3CL1A

M. loti cyclic-nucleotide binding domain, cyclic-gmp bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
RGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Energetic Analysis of Activation by a Cyclic Nucleotide Binding Domain.
pubmed doi rcsb
molecule keywords Mll3241 protein
source organism Rhizobium loti
molecule tags Membrane protein
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cl1A00
4N9IA 3FJSA 2PQQA 2PYTA 4AQ2A 2PAMA 4MGIE 4CYDA 4I0AA 3MDPA 4Q0PA 5C6CA 2QDRA 1QWRA 2BNOA 1ZZBA 1O3SA 2GH2A 2IXKA 2XL7A 3ES4A 3SHRA 3H3ZA 3HT2A 1TQ5A 4BHPA 3SCGA 2XL9A 1J59A 1OD5A 1YFWA 3EBRA 3OF1A 4I09A 4GULA 5JSOA 3HIFA 5K8SA 2K9ZA 3RYPA 4H7LA 4EWDA 5C8WA 2IXCA 4PIXA 1FT9A 2Z2SB 4YRDA 3RYRA 4JTOA 1OI6A 2XKPA 3CL1A 3LAGA 4KU7A 3NJZA 4DINB 4UXAA 2OZJA 1DGWA 4Q0QA 2IXHA 3ACLA 4Q29A 4ZU7A 5FLHA 3LA3A 3BALA 4HBNA 4QGNA 4HVOA 4P9GA 4PJYA 5I0SA 2XLGA 4IEVA 4XFHA 3ELNA 3RYKA 4IEOA 4Q0VA 4J1WA 5JR7B 1DGRA 2GZWA 1O3TA 3USSA 3G7DA 2K0GA 4L2NA 4J1XA 1UD1A 4E2SA 3EHKA 1CAUB 3WW2A 2B5HA 3DN7A 1SQ4A 4MGKE 3MZHA 3RZZA 3OD0A 4BH9A 2UY9A 4IEXA 2XLFA 1YFUA 4MV2A 3NSTA 2ETEA 4LTAA 2F4PA 3L2HA 3LOIA 1NZCA 3H1WA 4AQ6A 5I0UA 3E5QA 3KCCA 4HZFA 2OYZA 4WBBA 3E6BA 1ZX5A 3EO6A 3FZ3A 4NVPA 2GU9A 2D5FA 5FPXA 1Q5OA 2Q1ZB 4WVZA 4E2GA 3H9AA 1ZRFA 2N7GA 4I3PA 4FAGA 4BIFA 1O5UA 2GAUA 3DKWA 3NW4A 5FLIA 1J1LA 2IXJA 2BYVE 3E6DA 3LA7A 1YHFA 4UBGA 2IXLA 3B02A 1HW5A 3HQXA 2QNKA 4B29A 1WLTA 3D0SA 4Z82A 1UW8A 3DV8A 4YNIA 5JAXA 3RPQA 3FHIB 4KL1A 4MX3A 5FQ0B 4PIYA 3ST7A 4KU8A 1ZZ7A 1RGSA 2BGCA 1FI2A 1PM7A 3TNQA 1RUOA 3KMHA 3S0MA 5FCCA 3O14A 1PMIA 1QXRA 4ORFA 1YUDA 2QCSB 3QOPA 4IETA 2ZCWA 4KWJA 3WW4A 2EAAA 4X6RB 2XKOA 3HT1A 5EFUA 4K8FA 4O9EA 1EPZA 3E5UA 1XE7A 5LRRA 3E97A 1EY2A 5I0TA 4IERA 