I6LA 4FKQA 3LIJA 5A54A 4BFMA 4YUQA 2BRGA 2VWVA 2GQGA 2E9VA 3C4FA 5JT2A 2J0LA 5HE3A 4TTHB 4C2WA 4RA4A 4RLKA 4DGMA 4IAYA 3EN4A 3KEXA 3QQLA 4QMMA 2ITPA 2A1AB 3MBLA 5K3YA 4QO9A 2I40A 5HIEA 4CFVA 5A6NA 3CGOA 3P5KA 5HU3A 4O7VA 2G01A 2HCKA 2W17A 2XK7A 3QAME 4PWNA 3UG1A 4D58A 1M17A 5K9IA 1OUKA 1BX6A 5FEQA 2OIQA 4BCKA 4U3YA 3F3UA 2UV2A 4FVRA 5ANJA 3LAUA 4OTQA 2OF2A 4ZLYA 3BV2A 4LL5A 3ID6C 2CJMA 3JY9A 1TQPA 4BVUA 4I6HA 2QOKA 5FXRA 3UZRA 3R7IA 5ETIA 5IQEA 3PE1A 2IG7A 2B1PA 3QGYA 1LP4A 2YLEA 4UY9A 3RAKA 5JGDA 3ZSGA 4RBLA 5AAGA 5HCXA 2QHNA 5FGKA 4AZSA 5CU0A 3K2LA 2ONLC 5HOAA 3R02A 3RPVA 1OBDA 4RG0A 2Z60A 1TVOA 3D5VA 3UIUA 2GNGA 2WO6A 1WBWA 2YAAA 2PY3A 5AUZA 3VUDA 4BIEA 5I3RA 2XP2A 2VTLA 3FYJX 5CVFA 1W84A 4GT4A 2W4OA 3NIZA 2BDJA 4F1MA 4ZTMA 3SOAA 2CKOA 1Y91A 4FT5A 4IQ6A 3ZFYA 5J5TA 4ZOGA 5IH4A 4O0VA 3I79A 5LXMA 3PUPA 4C58A 5C27A 3R7VA 4RZWA 2GFSA 2XMYA 5CU4A 3RMFA 3IGGA 4K1BA 4O81A 3QRUA 3O8TA 3B8RA 1PJKA 4RJ8A 2E9NA 4PDOA 3VUGA 4FIHA 2VO7A 3EQPA 3S3IA 2V55A 2ZV7A 4FV4A 4BGQA 3ZLSA 1W83A 3V8SA 4BKZA 5KBRA 3L8PA 2UZTA 4FSTA 2Y4IC 4FNXA 2X0GA 1F0QA 2XCKA 4AN2A 4ACMA 5E90A 5KMIA 5ITAA 4FKGA 1PKDA 2WTVA 3DDPA 3DJ5A 4D2PA 3PVGA 1WMKA 4AS0A 4OBPA 4WUAA 4FNYA 2WMRA 3HRCA 2ZVAA 5A46A 4FKUA 4UMTA 4XV2A 3RHXA 2P2IA 4CFNA 1YHVA 1VR2A 3BGPA 4ZTRA 1PXPA 2UW7A 2IVSA 4GFGA 4DH8A 3FXWA 4LRMA 3O8PA 4ZMEA 4I0RA 3CC6A 5HGIA 2XS0A 4I6FA 4F63A 5CF5A 5E8XA 3VQUA 2UW3A 4B99A 2WMTA 4YJTA 3F3VA 3UVPA 3GOKA 4OW8A 4QP3A 3LPBA 4FKJA 3TCPA 2QG5A 3VRZA 2HELA 2WPAA 2UVYA 3MYGA 3FLYA 3BE2A 4U97A 3UO6A 3KL8A 5IEVA 3RNIA 4FZ6A 4C33A 4FKOA 3EIDA 2WNTA 4XEYA 3G0EA 3SW7A 4HW7A 2NRYA 3CD8A 4DINA 4LUDA 1YWRA 3KF7A 3LJ2A 2AYPA 2VTSA 1APME 4PP9A 3SC1A 3VS1A 3BU6A 5DGZA 3NAYA 3LVPA 3UIBA 4ACGA 3LFDA 4FKVA 3EZRA 4I5PA 4OBQA 3G0FA 3ZTXA 5J79A 3NW7A 4ZS0A 4EH5A 4NYEA 4R77A 2WTWA 4UB7A 1HCLA 3KRLA 2HENA 2WQNA 3BYMA 4DBNA 2Y0AA 2PE2A 2WD1A 4Y85A 3QC4A 5EHLA 3R9HA 5LMBA 4BR3A 3L9PA 2AC5A 2J0JA 3P4KA 1OL7A 4YSJA 5JEBA 1SM2A 1URCA 3FI2A 2UW5A 5GHVA 2RFSA 3MVHA 4KS7A 4O1PA 4EJNA 2X4ZA 5LMKA 3G51A 4DAWA 4WD5A 3CP9A 2R3OA 5CAVA 4DN5A 3FSKA 3H3CA 4EZ5A 4U8ZA 5FTOA 3UMXA 2UZVA 2YDIA 3TM0A 3FZSA 3QQFA 3W2RA 4QP4A 3TZ8A 4EI4A 1W82A 4DH5A 2PULA 3EQBA 4DC2A 4TWCA 3Q4UA 4XG4A 5AV3A 4MH7A 4M13A 2OJJA 3GT8A 3HV3A 3NS9A 3QKKA 2B9FA 4W8DA 4Y5QA 4XRLA 5AR5A 4FVPA 4U80A 5J9YA 1E9HA 2NNWB 2QOCA 4CV8A 4X3FC 3V6SA 2GS6A 5IA3A 3K54A 3P1AA 5JSMA 4E4XA 2JLDA 4F1OA 4O0WA 3B8QA 1W8CA 2VD5A 4O0UA 4U41A 2BKZA 3UO4A 3VBYA 4XG7A 3U6JA 2YIXA 4RJ4A 1R0EA 3COIA 3DBQA 4F9AA 2JD5A 4JI9A 4TYJA 2BIKB 4J8NA 1GIIA 3DLSA 2CLXA 4JJRA 4AOJA 3R8VA 3Q04A 4D2SA 3MB7A 2WTIA 3QZFA 4QYHA 3DXQA 3OF0A 3V5TA 2ITZA 3FQHA 2XIXA 4D4YA 4YGAA 3QLGA 1YHSA 4XBUA 5H9BA 4K33A 4E7WA 5A4EA 4AA5A 2UW6A 2YITA 2ERKA 5E92A 1UU8A 3GC7A 3KA0A 4NZWB 5F94A 3WF9A 5HLNA 2I0YA 4PX6A 3OWJA 3MPTA 3MIAA 4RRVA 4BBFA 4W9XA 3AC2A 3FLNC 3QKMA 2WKMA 2WFYA 3GFEA 4WRSA 5ETCA 5AIKA 3KB7A 3ZEWA 4O21A 1NY3A 2X2LA 3V5PA 4XP3A 3VAPA 4E5WA 1OL2A 4W9WA 1FVVA 2ITTA 2X2KA 4FT0A 3EL8A 4XP2A 3QQGA 2C3IB 3C4WA 2XEYA 3ENMA 5CAQA 5I9XA 5LVNA 3V8WA 4JDKA 4RVLA 4JRVA 5BX0A 5FTQA 2OK1A 3OC1A 3UQCA 4YTIA 3KVXA 3GU6A 3R1SA 5CSVA 3NRMA 3ODZX 1JNKA 2QR7A 4EOOA 3ORLA 3L9NA 2VZ6A 3M11A 2RFDA 5HO7A 1L3RE 4XG9A 3MPMA 4D2VA 4AU8A 2YCFA 4RA5A 2VWWA 1S9IA 2XEZA 1JVPP 3VBVA 4UZHA 1Y6AA 4Z7HA 4MQ2A 1H27A 2PE1A 3ZC5A 4Y46A 1M7QA 4RX7A 2F2UA 3HL7A 3OXTA 3E62A 4MAOA 5EI6A 1ZMUA 3RWPA 4BDBA 2O63A 4QP6A 1JQHA 4B8LA 1RJBA 3KMUA 2F7XE 3OCTA 2XNOA 5AUVA 5KX8A 2CCHA 3PVUA 3PXFA 2ZOQA 5AV1A 4USDA 4CD0A 3O50A 3OFMA 3PJ2A 1PXJA 4J1RA 2QKWB 1PXKA 5AUWA 1ZLTA 4BI2A 4F70A 5AA8A 4FBXA 2WZJA 3QZGA 2WEIA 1KSWA 2VNYA 1M2QA 2C69A 4YJUA 4G3CA 4NJDA 1V1KA 4GK4A 4MD7E 5J1VA 2C5YA 3V3VA 5KKRB 5K4IA 5AWMA 3PVWA 4MD9E 2FSTX 4F9BA 1JLUE 2C47A 5BVKA 3GCVA 3OWLA 2V7AA 4AACA 5FXSA 5KZ0A 3FE3A 4GCJA 2J50A 5HNGA 2CSNA 3NIEA 4AGDA 1NVRA 1WBTA 5BVWA 4D2WA 5BYYA 5CEOA 