3CKXA

Crystal structure of sterile 20-like kinase 3 (mst3, stk24) in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
279
structure length
276
Chain Sequence
PEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Crystal structure of sterile 20-like kinase 3 (MST3, STK24) in complex with staurosporine.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 276
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ckxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ckxA01
3ZEWA 2YZAA 5KZIA 5LMAA 2X8DA 5DGZA 3RAIA 3RHKA 5CEOA 2IZTA 3BQRA 5J8IA 2X7FA 4V04A 4O22A 3B2WA 5CVGA 5L4QA 2PUNA 4EOJA 1PMVA 2VU3A 2UZNA 3KRXA 4UMPA 4CD0A 1J91A 2BZKB 3MB7A 4C2WA 3FKNA 4QT1A 5AUTA 2V7AA 2X4ZA 3C0HA 3UOLA 5AADA 3E92A 4PPBA 3CBLA 3LLAA 3NCGA 2XNPA 5ANOA 5HNBA 4I5MA 2R2PA 2YFXA 3VS6A 4Z16A 3W8LA 1FGIA 1IG1A 3ZO4A 5IDNA 4DBNA 2W06A 4D9UA 3D94A 3U6IA 4ANOA 1BMKA 2XK6A 3QLFA 3FMKA 3SV0A 3NMUF 2R3QA 3HV3A 3A7JA 2XCKA 1CM8A 3PPZA 4EUTA 2H34A 5KMKA 5CANA 4FT7A 4FKSA 5HKMA 2QG5A 2Z7SA 3TJDA 2I6LA 5LQFA 3EN9A 4A7CA 4O0VA 3LXKA 5HIBA 4D4RA 3GFWA 3HV7A 3FL5A 5KBRA 4GUBA 4NU1A 3VQUA 5FLFA 1U5RA 3AMBA 3KXGA 3WF6A 4ASXA 4L67A 4ALVA 3A99A 3MI9A 4G3EA 3IS5A 5G1XA 4JG7A 3W16A 3D15A 5DG5A 4BCHA 3HRBA 3BE2A 3WBLA 3ZH8A 1UA2A 2WHBA 2QOCA 4P5QA 2YN8A 3QKKA 3NS9A 3Q9WA 2XP2A 4X2GA 4IAZA 3H4JA 2VGOA 1JKLA 4X3FC 3GT8A 2R3LA 2BZHB 1XJDA 3MWUA 3QD3A 4QYFA 5AR5A 3DB8A 4DHFA 5CXZA 4D2TA 2BVAA 3F7ZA 3ZZEA 5CSXA 1NXKA 5LVLA 3R9OA 2C5VA 1YOLA 4XG3A 4ZIMA 5IA1A 1CSNA 4ERWA 4FNZA 4C4FA 2PUPA 5IEXA 5EDRA 3QQGA 4BZDA 1URWA 3C51A 5GJGA 4DGNA 1PXJA 3MIAA 3QCXA 5HD7A 3VJNA 3VNTA 4NEUA 4AGCA 4FKTA 4CQEA 5KNJA 1IRKA 4HYIA 5CZIA 4H3QA 3VHKA 4M12A 3KN5A 4YZMA 3IGGA 2A0CX 4A06A 1APME 3BHUA 4K2RA 3ODYX 2R3KA 4N4SA 4Z3VA 2DQ7X 5I5ZA 3F69A 5ETIA 4DN5A 3TTJA 5L3AA 3U9NA 5AM6A 3FLQA 3H10A 5IA2A 4A07A 1Q4LA 2VN9A 1F3MC 3P1AA 3KN6A 5JRSA 3ZXZA 4DLJA 5M4CA 4HGLA 4XS2A 4DH1A 5DPVA 3ZSHA 4EZ7A 4MF1A 2BRBA 5HOAA 5GNKA 3ET7A 3AD4A 4I6HA 2XH5A 3R28A 4RIYB 4BICA 5AAFA 4BFMA 5K5NA 3S1HA 5ANIA 4B4LA 3KKVA 4FIHA 4EOLA 4RWJA 5CQWA 2XYUA 3FI4A 5CVFA 4F65A 3UNZA 4DCEA 3VAPA 3R2YA 4YTCA 2DYLA 2ESMA 1FBNA 1H8FA 4C02A 3LMGA 3H30A 5CI7A 4YHJA 5JGAA 2HW6A 4QYGA 1QCFA 2O5KA 5M07A 2UZWE 3BV2A 2VWYA 4S2ZA 3W2CA 3SQQA 3HUBA 2WOTA 3ENMA 3FKOA 4XX9A 4O86A 5EHLA 2VNWA 3RINA 3VF9A 1YXTA 4O0WA 5LMKC 2JDRA 4LV8A 5CALA 4MCVA 2ITNA 1M52A 3PUPA 4FK3A 4ZJJA 4F1TA 2ZOQA 2GDOA 1A06A 1W7HA 3EL8A 4IZ7A 4RC2A 4BDGA 1JAMA 4BCIA 2HZ4A 2P33A 5CAOA 4LRKA 5DR6A 5AUUA 4P5ZA 1NW1A 4DAWA 1WCCA 2ZV2A 4BN1A 5M51A 3U6JA 2J0LA 1IASA 3R7VA 4X6QC 4F64A 1XH9A 4MXYA 3SA0A 4PP9A 1YI3A 3BKBA 2YAAA 5GZAA 4G34A 3UQCA 2XNEA 4EOIA 3NW5A 3CJFA 5DMZA 4DTBA 4NH1A 2JD5A 5CEPA 3UE4A 2DUVA 5TE0A 4NZWB 4P7EA 4C4GA 2OIDA 3ZHPC 4E3CA 2BRMA 4L3PA 3PXFA 2CHLA 3FXZA 3OCTA 1OIRA 5E8UA 2X9FA 5A4EA 5L2WA 2A19B 4CNHA 3BEAA 3R21A 2WAJA 3TKIA 2X8IA 3OUKA 4Z55A 3MYGA 3D9VA 5CT7A 4QNYA 4QTCA 3F6XA 2WD1A 3FBVA 4XBRA 3DZOA 3C7QA 4YP8A 4BGQA 4C3FA 2OK1A 3ETAA 4HGTA 4DFZE 2SRCA 2BHHA 3LFEA 4FKUA 4I23A 4JR3A 4L3JA 4ZY6A 3EN6A 4J98A 4ACCA 4RJ6A 3WIGA 1H1WA 1OL2A 4O6LA 2O65A 5IUIA 3ZLWA 1IAHA 4EOOA 2Z7QA 2PZPA 4G3GA 4CFUA 2J5FA 4OTIA 4FSQA 5DWRA 3KULA 2EUFB 4E5BA 4UALA 1MRUA 2B9FA 1H1PA 3PY1A 3RK9A 3EQCA 2O3PA 2BIYA 3G0FA 3OWKA 3Q4UA 3IW6A 4LOOA 3PP1A 4A9YA 3VJOA 2V22A 3KXXA 5CLPA 4DG3E 4O7RA 4LGGA 5GIPE 3SX9A 1KV2A 1REJA 4QTDA 2OW3A 1ZZ2A 2PVJA 4PL5A 4QP9A 2HY0A 3PE1A 1VR2A 3G0EA 3CP9A 3QGWA 2PVMA 2GPHA 3RAKA 2FSMX 3DK6A 4K77A 3NYVA 5HLPA 3BLQA 1CKPA 3NSZA 4J8MA 3EWHA 2PMIA 1H25A 3Q60A 4AT4A 3TI1A 5EKNA 1M14A 4OTGA 2Y0AA 3VWAA 4B8LA 4CT1A 5HG5A 3RK5A 4ERKA 3DBQA 5I0BA 4WRGA 5E91A 3HMNA 5G6VA 4XG9A 1XH7A 3RWPA 4FYOA 3A4PA 1WBSA 4PMPA 5IDPA 3QQHA 1G3NA 2UW6A 5L8KA 4AZSA 2PVRA 3KMMA 1JSTA 2GQGA 3ORLA 3QCYA 3LFDA 3BCEA 1NVRA 3V5LA 1M7QA 1WBWA 4F6UA 4ZZNA 1BUHA 3OVVA 3FXWA 4E20A 3IOKA 4YJQA 4RLLA 2F7XE 4Y5HA 4CMTA 2C1BA 4CMUA 5C27A 5IPJA 1FGKA 3G9LX 4W8DA 4IVAA 4JG6A 1H26A 3ROCA 3SG8A 2ACXA 1HCLA 2W4JA 3DTCA 5J87A 2ETRA 4E73A 1UU9A 3MY0A 5EYDA 2X8EA 3A7IA 4I3ZA 3BWJA 4L7FA 4WHZA 5CI6A 5FXSA 1OKVA 4JBVA 5HCXA 2O0UA 3RTPA 4JIAA 4FSZA 4GK3A 4QMOA 2W9ZB 4ACDA 4EHZA 2YLFA 2VWXA 4BDBA 4MTAA 4RZVA 4G5PA 4A9RA 2ITPA 3UJGA 3UOJA 2I0EA 2ONLA 2ERKA 4JDHA 5I4NA 4FEXA 3S3IA 2A4LA 4EYJA 2PPQA 4CYIA 4LMNA 4U80A 5EK7A 1XBCA 3TL8A 4DTKA 4FT5A 5HTIA 3QRTA 5AUZA 4GYGA 5EW3A 2QKRA 5CS6A 4HNFA 3MFUA 4O0TA 1U59A 4JG8A 4XLIA 4GU6A 2RG5A 3SXSA 1YWRA 3ID6C 4QOXA 3LAUA 3RPYA 3CD8A 4BKJA 4FIIA 2W17A 3U9CA 4UZDA 3R7UA 4WKQA 2R3IA 3DB6A 3KMWA 3NRMA 5FEDA 2W1GA 5AX3A 3KF4A 3TNPC 4MXZA 3EIDA 4DE4A 4F9YA 3HGKA 3NYOA 3EFKA 3ACKA 5HE3A 2JC6A 3NNUA 4AW0A 4D2PA 3MH3A 4FKRA 1GIHA 3LCOA 3VW8A 3R63A 4GT4A 4A9TA 5DT0A 2C3JA 5BMMA 5EI8A 4B99A 5B2MA 1XH6A 5CEMA 4RG0A 4WG4A 4ASDA 3W2RA 3C50A 3NUNA 3AT2A 4O38A 4GVJA 3UPXA 2CKEA 3GEQA 3KRJA 5CU2A 2FSOX 4ANQA 3D2IA 4R7BA 1KE6A 2BRGA 2J6MA 2JGZA 4NW5A 4Q5HA 3FMJA 5HQ0A 2J4ZA 4EH8A 4PNIA 3NNVA 4XV1A 3ZBFA 4FGRA 4TYHB 1J1CA 2F2CB 2GTNA 3AT4A 1UNHA 3V04A 4CRLA 3EL7A 