3FX3A 4HSJA 4RD7A 3OTFA 4MUVA 3I7DA 3IBMA 1OMIA 1CAWA 2IXIA 1X8EA 5KHHA 2I45A 3CO2A 4XFFA 3UKTA 1VR3A 3E6CC 4ZU5A 3WW1A 2D93A 4Q0SA 3KSCA 2VQAA 3H1MA 1O4TA 4YYOA 1CAVA 3R6SA 3OGJA 1UPIA 1X7NA 2OZ6A 2XHKA 5CADA 1I6XA 3U10A 3N4MA 1CGPA 1O3RA 4JVAA 4JTNA 3IDCB 3MPBA 3SCHA 3FWEA 3WW3A 2EA7A 3IDBB 4I0BA 1V70A 2BNMA 5I8YA 3IWZA 4PIZA 1XE8A 3LWCA 4FBFA 5BUVA 5J48A 4I2OA 5CVRA 2PAKA 4HN0A 4OFGA 3C3VA 4FT8A 2UY8A 1JUHA 3I59A 3H1YA 1I5ZA 3KGLA 4LEJA 4EWAA 3D0JA 4XF0A 2D40A 1O5LA 2CAUA 1ZZ9A 5BY5A 2CGPA 4AVCA 1NE6A 4QM8A 3SMHA 1RTVA 2ATFA 2ET7A 4Q0UA 3H3UA 1LRHA 1LB2A 3M3IA 1EP0A 2VECA 3NL1A 4WZCA 5JSRA 5EZWA 4D7SA 1SEFA 3BCWA 4HN1A 1U12A 5J3UA 3GYDA 3D82A 2PTMA 3UKVA 1Q3EA 4XFIA 4HSLA 3ETQA 4IEQA 5KHGA 2ZKLA 4L11A 2Z69A 2PHDA 4MZUA 5E16A 1YLLA 2OA2A 4YARA 3H7YA 3JZVA 3ES1A 4HVQA 4A2UA 3E5XA 5BV6A 5I93A 1RL3A 5KBFA 4XFCA 5HI0A 4N9HA 2UYAA 4QX5A 2HJIA 1VP6A 3GBFA 4XFGA 2QJVA 1ZVFA 4XFBA 5BXXA 1CAXA 2ET1A 4ZU4A 3S7EA 1J3PA 2FQPA 1IPKA 5JCTA 4LLOA 1H1IA 3FFQA 5KHJA 3BB6A 1FXZA 2PA7A 2O8QA 4QGLA 5I0RA 3PVBB 2CAVA 2WC2A 4META 3EQEA 4YSFA 4Z07A 3NKTA 1CAWB 2EVXA 1YWKA 4MH0E 4OLLA 2H6BA 5LEKA 2VPVA 1DZRA 2Y0OA 2HKXA 3M70A 4XFAA 4D7TA 1Y9QA 1NXMA 1IPJA 2MNGA 4IESA 2MHFA 1CAVB 4FAHA 5JSPA 4LUKA 4XETA 2GC1A 1YFXA 2O1QA 5I91A 1RUNA 4R52A 3IIAA 5FQ0A 3H7JA 4XEZA 5D1IA 3H50A 1H1MA 1GQHA 4XF3A 3I54A 2BEOA 4QXKA 1UIJA 1ZRCA 2CV6A 3UKNA 4IEUA 2GC0A 2H6CA 3RNSA 1VJ2A 5AVPA 2QVSB 1ZRRA 1UIKA 2OPKA 3S7IA 4E2QA 3LA2A 1QY4A 1J58A 4QMAA 1ZZ8A 3PLQA 2PHLA 3CEWA 1LR5A 2WFPA 4IEZA 3CLPA 1OFNA 3I59B 1O7FA 1X8MA 1ZRDA 4XF9A 5J7MA 3FE5A 4JV4A 4AVBA 4QGMA 1O3QA 2Q0AA 1CX4A 4I02A 2C0ZA 2MPFA 4ONUA 1Y3TA 2E9QA 4MGZE 4QM9A 3VHRA 1WGPA 4KWKA 2H0VA 3MYXA 3TNPB 5FDBA 4HVRA 4EROA 4EWEA 4LA2A 4KWLA 