5I4NA 5KUPA 3HV6A 1OIUA 3MVMA 2ERZE 4YZDA 3V5WA 3H0YA 3PY0A 3MESA 1ZOHA 3DK3A 3IOPA 4N6YA 5HZNA 1KUTA 1XH8A 4FZAB 4ACDA 4E73A 4NL0A 5AP0A 3TDWA 2YN8A 4XG2A 4FV6A 4J8MA 5KMMA 3ATSA 5BVDA 3W18A 3VJNA 4YMJA 1ZRZA 4OR5A 3GOPA 4HZSA 4R3CA 2JFLA 5IQDA 2PTKA 4L7SA 2YM4A 4JL9A 5J8IA 4NW5A 2Z02A 3Q5IA 3S4QA 4DEIA 4MNFA 3KFAA 4W4YA 3NCZA 5LVLA 1YDRE 3IW6A 3ZBXA 5BVFA 3GC8A 5KMOA 1Q8TA 1WBPA 3CEKA 4ANOA 4JDJA 5M4FA 2VWXA 4YTHA 3O96A 3NWWA 4G17A 1OBGA 4PL4A 3R8UA 4OLIA 2PYWA 2OGVA 2W96B 3R6XA 3RK7A 2W1FA 4FE2A 3A7JA 4PL3A 3BKBA 3QYWA 4LRKA 1CMKE 3PRIA 5AA9A 3IW5A 4J52A 4Y73A 2R3QA 4BHNA 4F4PA 4V05A 4TW9A 3A7FA 3V01A 3Q9YA 4DLJA 4GKHA 5EHYA 4AT5A 4EC8A 4CFWA 4G16A 4EL9A 4FZ7A 2R3GA 2CLQA 4MWHA 3PPZA 4JAJA 3QD3A 2XUUA 4GSBA 4MQ1A 1PKGA 1W7HA 2BRMA 4FTIA 1XO2B 2GNLA 3RVGA 2F2CB 3DAJA 2BVAA 1H1SA 4DBXA 3FSFA 3D14A 4I21A 3UDBA 3ZDIA 1M2PA 4BWXA 1URWA 4WRGA 4O7SA 2VTOA 5EDRA 4C4IA 4C62A 3R1YA 3HX4A 5KHXA 4FTQA 2PZPA 5CI7A 1QPJA 4ANBA 1OPKA 5A4QA 4V04A 3OWKA 4BL1A 4RIWA 2YWPA 4LUEA 5E7RA 3ZLXA 4H05A 4K6ZA 5DMZA 3D9VA 1FBNA 1YQJA 2XYNA 3ACJA 3HP2A 5HD4A 3ZSIA 4NIFB 5ANEA 5IDNA 1CDKA 2GMXA 3LFAA 3MVJA 4RPVA 3FQEA 3ZUTA 5T3QA 3LLTA 1H0WA 1JSUA 3S2PA 4AZFA 3KQ7A 1G8AA 3ZC6A 4WNKA 2J4ZA 4G6NA 1R1WA 4XG8A 2JGZA 4X6QC 3MN3A 4IAAA 3PFQA 1SVHA 3PXQA 4KABA 1VEBA 4FODA 3MFSA 4O86A 2WQMA 4IE9A 3MY1A 5FQDC 4BCIA 4K11A 4UN0C 2J2IB 2FSMX 1T45A 2BPMA 3ZZEA 4LMUA 1MP8A 3QCSA 1YWNA 2WTKC 3G9NA 1TKIA 4RQVA 5AAEA 3RHKA 3SD0A 5T6KA 2RG6A 4BDFA 4PPAA 2IVTA 4KA3A 4BZDA 5HKMA 4LV5A 2CKEA 4L46A 4O91A 1I09A 2H96A 3QUEA 5HE0A 4KIKB 4NKSA 3KRJA 3KY2A 1CKIA 4X3JA 3GCPA 4WKQA 4IWPA 4FYOA 3ANQA 3FKOA 4G3FA 3IDPA 4F6WA 4CT2A 2OJ9A 1X8BA 3TI1A 4QTDA 1MRUA 3QF9A 1ZARA 3W33A 4BGHA 5BMSA 5HBJA 2HW7A 4FTCA 4IB0A 4ASZA 2GHGA 4O6EA 2AC3A 1DAWA 3POOA 3HMPA 4P5QA 3FUPA 2BR1A 1H1QA 4U79A 3HYHA 5DE2A 3ZS5A 4F64A 2VWZA 1VYWA 4TN6A 3K5VA 1LEWA 3OUKA 4IDTA 4JVGA 2ZDTA 3MWUA 2E9UA 3BEGA 4FTJA 3CPCA 4QMTA 4RQKA 3O71A 3TKIA 3EQHA 1KE8A 4FTTA 4L6QA 3UOHA 2E9OA 4EH8A 4XV1A 4FV0A 5CF4A 4FI1A 3ZOSA 3N4UA 4MXXA 4AN3A 3R04A 3IO7A 4Y8DA 1FVTA 4AT4A 4EHGA 2WEVA 2VGOA 4TRLA 5E9EA 5CI6A 2JKMA 2XNEA 3ZLWA 3UC4A 3ZRKA 4FTKA 3BHUA 3W10A 4DCAA 5CF8A 1H1WA 3P08A 4E4LA 3PPKA 4AZVA 3DB6A 2WTCA 4AW1A 3JS2A 3ZDUA 3DOGA 3OY1A 4I3ZA 3GNIB 3P7CA 2JIUA 5JRSA 4Z16A 4D1ZA 4DGNA 3IS5A 4NSTA 1K9AA 3HRBA 5CX9A 3BPRA 5GINE 1MRVA 4CT1A 4H58A 3R7YA 4BIBA 1ZMVA 4D0WA 3OMVA 4EHVA 3LXNA 2C6IA 2W99B 1Q99A 5IQGA 4FIGA 1H00A 4BCHA 2C6OA 3OBGA 3ZH8A 1PXIA 3EYHA 3F61A 4IX6A 4MNEB 3ZMMA 5DEYA 4TY1A 4BBEA 4NIFA 4U7ZA 3UVRA 3V5LA 2XCHA 2BRNA 3ZUUA 4N70A 1WFCA 2X6DA 3BBWA 5AJQA 3QXPA 5LWNA 3QRKA 2VX3A 3VS2A 3FKLA 2XB7A 2PVFA 3I5NA 3ETAA 3ZO3A 2YIYA 3FHIA 3AGMA 3N51A 4JLCA 4HGLA 1RW8A 3HUBA 5CEIA 3R7UA 3U9NA 4TNBA 5LQFA 4MCVA 5DT4A 3D7TB 4UXQA 1S9JA 3FQSA 4HVIA 4IWDA 5B7VA 1REJA 1K2PA 3OTVA 2GDOA 5CNOA 4BBMA 4I1ZA 5AP2A 4C4HA 5A4LA 4G31A 3LCKA 5FP5A 1JSVA 4PMMA 2OJIA 5HICA 4PPBA 5L8LA 4FUXA 4APPA 4QTCA 3HMNA 4DT8A 4ZMFA 4FSUA 4AFJA 4U43A 4F9YA 1DI9A 5BUEA 3NLBA 1QL6A 2XJ2A 2J0KA 2UW8A 4DG2E 3IONA 3W16A 2WMQA 3MY5A 3FLQA 1SZMA 1XH5A 4PP7A 5CASA 1V0BA 4TWPA 3FZPA 4ONAA 4CFFA 3FMEA 3HLLA 5E91A 3AQVA 3C7QA 4FYNA 2R3FA 4YJSA 3T8OA 4AW5A 1ZMWA 4DGOA 3GP0A 3CLYA 1KE7A 1FGIA 3W8LA 2YM5A 3M1SA 2I0VA 2YCSA 3BHVA 1OUYA 4DT9A 3KRRA 3B2TA 5CT7A 3TJDA 2HIWA 1ZYCA 2H8HA 2ITVA 2OO8X 4FL1A 4BTFA 2ZB1A 2A27A 3G33A 5DBXA 3QCQA 1LUFA 3A7GA 2E9PA 4XH6A 4ALWA 4FV2A 3ANRA 3PSBA 4NCTA 3U6IA 3NGAA 4JR3A 4L9IA 4ORKA 2XKEA 4O38A 4E6QA 1BI8A 2PMOX 2W05A 3MFUA 4D2TA 3AD6A 2PVLA 4LOOA 4JXFA 5F9EA 3GENA 1WVYA 2JAVA 3EQIA 4CQGA 4KKGA 4GU6A 5CZIA 4C59A 3LZBA 3VULA 4Q5HA 3NYXA 1PXLA 4EHZA 3RK9A 4BICA 2ZYBA 3PY1A 4FKLA 4ANMA 3TKUA 5K0KA 3RTPA 3ACKA 3NUUA 3EQDA 4EH3A 1JWHA 1TQIA 1YOMA 5FBNC 4MNEA 4RX8A 5DT0A 3COKA 2XH5A 3R73A 4WBBB 4ZY6A 2ITWA 2R3LA 2AUHA 3UE4A 2GNIA 2IZTA 2PMNX 1BI7A 4H39A 4QTAA 2CNQA 5CAUA 