5J1VA 1Y57A 3GBZA 2VWZA 3PTGA 3PXRA 4S30A 3F5GA 4X0MA 5AUXA 4WUAA 2PL0A 3PSBA 2C30A 4TTHB 4AGUA 1ATPE 3NYXA 3O71A 3EH9A 4OTFA 5HIEA 5T3QA 3PY3A 4PTCA 3S0OA 3MVMA 1YXVA 2JKKA 4DFXE 1OGUA 2BAKA 4U40A 4CCBA 3ORTA 1A9UA 4PWNA 2QHNA 3TKUA 3BYVA 4YBJA 4B7TA 2XNGA 4IFCA 4WSQA 3ZDIA 4UWCA 4QQCA 3AXWA 4KIQA 4X2JA 4UN0C 2PVFA 4C4HA 3BEGA 4DH7A 2YEXA 3PG3A 5M57A 5T6KA 1KE7A 5CX9A 5FTOA 4BWKA 3DXQA 4ZTSA 3EN5A 1ZYSA 4CT2A 3ZLSA 1MUOA 5BVKA 4TL0A 2WU7A 1NA7A 2B9JA 4HPTE 5CU3A 4AE9A 5JGDA 3BHVA 4OGRA 2AYPA 4ZAUA 3OUNB 3A2CA 1OMWA 4WBOA 4RX7A 4IIRA 4L42A 5B2KA 5JFXA 4H05A 2FGIA 1WBVA 4NM7A 3GC0A 2YDKA 2A1AB 4HCUA 3GUBA 4P2KA 4S34A 4DFYA 4DLIA 3PSCA 5A46A 4PDYA 3MH0A 4RFMA 4AGDA 2BDWA 2UVYA 3I81A 3KVXA 3QTUA 4EC8A 5KHXA 3EYHA 4WNMA 5DOSA 4TWCA 4NL0A 2C3IB 5DE2A 5DEWA 3ATSA 3I79A 3SRVB 4H58A 3C4ZA 4S31A 4LV5A 3OOMA 4NCTA 5FBOA 3QRUA 4QTEA 5EG3A 5HE1A 3FZRA 3QD2B 3TWJA 4DH3A 4GVAA 4YZNA 2XCHA 3GU4A 3LFFA 2IVTA 3BU3A 4AT5A 4LMUA 1R1WA 2VWVA 3NPCA 3OROA 3Q53A 3HX4A 4TWPA 2I40A 4TWNA 4I6BA 5HG9A 3UMWA 4BCMA 3G9NA 4IAIA 4J96A 2X2MA 2EVAA 3QTWA 2WTDA 3R0TA 5EYCA 2LAVA 4EI4A 5HZNA 2RIOA 1IA8A 5GJDA 1ZOGA 3BRBA 3CE3A 4GKIA 4HVDA 3CGFA 3V5WA 1W83A 4D9TA 3JXWA 3CCNA 1IR3A 3IQ7A 3I60A 3OCSA 2WMBA 3U4WA 4R1YA 3P0MA 5BVNA 3F7WA 2YJRA 3PA5A 5FEQA 3MESA 1U54B 4WIHA 3VQHA 5KMJA 4N57A 2G9XA 3HP5A 4YURA 4E4LA 4FUXA 3CR0A 4X7QA 3OF0A 3V01A 5HTBA 4D5KA 5AMNA 5H3QA 3H9OA 4ZXTA 5DLSA 4I0RA 4YR8A 4APPA 4B0GA 1Q8WA 2XNMA 1J1BA 3Q6WA 2HZIA 3GVUA 4JQ7A 4RPVA 2VTLA 3KEXA 4QMTA 4XV3A 3ZBXA 3KXNA 2C3LA 3VIDA 3RM6A 3R1YA 5LWNA 3FI3A 3H0ZA 4ZTLA 3QTQA 4FSTA 1MRVA 3Q5IA 3GU8A 4LUEA 4IVBA 4FG8A 4G3DA 4XYFA 3TT0A 1ZMUA 2WQOA 4FL2A 3EFLA 3IK3A 1KSWA 3Q4CA 2ZM1A 2YCQA 3FI2A 5J9LA 1JKKA 4FL1A 1JSUA 2WTKB 3MV5A 2C6TA 4FV1A 3QD0A 3TV6A 3RPRA 2YIRA 4JQ8A 2JLDA 4RSSA 3ZSIA 1FOTA 3PYYA 3G90X 2HZ0A 2J2IB 4IM2A 2OH0E 4HPUE 4RIOA 1FVTA 3FV8A 4KSQA 4OLIA 2OG8A 2I0YA 1OM1A 3R7IA 1KE5A 4QMNA 3ZUUA 4LGHA 4L00A 2QU5A 4PDSA 5K0XA 2ITZA 2P55A 3REPA 3AC4A 5JT2A 3NGAA 4WBBB 2BKKA 4MKCA 4V0GB 3WZUA 4HVGA 3ZFXA 3ZU7A 4EZ3A 3U55A 2ZM3A 4BDJA 3RWQA 2BTRA 4QTAA 1P14A 1XBAA 5BVEA 4G5JA 3TACA 4JJRA 3RVGA 2XRUA 4R78A 4J97A 2A27A 3QCQA 5ANDA 2UW5A 2YCSA 4EWQA 4F9CA 1SNXA 3LFAA 3L9LA 2H96A 4MD9E 4XRLA 1W98A 3HV6A 2C69A 3I0QA 2ZDTA 2BDJA 4GL9A 1V0OA 3ORXA 4FTUA 4U81A 4WNKA 3O2MA 5EH0A 3GXLA 4E4MA 3BYUA 2UVZA 2C0TA 3QALE 4FSUA 2OXYA 4O0YA 4FKVA 3ZLYA 4RWIA 4PTEA 4L68A 3MW1A 4BCOA 4O0XA 4IC7A 4M69B 3UBDA 1Q62A 3VS3A 5AEPA 4AAAA 2JDOA 3LW0A 4K1BA 4M0YA 4E5WA 3RCDA 5EM5A 3AD6A 2NRYA 4KIKB 4AW5A 1YKRA 4CVAA 5A14A 1H1RA 5DRBA 3DK7A 3FLSA 4FKQA 3WF5A 4WA9A 1XQZA 2NPQA 3PIXA 4AA4A 3ZMMA 3OTUA 4DYMA 5KCVA 2ZMDA 3EN7A 4H3BA 5HNIX 3COMA 5AX9A 5D7AA 3NUSA 3PWYA 4Q5EA 4LYNA 3FPMA 3OBJA 4QRCA 3OT8A 3BU5A 5BPYA 5HESA 2G2HA 4ZSLA 3D2KA 3SC1A 4XRJA 2RF9A 5L6OA 4IX3A 3WE4A 2R64A 3TM0A 1Y6BA 3BLRA 4FR4A 3H0YA 4YC3A 3BE9A 4QMSA 3PA3A 2CDZA 3T9TA 3V8TA 3OXZA 4ZLYA 3JUHA 5HORA 4X21A 5CENA 4R7IA 3OOGA 3LXNA 2Z2WA 2WTCA 4EOKA 2JIUA 2PE2A 1REKA 1SYKA 2R3MA 4OT5A 3RM7A 3TTIA 3ZC6A 1UV5A 4O21A 2P2IA 4PMSA 4RX9A 3VS0A 5BX0A 4KUJA 5HHWA 2AC3A 2ZMCA 4C3PA 4JX3A 1IEPA 1LEZA 4I21A 1XR1A 2WZJA 3E3BX 5DT3A 5EQYA 2YIWA 1PMUA 2UW3A 5IISA 4F1OA 2YDIA 3OCGA 4WNPA 1ZYJA 4FV0A 4EOSA 4F6WA 3IW5A 2YM6A 4X3JA 2YJSA 3OS3A 3QAME 3V8WA 3ZSGA 4E6CA 3ZRKA 1MRYA 1QPDA 3GFEA 3FHRA 1XHAA 3P86A 2PE0A 4MNEB 4OTHA 4XCUA 3RCJA 5HU9A 1S9IA 5HO8A 3KY2A 2F57A 4UYNA 3AT3A 3OEZA 4RC4A 4QTBA 4RIWA 3TG1A 3WYYA 5E9EA 3SLSA 3UO5A 2W5HA 5EFQA 1OZ1A 3UQGA 4RX8A 4HW7A 5B0XA 2F4JA 4HGSA 4YZBA 3VS7A 4O7LA 3HVCA 5CSPA 3PVBA 3VBVA 3DY7A 2AC5A 3ODZX 4NK9A 4A9UA 5AWMA 4M68A 2CLQA 3BU6A 3UQFA 4KRCA 4FI1A 3FLYA 2OJFE 2HWPA 2NP8A 3UG1A 4QMVA 4WSYA 3SW7A 3VBYA 2XUUA 4FX3A 3KQ7A 3PDTA 3MIYA 4FEUA 4IZAA 1YHVA 4TWOA 3BBWA 4GEOA 4BBMA 3DV3A 4I24A 3ITZA 3E7OA 3ZM4A 3NUAA 2B55A 2ITTA 1IAJA 3HDNA 2YM8A 2GFSA 4EQUA 4M97A 1Q8ZA 4FF8A 4U0IA 2UZVA 5LVPA 4F9WA 4OW8A 1T46A 4D4VA 5IA0A 4N6ZA 3RHXA 5BQ0A 3RZFA 4RT7A 4FE2A 2WTKC 4FEQA 3LCSA 3NUUA 4AOTA 4PNKA 2WU6A 3GU5A 4ZY5A 1OL7A 3E88A 4K9YA 2XKEA 2WMVA 5CTPA 3T8OA 4BL1A 4BYJA 4C58A 3QTRA 4EOMA 2EB3A 3MA3A 1LP4A 1VYWA 4MNFA 3RI1A 4TYIA 3OY1A 1YW2A 2X2KA 5CSHA 3O0GA 1DAWA 3CXWA 4BHZA 3KRLA 5AP0A 1P4FA 2OZAB 3AC8A 4EZ5A 1PKDA 2X7OA 3E8NA 2QOFA 5A3XA 3EKNA 3SOAA 3Q3BA 1T45A 3I7CA 1Q8UA 3PSDA 4FTIA 3OP5A 4IB3A 5M53A 1KE8A 3FAAA 2QOOA 2VX3A 2LGCA 3UYTA 2X6DA 3CTQA 4KS8A 1DI8A 2H8HA 2RKUA 3L1SA 3QYWA 1LR4A 3PJ3A 5C26A 2DWBA 3DT1A 3FYJX 5AR3A 4BTJA 4ITJA 3BGPA 5ANJA 2CGXA 5J1WA 4HGEA 2HYYA 4CYJA 4XP3A 5CF6A 3S00A 4XMOA 5H8GA 3K2LA 4OTQA 5BUJA 5AIRA 3CKWA 2WIHA 4O0UA 5I9XA 1PXOA 1BX6A 5CNOA 1J7IA 4KBKA 2WMQA 4QYHA 5BVFA 3I6UA 2RGPA 2QOKA 2QQ7A 3IOPA 4J71A 4HYUA 4QMZA 5AV3A 2UZOA 4QP1A 3R00A 5EQEA 1U46A 2FVDA 1OB3A 4EONA 3AGLA 4BCGA 3DBCA 4FSYA 2VWWA 4IZYA 2WEVA 3D7TA 1YXUA 3E5AA 4CFNA 2R0UA 3O7LD 2B7AA 4FTQA 4PMTA 3MN3A 4ALWA 3K5VA 3ORPA 4FV5A 3QQFA 4XP0A 3R1NA 4ZP5A 5C9CA 3UGCA 3WIKA 1OKYA 3P79A 5EDQA 2Y4IC 1XH4A 4HJOA 2W05A 2GQRA 4G3CA 4RWKA 3LQ3A 