3SCFA 3EJKA 1XRUA 4F8AA 1G6NA 4XF1A 3PNAA 4R8HA 1GQGA 2PFWA 4IEPA 5BPXA 5FPZA 2Q4SA 5KHKA 4O9GA 2V09A 2XLAA 4AVAA 3CF6E 4HMZA 4LULA 1CAUA 3BPZA 1LKNA 2PAEA 1SFNA 1NE4A 5I8SA 1ZZ6A 5KHIA 2UYBA 5T3NA 2D5HA 3ROUA 2FMYA 5CU1A 3H8UA 5LEJA 4LUMA 4F7ZA 4XF4A 4MGYE 5E1RA 1CAXB 5I8TA 4AXOA 1UCXA 4BYYA 1ZZCA 1L3JA 1DZTA 2Q30A 2GC2A 2IC1A 3SXWA 3DL3A 3U11A 4TLFA 1WA4A 1RC6A 2DCTA 3CJXA 3KGZA 1J3RA 4UBHA 3RDIA 1NYWA 4IEYA 2B9UA 2B8MA 5FLJA 4LA3A 3NVCA 1ZNPA 4IEWA 2P17A 3U0ZA 1X82A 1ZREA 1J3QA 3OCPA 1EYBA 4I01A 4EV0A 3BU7A 5LRSA 1YFYA 3ZDSA 5F1RA 2BNNA 1Q43A 3QACA 1QXJA 2KXLA 4HLTA 4X6QB 3LZZA 2XGXA 2GC3A
chains in the Genus database with same CATH superfamily
3PUAA 3RI9A 5F5QA 2B4KA 3NV1A 4I0AA 2H0BA 3P5BA 4G4FA 3WQ1A 4P9LA 4CDXC 4N43A 1PZ9A 4CPBD 1GNYA 2VULA 1WW4A 5T5PA 4Q4W1 2GH2A 2XL7A 5D8AB 1Q8PA 1AVBA 5KXBA 1WWYA 4BHPA 3SCGA 4BK4A 2BBAA 1BVVA 1XE0A 4DUVA 5FP3A 3RWKX 2WS92 1N1TA 1BK1A 1RUC3 2FMDA 1TNRA 3AXEA 2JDZA 2A6XA 5DDJ2 3LB9A 4JGYC 5H9SA 3RYPA 4TZDA 3KWVA 5H9QA 4H7LA 1QJZA 2IXCA 2EXHA 4B1MA 1F15A 1N47A 3OBAA 4XXPA 2XONA 1FT9A 2Z2SB 3VBFA 3KV4A 3VHOA 5C3RA 3P1IA 4YG0A 1AR83 2OX0A 3FC0A 4EZHA 5HBAA 4UFHA 2X5IA 5CA6A 1VBE3 4Y4RA 1UX6A 2E7AA 3W20A 1V6OA 3ZDVA 3CL1A 3KVAA 4JZRA 3LAGA 3O0XA 1JZ2A 3S6PA 5CKQA 1VBA1 3TB0A 4Q0QA 3KQ4B 1LCLA 2WNEA 1RUJ1 4IV3B 4FPEA 4FOWA 1CR7A 4RR3C 1V6JA 4AHZA 1LEMA 3TEZA 1BMV1 1J83A 2VE1A 1QJU2 4HBNA 4A4AA 3UGHA 1UY2A 4AF9A 4QGNA 1N1SA 1BKZA 3USUA 3CJIC 3BODA 4OI2A 5K0UB 4CU7A 3JB8A 4IEOA 1VE0A 4Q0VA 2BZDA 4J1WA 4LIUA 4Y1VA 3VBUC 1R64A 1B35A 4IE4A 5JR7B 4DRRA 4CUCA 2GZWA 3AP7A 4Q4V3 4OHWA 3TN91 4NPMA 1AR63 2YDEA 2WT1A 1UD1A 3FLRA 3N9PA 3RJRA 4TWTA 1UXXX 4UFIA 3WNLA 5C5UA 3DN7A 1H4GA 1CZVA 4N53A 4Q4Y1 2Y6JA 3Q8EA 1URXA 3JB4C 