5I9UA 3A2CA 4EUTA 2BMCA 3Q9ZA 4O0SA 1OGUA 4L52A 4HVHA 3F6XA 5GZ8A 2C3KA 5I9VA 5L3AA 4L3JA 3H9FA 5A4CA 5JK3A 3D7TA 4CQEA 2X8IA 3HMOA 3OG7A 4WSQA 5BUJA 2UZEA 5HEZA 5LMAA 4TYIA 5CYIA 3WE8A 4QP8A 3R8LA 3S1HA 1OPLA 1E1VA 5GZAA 3DJ7A 5CEQA 3EFLA 5J7BA 4D2RA 2RFEA 4WO5A 5EYKA 3GU4A 3ITZA 2C6LA 3MDYA 2PE0A 3R1NA 4FF8A 4IAKA 3ZO2A 1H0VA 3O17A 4E3CA 5J9LA 3C1XA 2O65A 3I5ZA 4NU1A 4YJVA 1Q4LA 4E6CA 4ZZNA 4R78A 3TUBA 4ZS4A 1Q62A 2XKFA 3ORIA 3LMHA 5AR7A 5EH0A 3UBDA 3MA6A 4HJOA 3Q52A 1OL6A 3D5XA 3ZCLA 2ITOA 1LR4A 3CPBA 4IJ9A 3QUPA 4OUCA 2ZV9A 3QTQA 4XJ0A 5E8SA 4X2FA 4EYJA 2X4FA 4USFA 2PUIA 3CSVA 2FUMA 4YHJA 3A4PA 3SA0A 5KMLA 5M55A 4DEAA 3F3ZA 5GIPE 4QMQA 3FZOA 5GIOE 3A4OX 4RC4A 3OT3A 3DS6A 4RLLA 3FLZA 2J5EA 2XNBA 3DFAA 4GVAA 4RWLA 4TYEA 4G5PA 3W8QA 4W4WA 5CSHA 4FK6A 4KD1A 5CANA 3HA6A 1RQQA 4QP9A 2WELA 5KHWA 4YLJA 2QOQA 1FMOE 3EYGA 3EFKA 5D11A 3QA0A 3P23A 3GXLA 3A8WA 5DNRA 4K77A 2A19B 2W1ZA 4IFCA 4IB5A 5I5ZA 4C57A 4IX4A 5JGBA 5H8GA 4U6RA 1FMKA 4OTPA 5ANKA 4I4EA 2W0JA 3RP9A 3JUHA 3AOXA 3VIDA 5HNBA 3V5JA 4RZVA 5I9YA 1YKRA 2FSLX 4F7JA 3DQWA 4NM5A 5DYJA 2RF9A 3FLSA 5KE0A 1XH4A 3G90X 5IUGA 3FKNA 2HZNA 4BTMA 3QA8A 4PRJA 4IMYA 4AGUA 4DLIA 5FP6A 5HG5A 2YM8A 4LOQA 3H30A 2C4GA 4JIKA 3DKCA 5FXQA 4A07A 2F7ZE 5H8BA 4CKIA 3M2WA 2BROA 2W9FB 3P9JA 4N6ZA 4QQTA 3F88A 3C4XA 2OICA 3BZ3A 2X6EA 1F3MC 1ZYLA 3ENHA 2YDJA 5AR4A 4R5SA 3L9LA 2JKOA 5DR6A 3HMMA 4IZAA 4HGSA 2R4BA 3RAWA 3ZFMA 4DE4A 4IVBA 4G9CA 1JOWB 4GG5A 3PTGA 4EEVA 4CG9A 2VTPA 4KB8A 4U44A 5AM6A 3RPYA 4I4FA 4L3PA 5AX3A 3D4QA 3QHWA 3DB8A 3FHRA 2B52A 4GT3A 3R8MA 4DFBA 3KXHA 3UGCA 4ZTHA 2RFNA 3HECA 2QLQA 4TWOA 4ZIMA 2QQ7A 3UMWA 4GVJA 3MVLA 5D9HA 1PMEA 3QQUA 4AW0A 3MW1A 4WA9A 5J5SA 4X0MA 3CY3A 4FT3A 5C26A 4ERKA 4A9YA 3IDCA 3QD2B 1IAJA 4YPSA 5AIRA 3TV4A 5DVRA 4GU9A 1M52A 4YNEA 3MIYA 1CKPA 2Y7JA 3UTOA 3Q96A 2CCIA 4BCJA 3E8CA 4FKPA 1OL1A 5AUYA 2W5AA 2C6DA 3TNIA 2ITYA 2PMLX 4NFNA 3T9TA 1B6CB 2EU9A 4YJNA 4UBAA 3R21A 3S0OA 4TXCA 1M14A 4RMZA 4J7BA 3DK7A 4O7ZA 4LQMA 3GCSA 3R9RA 1CM8A 2HZ0A 4P2KA 1Q8YA 3QTWA 4ALVA 2HZ4A 4M66A 3KN6A 4EOMA 4EYMA 1G5SA 3BLHA 2A4LA 4DA5A 4ZJJA 4D1SA 5H2UA 4U40A 3WZJA 2XF0A 2HY0A 4Y95A 3QL8A 2OBJA 3ORKA 1YXVA 2ITQA 1OIYA 3DY7A 4WSYA 1CTPE 1R0PA 5EOLA 5AV2A 1L8TA 5JH6A 5BQ0A 3AMAA 5DRBA 1OKZA 4FV3A 4BDEA 4UV0A 3QGWA 4IM0A 4FX3A 4G3EA 2B9IA 2GTNA 3QC9A 4TKSA 3T3VA 3UIXA 5C8NA 5L2SA 3QTRA 5HG9A 2UZOA 3HZTA 1ZY4A 3VWAA 4V0GB 3RINA 3KXNA 3HDMA 4YJRA 2VRXA 4HPTE 3V6RA 3VN9A 4FK3A 2R3KA 4MF0A 3LHJA 4PTGA 3BIZA 3PY3A 3DZOA 1U5RA 3O51A 4L43A 3S00A 3LFNA 2B54A 4AOIA 2QOBA 5IA4A 3NDMA 3OCBA 5C8MA 4EQCA 5JKGA 3HRFA 3HP5A 5ACKA 4EHEA 2JIVA 2YA9A 3GI3A 3KRWA 4B6LA 4O0TA 4EH9A 4YO4A 3MH1A 2W1DA 5IZFA 2Z2WA 5HQ0A 1BYGA 3VS5A 2VTJA 2C5OA 1U54B 1H1PA 2X7GA 3QX4A 3KXXA 5HESA 4CKJA 2G9XA 5CZHA 1DI8A 1XH6A 2PVYA 1YHWA 2R3HA 4NUSA 4AP7A 3NUAA 4FIIA 3QLFA 5HTCA 4YLKA 2V7OA 4R6VA 3W1FA 1G8SA 2LGCA 2XYUA 2QC6A 3FPMA 4FZDB 5EK7A 2ZM4A 2YZAA 1UV5A 3TNWA 5ACBC 4AZEA 3C0GA 3WF6A 4D0XA 5HE2A 2QOLA 3BEAA 4F6SA 1KWPA 2FO0A 3FDNA 1REKA 2WMUA 3FL4A 4B7TA 3HEGA 3LMGA 4F7NA 2X9FA 4FR4A 3NUPA 3R83A 3K3JA 4CYJA 2VWYA 4S32A 5EQEA 4XNEA 2J90A 2VO0A 2J51A 3OZ6A 3UP7A 2QCSA 5B0XA 5GNKA 4O82A 4O7LA 4J95A 3IOKA 4ID7A 2PVNA 2W1IA 1NA7A 5G6VA 1CKJA 5LWMA 3NNWA 5T68A 3TN8A 4A4LA 5B2LA 4C35A 3P86A 3R9DA 5E4HA 3NUSA 2B9HA 2UW0A 3FXXA 5TE0A 4MXAA 3A7IA 4FNWA 4QYFA 4XP0A 5TKDA 5HNIX 2VU3A 2W1HA 4TYHA 5HVYA 3NUNA 4RJ7A 2V0DA 1QCFA 2W4KA 5EG3A 3G5DA 2J6MA 1JAMA 1O9UA 3ZZWA 4FEUA 3WIGA 1H01A 4FC0A 3RK5A 1JKTA 4U0IA 3NNXA 3OXZA 4W4VA 3LCOA 5I3OA 2OWBA 3Q53A 5L2TA 2IJMA 2F7EE 1BL6A 3ALOA 2PZIA 3QTIA 2EB2A 4MK0A 3TNPC 4AA4A 3DBCA 1B38A 4FTLA 4ZY5A 2C6EA 4BCMA 3KREA 1A9UA 4GUEA 4NW6A 5C8KA 2HY81 4FV7A 4C34A 2QOHA 5IUIA 4AE6A 1OB3A 4NEUA 4OTGA 4QQJA 3RZFA 3VJOA 4UWCA 3FL5A 4V0GA 4BZNA 5KZIA 3OOMA 3JY0A 4I6QA 2QODA 4FV5A 4AUAA 4OTHA 5HBHA 3KK9A 2XBAA 4J97A 2JEDA 5CF6A 3Q6UA 3IW4A 3EFWA 3FC1X 