4RIXB 2GS6A 4XP2A 5GZ9A 2QOBA 4E7WA 1B38A 2WEIA 5AAGA 3MPTA 2ITVA 4GFMA 4NUSA 5HU3A 3U51A 3VS4A 3A60A 4G9CA 3DBFA 3BLHA 5DR2A 4EK4A 3OWLA 4BI1A 2X2LA 2X9EA 3R7YA 2ZV8A 2E9VA 2XKCA 2WMAA 4I20A 4CTCA 3FDNA 5M4FA 2PVKA 4GRBA 2PZRA 5L6PA 3HP2A 3ZOSA 4O96A 4RA5A 3R73A 4GH2A 4BCNA 4BTFA 4C4EA 2XRWA 1J3HA 4DFNA 3VBQA 5IUGA 2B1PA 1STCE 3NUYA 4BB4A 4CFMA 5TT7A 4AXAA 3DJ6A 3EQPA 1Z5MA 3LQ5A 4YSMA 1SMHA 3DFCB 4H1MA 3RBWA 5D41A 2W0JA 3CTHA 5F9EA 4O0SA 4NFMA 3WILA 2HW7A 4AFJA 3MS9A 1GJOA 2IZSA 1KOAA 2QO2A 2PE1A 2CN5A 3AC1A 5CVHA 4BKYA 4E5AX 2B9IA 2E9NA 2WMSA 2UW4A 1RW8A 3FQEA 4FTNA 4OTDA 1YI4A 2RG6A 5CEIA 2GQSA 4CGAA 4EH3A 5JZJA 4HOKA 5BMSA 3D4QA 3GCVA 4II5A 3UP2A 2OH4A 2OWBA 3EB0A 3GB2A 5FP6A 5A6NA 2X6EA 4Y5QA 3LLTA 3D83A 4D4SA 4BY9E 4Z7GA 3ANRA 3LJ1A 4YPDA 3UO6A 4AZTA 3QX4A 4QPAA 3D0EA 2Y6OA 2GHLA 5HVJA 3FMEA 3DNEA 4XG8A 4DH5A 5JH6A 1DM2A 1XBBA 2BPMA 2CCIA 2BCJA 4EH2A 2WB8A 5AP7A 5K0KA 4EH7A 4F99A 3LZBA 3Q96A 4IMYA 5AUWA 3FPQA 3GI3A 2BRHA 3RAWA 3TUDA 1VZOA 4JX7A 3RP9A 2WOUA 1UWJA 5FG8A 2UUEA 4KA3A 1QPJA 3DQXA 5KHWA 3CSVA 3ZC5A 3KL8A 3PJCA 3QTZA 4PX6A 3OZ6A 2W4OA 4FL3A 4R1VA 2YM4A 5HG7A 3ULZA 2OICA 3OWJA 3QXPA 1YVJA 4DEAA 2ERZE 4M69A 5M44A 1BLXA 4F7JA 3RPSA 2W4KA 3C13A 4LG4A 3QRKA 3HMIA 4X3FA 2YM7A 4L01A 3W33A 2BTSA 3II5A 1H0WA 2BROA 5JMSA 1OPKA 3UTOA 2J0MB 4H36A 3F5UA 1Q24A 2FA2A 3A62A 3MY1A 5EHYA 2QONA 2V55A 1VJYA 3GQLA 4Y46A 4CFXA 4EQCA 3C4EA 4PF4A 4LRMA 4FKIA 4FTCA 4FZ6A 4O1OA 4RJ7A 3U6HA 3DKGA 1UU3A 4BDCA 1WAKA 3LFQA 4EHEA 4JBPA 1YHSA 3GGFA 1ZYCA 3CJGA 3O8PA 4O0RA 4E6AA 1JPAA 2GHGA 3E63A 3PXZA 4OUCA 5K3YA 5JGBA 3Q52A 3A7FA 3PJ2A 4FSWA 4KWPA 2VTRA 1ZMVA 3QD4A 2J90A 1W8CA 5AJQA 2UZTA 4TY1A 4GMYA 3QRJA 3R8UA 3V6SA 3ULIA 2PZ5A 4B6LA 5KZ0A 4HYSA 4TW9A 2ITOA 4YPSA 5KMLA 4QMLA 3BV3A 2ITQA 2VO3A 3N9XA 4WD5A 1PW2A 3HAMA 3O8TA 2WQEA 3ZM9A 4D58A 4QYYA 2CKOA 4IWQA 3TKHA 4IAAA 2IZRA 3QTSA 3I4BA 2YIQA 4E4NA 3QKLA 3A4OX 4TPTA 4WNOA 5DR9A 1DI9A 2XK8A 4M3QA 3D14A 1J7LA 3KGAA 4NWMA 4FV9A 3TN8A 3VRZA 5A4TA 4FIFA 3UYSA 2YWPA 4W9WA 4CFFA 1ZAOA 4FNWA 3ZRMA 4AF3A 4DITA 2QOHA 3DAKA 5IA3A 5IMEA 1H01A 3WZDA 1YWVA 5DN3A 4NKAA 4FZDB 4HZRA 4XJ0A 3FC1X 4G2FA 5HCYA 4NM3A 5ICPA 2OJJA 1QPEA 4EYMA 2OZOA 3VO3A 1H07A 5LCKA 3BI6A 3DS6A 5ETFA 1ND4A 4D55A 5LMKA 1QL6A 2OLCA 5FM2A 5CAVA 2XK7A 5AR4A 3RALA 4EWHA 1G8SA 3NCZA 2CLXA 3AG9A 4NIFA 4D0XA 5A6OA 3AC2A 5JZNA 2UZEA 4FZ7A 3PRIA 3R2BA 4WT6A 3C1XA 2FYSA 4I0SA 3ZYAA 1P4OA 2I0HA 2YLEA 2BRNA 3PPJA 4B8MA 4NSTA 4F1MA 1KUTA 3CPCA 3QA8A 3QGYA 5M09A 5C8KA 5ANKA 5IA4A 4W4VA 5IQAA 5IQDA 3P23A 2BR1A 4J7BA 1LPUA 3VVHA 3IONA 3G2FA 4YZ9A 3MFTA 4AW1A 3COHA 1KE9A 2ZM4A 2V0DA 4YGAA 3D5XA 2ZAZA 4MEDA 4UZHA 4O7YA 4I0TA 4IM0A 3KK9A 4MD8E 5DHJA 1JKTA 4JR7A 4UX9A 5E8YA 4FZAB 5CT0A 3ACJA 3ANQA 2PU8A 5BVDA 3NUPA 5HBEA 4QMQA 3FYKX 4QQJA 3EFJA 4Y83A 4M13A 1P5EA 5DEYA 5HBHA 4EH4A 1JLUE 2GNLA 4JRNA 4YLLA 2B54A 2XIYA 5IQBA 4DFLA 4GG7A 3F3TA 1XH5A 2VTJA 5IA5A 2VTIA 4EUUA 4X2NA 5AA9A 3BHHA 3FZPA 2ZJWA 4XH6A 2BFYA 4CG9A 2V5QA 3M11A 4BDFA 2YDJA 4GK2A 3W2QA 4AZWA 3O23A 4ZTHA 2XB7A 4IADA 2PMOX 4PUZA 3TNWA 4O82A 2JKQA 2O8YA 1UNLA 3FY0A 4ALUA 1SVHA 3QWJA 2OJIA 4I92A 5IU2A 1UNGA 2XMYA 3PJ1A 3TIZA 4E8AA 5C8MA 4DGOA 3F3VA 4KNBA 1FMKA 4EK6A 1S9JA 3EQHA 5E8XA 3UIUA 5M56A 5BYZA 4G6OA 5T68A 5HX6A 1WBPA 2JKOA 3C4XA 4XG2A 4JOAA 4Q2AA 2ETMA 1PJKA 3ALOA 5AV1A 5CEKA 3RJCA 3R04A 4GFGA 3IO7A 1HOWA 3OG7A 4R3RA 3K54A 3TV7A 3UVRA 3TDWA 2RFEA 3EFWA 5ACKA 1E9HA 4M7IA 2R7IA 4FTLA 5EM8A 2JFMA 5EOBA 3LCTA 1ZXEA 1OUYA 4U79A 1ZY4A 3N4TA 4W8EA 5TOZA 2OI4X 4BHNA 3LCDA 3PVUA 4PQNA 4P90A 3HEGA 3K3JA 2BMCA 4YC6A 2YITA 4H3PA 5EI6A 3WOWA 4CLJA 4Q9SA 4HVSA 4U3YA 5LMBA 5GIOE 2QNJA 3UOHA 2QOIA 4IANA 4I94A 4M84A 4CRSA 4AU8A 1YOMA 2EXEA 1GAGA 4IBMA 2I0VA 3DFAA 4CZTA 4F9AA 1ZZLA 5E1SA 2BZJA 4MD7E 4DEEA 5E8VA 4BDHA 2JEDA 1QMZA 3I5NA 1JSVA 3PVGA 3IECA 4YJVA 3EN4A 3WARA 4A4XA 4D2SA 2UW8A 4TZRA 1YDTE 3C4WA 3POOA 4UWBA 4BWPA 2W1IA 3ATTA 3G6HA 1LEWA 4PTGA 3F5XA 2J0IA 1H0VA 2PZYA 2C6IA 4RZWA 2CGUA 4AWIA 1WZYA 1E1VA 2CMWA 4PDOA 4IHPA 3VUKA 2QD9A 5BYLA 5EI2A 4MAOA 3DNDA 3L8VA 3CTJA 4XUFA 4AW2A 1YQJA 4ZY4A 2C1AA 4KD1A 2WXVA 3QHWA 4FT3A 3WF7A 3NVMB 3Q2JA 3IGOA 4IFGA 3T9IA 3ZRLA 2PUIA 2R0IA 1GY3A 3OXTA 4MWIA 2WNTA 4RIYA 4DBXA 2HXLA 4EKLA 3QCSA 3IDBA 2FH9A 5FXRA 3LOKA 5EM6A 1ZMWA 3OEFX 4IX5A 1OIQA 4I5HA 4U6RA 1BL7A 2IN6A 3DU8A 2P3GX 5J79A 2QCSA 3FMDA 3Q9YA 4FG9A 4GG5A 5AA8A 3DA6A 1PXIA 3OY3A 4W4YA 3E8CA 3SDJA 2HIWA 3KU2A 4L8MA 2X4FA 4TKSA 1OKWA 3UVQA 4DEGA 3NVKI 3P5KA 4PPAA 1R0EA 1VYZA 4FTRA 4U8ZA 1TQPA 3FZOA 4KIOA 4QNAA 5D11A 1J7UA 4BKZA 2WKMA 3O96A 1Q97A 2XJ0A 2BFXA 3ORIA 3LMHA 3MDYA 3HECA 1P2AA 4OBPA 4LL5A 4IEBA 4IAKA 3LM5A 4AGWA 1BI8A 2PVHA 5E8SA 4AG8A 2ITUA 2XK4A 3FMNA 3LPBA 1AQ1A 5J5SA 2I7QA 2WO6A 3O17A 2VZ6A 2XIXA 2WQNA 3RZBA 4ACGA 2W5BA 5HEZA 4YHTA 4JS8A 2ITWA 3SAYA 4UB7A 3R8ZA 1PF8A 4NM5A 3EHAA 3KMUA 5DRDA 4KRDA 1CKIA 1PXPA 1ZLTA 3TV4A 4K6ZA 2BDFA 4U43A 1I44A 2C6EA 5EKOA 1YOJA 2JBOA 2J9MA 2XM9A 4DEDA 2VX0A 3FZTA 3PJ8A 4QMWA 4Y8DA 5CAUA 4HZSA 2QVSE 1V0BA 4I41A 4CV8A 4JT3A 4R7HA 3FZSA 4F70A 