3AZWA 3MF9A 1OD3A 4AHYA 3SC7X 4M3CB 2QQVA 2C5DA 4IEXA 4A6OA 2XLFA 1W9TA 3SEEA 5F8PA 4Q8KA 1UYZA 4NHKA 1H4HA 4FFFA 1W90A 5BNOA 1OKQA 2GP5A 3NNLA 3OUHA 4YM3A 3LOIA 1R083 1L7QA 2AREA 3VKNA 4QPIC 2RJ2A 2W91A 3DKQA 4DUWA 1RMU2 5CZKA 2OYZA 3WNPA 3OUJA 4BIOA 4WBBA 1QGLA 4YM1A 5J96B 3APBA 1VBC2 1DFQA 4N8MA 1W9SA 5D2AA 2R042 1C8M3 5FYBA 1F9KA 4XQWA 1K5MC 4EN0A 2D5FA 2ZEWA 3LEIA 1Q5OA 5CFDA 2E6VA 4WVZA 2RS13 1S2KA 4ASLA 1ZBA2 3EYPA 3JD72 1H30A 1ZRFA 1KXGA 2R062 2ZGRA 1OXCA 3FLPA 1HXS1 4UF0A 4AFCA 2E7TA 2HWD1 3HN1A 5D8AC 4FAGA 3AXDA 5FLIA 4C1WA 3QCWA 2IXJA 1FNZA 4IXLA 1KFXL 3JQWA 5F37A 1OA4A 1YXWA 4UBGA 3THCA 3ZXFA 1OF4A 4LO4B 1OC1A 1W3VA 2BPA2 3MO4A 2NLRA 1MEC2 2JG8A 4K8RB 5AFEA 2JE7A 3BVCA 3D6EA 1YJLA 3LEMA 2YBPA 4C1XA 1WW5A 1Q56A 1SMVA 1WW7A 2OT7A 2V5DA 2JJ6A 5FUPA 5A7WA 3ZFEA 2JG9B 4CDUB 5C4WC 2D6LX 1QJY3 2IUWA 5JAXA 4YNIA 3T2OA 3FLTA 4FCAA 1IS6A 4BMEA 1LOFA 4KL1A 4PQ9A 5K9YA 5FP4A 5FQ0B 3POFA 1UYPA 5FV3A 3HPNA 4G9SB 4JKMA 2C9KA 4IV3C 5BNNA 2XPJA 2BGCA 2BOIA 2IZWA 3NV3A 4E8DA 5L36A 2RS32 2NMNA 3C2UA 1TEIA 2QQUA 4NRPA 1RUC1 4GA9A 3VBRA 2WFF2 2QCSB 2ZHNA 4GALA 5T52A 1FMD3 1JYWA 4MVTA 1O59A 2IVJA 2BQPA 2EAAA 2VVEA 3T1LA 1LAJA 1JTZX 2WJSA 2RVAA 1VBE1 1NLSA 2OQ6A 1LHNA 4O9EA 4XUPA 3B94A 5IW0A 2WBKA 1W6MA 3POIA 1XE7A 1ULEA 1IGOA 1YQ2A 3E97A 1EY2A 4A7KA 4RS5B 2ZS6B 4AGRA 3B69A 5JZGB 4FPGA 4MUVA 1RJ8A 2E53A 3POYA 2DUQA 1U5ZA 1GZWA 3H8OA 2WWJA 3GHNA 1C1FA 5KHHA 3K2OA 5DXDA 3WNKA 5JMOA 3WF3A 2XUMA 3BIWE 1EV11 1NA1A 2LROA 4XFFA 5IAVA 3E6CC 2Y6FA 3HMYA 2WA4A 4RHV3 2RS51 1U5YA 4Q0SA 3KSCA 1W6OA 4Q4V1 1UWWA 2JD9A 5K0UA 4YYOA 1AR61 2X53S 1OQDA 3WOGA 1HRV3 4BE3A 4JGZB 4MADA 1X7NA 2XHKA 2WINB 3JBG2 3U10A 1QU0A 1V00A 4XJWA 1XNKA 1ZA4A 4NR1A 4BDVB 2GMMA 3IDCB 1AYM3 4FPOB 2TEPA 