4B8MA 3CBLA 4PNKA 4I24A 3KULA 3SQQA 2OW3A 5IA1A 5HCYA 4L42A 3DU8A 1UNHA 2QVSE 4FL3A 5DR9A 2CKQA 2XVDA 4P4CA 3QZIA 4QD6A 2GNFA 5DI1A 5GJGA 3R0TA 4C38A 4CTBA 5CALA 4HCTA 3EL7A 3VUIA 2CGUA 1XKKA 1M2RA 1U54A 2XZSA 4FGRA 4BTJA 1JKSA 3LQ3A 4RIWB 3RAIA 2GPHA 3C4ZA 2W7XA 4JX7A 4M0ZA 3VBTA 3GB2A 5IISA 2FYSA 4FICA 3VQHA 5J87A 2YACA 3Q2JA 4BHZA 1GZ8A 4JQEA 3WF7A 4H3QA 3ZYAA 2XK9A 5EYCA 4WG5A 3VS4A 3KXGA 2WGJA 5A9UA 4CZYB 2UW9A 4GJ2A 4KSQA 2XIRA 3BQCA 3WZUA 2B55A 2C1AA 1P4OA 4ALUA 4R7IA 5EM7A 4O83A 4CNHA 2XNPA 2PZYA 4FTAA 3MPAA 4YJOA 3D2KA 4LM5A 2XNGA 4FSZA 5TF9A 5FBOA 4ENXA 4ZAUA 4KIQA 1BMKA 4JG7A 2EXEA 4IHPA 4RVTA 5CQWA 2WMSA 3WIKA 4CG8A 3I7BA 4HNIA 2IN6A 4F0IA 4OT6A 4FV8A 3TV7A 3WARA 2WHBA 3FEGA 3FMNA 3CIKA 1GAGA 3AC5A 4KSPA 2W9ZB 4ZTLA 1QPDA 4WG3A 4PDYA 3F82A 4HGEA 2H34A 2OFUA 3LMIA 4OTFA 2WQEA 1BKXA 2CPKE 4KNBA 3VS0A 2CGXA 3ZEPA 1O6YA 3EN5A 4KINA 3RPOA 1GIJA 5C01A 4APCA 2XK3A 5GJFA 4UWBA 5FM2A 3U8WA 4PTEA 1J91A 1UWJA 2EXCX 4EH4A 3ODYX 3QXOA 2C6KA 1BLXA 4HYHA 3ALNA 4G9RA 3C0HA 4EOSA 1TQMA 3R8ZA 3G6GA 4B4LA 2JDRA 3QU0A 2C5VA 2Z7RA 3K3IA 3UODA 4JNWA 3DKFA 2BRHA 4F09A 5EM8A 3EZVA 4RIOA 4EONA 4BYJA 1DAYA 5BNJA 2RKUA 4EOLA 4NTSA 1Y6BA 2BALA 5DLSA 4CVAA 2O5KA 3U87A 4IW0A 4JDHA 2UZLA 2WMWA 3T3UA 2VTNA 3CJFA 4EBWA 4O0XA 4QNYA 4K18A 3W2QA 5CEKA 4RX5A 3P7AA 5FTGA 1BL7A 2QG7A 4BB4A 2ZM3A 3D2IA 4C7TA 4E5AX 4IZYA 2YERA 5KBQA 2YJSA 2VWIA 4R3PA 3SG8A 4DFUA 4AOTA 3PYYA 1YXUA 1E1XA 4EQMA 3CY2A 2PPQA 4QYYA 4UX9A 1SYKA 1WBOA 2XIKA 4GV1A 3UZPA 5K0XA 1GJOA 2JITA 2WIHA 4I92A 4BRXA 2PVKA 5E8VA 5LMKC 4QP2A 2I1MA 5HU9A 3BYOA 2F57A 4G6LA 4GFMA 4PV0A 2OZAB 4YZBA 5HE1A 3PIZA 4NT4A 4DHFA 4QMZA 5FD2A 2GU8A 4CMUA 2ZAZA 4NK9A 4MD8E 4DITA 3TIYA 3OT8A 4EH7A 1OIQA 4CFMA 4M7IA 1GZNA 1YI3A 4ACCA 5CY3A 1YI4A 3LKMA 4TT7A 4USEA 4EWHA 2YM7A 4L53A 1XH7A 1KE9A 3F2AA 3ZU7A 4KBKA 3WYYA 3EB0A 3EHAA 2A0CX 3R7EA 2XBJA 3GU5A 4BDAA 1FOTA 2YZLA 4WG4A 4YJQA 3AT2A 4ZLZA 4CEGA 3E8EA 4N0SA 3TACA 3EN9A 2VTTA 5AP1A 3VUKA 4AGCA 2C5NA 2UVZA 2VTHA 2DYLA 2OH4A 2XK8A 3QKLA 4GFOA 4D9TA 3LFSA 5AM7A 5IUHA 2IW6A 3ZXZA 2PZRA 4QMWA 3V51A 4FIJA 5EFQA 2IPXA 2P0CA 4O7WA 4ZSLA 4MXCA 4RWKA 1ZZ2A 4ZJVA 1GZKA 1KE6A 2Z7LA 4QNAA 1JPAA 2BCJA 3G2FA 2VTQA 4AZWA 5FRIA 4DGLC 4F7SA 3Q60A 3KGAA 4IACA 4Y83A 2WQBA 3AD5A 3JXWA 4J96A 4YZCA 5AV0A 4EUUA 1OKWA 4CTCA 2BHHA 4RFZA 1OMWA 4V01A 2BUJA 2O3PA 3ORNA 4ANQA 3QRIA 4FIFA 1ZAOA 4E93A 3F3TA 4DEEA 3PPJA 2OH0E 3GC9A 4FKSA 4IH8A 4RVKA 5FUTA 3FZ1A 4EH2A 4BDCA 4ZK5A 4BI0A 3A61A 2C0OA 2IZRA 3PA5A 5K4JA 5FM3A 2QHMA 4BI1A 5IEYA 4EOQA 3OD6X 5J95A 5AP7A 1G3NA 5E8TA 3E93A 3QX2A 3OTUA 5JQ5A 3IW8A 2VTRA 4EJ7A 4DH7A 2CNVA 4NM0A 3SKCA 3QTUA 4BCPA 4ITHA 4YNOA 2BHEA 2UW4A 3BHTA 3GVUA 4RWJA 4JG6A 5DR2A 4A7CA 2HWOA 2J7TA 4FMQA 2WAJA 1NVQA 2BTSA 3LCDA 4CZUA 2HYYA 3BGZA 2C0TA 3R22A 4YJPA 3BYVA 3HMIA 4GK3A 3VO3A 1B39A 4IVAA 2I0EA 4P90A 4UZDA 4I6BA 2BKKA 3RALA 2B0QA 2J9MA 3ZM9A 4ANNA 5M07A 3Q6WA 4R5YA 5CNNA 5L8KA 3HDNA 4K9YA 3DV3A 2YM3A 3F69A 4XCUA 3ROCA 4FKRA 4FSRA 5IQFA 1PF8A 3FYKX 1JSTA 3LFCA 3NX8A 3SOCA 3UQGA 2X7FA 2OZAA 3H10A 1ZOGA 3QHRA 4ZP5A 3DGKA 4S34A 2PUNA 3U54A 5LVMA 3IG7A 3VRYA 3R01A 2X2MA 3IPHA 4C37A 3LCTA 3GFWA 4JAIA 4D4RA 3A99A 2JKKA 2EVAA 2Y4IB 3VVHA 3VW6A 3LXPA 4IEBA 4IM2A 1Y8GA 2QURA 4GUBA 3FAAA 4PMTA 2C6MA 5DEWA 5IQBA 3RM7A 5AUTA 4RC3A 4U81A 3DXNA 3FY0A 5AP6A 2R9SA 2CGWA 4O0YA 3QRJA 4YURA 2XKCA 2IVVA 3PSDA 1UU9A 3L1SA 3BHYA 1XBBA 4HYUA 2ZB0A 5HCZA 2BZKB 2RL5A 4FSMA 2FGIA 3QD4A 4U9AA 4W4XA 4EZ7A 5CENA 2F9GA 2NP8A 1P4FA 2QI8A 3R2YA 3VNTA 2BZJA 4WBOA 4AWIA 3JPVA 4RFYA 1ZZLA 3C5IA 4YU2A 2G1TA 3ZRMA 4IADA 4GMYA 2EB3A 4D5KA 4FEQA 3ZONA 4BGGA 4F08A 4ZZOA 4L45A 4R1VA 4ZY4A 4ZXTA 3D5UA 3UVQA 4IWQA 2GQRA 4KBCA 4Z9LA 2R3MA 5DWRA 4XG6A 3N4TA 5ANOA 3CKXA 4AAAA 2P55A 3E7VA 2KTYA 3MB6A 4IVCA 3TL8A 3Q3BA 5CTPA 4AF3A 1LEZA 3C51A 1UA2A 3OCSA 5AP4A 1U46A 3C4CA 2UZNA 5ETAA 5M51A 2BZHB 2Y6MA 2QLUA 4NM3A 4XRJA 3COMA 1I44A 4ENYA 4E4MA 