4ZTQA 4KKGA 4TNDA 5AUYA 3W8QA 4H1JA 3P9JA 1UVRA 2Z7LA 5BVWA 1PRYA 2HENA 3AOXA 4XG4A 4C38A 3FLZA 3W2PA 1ZYLA 3KVWA 1NT2A 2VX1A 4NKSA 1WBTA 4K11A 2R7BA 2WTJA 2UZBA 1H1SA 3GENA 4IX6A 1PYEA 3HZTA 3QYZA 1H4LA 4QP4A 1R0PA 4U45A 4U42A 4R3PA 4YJOA 5CU4A 5L6WL 3W55A 2CSNA 5I9WA 4RVTA 4G6NA 4CTBA 3V5TA 3N51A 2IPXA 1PMEA 4FKWA 2CNVA 2X0GA 2W5AA 3QZFA 2XBJA 1WFCA 2CN8A 3UPZA 3OW4A 3AC3A 1G5SA 3BIZA 4KABA 4O81A 4BDIA 4EORA 4GS6A 4MBLA 1WVYA 4M14A 2YWVA 4MH7A 1Q99A 2GTMA 4BTMA 3R7OA 5BNJA 4UV0A 2R3HA 3EKKA 5AV4A 2RL5A 3ZFYA 1ZARA 3RAHA 3TZ8A 1KOBA 5DH3A 1G8AA 3G15A 3CS9A 4GFOA 4W4XA 1I09A 2QOLA 3R22A 4KKHA 4WO5A 5HG8A 2J5EA 3NW6A 4LGDA 1BKXA 4AZVA 3I5ZA 4BDEA 5IQIA 4F09A 3NNXA 2RFNA 3NR9A 5A4QA 4RC3A 3ALNA 2XIRA 3C0IA 4FKGA 3HMPA 4JI9A 1OECA 1JNKA 4QQ5A 4AOJA 4K18A 2EB2A 4GK4A 2C5XA 3FMLA 5CSVA 3LJ0A 2WTVA 3R8MA 3PZEA 4MYGA 2H9VA 1Q8YA 5FUTA 4DT9A 4XNEA 3R30A 3GU7A 4MXAA 4YU2A 2GS7A 2OO8X 2WMRA 4PV0A 4LOQA 5F20A 3TUBA 3MFSA 3R7EA 2B52A 3G51A 4FYNA 3L8XA 4Y73A 3FLNC 4F63A 2Y4IB 3I7BA 1OBGA 2QODA 4ONAA 4LOPA 4L53A 4G9RA 4QP6A 4ZZOA 5HGIA 3ORZA 1PXNA 2CNQA 4F7SA 5HD4A 4RFZA 1Z9XA 4RFYA 3SD0A 3U4UA 4TYJA 3QZHA 3RNYA 1PXMA 3PPKA 3Q5ZA 5AP4A 5FTGA 4ANNA 4DEIA 5KMIA 3TNHA 2XIZA 3Q9XA 5HIDA 1WMKA 4G17A 4XG6A 4D4YA 5JFSA 1O9UA 1FPUA 3EOCA 3TDVA 4WUNA 4K33A 2WMUA 3C4CA 3BYSA 2X7GA 3KXZA 2YM3A 5D1JA 4AT3A 2E9OA 4IW0A 2QG7A 4FBXA 4QP2A 2R3OA 3DXPA 4FEVA 4U44A 3EZVA 4IB1A 4C8BA 1PKGA 4KINA 3AGMA 2O64A 4EHGA 5C8NA 5LXMA 2NRUA 2FO0A 2Y7JA 4FV6A 4BGHA 4EH5A 3EZRA 4U97A 4HVIA 3HRFA 4FKOA 5A4LA 5CXHA 2R4BA 5KMMA 4FVQA 4TXCA 3ZTXA 4DINA 5HLNA 2QI8A 4EC9A 5TO8A 1MQ4A 2WMWA 3TCPA 4O2PA 2ETKA 2RSVA 3JS2A 3ZCLA 2Z7RA 4MWHA 5HE0A 1FVRA 4A4LA 5EW9A 1JBPE 4J99A 4JNWA 4O6EA 2VUWA 4FEWA 3V5JA 3N4VA 3KULB 4UMUA 2GFCA 3OWPA 4O7ZA 5J5TA 3TZ9A 3ZO1A 4PDPA 4BI0A 5L2SA 3KFAA 2OJGA 2OSCA 3I1AA 1V0PA 4FTTA 4IQ6A 5CWZA 5AV0A 3R8VA 3JVRA 2UW9A 4G16A 4YHFA 5E8ZA 3UVPA 3CQEA 4F0GA 3MJ1A 4CG8A 2JBPA 2IO6A 2OKRA 4G6LA 4O1PA 4AN9A 3TUCA 3ZXTA 4BCFA 2HK5A 1VEBA 2C5OA 2VTSA 3RNIA 2GCDA 4YNEA 5J7HA 3FI8A 4ID7A 4WG3A 4TYHA 2G01A 4GJ3A 4EH6A 5CZHA 3U54A 4PL4A 1M7NA 2QC6A 3R83A 2ZV9A 4RQVA 5M4IA 5CNNA 1M17A 5A54A 1L3RE 4FNYA 5IQFA 2PVYA 2J7TA 2W96B 3UC4A 4FTJA 4FT9A 3FMMA 1NVSA 2I1MA 1GIIA 4QMUA 3RMFA 3R1QA 3QA0A 4ZSJA 5BUEA 3HDMA 3C5UA 5ETAA 4NJ3A 2H6DA 1OL1A 2PTKA 3S95A 1ZY5A 4I93A 3LCKA 3U8WA 2UV2A 1PXLA 5FGKA 3T3UA 4M67A 3Q04A 4I4EA 3MPMA 3QFVA 4KSPA 4QPMA 3DKCA 3HMMA 4FMQA 3COIA 4GU9A 2Z8CA 3ELJA 5HLWA 2Y8OA 1RE8A 2PVLA 3GQIA 4GIHA 4LFIA 3OFMA 1HCKA 3NX8A 4U7ZA 3VRYA 1Q3DA 4BRXA 2A2AA 2IZUA 2C5NA 4R8QA 3ZUTA 5HVKA 4BYIA 3H3CA 2HWOA 4YLKA 3UO4A 1XO2B 2QLUA 3F9NA 2GNGA 3JY9A 5I9ZA 2XK3A 4DFUA 3LFBA 1XKKA 1K3AA 4IB5A 1JQHA 4CLIA 1W84A 3E8EA 4BI2A 2F2UA 1XWSA 1AD5A 3OMVA 4QD6A 4Y95A 3I0OA 1OL6A 1UWHA 3NIZA 3ORNA 3FY2A 4AZEA 5FBNC 2OIBA 3PWDA 4J1RA 4GUEA 5CU0A 3F61A 2PMLX 3GC7A 5EOLA 3BQCA 5AP6A 2DS1A 2QURA 2YIYA 3SRVA 4MBIA 3VHEA 4NFNA 4MXXA 5AUVA 3DXNA 5HICA 3ZDUA 5LVMA 4R77A 1UU8A 5D10A 3FL4A 4O83A 1JKSA 3M42A 2C6LA 4XLVA 4JRVA 4YJPA 5KMNA 5HO7A 5DIAA 3V3VA 3AD5A 2CGWA 5CASA 4O84A 3VS1A 5FWKK 4OTPA 4FV3A 2OFVA 2R3JA 3D5VA 4IZ5A 5ACBC 4UMTA 3RGFA 3PA4A 4RWLA 3KB7A 3VUTA 2Q0BA 5J9YA 4RGJA 3VUIA 1BL6A 3BGQA 1TKIA 3EQDA 3PFQA 1X8BA 3BYMA 3LFSA 4C4JA 1H1QA 1BYGA 3NAYA 3KF7A 3QRIA 3V51A 4ENXA 4ANLA 4EK3A 3B8QA 4QP8A 4XOYA 1OPJA 5IG1A 2PZIA 2WQBA 4R6VA 5E1EA 5LARA 2QHMA 3AQVA 1U54A 5ETCA 2OXXA 3FKLA 4FUYA 1FVVA 1OIUA 4L44A 4IWPA 4NTTA 5D9HA 4BZOA 3HA8A 2GHMA 3QQUA 2Z60A 4QP7A 5M4UA 2FSLX 3SVVA 1TVOA 4BTKA 2BAJA 2QO9A 3QZGA 5DA3A 4DC2A 4C62A 3DLZA 3R7GA 5LJJA 5CEQA 3QU0A 1JVPP 4JDJA 3FSKA 1O6KA 4CFWA 3LE6A 3GP0A 5HVYA 4V05A 4AACA 2CKQA 4ANMA 3MSSA 3NNWA 1NVQA 4FTKA 4UXQA 3NWWA 4L9IA 4ARKA 5L2QA 5GJFA 4FV7A 4F7LA 4YJNA 2Z02A 3CGOA 3KREA 3HL7A 4O27B 5LWMA 2QR7A 3FJQE 4GIIA 5K4JA 4O7TA 3BPRA 2JAVA 3K3IA 2IVVA 2XNBA 4ORKA 4CCUA 2C6MA 4DT8A 3GC9A 2OF2A 3WE8A 2W1CA 5AP2A 4DGLC 1H08A 3FE3A 3QX2A 2AUHA 4OR5A 1SNUA 4ZEGA 2VTOA 3P7CA 1SVEA 3B2TA 4BDKA 4MQ2A 5HCZA 3VBWA 1SZMA 1UU7A 4CSVA 5KKRB 4CV9A 2XZSA 5FDPA 4ZMFA 2Y6MA 2GNIA 2VGPA 5JQ5A 5AV2A 5HNGA 1PMNA 4D1SA 2VRXA 2IG7A 4EKKA 1R3CA 2VTQA 3LIJA 5AP3A 3IKAA 4JQEA 4ZZMA 4FODA 4V0GA 2ZDUA 4XG7A 5AM7A 3HMOA 2OGVA 3NLBA 4C37A 3D5WA 3MH1A 3E8DA 1LUFA 4BIEA 5LOHA 3D7ZA 4E93A 2PVNA 3A61A 4GT3A 3PIZA 2XNOA 4D2VA 3OW3A 3HA6A 2XBAA 1YDSE 4YLJA 1PHKA 2JDVA 4FV8A 4C36A 5HE2A 2WPAA 4LQMA 4FIEA 2FUMA 3S2PA 3ZO3A 4J95A 2R9SA 3EQFA 4XOZA 4EEVA 2VTTA 4XHKB 4BWXA 3R02A 3KA0A 2JDSA 4QO9A 4TNBA 4D2RA 5HO6A 1ZRZA 5KBQA 4DA5A 4L52A 2CCHA 3IW4A 4FSRA 5GINE 1W82A 4ZS4A 3ROYA 4ZJVA 5GHVA 4PMMA 3MVLA 3HYHA 2B53A 4W4WA 4EK5A 4RRVA 4YUQA 2X81A 4F6SA 4YO4A 1Y8GA 3TNQB 4QMYA 5E92A 5IEYA 3HRCA 3DKFA 4KIKA 4YO6A 3RK7A 5LCJA 4ITHA 4RVKA 3T3VA 5TR6A 2KULA 4IE9A 4ASEA 4CMOA 3E87A 2R3PA 2W1EA 4MHAA 4U41A 2E9UA 2IJMA 3UOKA 4RQKA 5IKWA 5HTCA 4ZLOA 4ASZA 4BC6A 4BR3A 5F1ZA 2BHEA 4FA2A 3CKXA 3RKBA 3C4FA 4G31A 4G3FA 4ZTNA 3PP0A 4C4IA 3EMGA 3PXKA 4N0SA 3P78A 4JDIA 3BX5A 3R6XA 4CKRA 2ITXA 4FOCA 4FSNA 3SXRA 1OI9A 5A9UA 2WTWA 4MQ1A 2ONLC 2OU7A 4IC8A 4NTSA 5E90A 3VS2A 4I22A 3DDPA 2YACA 4FK6A 2JITA 4S33A 3DBEA 2WGJA 2VV9A 4XV9A 1NY3A 2F9GA 4IXPA 1TQMA 4DTAA 1H00A 2HAKA 4V01A 2JFLA 2XKDA 4L6QA 3F66A 2CJMA 4FC0A 4LM5A 2PUUA 4N70A 2P2HA 4RBLA 4L46A 3GCUA 3PIYA 3OTVA 2VTHA 5FEEA 5KE0A 4ZTMA 1YWNA 4FIGA 4DEHA 4QYEA 1ZOEA 3DJ5A 4BCQA 3OD6X 3MVHA 1DS5A 3IG7A 2C3KA 5IH6A 4CZYB 4EOPA 4IDVA 4JAJA 4WOVA 5CY3A 5IEVA 3W2SA 1OUKA 3P7AA 4JL9A 4BBEA 5AFVA 3MY5A 3QTXA 4FVPA 3C0GA 3FMHA 2PY3A 5AP5A 4MNEA 2GSFA 4GJ2A 3LXPA 2W1DA 3ORMA 4GKHA 3TZ7A 2XEYA 4FNXA 4UXLA 3V5QA 4AUAA 4R5YA 3G6GA 2YHVA 1R78A 3EYGA 3TZMA 2F49A 4LRJA 3JPVA 5IQEA 3VN9A 3ZS5A 2ZYBA 3R71A 3OC1A 5DVRA 3JY0A 3Q2MA 5AR8A 4C59A 4EK8A 4Z7HA 2IWIA 4RLKA 3AC5A 3MA6A 3ZONA 2GU8A 3GOPA 4ITIA 3SG9A 4IJPA 5E4HA 4IB0A 3DLSA 4FZFB 3S4QA 5TKDA 2HOGA 2C0OA 5CYIA 5E8WA 3THBA 5CAPA 3F2AA 1RQQA 3DJ7A 5B2LA 3R8LA 2PULA 3IDPA 2ZVAA 3FZ1A 2Q0NA 2OIQA 4F7NA 4QP3A 4RJ3A 3LVPA 3ZFMA 3WF8A 4PP7A 3PE2A 3VUMA 4UYAA 4UY9A 1JWHA 2BZIB 4HCTA 3V8SA 3C5IA 2PHKA 4YBKA 3JYAA 3DOGA 3NEWA 4FSMA 4FVRA 3GNIB 4PY1A 4ZK5A 2XIKA 4F0IA 3UZTA 4NJDA 3CY2A 4DH8A 4MX9A 4HVHA 4O7NA 5FM3A 3O51A 2JDTA 4C2VA 2VO7A 5KUPA 4GV1A 4ZSAA 4RVLA 1Q41A 3R1SA 1DAYA 1GZNA 3QQLA 3DPKA 4IVCA 4L43A 5LVOA 2YM5A 2HY81 4FTOA 4TYGA 2G2IA 4M8TA 5KKRC 5EQPA 2J51A 4RX5A 4AQCA 4EBVA 4F08A 3EQRA 4AFEA 3NZ0A 4E1ZA 5GZ8A 2B0QA 2OZAA 2VTMA 4ZMEA 2WFYA 4C33A 2VO0A 2OXDA 5DNRA 4ZSGA 3W18A 5LVNA 5J9ZA 4FT0A 4IWDA 2YZLA 2Q83A 3QUDA 3ENHA 5J7BA 3QQJA 5JN2A 4IVDA 4DG2E 4OT6A 2G2FA 2JIIA 4AA0A 3RPVA 2W1ZA 3DGKA 2W7XA 1Y8YA 4O7WA 5IQGA 2OF4A 5E7RA 5FD2A 5ANEA 4DGMA 4NCTC 2W1FA 4I1ZA 2C68A 2YCRA 2R3FA 5M08A 4PRJA 4DCAA 3VS5A 3EQBA 3LQ8A 4EL9A 4MK0A 2CNUA 4EJ7A 3E64A 5CF5A 3TIYA 2X39A 2J0KA 3VC4A 2PWLA 4A9SA 4AX8A 4BIBA 4DGGA 2REIA 5H2UA 3BWFA 1YRPA 4BDDA 1MQBA 2V7OA 1SM2A 3E3PA 4AA5A 3QKMA 4EH9A 3MJ2A 2C6KA 5C01A 4ENYA 4DEBA 3E62A 2IW6A 2BALA 3F82A 3PZHA 4K0YA 4EOQA 2GS2A 1FQ1B 4RJ5A 3FHIA 4USEA 1JOWB 1ZOHA 1FMOE 3DTWA 3EQIA 5AR7A 3HV5A 1SVGA 2BUJA 1CMKE 3HAVA 3UODA 1A48A 3WZEA 4RIWB 4KKEA 4ZJIA 3W10A 5FTQA 4YJUA 2E9PA 3DCVA 4QMMA 5AR2A 1Q5KA 4CZUA 4KAOA 1UKHA 4XEYA 3BGZA 2FSTX 4YMJA 4UBAA 2XJ1A 5D12A 3RPOA 1W0XC 2UZUE 4RIXA 1B39A 2PSQA 4IWOA 4A4OA 1YXSA 4D5HA 2R5TA 5BVOA 3TEIA 3ZO2A 3M1SA 3NIEA 1RDQE 1GNGA 2CGVA 2ZV7A 4QMPA 3QLGA 4CQGA 3GCSA 1OIYA 4FTMA 4EHVA 4DFBA 4IX4A 3PXQA 4ZLZA 4Y72A 4KS7A 4XV2A 4JBQA 5CF8A 4NYEA 3UG2A 5B7VA 2Y4PA 1YHWA 2B9HA 4USDA 5I9YA 3KK8A 1O6YA 4GCJA 3ZZWA 3H9FA 2O2UA 2GNJA 2ZB1A 1M2RA 2IW9A 3VW6A 2VTAA 2HXQA 2UZDA 2EXMA 4S32A 3KXMA 2XJ2A 3MH2A 3H9RA 2C47A 4BIDA 5DFPA 3E7VA 3FQHA 2X1NA 4FIJA 5JQ8A 1GIJA 5K5XA 5JRQA 3F3ZA 3DAEA 4HCVA 5F95A 3Q4ZA 3CD3A 4AN2A 3B8RA 2BIKB 3QZIA 3UC3A 3F2NA 4D1ZA 4N6YA 3D5UA 3GU6A 4FV2A 5F94A 1K9AA 1WVXA 2VWIA 2YABA 3PVWA 4FG7A 4D1XA 3V6RA 3W1FA 4L7SA 5JEBA 3NAXA 4IAFA 4Z9LA 4MVFA 4YJTA 5AIKA 4TYEA 4GSBA 3LHJA 2Y9QA 5DI1A 4FOBA 4LUDA 5A4CA 3I6WA 3LFNA 3UIMA 4BCKA 1OKZA 2W9FB 2C0IA 3ZLXA 5JSMA 1O6LA 2J0JA 3DKOA 4ACMA 5BUIA 5M06A 2XA4A 4CXAA 2ZB0A 1OBDA 2VWUA 2W1HA 3IW7A 4MXOA 1WBOA 2RFSA 1ZWSA 3ERKA 3Q32A 1U5QA 3QTIA 2IVSA 4I4FA 4UEUA 2QKWB 5D7VA 3WI6A 1KWPA 4NT4A 5I9UA 3NUXA 3E93A 3P4KA 4YTHA 4I5CA 3R9DA 4YSJA 1OL5A 4AN3A 3Q9ZA 4D0WA 4J8NA 3O7LB 5C03A 2VD5A 3L8SA 3FUPA 4G1WA 3MTFA 5H9BA 5L2TA 4F0FA 3QUPA 3R9HA 3QWKA 2NO3A 5FXQA 2ITYA 3D7TB 3LFCA 4X2KA 4R5SA 1ZYDA 3NYNA 2CPKE 2XEZA 3WYXA 1Q3WA 3F2RA 1FINA 3A7HA 1OPLA 4Q9ZA 3G5DA 1Q61A 3FWQA 4HNIA 2CKPA 5C4LA 3FSFA 1OITA 4YZCA 5EYKA 1B6CB 4QQTA 4C35A 4C61A 5KMOA 3HLLA 4RJ8A 3MGYA 1L8TA 2V62A 1XH8A 3UMXA 2C6OA 2XYNA 3L8PA 2NNWB 3P7BA 3COKA 4FV4A 3UZPA 3VF8A 4O7SA 3DDQA 3L9MA 4GT5A 4MXCA 4BBFA 5HX8A 2RFDA 4AP7A 3CLYA 5IF1A 3TXOA 1GZ8A 3SW4A 3OT3A 3OXIA 2WMTA 5IUHA 1QPCA 5EDPA 4BCJA 4BVUA 5JK3A 2IW8A 3CEKA 2VO6A 3DK3A 3FC2A 3DAJA 5I3RA 5JFWA 1K2PA 3WZKA 4CKIA 2HZNA 3LKMA 2G15A 4P4CA 4YZDA 2GNFA 4WRSA 4C34A 2UW7A 4X6RA 3QC4A 4RMZA 4FKJA 2XF0A 4K8AA 4PL3A 4OBQA 3MVJA 4OTRA 3L9NA 4X2FA 4OAVB 2YAKA 3O50A 1WBNA 2W99B 4C3RA 5CSWA 5HI2A 5C1QB 4ACHA 3GOKA 5FRIA 3W32A 4E4XA 5KX8A 4GW8A 3NW7A 5BYYA 1E1XA 3JVSA 4IM3A 2XS0A 3DBDA 4LI5A 2F7ZE 5L8LA 5IH5A 4FKLA 4BZNA 1MP8A 2B4SB 3BZ3A 2QU6A 3KCFA 4RJ4A 4KBCA 3UZRA 3CQWA 5KO1A 3GCPA 2KTYA 5CF4A 4F9BA 2C4GA 4FICA 1Z57A 2YIXA 3EQGA 3F5PA 3WF9A 3PG1A 1YI6A 1H27A 3VUGA 4AOIA 1F0QA 2C6DA 2WIPA 3C9WA 4NM0A 5EM7A 4E26A 3AMAA 2VAGA 3CPBA 4YTFA 5C4KA 4DF3A 3ORKA 3OHTA 2VTPA 2R3GA 1IA9A 1ERKA 5DBXA 2J50A 4Y85A 4O7VA 3PRFA 4YTIA 4TRLA 3BYOA 3FLWA 3BHTA 3F88A 3P08A 3R9RA 5EYMA 3A8XA 3HKOA 2XNNA 2WTIA 4L3LA 4W9XA 3DZQA 3IPHA 4FGBA 4J52A 3JR1A 3SGCA 3PLSA 3V5PA 1KV1A 3A8WA 4L45A 3BHYA 5IMXA 3G33A 5L8JA 2HELA 2PYWA 3CIKA 4KBAA 4UMRA 5IH4A 4JIKA 4M0ZA 4BDAA 3PXYA 5H8BA 5DYJA 3Q6UA 2UVXA 3QQKA 4X3FB 3TJCA 4UMQA 4JBOA 2BAQA 3IDCA 3K5UA 3ZUVA 1CDKA 2VWBA 2BKZA 5CU6A 1Y91A 3GC8A 4IDTA 1BI7A 4O2ZA 3FQSA 3M2WA 3OBGA 1CKJA 4R3CA 2HCKA 3FEGA 3CQUA 1PXKA 3HUCA 2VTNA 5JKGA 4AE6A 1PYXA 4JAIA 5HBJA 2GMXA 4GYIA 5EHOA 5FP5A 4I5PA 