2JDSA 4IZ5A 5AX9A 3UPZA 3CXWA 3LQ8A 3MJ1A 4XS2A 3AC1A 5FEEA 5L2IA 1XBAA 2GS2A 4XLVA 2IW9A 3THBA 2Z7QA 4W8EA 3RPSA 3ORXA 5DH3A 4A9TA 2BTRA 4JG8A 1YRPA 4U42A 3W32A 3VUTA 2P2HA 3II5A 2ONLA 4KBAA 4RIYA 1YVJA 3CR0A 4EORA 4OGRA 2PUUA 3TNHA 4Z7GA 4UXLA 4DH3A 2YDKA 5A6OA 3GUBA 1R78A 1YXSA 2CMWA 4CKRA 3OVVA 2C3LA 2UUEA 4RFMA 2HZIA 3DT1A 1Q41A 5AEPA 5HIDA 3L8SA 4QP7A 3R2BA 4QYGA 1YXTA 3U55A 1FPUA 4UYAA 3CTQA 4IAIA 3KMMA 4JRNA 2ZV2A 4E8AA 2J5FA 2PSQA 4KIOA 4R8QA 1LPUA 4X6RA 4G34A 4I41A 1Q61A 1YWVA 4G3DA 3DJ6A 5C9CA 4BIDA 1IEPA 5AV4A 1ZOEA 3C9WA 3F5UA 3FXZA 3ZFXA 1K3AA 3PWDA 3P78A 4CV9A 4F0GA 2QOFA 5HO6A 4YR8A 5IDPA 4HYIA 5KKRC 1IRKA 4M0YA 1YI6A 4HOKA 2W1CA 4NJ3A 2X7OA 3SHEA 4X2NA 4EK4A 2GCDA 5A3XA 2YCRA 4FZFB 4FA2A 4YO6A 4EBVA 2BDWA 5BYZA 4O7TA 4FSYA 3GBZA 1Z9XA 2JBOA 2PWLA 3FI3A 4JBPA 4F1TA 2B53A 1GY3A 4CCUA 4UEUA 4A4XA 3OOGA 1IASA 2RSVA 1PYXA 3TTJA 2GTMA 3AMBA 4XOZA 3WBLA 1SNUA 3CGFA 3BLQA 3U4WA 2OZOA 4EKLA 3TUCA 3N4VA 2JDTA 4M68A 3C0IA 3KC3A 1PXNA 5HX8A 1OITA 2QO7A 3IKAA 3C4EA 4I94A 2GHMA 1T46A 4MHAA 3BQRA 5C4KA 4KRDA 1PRYA 4L01A 3W2OA 2DQ7X 3F5XA 2QOIA 4XV3A 1UKIA 4QMXA 4QMNA 2WTJA 1XWSA 3I1AA 4J53A 3OP5A 1J7UA 2C3JA 2QO2A 1ZWSA 1F5QA 3N9XA 4HPUE 4QPMA 3LFEA 1U5QA 4IB3A 3MFTA 3LCSA 2OF4A 2OKRA 3W2SA 5CVGA 5AP5A 3DCVA 4LMNA 5M4IA 3MY0A 4DCEA 2O2UA 2XM9A 2OU7A 4AW2A 3EMGA 4M15A 2REIA 3VUMA 3TNQB 2QNJA 5IH5A 1HCKA 1SNXA 4EC9A 5FDXA 4WT6A 1JKKA 5IU2A 5DN3A 4GIIA 1V0OA 3VF8A 1NT2A 1KV2A 3QQKA 3NNVA 3D83A 4JT3A 4UALA 5J1WA 4IXPA 4YC8A 3RGFA 4O96A 3ERKA 4FOCA 4LGDA 4C2VA 3U4UA 5I9ZA 3C50A 2ETMA 4GJ3A 2W06A 5L2QA 3ZSHA 4BKJA 4JBOA 4I20A 3UJGA 3UG2A 2WMVA 4FTRA 1KOAA 3BRBA 3E8NA 3DA6A 1JBPE 1OVEA 1WVXA 3E88A 1J7IA 3ZO1A 3AT4A 3PZHA 4U3ZA 4AXAA 2XK4A 4M14A 4A9SA 3LFBA 5DRDA 1QPEA 3PRFA 4X3FA 4Q9SA 5TO8A 4C02A 4ASEA 5HHWA 4C4JA 4DF3A 1J1BA 5I9WA 3UP2A 4ZLOA 4S30A 1VJYA 4ZSGA 3CKWA 5K5NA 5J7HA 1OM1A 1XH9A 3SG9A 1XR1A 3AC8A 3RCJA 3KXMA 3L9MA 4LG4A 3NZ0A 2X9EA 4XV9A 3Q9XA 3O7LD 4IIRA 2Z7SA
chains in the Genus database with same CATH superfamily
3KVWA 3G6HA 1ZY5A 2HW6A 1WAKA 2G2HA 4C4GA 4NKAA 3W2PA 3SRVA 4D9UA 5JRQA 4XHKB 2IZUA 5EDQA 2V5QA 4E6AA 3UDZA 3PIXA 4QTBA 3F9NA 4EWQA 4BWKA 4ZJIA 3F7WA 4WIHA 3RI1A 4H3BA 5M57A 4CRLA 3KF4A 4OAVB 3MH3A 3NR9A 2R0UA 3DDQA 3A60A 4UYNA 5D7VA 2P3GX 4ZSJA 4I22A 4H36A 1YDSE 2PL0A 1H8FA 3E3PA 1O6KA 3GQIA 3ZRLA 3BL9A 3AXWA 2UVXA 5EW9A 5EM6A 2WQOA 3V04A 4S31A 1PW2A 1WCCA 2GNJA 5EKNA 5IPJA 5B2KA 4FTNA 1YXXA 2XIYA 2W5BA 4MTAA 4HVGA 3BYSA 2ZFYA 4EK8A 3I0QA 5AUUA 5L2WA 2XNMA 3EQCA 3Q2MA 3L8VA 3BELA 3OW4A 3R00A 1KOBA 4NM7A 3TIZA 5E8WA 2DUVA 1A06A 4G6OA 4F9WA 4KKEA 4RX9A 3ORZA 5L6PA 4HZRA 4QTEA 4A9RA 4OT5A 1H08A 3F2NA 3F3WA 2W1EA 2BFXA 4PTCA 4A06A 4O6LA 4TZRA 1DS5A 1UU3A 3COHA 2ACXA 1KV1A 5A4TA 5FLFA 4FSQA 4WHZA 3QQHA 3I60A 4DTBA 2CDZA 3T9IA 4NCTC 2QU5A 4BY9E 4GKIA 4A4OA 3QBNA 3UOLA 4O7RA 4CYIA 2OI4X 3QZHA 4O4BB 5DIAA 4HVDA 2YWVA 3DNDA 5IKWA 4JR7A 4LFIA 5M53A 2BRBA 1Q8ZA 3DK6A 3M42A 4BJJA 5EQYA 3BI6A 3BCEA 3QWKA 5AADA 3FBVA 4IJPA 1W98A 5EQPA 5DFPA 3Q4TA 4TYHB 3PVBA 2I7QA 4QT1A 2YISA 1GZOA 2C30A 5AR2A 1GNGA 4ASDA 4HCVA 3RBWA 4ASXA 3OXIA 3P79A 4RC2A 5CWZA 5AUXA 1OI9A 4FG9A 2ITXA 2YABA 1XQZA 3DFCB 3GQLA 5EHOA 2VAGA 3H9RA 4LGGA 4PDPA 2Y6OA 5AP3A 3JYAA 3RKBA 3DQXA 2HXLA 3HAVA 4M69A 5CU3A 2R0IA 2ZJWA 3KMWA 4FVQA 2XIZA 3IK3A 5HI2A 1QPCA 1Q3WA 1Q8UA 3O0GA 4MBIA 5IEXA 3KRXA 5EW8A 2WTKB 2FB8A 3NSZA 4QOXA 4YZ9A 4LL0A 4MVFA 4EK5A 3ORMA 3SXRA 4FKWA 4GYGA 4IAZA 3CQWA 5CSPA 4MEDA 3KULB 3ZO4A 4EK3A 1R3CA 4M84A 1KE5A 1M7NA 4QQ5A 5HLWA 1H1RA 3WF8A 4G3GA 2XRUA 2YCQA 2DS1A 4TYGA 2R2PA 1H07A 3ULZA 2CGVA 4FUYA 4FEVA 3FY2A 5JN2A 5CQUA 5IQAA 3QTXA 4BCFA 4DEHA 1G8JA 3RAHA 4ERWA 2CNUA 4EOIA 2PVJA 3R63A 4CRSA 4BCOA 3LXKA 4M8TA 3R9OA 2BILB 5DPVA 1NW1A 2VWBA 4F9CA 1UU7A 3GU8A 3NW6A 3NUYA 3MH2A 4XOYA 2X1NA 5HD7A 4O7YA 5HLPA 4G5JA 3KN5A 2WOTA 4S2ZA 3LW0A 4BTKA 3NVMB 4AXDA 4FTOA 1IG1A 4KS8A 