4AZFA 1PY5A 2YA9A 2XK9A 4U9AA 5AP1A 3N4UA 3R9NA 3UIBA 4LL0A 1U4DA 4EQMA 5IQCA 1GZKA 2GNHA 5CQUA 2EXCX 4H39A 5H8EA 4JLCA 2G1TA 3HNGA 2O63A 4D2WA 1GOLA 1UKIA 3OCBA 2OJ9A 5J95A 2P0CA 4KB8A 5IZFA 5TF9A 4YJRA 3QL8A 3U87A 4JDKA 4WG5A 2UW0A 3UNKA 4C7TA 4ZOGA 4JXFA 5FDXA 2UZLA 2PK9A 2IVUA 3KRWA 2F7EE 3AMYA 2P4IA 4CEGA 4IH8A 3NDMA 1WVWA 3DQWA 3LXLA 4BCPA 4FKPA 3F3UA 4ZS0A 4EBWA 1RJBA 5E8TA 3UDBA 3VULA 2R3RA 4XBUA 4F4PA 4CKJA 3LMIA 3PLAE 2YERA 1V1KA 3QF9A 4RVMA 3Q4TA 4ANBA 4C0TA 4IAYA 4IACA 4OAUC 3SOCA 3BELA 4ZSEA 2E2BA 2VNYA 2C5YA 4FTAA 4IJ9A 5DT4A 5AAEA 4EJNA 2WQMA 3MB6A 5ANGA 4I6FA 3VBXA 2OBJA 3BBTB 3KCKA 3KXHA 2JAMA 4E6DA 5CAQA 3R01A 4USFA 1F5QA 4RA4A 3QUEA 5F4NA 5JFVA 2JIVA 3F3WA 1H24A 2YCFA 3A7GA 3SHEA 2WELA 4BF2A 4U5JA 3QHRA 4MF0A 5IQHA 3KRRA 1R39A 4OTWA 1GZOA 4MBJA 5I9VA 1H28A 4I6QA 4PPCA 3R8PA 1TQIA 4DG0E 4KIPA 2XM8A 5M55A 4B9DA 2QO7A 3LM0A 4JVGA 3ZEPA 2PMNX 3VUDA 2OFUA 5L2IA 3PY0A 3CC6A 1URCA 3HV4A 5EW8A 4NIFB 2QOQA 4TN6A 4J53A 5K4IA 4APCA 4OBOA 3MPAA 4QPSA 2JKMA 3CY3A 3UIXA 4HYHA 3GCQA 1YXXA 3VBTA 2EU9A 5K9IA 3LJ2A 4E6QA 4YNOA 1M2PA 3MTLA 3QC9A 4U3ZA 3UNJA 2R3NA 2XVDA 3SXFA 4AS0A 1OVEA 4QMXA 4CFVA 4M15A 2XKFA 2FB8A 3O8UA 2YISA 3WZJA 3MFRA 1EH4A 3POZA 2BILB 3FXXA 3UP7A 4M66A 1Y6AA 5I3OA 3L9PA 2QLQA 3TNIA 1YDRE 3W2OA 4ANSA 1CTPE 4ZTRA 3SKCA 1AGWA 3QBNA 4NW6A 4UWYA 4BGGA 1M2QA 3EJ1A 4TT7A 5FQDC 2QR8A 3KC3A 4D28A 4YC8A 4YJSA 4O91A 3IW8A 2WMXA 1Q8TA 3QXOA 3VUHA 2EWAA 4C57A 3MBLA 5ITAA
chains in the Genus database with same CATH superfamily
3ZEWA 2YZAA 5KZIA 5LMAA 2X8DA 5DGZA 3RAIA 3RHKA 5CEOA 2IZTA 3BQRA 5J8IA 2X7FA 4V04A 4O22A 3B2WA 5CVGA 5L4QA 2PUNA 4EOJA 1PMVA 2VU3A 2UZNA 3KRXA 4UMPA 4CD0A 1J91A 2BZKB 3MB7A 4C2WA 3FKNA 4QT1A 5AUTA 2V7AA 2X4ZA 3C0HA 3UOLA 5AADA 3E92A 4PPBA 3CBLA 3LLAA 3NCGA 2XNPA 5ANOA 5HNBA 4I5MA 2R2PA 2YFXA 3VS6A 4Z16A 3W8LA 1FGIA 1IG1A 3ZO4A 5IDNA 4DBNA 2W06A 4D9UA 3D94A 3U6IA 4ANOA 1BMKA 2XK6A 3QLFA 3FMKA 3SV0A 3NMUF 2R3QA 3HV3A 4O4EA 3A7JA 2XCKA 1CM8A 3PPZA 4EUTA 2H34A 5KMKA 5CANA 4FT7A 4FKSA 5HKMA 2QG5A 2Z7SA 3TJDA 2I6LA 5LQFA 3EN9A 4A7CA 4O0VA 3LXKA 5HIBA 4D4RA 3GFWA 3HV7A 3FL5A 5KBRA 4GUBA 4NU1A 3VQUA 5FLFA 1U5RA 3AMBA 3KXGA 3WF6A 4ASXA 4L67A 4ALVA 3A99A 3MI9A 4G3EA 3IS5A 5G1XA 4JG7A 3W16A 3D15A 5DG5A 4BCHA 3HRBA 3BE2A 3WBLA 3ZH8A 1UA2A 2WHBA 3W0RA 2QOCA 4P5QA 2YN8A 3QKKA 3NS9A 3Q9WA 2XP2A 4X2GA 4IAZA 3H4JA 2VGOA 1JKLA 4X3FC 3GT8A 2R3LA 2BZHB 1XJDA 3MWUA 3QD3A 4QYFA 5AR5A 3DB8A 4DHFA 5CXZA 4D2TA 4BJJB 2BVAA 3F7ZA 3ZZEA 5CSXA 1NXKA 5LVLA 3R9OA 2C5VA 1YOLA 4XG3A 4ZIMA 5IA1A 1CSNA 4ERWA 4FNZA 4C4FA 2PUPA 5IEXA 5EDRA 3QQGA 4BZDA 1URWA 3C51A 5GJGA 4DGNA 1PXJA 3MIAA 3QCXA 5HD7A 3VJNA 3VNTA 4NEUA 4AGCA 4FKTA 4CQEA 5KNJA 3NFFB 1IRKA 4HYIA 5CZIA 4H3QA 3VHKA 4M12A 3KN5A 4YZMA 3IGGA 2A0CX 4A06A 1APME 3BHUA 4K2RA 3ODYX 2R3KA 4N4SA 4Z3VA 2DQ7X 5I5ZA 3F69A 5ETIA 4DN5A 3TTJA 5L3AA 3U9NA 5AM6A 3FLQA 3H10A 5IA2A 4A07A 1Q4LA 2VN9A 1F3MC 3P1AA 3KN6A 5JRSA 3ZXZA 4DLJA 5M4CA 4LDTA 4HGLA 4XS2A 4DH1A 5DPVA 3ZSHA 4EZ7A 4MF1A 2BRBA 5HOAA 5GNKA 3ET7A 3AD4A 4I6HA 2XH5A 3R28A 4RIYB 4BICA 5AAFA 4BFMA 5K5NA 3S1HA 5ANIA 4B4LA 3KKVA 4FIHA 4EOLA 4RWJA 5CQWA 2XYUA 3FI4A 5CVFA 4F65A 3UNZA 4DCEA 3VAPA 3R2YA 4YTCA 2DYLA 2ESMA 1FBNA 1H8FA 4C02A 3LMGA 3H30A 5CI7A 4YHJA 5JGAA 2HW6A 4QYGA 1QCFA 2O5KA 5M07A 2UZWE 3BV2A 2VWYA 4S2ZA 3W2CA 3SQQA 3HUBA 4O4DA 2WOTA 3ENMA 3FKOA 4XX9A 4O86A 4O4FA 5EHLA 2VNWA 3RINA 3VF9A 1YXTA 4O0WA 5LMKC 2JDRA 4LV8A 5CALA 4MCVA 2ITNA 1M52A 3PUPA 4FK3A 4ZJJA 4F1TA 2ZOQA 2GDOA 1A06A 1W7HA 3EL8A 4IZ7A 4RC2A 4BDGA 1JAMA 4BCIA 2HZ4A 2P33A 5CAOA 2X0QA 4LRKA 5DR6A 5AUUA 4P5ZA 1NW1A 4DAWA 1WCCA 2ZV2A 4BN1A 5M51A 3U6JA 2J0LA 1IASA 3R7VA 4X6QC 4F64A 1XH9A 4MXYA 3SA0A 4PP9A 1YI3A 3BKBA 2YAAA 5GZAA 4G34A 3UQCA 2XNEA 4EOIA 3NW5A 3CJFA 5DMZA 4DTBA 4NH1A 2JD5A 5CEPA 3UE4A 2DUVA 5TE0A 4NZWB 4P7EA 4C4GA 2OIDA 3ZHPC 3AKLA 4E3CA 2BRMA 4L3PA 3PXFA 2CHLA 3FXZA 3OCTA 1OIRA 5E8UA 2X9FA 5A4EA 5L2WA 2A19B 4CNHA 3BEAA 3R21A 2WAJA 3TKIA 2X8IA 3OUKA 4Z55A 3MYGA 3D9VA 5CT7A 4QNYA 4QTCA 3F6XA 2WD1A 3FBVA 4XBRA 3DZOA 3C7QA 4YP8A 4BGQA 4C3FA 2OK1A 3ETAA 4HGTA 4DFZE 2SRCA 2BHHA 3LFEA 4FKUA 4I23A 4JR3A 4L3JA 4ZY6A 3EN6A 4J98A 4ACCA 4RJ6A 3WIGA 1H1WA 1OL2A 4O6LA 2O65A 5IUIA 3ZLWA 1IAHA 4EOOA 2Z7QA 2PZPA 4G3GA 4CFUA 2J5FA 4OTIA 4FSQA 5DWRA 3KULA 2EUFB 4E5BA 4UALA 1MRUA 2B9FA 1H1PA 3PY1A 3RK9A 3EQCA 2O3PA 2BIYA 3G0FA 3OWKA 3Q4UA 3IW6A 4LOOA 3PP1A 4A9YA 3VJOA 2V22A 3KXXA 5CLPA 4DG3E 4O7RA 4LGGA 5GIPE 3SX9A 1KV2A 1REJA 4QTDA 2OW3A 1ZZ2A 2PVJA 4PL5A 4QP9A 2HY0A 3PE1A 1VR2A 3G0EA 3CP9A 3QGWA 2PVMA 2GPHA 3RAKA 2FSMX 3DK6A 4K77A 3NYVA 5HLPA 3BLQA 1CKPA 3NSZA 4J8MA 3EWHA 2PMIA 1H25A 3Q60A 4AT4A 3TI1A 5EKNA 1M14A 4OTGA 2Y0AA 3VWAA 4B8LA 4CT1A 5HG5A 3RK5A 4ERKA 3DBQA 5I0BA 4WRGA 5E91A 3HMNA 5G6VA 4XG9A 1XH7A 3RWPA 4FYOA 3A4PA 1WBSA 4PMPA 5IDPA 3QQHA 1G3NA 2UW6A 5L8KA 4AZSA 2PVRA 3KMMA 1JSTA 2GQGA 3ORLA 3QCYA 3LFDA 3BCEA 1NVRA 3V5LA 1M7QA 1WBWA 4F6UA 4ZZNA 1BUHA 3OVVA 3FXWA 4E20A 3IOKA 4YJQA 4RLLA 2F7XE 4Y5HA 4CMTA 2C1BA 4CMUA 5C27A 5IPJA 1FGKA 3G9LX 4W8DA 4IVAA 4JG6A 1H26A 3ROCA 3SG8A 2ACXA 1HCLA 2W4JA 3DTCA 5J87A 2ETRA 4E73A 1UU9A 3MY0A 5EYDA 2X8EA 3A7IA 4I3ZA 3BWJA 4L7FA 4WHZA 5CI6A 5FXSA 1OKVA 4JBVA 5HCXA 2O0UA 3RTPA 4JIAA 4FSZA 4GK3A 4QMOA 2W9ZB 4ACDA 4EHZA 2YLFA 1G8JA 2VWXA 4BDBA 4MTAA 4RZVA 4G5PA 4A9RA 2ITPA 3UJGA 3UOJA 2I0EA 2ONLA 2ERKA 4JDHA 5I4NA 4FEXA 3S3IA 2A4LA 4EYJA 2PPQA 4CYIA 4LMNA 4U80A 5EK7A 1XBCA 3TL8A 4DTKA 4FT5A 5HTIA 3QRTA 5AUZA 4GYGA 5EW3A 2QKRA 5CS6A 4HNFA 3MFUA 4O0TA 1U59A 4JG8A 4XLIA 4GU6A 2RG5A 3SXSA 1YWRA 3ID6C 4QOXA 3LAUA 3RPYA 3CD8A 4BKJA 4FIIA 2W17A 3U9CA 4UZDA 3R7UA 4WKQA 2R3IA 3DB6A 3KMWA 3NRMA 5FEDA 2W1GA 5AX3A 3KF4A 3TNPC 4MXZA 3EIDA 4DE4A 4F9YA 3HGKA 3NYOA 3EFKA 3ACKA 5HE3A 2JC6A 3NNUA 4AW0A 4D2PA 3VONA 3MH3A 4FKRA 1GIHA 3LCOA 3VW8A 3R63A 4GT4A 4A9TA 5DT0A 2C3JA 5BMMA 5EI8A 4B99A 5B2MA 1XH6A 5CEMA 4RG0A 4WG4A 4ASDA 3W2RA 3C50A 3NUNA 3AT2A 4O38A 4GVJA 3UPXA 2CKEA 3GEQA 3KRJA 5CU2A 2FSOX 4ANQA 3D2IA 1XMLA 3O5AA 4R7BA 1KE6A 2BRGA 2J6MA 2JGZA 4NW5A 4Q5HA 3FMJA 5HQ0A 2J4ZA 4EH8A 4PNIA 3NNVA 4XV1A 3ZBFA 4FGRA 4TYHB 1J1CA 2F2CB 2GTNA 3AT4A 1UNHA 3V04A 4CRLA 3EL7A 5J1VA 1Y57A 3GBZA 2VWZA 3PTGA 3PXRA 4S30A 3F5GA 4X0MA 5AUXA 4WUAA 2PL0A 3PSBA 2C30A 4TTHB 4AGUA 1ATPE 3NYXA 3O71A 3EH9A 4OTFA 5HIEA 5T3QA 3PY3A 4PTCA 3S0OA 3MVMA 1YXVA 2JKKA 4DFXE 1OGUA 2BAKA 4U40A 4CCBA 3ORTA 1A9UA 4PWNA 2QHNA 3TKUA 3BYVA 4YBJA 4B7TA 2XNGA 4IFCA 4WSQA 3ZDIA 4UWCA 4QQCA 3AXWA 4KIQA 4X2JA 4UN0C 2PVFA 4C4HA 3BEGA 4DH7A 2YEXA 3PG3A 5M57A 5T6KA 1KE7A 5CX9A 5FTOA 4BWKA 3DXQA 4ZTSA 3EN5A 1ZYSA 4CT2A 3ZLSA 1MUOA 5BVKA 4TL0A 2WU7A 1NA7A 2B9JA 4HPTE 5CU3A 4AE9A 5JGDA 3BHVA 4OGRA 2AYPA 4ZAUA 3OUNB 3A2CA 1OMWA 4WBOA 4RX7A 4IIRA 4L42A 5B2KA 5JFXA 4H05A 2FGIA 1WBVA 4NM7A 3GC0A 2YDKA 2A1AB 4HCUA 3GUBA 4P2KA 4S34A 4DFYA 4DLIA 3PSCA 5A46A 4PDYA 3MH0A 4RFMA 4AGDA 2BDWA 2UVYA 3I81A 3KVXA 3QTUA 4EC8A 5KHXA 3EYHA 4WNMA 5DOSA 4TWCA 4NL0A 2C3IB 5DE2A 5DEWA 3ATSA 3I79A 3SRVB 4H58A 3C4ZA 4S31A 4LV5A 3OOMA 4NCTA 5FBOA 3QRUA 4QTEA 5EG3A 5HE1A 3FZRA 3QD2B 3TWJA 4DH3A 4GVAA 4YZNA 2XCHA 3GU4A 3LFFA 2IVTA 3BU3A 4AT5A 4LMUA 1R1WA 2VWVA 3NPCA 3OROA 3Q53A 3HX4A 4TWPA 2I40A 4TWNA 4I6BA 5HG9A 3UMWA 4BCMA 3G9NA 4IAIA 4J96A 2X2MA 2EVAA 3QTWA 2WTDA 3R0TA 5EYCA 2LAVA 4EI4A 5HZNA 2RIOA 1IA8A 5GJDA 1ZOGA 3BRBA 3CE3A 4GKIA 4HVDA 3CGFA 3V5WA 1W83A 4D9TA 3JXWA 3CCNA 1IR3A 3IQ7A 3I60A 3OCSA 2WMBA 3U4WA 4R1YA 3P0MA 5BVNA 3F7WA 2YJRA 3PA5A 5FEQA 3MESA 1U54B 4WIHA 3VQHA 5KMJA 4N57A 2G9XA 3HP5A 4YURA 4E4LA 4QDVA 4FUXA 3CR0A 4X7QA 3OF0A 3V01A 5HTBA 4D5KA 5AMNA 5H3QA 3H9OA 4ZXTA 5DLSA 4I0RA 4YR8A 4AXDA 4APPA 4B0GA 1Q8WA 2XNMA 1J1BA 3Q6WA 2HZIA 3GVUA 2IF8A 4JQ7A 4RPVA 2VTLA 3KEXA 4QMTA 4XV3A 3ZBXA 3KXNA 2C3LA 3VIDA 3RM6A 3R1YA 5LWNA 3FI3A 3H0ZA 4ZTLA 3QTQA 4FSTA 1MRVA 3Q5IA 3GU8A 4LUEA 4IVBA 4FG8A 4G3DA 4XYFA 3TT0A 1ZMUA 2WQOA 4FL2A 3EFLA 3IK3A 3PFYA 1KSWA 3Q4CA 2ZM1A 2YCQA 3FI2A 5J9LA 1JKKA 4FL1A 1JSUA 2WTKB 3MV5A 2C6TA 4FV1A 3QD0A 3TV6A 3RPRA 2YIRA 4JQ8A 2JLDA 4RSSA 3ZSIA 1G8KA 1FOTA 3PYYA 3G90X 2HZ0A 2J2IB 4IM2A 2OH0E 4HPUE 4RIOA 1FVTA 3FV8A 4KSQA 4OLIA 2OG8A 2I0YA 1TFFA 1OM1A 3R7IA 1KE5A 4QMNA 3ZUUA 4LGHA 4L00A 2QU5A 4PDSA 5K0XA 2ITZA 2P55A 3REPA 3AC4A 5JT2A 3NGAA 4WBBB 4AAYA 2BKKA 4MKCA 4V0GB 3WZUA 4HVGA 3ZFXA 3ZU7A 4EZ3A 3U55A 2ZM3A 4BDJA 3RWQA 2BTRA 4QTAA 1P14A 1XBAA 5BVEA 4G5JA 3TACA 4JJRA 3RVGA 2XRUA 4R78A 4J97A 2A27A 3QCQA 5ANDA 2UW5A 2YCSA 4EWQA 4F9CA 1SNXA 3LFAA 3L9LA 2H96A 4MD9E 4XRLA 1W98A 3HV6A 2C69A 3I0QA 2ZDTA 2BDJA 2XAMA 4GL9A 1V0OA 3ORXA 4FTUA 4U81A 4WNKA 3O2MA 5EH0A 3GXLA 4E4MA 3BYUA 2UVZA 2C0TA 3QALE 4FSUA 2OXYA 4O0YA 4FKVA 3ZLYA 4RWIA 4PTEA 4L68A 3MW1A 4BCOA 4O0XA 4IC7A 4M69B 3UBDA 1Q62A 3VS3A 5AEPA 4AAAA 2JDOA 3LW0A 4K1BA 4M0YA 4E5WA 3RCDA 5EM5A 3AD6A 2NRYA 4KIKB 4AW5A 1YKRA 4CVAA 5A14A 1H1RA 5DRBA 3DK7A 3FLSA 4FKQA 3WF5A 4WA9A 1XQZA 2NPQA 3PIXA 4AA4A 3ZMMA 3OTUA 4DYMA 5KCVA 2ZMDA 3EN7A 4H3BA 5HNIX 3COMA 5AX9A 5D7AA 3NUSA 3PWYA 4Q5EA 4LYNA 3FPMA 3OBJA 4QRCA 3OT8A 3BU5A 5BPYA 5HESA 2G2HA 4ZSLA 3D2KA 3SC1A 4XRJA 2RF9A 5L6OA 4IX3A 3WE4A 2R64A 3TM0A 1Y6BA 3BLRA 4FR4A 3H0YA 4YC3A 3BE9A 4QMSA 3PA3A 2CDZA 3T9TA 3V8TA 3OXZA 4ZLYA 3JUHA 5HORA 4X21A 5CENA 2ZFYA 4R7IA 3OOGA 3LXNA 2Z2WA 2WTCA 4EOKA 2JIUA 2PE2A 1REKA 1SYKA 2R3MA 4OT5A 3RM7A 3TTIA 3ZC6A 1UV5A 4O21A 2P2IA 4PMSA 4RX9A 3VS0A 5BX0A 4KUJA 5HHWA 2AC3A 2ZMCA 4C3PA 4JX3A 1IEPA 1LEZA 4I21A 1XR1A 2WZJA 3E3BX 5DT3A 5EQYA 2YIWA 1PMUA 2UW3A 5IISA 4F1OA 2YDIA 3OCGA 4WNPA 1ZYJA 3P5JC 4FV0A 4EOSA 4F6WA 3IW5A 2YM6A 4X3JA 2YJSA 3OS3A 3QAME 3V8WA 3ZSGA 4E6CA 3ZRKA 1MRYA 1QPDA 3GFEA 3FHRA 1XHAA 3P86A 2PE0A 4MNEB 4OTHA 4XCUA 3RCJA 5HU9A 1S9IA 5HO8A 3KY2A 2F57A 4UYNA 3AT3A 3OEZA 4RC4A 4QTBA 4RIWA 3TG1A 3WYYA 5E9EA 3SLSA 3UO5A 2W5HA 5EFQA 1OZ1A 3UQGA 4RX8A 4HW7A 5B0XA 2F4JA 4HGSA 4YZBA 3VS7A 2NYAA 4O7LA 3HVCA 5CSPA 3PVBA 3VBVA 3DY7A 2AC5A 3ODZX 4NK9A 4A9UA 5AWMA 4M68A 4AXEA 2CLQA 3BU6A 3UQFA 4KRCA 4FI1A 3FLYA 2OJFE 2HWPA 2NP8A 3UG1A 4QMVA 4WSYA 3SW7A 3VBYA 2XUUA 4FX3A 3KQ7A 3PDTA 3MIYA 4FEUA 4IZAA 1YHVA 4TWOA 3BBWA 4GEOA 4BBMA 3DV3A 4I24A 3ITZA 3E7OA 3ZM4A 3NUAA 2B55A 