3BWFA 3PWYA 5BVNA 1AQ1A 3SXFA 3PLAE 1WBSA 2ZMDA 1AGWA 3BYUA 3R28A 4DG0E 3WI6A 5EDPA 3HUCA 3POZA 4YHFA 4BCQA 2YM6A 4H1JA 3HA8A 3PDTA 3EN6A 5IQHA 3RPRA 5HG8A 5LVOA 1J7LA 4BWPA 3IW7A 1H24A 2PU8A 2J0IA 5D41A 3R8PA 4RWIA 1PXOA 2QD9A 4JIAA 4F99A 3UNKA 4DTAA 3ROYA 3WZEA 4O2PA 2QO9A 2VWUA 4FSWA 3EQRA 3Q4ZA 3R71A 2CHLA 3ATTA 4MX9A 3S95A 2F4JA 3KKVA 1GIHA 5DOSA 3AD4A 3FMDA 5FEDA 2CKPA 2PVRA 4GK2A 3MA3A 2XANA 4ZTQA 1AD5A 3NCGA 4I0TA 4FG7A 1FGKA 3QD0A 1IR3A 4RJ5A 5F4NA 5C1QB 3ELJA 4D55A 5CSWA 2OFVA 3MI9A 3OW3A 4XX9A 5TOZA 3ORTA 4L67A 2O0UA 3BWJA 2VTMA 2W4JA 3R7GA 4O84A 1IA9A 2NPQA 3A7HA 1MQ4A 3PA3A 2XM8A 4AQCA 3Q4CA 3O23A 3V5QA 2R7IA 3ZHPC 4DGGA 3CS9A 3FMJA 3F5GA 5IMEA 1Q5KA 4UMQA 2C6TA 4FKIA 4OAUC 5IG1A 3LXLA 3OY3A 5G1XA 3OBJA 4UMPA 5TT7A 4RGJA 4E1ZA 2PK9A 4FEXA 4QPSA 5JGAA 3WILA 3AC4A 5D12A 2W5HA 3C13A 5DG5A 5CAOA 5CEPA 3FZRA 3IDBA 5LARA 4DEDA 2OG8A 4O4DA 4YBJA 4FT9A 4I5MA 4X7QA 2I0HA 4XLIA 5A14A 3D0EA 1P5EA 4FTUA 4C4EA 4LYNA 3BU5A 5FDPA 2EXMA 3B2WA 5CXHA 2YIQA 3W0QA 1OPJA 5EM5A 3NMUF 3BE9A 5CAPA 1VYZA 5EOBA 3TTIA 2B9JA 5CSXA 2IO6A 1GOLA 2ETRA 3HNGA 4JBVA 3LOKA 5IA0A 3W2CA 2UZDA 3DAEA 3FMMA 2O64A 5M06A 4XG3A 4IM3A 4U45A 4PQNA 5D10A 3PXZA 2R3JA 2J0MB 4BDKA 4JOAA 3TT0A 2DWBA 3RWQA 2XRWA 2R3IA 4G1WA 5BUIA 2BIYA 2W1GA 3I6UA 1P14A 4OBOA 2PVMA 4GYIA 1PMUA 3LM5A 3CE3A 1Z5MA 4AX8A 3EFJA 4OTIA 3VF9A 3VONA 4EZ3A 4QMLA 5GJDA 4N4SA 3W0SA 4GEOA 3SDJA 3FWQA 2VUWA 5HORA 3UQFA 3I0OA 3U6HA 4F6UA 5EI8A 4XUFA 5BVOA 2WMBA 4K0YA 4C8BA 3UOKA 5HTIA 2HXQA 3DAKA 5AMNA 2G2IA 2ITUA 3R1QA 4FIEA 4ITIA 2OJFE 3WYXA 4CFXA 2JIIA 1ATPE 2IZSA 1Q3DA 2Q0NA 1UNGA 5EI2A 4ZEGA 2QU6A 3PIYA 3SAYA 5ANGA 4ANLA 5ICPA 2VTIA 4EOPA 2UZUE 4GG7A 5H3QA 3E5AA 2IVUA 3GC0A 5EYMA 5IMXA 3PXYA 4PY1A 3TZMA 1OKYA 2XKDA 1H25A 3GU7A 2R3PA 5E1SA 5BVEA 4C3PA 3FMKA 1OECA 1U4DA 3TG1A 5L4QA 2EUFB 3WE4A 3GEQA 1Z57A 4IX3A 4BCNA 4O27B 3UNZA 4CSVA 3LJ0A 1YDTE 2G15A 3KCFA 2OXYA 2YAKA 4QMOA 5CLPA 3MGYA 5CT0A 1STCE 4YBKA 4MXYA 2PMIA 3FJQE 2XNNA 3VS3A 2FVDA 2P4IA 4YTCA 3O2MA 4FGBA 4BYIA 3BL7A 1BUHA 4CGAA 4YZMA 1NXKA 1IAHA 1ZYJA 4FT7A 1UNLA 4GH2A 3G9LX 1VZOA 2Z8CA 5HVKA 4NWMA 4TPTA 4I0SA 1MUOA 1ZXEA 2VO3A 3AGLA 5JZJA 2UZWE 4QMYA 5DHJA 3TUDA 4MF1A 4ZSEA 3OWPA 5M56A 3VBXA 5KNJA 4F65A 3HGKA 3MJ2A 5D7AA 2BZIB 1H28A 3GCQA 4DFYA 3LLAA 4N57A 4PMSA 3EKKA 4XMOA 3NVKI 3LM0A 2JDVA 4QMPA 5EKOA 4ZTSA 4GRBA 2ZM1A 3EWHA 4DTKA 5M08A 3H9OA 3BLAA 4L44A 3TXOA 4E26A 3TV6A 4EK6A 4XYFA 4ZSAA 3CQEA 5IH6A 2WMAA 3MTLA 1ERKA 1ST0A 2HWPA 4J71A 3DBEA 5L8JA 2LAVA 4C36A 4CCBA 5KMJA 4NFMA 3QCXA 4JS8A 2OJGA 3LFFA 4IDVA 4PL5A 4ITJA 4PF4A 4F7LA 2R3RA 5KMKA 3EKNA 2JBPA 4P5ZA 3BGQA 2H9VA 4HYSA 4OTDA 4PUZA 2P33A 3TZ7A 3AT3A 3IQ7A 2R64A 4OTWA 1Q8WA 4IANA 3MV5A 1H4LA 2F49A 3EH9A 4FG8A 1YOLA 3FMHA 4H1MA 4RJ3A 1ND4A 5F95A 3ZBFA 4L8MA 5AAFA 4R7BA 4IFGA 4L7FA 3WZKA 4L68A 2WB8A 5L6OA 3TZ9A 3K5UA 1FVRA 4RSSA 2C5XA 3FI4A 3TJCA 4JDIA 2QOOA 4QP1A 3FLWA 1U59A 5HO8A 3PE2A 2JC6A 1NVSA 3PJ3A 1H26A 4GL9A 4GW8A 4R3RA 5D1JA 5DA3A 3OHTA 3EQFA 3NYOA 3VS7A 4B0GA 2R5TA 1CSNA 4P7EA 4S33A 4Q9ZA 3Q32A 3UZTA 2BAQA 3HKOA 3REPA 4BN1A 4EKKA 4CXAA 3QRTA 3NPCA 2OIDA 1WVWA 4H3PA 5TR6A 3V8TA 4DG3E 2R7BA 3CCNA 3PG3A 4IAFA 5AR8A 3PSCA 1RE8A 5CVHA 2H6DA 4O2ZA 3SX9A 5KO1A 2B4SB 1PXMA 2WIPA 3KU2A 1UWHA 4KWPA 2B7AA 4MBJA 4MXOA 4M12A 4C4FA 3HV7A 3EN7A 4ANSA 2PHKA 3WZDA 3AG9A 4XBRA 2Y8OA 5LCKA 4EQUA 5KCVA 4DEGA 3RJCA 4TWNA 4HVSA 4RIYB 3UOJA 5IA5A 4MKCA 4AA0A 2X8DA 3NYVA 4KIPA 4YSMA 4D4VA 5CU2A 3F7ZA 3UYSA 3BU3A 5J9ZA 3BHHA 5M09A 5ANDA 2YHVA 2YEXA 2JKQA 4BDGA 3FZTA 4QRCA 5BPYA 5KMNA 3DBFA 3HAMA 3UC3A 2XK6A 5I0BA 1Y57A 4DFZE 5JMSA 3CD3A 4YPDA 3Q5ZA 4WNMA 3NYNA 3I7CA 2V22A 4JX3A 3UYTA 2E2BA 4DEBA 4R7HA 3DPKA 4QPAA 1YW2A 5C03A 3UNJA 3UPXA 5CU6A 4MXZA 4FV1A 4IZ7A 3CTJA 3D15A 3HV4A 2NRUA 3VBWA 5LJJA 3ET7A 1YOJA 4RIXB 3QFVA 2VV9A 4LI5A 3QWJA 3VBQA 4K8AA 3E92A 2WXVA 4D5HA 4ACHA 4CMOA 3RCDA 3P5JC 3NW5A 2V62A 4BC6A 2VGPA 3D94A 3F66A 3KK8A 