2ITTA 1IAJA 3HDNA 2YM8A 2GFSA 4EQUA 3BL9A 4M97A 1Q8ZA 4FF8A 4U0IA 2UZVA 5LVPA 4F9WA 4OW8A 1T46A 4D4VA 5IA0A 4N6ZA 3RHXA 5BQ0A 3RZFA 4RT7A 4FE2A 2WTKC 4FEQA 3LCSA 3NUUA 4AOTA 4PNKA 2WU6A 3GU5A 4ZY5A 1OL7A 3E88A 4K9YA 2XKEA 2WMVA 5CTPA 3T8OA 4BL1A 4BYJA 4C58A 3QTRA 4EOMA 2EB3A 3MA3A 1LP4A 1VYWA 4MNFA 3RI1A 4TYIA 3OY1A 1YW2A 2X2KA 5CSHA 3O0GA 1DAWA 3CXWA 4BHZA 3KRLA 5AP0A 1P4FA 2OZAB 3AC8A 4EZ5A 1PKDA 2X7OA 3E8NA 2QOFA 5A3XA 3EKNA 3SOAA 3Q3BA 1T45A 3I7CA 1Q8UA 3PSDA 4FTIA 3OP5A 4IB3A 5M53A 1KE8A 3FAAA 2QOOA 2VX3A 2LGCA 3UYTA 2X6DA 3CTQA 4KS8A 1DI8A 2H8HA 2RKUA 3L1SA 3QYWA 1LR4A 3PJ3A 5C26A 2DWBA 3DT1A 3FYJX 5AR3A 4BTJA 4ITJA 3BGPA 5ANJA 2CGXA 5J1WA 4HGEA 2HYYA 4CYJA 4XP3A 5CF6A 3S00A 4XMOA 5H8GA 3K2LA 4OTQA 5BUJA 5AIRA 3CKWA 2WIHA 4O0UA 5I9XA 1PXOA 1BX6A 5CNOA 1J7IA 4KBKA 2WMQA 4QYHA 5BVFA 3I6UA 2RGPA 2QOKA 2QQ7A 3IOPA 4J71A 4HYUA 4QMZA 5AV3A 2UZOA 4QP1A 3R00A 5EQEA 1U46A 2FVDA 1OB3A 4EONA 3AGLA 4BCGA 3DBCA 4FSYA 2VWWA 4IZYA 2WEVA 3D7TA 1YXUA 3AKKA 3E5AA 4CFNA 2R0UA 3O7LD 2B7AA 4FTQA 4PMTA 3MN3A 4ALWA 3K5VA 3ORPA 4FV5A 3QQFA 4XP0A 3R1NA 4ZP5A 5C9CA 3UGCA 3WIKA 1OKYA 3P79A 5EDQA 2Y4IC 1XH4A 4HJOA 2W05A 2GQRA 4G3CA 4RWKA 3LQ3A 4RIXB 2GS6A 4XP2A 5GZ9A 2QOBA 4O4CA 4E7WA 1B38A 2WEIA 5AAGA 3MPTA 2ITVA 4GFMA 4NUSA 5HU3A 3U51A 3VS4A 3A60A 4G9CA 3DBFA 3BLHA 5DR2A 4EK4A 3OWLA 4BI1A 2X2LA 2X9EA 3R7YA 2ZV8A 2E9VA 2XKCA 2WMAA 4I20A 4CTCA 3FDNA 5M4FA 2PVKA 4GRBA 2PZRA 5L6PA 3HP2A 3ZOSA 4O96A 4RA5A 3R73A 4GH2A 4BCNA 4BTFA 4C4EA 2XRWA 1J3HA 4DFNA 3VBQA 5IUGA 2B1PA 1STCE 3NUYA 4BB4A 4CFMA 5TT7A 4AXAA 3DJ6A 3EQPA 1Z5MA 3LQ5A 4YSMA 1SMHA 3DFCB 4H1MA 3RBWA 5D41A 2W0JA 3CTHA 5F9EA 4O0SA 4NFMA 3WILA 2HW7A 4AFJA 3MS9A 1GJOA 2AQXA 1KOAA 2QO2A 2IZSA 2CN5A 2PE1A 3AC1A 5CVHA 4BKYA 4E5AX 2B9IA 2E9NA 2WMSA 2UW4A 1RW8A 3FQEA 4FTNA 4OTDA 1YI4A 2RG6A 5CEIA 2GQSA 4CGAA 4EH3A 5JZJA 4HOKA 5BMSA 3D4QA 3GCVA 4II5A 3UP2A 2OH4A 2OWBA 3EB0A 3GB2A 5FP6A 5A6NA 2X6EA 4Y5QA 3LLTA 3D83A 4D4SA 4BY9E 4Z7GA 3ANRA 3LJ1A 4YPDA 3UO6A 4AZTA 3QX4A 4QPAA 3D0EA 2Y6OA 3W0SA 2GHLA 5HVJA 3FMEA 3DNEA 4XG8A 4DH5A 5JH6A 1DM2A 1XBBA 2BPMA 2CCIA 2BCJA 4EH2A 2WB8A 5AP7A 5K0KA 4EH7A 4F99A 3LZBA 3Q96A 4IMYA 5AUWA 3FPQA 3GI3A 2BRHA 3RAWA 3TUDA 1VZOA 4JX7A 3RP9A 2WOUA 1UWJA 5FG8A 2UUEA 4KA3A 1QPJA 3DQXA 5KHWA 3CSVA 3ZC5A 3KL8A 3PJCA 3QTZA 4PX6A 3OZ6A 2W4OA 4FL3A 4R1VA 2YM4A 5HG7A 3ULZA 2OICA 3OWJA 3QXPA 1YVJA 4DEAA 2ERZE 4M69A 5M44A 1BLXA 4F7JA 3RPSA 2W4KA 3C13A 4LG4A 3QRKA 3HMIA 4X3FA 2YM7A 4L01A 3W33A 2BTSA 3II5A 1H0WA 2BROA 5JMSA 1OPKA 3UTOA 2J0MB 4H36A 3F5UA 1Q24A 2FA2A 3A62A 3MY1A 5EHYA 2QONA 2V55A 1VJYA 3GQLA 4Y46A 4CFXA 4EQCA 3C4EA 4PF4A 4LRMA 4FKIA 4FTCA 4FZ6A 4O1OA 4RJ7A 3U6HA 3DKGA 1UU3A 4BDCA 1WAKA 3LFQA 4EHEA 4JBPA 1YHSA 3GGFA 1ZYCA 3CJGA 3O8PA 4O0RA 4E6AA 1JPAA 2GHGA 3E63A 3PXZA 4OUCA 5K3YA 5JGBA 3Q52A 3A7FA 3PJ2A 4FSWA 4KWPA 2VTRA 1ZMVA 3QD4A 2J90A 1W8CA 5AJQA 2UZTA 4TY1A 4GMYA 3QRJA 3R8UA 3V6SA 3ULIA 2PZ5A 4B6LA 5KZ0A 4HYSA 4TW9A 2ITOA 4YPSA 5KMLA 4QMLA 3BV3A 2ITQA 2VO3A 3N9XA 4WD5A 1PW2A 3HAMA 3O8TA 2WQEA 3ZM9A 4D58A 4QYYA 2CKOA 4IWQA 3TKHA 4IAAA 2IZRA 3QTSA 3I4BA 2YIQA 4E4NA 3QKLA 3A4OX 4TPTA 4WNOA 5DR9A 1DI9A 2XK8A 4M3QA 3D14A 1J7LA 3KGAA 4NWMA 4FV9A 3TN8A 3VRZA 5A4TA 4FIFA 3UYSA 2YWPA 4W9WA 4CFFA 1ZAOA 4FNWA 3ZRMA 4AF3A 4DITA 3W0OA 2QOHA 3DAKA 5IA3A 4DDGA 5IMEA 1H01A 3WZDA 1YWVA 5DN3A 4NKAA 4FZDB 4HZRA 4XJ0A 4JMQA 3FC1X 4G2FA 5HCYA 4NM3A 5ICPA 2OJJA 1QPEA 4EYMA 2OZOA 3VO3A 1H07A 5LCKA 3BI6A 3DS6A 5ETFA 1ND4A 4D55A 5LMKA 1QL6A 2OLCA 5FM2A 5CAVA 2XK7A 5AR4A 3RALA 4EWHA 1G8SA 3NCZA 2CLXA 3AG9A 4NIFA 4D0XA 5A6OA 3AC2A 5JZNA 2UZEA 4FZ7A 3PRIA 3R2BA 4WT6A 3C1XA 2FYSA 4I0SA 3ZYAA 1P4OA 2I0HA 2YLEA 2BRNA 3PPJA 4B8MA 4NSTA 4F1MA 1KUTA 3CPCA 3QA8A 2XAOA 3QGYA 5BV3A 5M09A 5C8KA 5ANKA 5IA4A 4W4VA 5IQAA 5IQDA 3P23A 2BR1A 4J7BA 1LPUA 3VVHA 3IONA 3G2FA 4YZ9A 3MFTA 4AW1A 3COHA 1KE9A 2ZM4A 2V0DA 4YGAA 3D5XA 2ZAZA 4MEDA 4UZHA 4O7YA 4I0TA 4IM0A 3KK9A 4MD8E 5DHJA 1JKTA 4JR7A 4UX9A 5E8YA 4FZAB 5CT0A 3ACJA 3ANQA 2PU8A 5BVDA 3NUPA 1OGYA 5HBEA 4QMQA 3FYKX 3ML1A 4QQJA 3EFJA 4Y83A 4M13A 1P5EA 5DEYA 5HBHA 4EH4A 1JLUE 2GNLA 4JRNA 4YLLA 2B54A 2XIYA 5IQBA 4DFLA 4GG7A 3F3TA 4O4BB 1XH5A 2VTJA 5IA5A 2VTIA 4EUUA 4X2NA 5AA9A 3BHHA 3FZPA 2ZJWA 4XH6A 2BFYA 4CG9A 2V5QA 3M11A 4BDFA 2YDJA 4GK2A 3W2QA 4AZWA 3O23A 4ZTHA 2XB7A 4IADA 2PMOX 4PUZA 3TNWA 4O82A 2JKQA 2O8YA 1UNLA 3FY0A 4ALUA 1SVHA 3QWJA 2OJIA 4I92A 5IU2A 1UNGA 2XMYA 3PJ1A 3TIZA 4E8AA 5C8MA 4DGOA 3F3VA 4KNBA 1FMKA 4EK6A 3NFGB 1S9JA 3EQHA 5E8XA 3UIUA 5M56A 5BYZA 4G6OA 5T68A 5HX6A 1WBPA 2JKOA 3C4XA 4XG2A 4JOAA 4Q2AA 2ETMA 1PJKA 3ALOA 5AV1A 5CEKA 3RJCA 3R04A 4GFGA 3IO7A 1HOWA 3OG7A 4R3RA 3K54A 3TV7A 3UVRA 3TDWA 2RFEA 3EFWA 5ACKA 1E9HA 4M7IA 2R7IA 4FTLA 5EM8A 2JFMA 5EOBA 3LCTA 1ZXEA 1OUYA 4U79A 1ZY4A 3N4TA 4W8EA 5TOZA 2OI4X 4BHNA 3LCDA 3PVUA 4PQNA 4P90A 3HEGA 3K3JA 2BMCA 4YC6A 2YITA 4H3PA 5EI6A 4BJJA 3WOWA 4CLJA 4Q9SA 4HVSA 4U3YA 5LMBA 5GIOE 2QNJA 3UOHA 2QOIA 4IANA 4I94A 4M84A 4CRSA 4AU8A 1YOMA 2EXEA 1GAGA 4IBMA 2I0VA 3DFAA 4CZTA 4F9AA 1ZZLA 5E1SA 2BZJA 4MD7E