4BKYA 3SLSA 2YFXA 4A9UA 3GCUA 4WOVA 4HGTA 2OSCA 4C0TA 5ETFA 4I93A 2YJRA 3JR1A 2FA2A 4WNOA 5E8UA 3QTZA 4EOJA 2ZMCA 5JFSA 3QUDA 4DHIB 2YLFA 3TEIA 1Y8YA 5M4UA 2OIBA 3VC4A 2VTAA 2WU6A 4AE9A 4BDHA 4Z3VA 1J3HA 5M4CA 2A2AA 3GGFA 3ZUVA 2O8YA 5GZ9A 1SVEA 4Q2AA 2FSOX 4KRCA 5B2MA 2CN5A 3NNUA 4C3RA 3SW4A 2IWIA 5JFVA 4F0FA 2BAKA 2ETKA 3H4JA 3I81A 4D1XA 2OXDA 4C61A 3QTSA 3DKOA 5EYDA 4AG8A 4BDJA 4GS6A 5H8EA 4Z55A 4C3FA 1O6LA 4IWOA 1HOWA 3MS9A 3E8DA 3I6WA 4ZZMA 3FPQA 2ZV8A 3U9CA 4BCGA 4YP8A 5HX6A 3PLSA 3U51A 3IECA 4MBLA 4MYGA 3VHEA 3WF5A 3QCYA 4NH1A 3A62A 1J1CA 2ESMA 3JVRA 2KULA 3PXRA 3PP0A 4FKTA 3TKHA 3JVSA 3KCKA 3PP1A 4I5HA 4LV8A 4FV9A 1EH4A 4J99A 5F20A 2WU7A 4AN9A 3D7ZA 2Y4PA 4X21A 5HG7A 4UMUA 1FQ1B 2PVHA 5M44A 3QQJA 4IC8A 3ZXTA 2RGPA 3R30A 4PDSA 2VO6A 1ZYDA 2XJ1A 3DTCA 4M67A 3E7OA 2R3NA 4QQCA 4CMTA 5HTBA 2C0IA 5IQIA 3P0MA 3OUNB 3OS3A 4OTRA 4KIKA 5E8ZA 3NEWA 4FTMA 3I4BA 1A48A 4DH1A 4UMRA 4LGHA 4FEWA 1W0XC 4WUNA 3EJ1A 4ARKA 3CJGA 2Y9QA 4X2JA 1DM2A 2GS7A 1WBNA 3NUXA 3ZLYA 4D28A 2HOGA 4II5A 3PJ1A 4EOKA 2YIRA 3DZQA 4M97A 1Q97A 3HVCA 3MH0A 3SXSA 5F1ZA 2VX0A 4AGWA 4DFXE 3L8XA 5ANIA 4FSNA 1RDQE 4YHTA 2Q0BA 4O7NA 3HV5A 5FWKK 3F5PA 3UIMA 1PMNA 3BBTB 4CFUA 3LE6A 4DFLA 4J98A 4QMSA 3O5AA 3ULIA 3PA4A 2QONA 3BV3A 2AQXA 2G2FA 3CQUA 3E63A 3O8UA 4IBMA 4PNIA 4FRFA 1MQBA 4LRJA 4X3FB 5HBEA 5JZNA 1PY5A 3E64A 3BLRA 3QYZA 3PJ8A 1ZYSA 1UVRA 4RJ6A 3PXKA 5HIBA 3W55A 3MTFA 3OCGA 4BF2A 1OL5A 3P7BA 4RIXA 4IX5A 3VS6A 5K5XA 3AC3A 4QMVA 2JAMA 5LCJA 1WZYA 4AT3A 3QALE 1FINA 5E8YA 3R9NA 3RZBA 4AZTA 3FMLA 5JQ8A 2X8EA 4G2FA 2WOUA 4D4SA 4U5JA 1JKLA 2QKRA 2C1BA 3SRVB 5CXZA 3UDTA 5C4LA 2XJ0A 2VNWA 5E1EA 3OEZA 4I5CA 3VUHA 4BDDA 4Q5EA 4DYMA 3Q9WA 4KKHA 3SV0A 3OROA 2GNHA 2UZBA 3C5UA 3WOWA 3VHKA 2ZDUA 3TYKA 2PUPA 2HK5A 4DFNA 5AR3A 3R7OA 4AQKA 1UKHA 4O1OA 4B9DA 2YIWA 5BMMA 4MWIA 4R1YA 2VX1A 2QR8A 3PZEA 2GHLA 3PG1A 1QMZA 1P2AA 2BAJA 2X39A 2XA4A 3VW8A 2OLCA 5IA2A 3TWJA 4CLIA 4JBQA 1OZ1A 4X2KA 1WBVA 5BYLA 4LOPA 3O7LB 1Q24A 5DT3A 2FH9A 4YC6A 3PJCA 1SMHA 5EW3A 4YTFA 4K2RA 5IQCA 4E20A 4HNFA 4GIHA 2BDFA 4RVMA 3MSSA 4O22A 3IGOA 3LQ5A 4X2GA 1MRYA 2JFMA 5JFXA 2BFYA 4BZOA 4YLLA 5JFWA 3CTHA 4Y5HA 3DXPA 1XHAA 2SRCA 3DTWA 4O0RA 5HVJA 3E87A 3LFQA 4UWYA 5FG8A 2IW8A 3UO5A 3DLZA 3D5WA 3EQGA 3A8XA 4GT5A 2XAOA 2C68A 4LV7A 3EOCA 4M3QA 3H0ZA 1IA8A 4I23A 2WTDA 5L6WL 5LVPA 3FI8A 4WNPA 3E3BX 3KXZA 2VN9A 3ZM4A 4IC7A 5AFVA 3DBDA 1R39A 1PMVA 4JQ8A 4PMPA 4FNZA 4BDIA 1XBCA 3DKGA 4ZTNA 2OXXA 3DNEA 3RM6A 2GQSA 4JQ7A 4QYEA 4IB1A 4CLJA 4KAOA 5CEMA 1OIRA 1OKVA 4RT7A 2PZ5A 3SGCA 2WMXA 5CS6A 4CZTA 1PYEA 4FL2A 4HCUA 5IF1A 3FV8A 4YZNA 4IVDA 2GSFA 4FOBA 4PPCA 4E6DA 3FC2A 4EH6A 2GFCA 3BX5A 4NTTA 2X81A 4YC3A 3F2RA 2RIOA 3AMYA 4M69B 1SVGA 3SVVA 3MFRA 1XJDA 4KUJA 4E4NA 4E5BA 4L00A 3OEFX 2HAKA 1V0PA 5LOHA 4AAYA 3LJ1A 4AFEA 4Y72A 3G15A 4TL0A 3TDVA 3ORPA 4L3LA 2EWAA 1PHKA 3RNYA 2RG5A 2CN8A 2JDOA 3NAXA 2Q83A 2ITNA 4QMUA 4TNDA 2NO3A 2I6LA 4FKQA 3LIJA 5A54A 4BFMA 4YUQA 2BRGA 2VWVA 2GQGA 2E9VA 3C4FA 5JT2A 2J0LA 5HE3A 4TTHB 4C2WA 4RA4A 4RLKA 4DGMA 4IAYA 3EN4A 3KEXA 3QQLA 4QMMA 2ITPA 2A1AB 3MBLA 5K3YA 4QO9A 2I40A 5HIEA 4CFVA 5A6NA 3CGOA 3P5KA 5HU3A 4O7VA 2G01A 2HCKA 2W17A 2XK7A 3QAME 4PWNA 3UG1A 4D58A 1M17A 5K9IA 1OUKA 1BX6A 2XAMA 5FEQA 2OIQA 4BCKA 4U3YA 3F3UA 2UV2A 4FVRA 5ANJA 3LAUA 4OTQA 2OF2A 4ZLYA 3BV2A 4LL5A 3ID6C 2CJMA 3JY9A 1TQPA 4BVUA 4I6HA 2X0OA 2QOKA 5FXRA 3UZRA 3R7IA 5ETIA 5IQEA 3PE1A 2IG7A 2B1PA 3QGYA 1LP4A 2YLEA 4UY9A 3RAKA 5JGDA 3ZSGA 4RBLA 5AAGA 5HCXA 2QHNA 5FGKA 4AZSA 5CU0A 3K2LA 2ONLC 5HOAA 3R02A 3RPVA 1OBDA 4RG0A 2Z60A 1TVOA 3D5VA 3UIUA 2GNGA 2WO6A 1WBWA 2YAAA 2PY3A 5AUZA 3VUDA 4BIEA 5I3RA 2XP2A 2VTLA 3FYJX 5CVFA 1W84A 4GT4A 2W4OA 3NIZA 2BDJA 4F1MA 4ZTMA 3SOAA 2CKOA 1Y91A 4FT5A 4IQ6A 3ZFYA 5J5TA 4ZOGA 5IH4A 4O0VA 3I79A 5LXMA 3PUPA 4C58A 5C27A 3R7VA 4RZWA 2GFSA 2XMYA 5CU4A 3RMFA 3IGGA 4K1BA 4O81A 3QRUA 3O8TA 3B8RA 1PJKA 4RJ8A 2E9NA 4PDOA 3VUGA 4FIHA 2VO7A 3EQPA 3S3IA 2V55A 2ZV7A 4FV4A 4BGQA 3ZLSA 4LDTA 1W83A 3V8SA 4BKZA 5KBRA 4DDGA 3L8PA 2UZTA 4FSTA 2Y4IC 4FNXA 2X0GA 1F0QA 2XCKA 4AN2A 4ACMA 5E90A 5KMIA 5ITAA 4FKGA 1PKDA 2WTVA 3DDPA 3DJ5A 4D2PA 3PVGA 1WMKA 4AS0A 4OBPA 4WUAA 4FNYA 2WMRA 3HRCA 2ZVAA 5A46A 4FKUA 4UMTA 4XV2A 3RHXA 2P2IA 4O4EA 4CFNA 1YHVA 1VR2A 3BGPA 4ZTRA 1PXPA 2UW7A 2IVSA 4GFGA 4DH8A 3FXWA 4LRMA 3O8PA 4ZMEA 4I0RA 3CC6A 5HGIA 2XS0A 4I6FA 4F63A 5CF5A 3AKJA 5E8XA 3VQUA 2UW3A 4B99A 2WMTA 4YJTA 3F3VA 3UVPA 3GOKA 4OW8A 4QP3A 3LPBA 4FKJA 3TCPA 2QG5A 3VRZA 2HELA 2WPAA 2UVYA 3MYGA 3FLYA 3BE2A 4U97A 3UO6A 3KL8A 5IEVA 3RNIA 4FZ6A 4C33A 4FKOA 3EIDA 2WNTA 4XEYA 3G0EA 3SW7A 4HW7A 2NRYA 3CD8A 4DINA 4LUDA 1YWRA 3KF7A 3LJ2A 2AYPA 2VTSA 1APME 4PP9A 2IEWA 3SC1A 3VS1A 3BU6A 5DGZA 3NAYA 3LVPA 3UIBA 4ACGA 3LFDA 4FKVA 3EZRA 4I5PA 4OBQA 3G0FA 3ZTXA 5J79A 3NW7A 4ZS0A 4EH5A 4NYEA 4R77A 2WTWA 4UB7A 1HCLA 3KRLA 2HENA 2WQNA 4QDVA 3BYMA 4DBNA 2Y0AA 2PE2A 2WD1A 4Y85A 3QC4A 5EHLA 3R9HA 5LMBA 4BR3A 3L9PA 2AC5A 2J0JA 3P4KA 1OL7A 4YSJA 5JEBA 1SM2A 1URCA 3FI2A 2UW5A 5GHVA 2RFSA 3MVHA 4KS7A 4O1PA 4EJNA 4AXCA 2X4ZA 5LMKA 3G51A 4DAWA 4WD5A 3CP9A 2R3OA 5CAVA 4DN5A 3FSKA 3H3CA 4EZ5A 4U8ZA 5FTOA 3UMXA 2UZVA 2YDIA 3TM0A 3FZSA 3QQFA 3W2RA 4QP4A 3TZ8A 4EI4A 1W82A 4DH5A 2PULA 3EQBA 4DC2A 4TWCA 1W2DA 3Q4UA 4XG4A 5AV3A 4MH7A 4M13A 2OJJA 3GT8A 3HV3A 3NS9A 3QKKA 2B9FA 4W8DA 4Y5QA 4XRLA 5AR5A 4FVPA 4U80A 5J9YA 1E9HA 2NNWB 3KIOC 2QOCA 4CV8A 4X3FC 3V6SA 2GS6A 5IA3A 3K54A 3P1AA 5JSMA 4E4XA 2JLDA 4F1OA 4O0WA 3B8QA 1W8CA 2VD5A 4O0UA 4U41A 2BKZA 3UO4A 3VBYA 4XG7A 3U6JA 2YIXA 4RJ4A 1R0EA 3COIA 3DBQA 4F9AA 2JD5A 4JI9A 4TYJA 2BIKB 4J8NA 1GIIA 3DLSA 2CLXA 4JJRA 4AOJA 3R8VA 3Q04A 4D2SA 3MB7A 2WTIA 3QZFA 4QYHA 3DXQA 3OF0A 3V5TA 2ITZA 3FQHA 3AKLA 2XIXA 4D4YA 4YGAA 3QLGA 1YHSA 4XBUA 5H9BA 4K33A 4E7WA 5A4EA 4AA5A 2UW6A 2YITA 2ERKA 5E92A 1UU8A 3GC7A 3KA0A 4NZWB 5F94A 3WF9A 5HLNA 2I0YA 4PX6A 3OWJA 3MPTA 3MIAA 4RRVA 4BBFA 4W9XA 3AC2A 3FLNC 3QKMA 3TMOA 2WKMA 2WFYA 3GFEA 4WRSA 5ETCA 5AIKA 3KB7A 3ZEWA 4O21A 1NY3A 2X2LA 3V5PA 4XP3A 3VAPA 4E5WA 1OL2A 4W9WA 1FVVA 2ITTA 2X2KA 4FT0A 3EL8A 4XP2A 3QQGA 2C3IB 3C4WA 4DHJA 2XEYA 3ENMA 5CAQA 5I9XA 5LVNA 3V8WA 4JDKA 4RVLA 4JRVA 5BX0A 5FTQA 2OK1A 3OC1A 3UQCA 4YTIA 3KVXA 3GU6A 3R1SA 5CSVA 3NRMA 3ODZX 1JNKA 2QR7A 4EOOA 3ORLA 3L9NA 2VZ6A 3M11A 2RFDA 5HO7A 1L3RE 4XG9A 3MPMA 4D2VA 4AU8A 2YCFA 4RA5A 2VWWA 1S9IA 2XEZA 1JVPP 3VBVA 4UZHA 1Y6AA 4Z7HA 4MQ2A 1H27A 2PE1A 3ZC5A 4Y46A 1M7QA 4RX7A 2F2UA 3HL7A 3OXTA 3E62A 4MAOA 5EI6A 1ZMUA 3RWPA 4BDBA 2O63A 4QP6A 1JQHA 4B8LA 1RJBA 3KMUA 2F7XE 3OCTA 2XNOA 5AUVA 5KX8A 2CCHA 3PVUA 3PXFA 2ZOQA 5AV1A 4USDA 4CD0A 3O50A 3OFMA 3PJ2A 1PXJA 4J1RA 2QKWB 1PXKA 5AUWA 1ZLTA 4BI2A 4F70A 5AA8A 4FBXA 2WZJA 3QZGA 2WEIA 1KSWA 2VNYA 1M2QA 2C69A 4YJUA 4G3CA 4NJDA 1V1KA 4GK4A 4MD7E 5J1VA 2C5YA 3V3VA 5KKRB 5K4IA 5AWMA 3PVWA 4MD9E 2FSTX 4F9BA 1JLUE 2C47A 5BVKA 3GCVA 3OWLA 2V7AA 4AACA 5FXSA 5KZ0A 3FE3A 4GCJA 2J50A 5HNGA 2CSNA 3NIEA 4AGDA 1NVRA 1WBTA 5BVWA 4D2WA 5BYYA 5CEOA 5I4NA 5KUPA 3HV6A 1OIUA 3MVMA 2X0PA 2ERZE 4YZDA 3V5WA 3H0YA 3PY0A 3MESA 1ZOHA 3DK3A 3IOPA 4N6YA 5HZNA 1KUTA 1XH8A 4FZAB 4ACDA 4E73A 4NL0A 5AP0A 3TDWA 2YN8A 4XG2A 4FV6A 4J8MA 5KMMA 3ATSA 5BVDA 3W18A 2NYAA 3VJNA 4YMJA 1ZRZA 4OR5A 3GOPA 4HZSA 4R3CA 2JFLA 5IQDA 2PTKA 4L7SA 2YM4A 4JL9A 5J8IA 4NW5A 2Z02A 3Q5IA 3S4QA 4DEIA 4MNFA 3KFAA 4W4YA 3NCZA 5LVLA 1YDRE 3IW6A 3ZBXA 5BVFA 3GC8A 5KMOA 1Q8TA 1WBPA 3CEKA 4ANOA 4JDJA 5M4FA 2VWXA 4YTHA 3O96A 3NWWA 4G17A 1OBGA 4PL4A 3R8UA 4OLIA 2PYWA 2OGVA 2W96B 3R6XA 3RK7A 2A98A 2W1FA 4FE2A 3A7JA 4PL3A 3BKBA 3QYWA 4LRKA 1CMKE 3PRIA 5AA9A 3IW5A 4J52A 4Y73A 2R3QA 4BHNA 4F4PA 4V05A 4TW9A 3A7FA 3V01A 3Q9YA 4DLJA 4GKHA 5EHYA 4AT5A 4EC8A 4CFWA 4G16A 4EL9A 1OGYA 4FZ7A 2R3GA 2CLQA 4MWHA 3PPZA 4JAJA 3QD3A 2XUUA 4GSBA 4MQ1A 1PKGA 1W7HA 2BRMA 4FTIA 4QEBA 1XO2B 2GNLA 3RVGA 2F2CB 3DAJA 2BVAA 1H1SA 4DBXA 3FSFA 3D14A 4I21A 3UDBA 3ZDIA 1M2PA 4BWXA