3WW3A 4XC9A 4DO0A 2VUDA 2XJSA 4M3CE 1DF0A 1COV2 5EYXA 3T2TA 2MEV3 1AYN2 1R093 3ZSKA 2RDNA 3A4UA 3I2FA 1OHFA 2L9LA 4R9BA 3WDYA 2O14A 3IDAA 4XTMA 4XACA 4FTEA 2C9AA 5FZAA 4QX7A 2JDAA 4L92A 5J48A 5A3OA 2VBDA 2PAKA 1AHSA 3D8CA 4NHLA 1IQAA 2NYYA 2YPDA 1BQPA 1EAH2 1UZYA 2BWAA 5F3IA 2UY8A 3ATGA 4AOCA 4EN7B 1GFF2 2VCMA 4XDQA 4CU9A 1LESA 2FCTA 2JB4A 2RS11 1XSQA 4AZZA 4LEJA 4EWAA 3D0JA 2YPJA 4NOTA 2D40A 5FYCA 3ENRA 2BP6A 3WR0A 3T2QA 4AYUA 1MPXA 2VVDA 5FZ4A 2CGPA 1NE6A 3VKOA 1XQNA 5FK7A 2FDFA 1Z0HA 4QX2A 5FYIA 4BISA 1UKGA 5JIAA 1AR92 3M3IA 3SKVA 4TN7A 3I2JA 3AM2A 2NN8A 5JSRA 5FOJB 4LBLA 1UZ0A 4H14A 4HN1A 3ZLIA 5J3UA 2JXAA 2HEWF 1UKRA 5LASA 3AP9A 5KHGA 1QHDA 1QJY1 2ZKLA 5FRAA 2FZ2A 1YLLA 2DWRA 3LEKA 4YARA 1RHI2 2VW1A 1P8JA 2VMFA 3ES1A 3AYEA 3NMBA 4Y5Z0 5FZ8A 4GH4B 2HWE2 3E5XA 3W21A 3M3CA 5JZGC 1D4M3 1XXNA 3DF0A 1QOSA 5HI0A 3V64A 4QX0A 3FHQA 4Y1UA 3PVNA 3SLIA 2XJPA 1FMD1 1ZVFA 4XFBA 3ITQA 3HQRA 4AR2A 1J3PA 2ZEZA 5FY1A 3N35A 1RUH3 2NZ9A 2DVAA 5FY7A 3FFQA 3LKJA 5FYYA 1ND2A 3KLSA 4F3JA 1QQP2 4HPKB 5HPOA 4K1YA 5A6QA 2PLV3 2WNUB 1GOGA 4CCMA 4CCLA 3AZYA 1GKBA 1HRI3 4HANA 5FP7A 1CX1A 3AKRA 2VXRA 4JHZA 5FUNA 4QKBA 4Z07A 1OOPA 1QJX3 1JYNA 2ZEXA 5C8CC 1SBEA 4GJZA 1G9CA 1YQCA 2V72A 4LHSA 1RUF3 2ZX1A 5EJ3A 4MH0E 4IE7A 4OLLA 3WP3A 4AAPA 4NROA 5LBBA 3WF0A 2D44A 1MZFA 2Y0OA 4MHRA 2HKXA 4OUSA 4XFAA 4AW7A 5JXGA 3NNJA 4Q1PA 4Y20B 1BJQA 4BK5A 2VUCA 3M3EA 4K9SA 3LDKA 4LUKA 2P1BA 4Q4W2 4BLIA 5CKNA 2VOTA 4JQRA 1D2SA 2VZRA 2WO3A 4NIAA 3MICA 5DZFA 4Q27A 1VB2A 4XVHA 3VDBA 5C3SA 4R52A 2D97A 4N90A 3RMYA 5FQ0A 3H7JA 5A3PA 1H1MA 4P14A 2B46X 3MUY1 2YU1A 1V9U2 5CKMA 2D6NA 2NQYA 4YZ3A 3I54A 4QXKA 3CQOA 4YWAA 3UYJA 4AI2A 3UESA 1NQDA 4LR4A 4A44A 4IEUA 5J09A 2H6CA 1R091 2MEV1 4FXKB 4MG2A 3RNSA 1VJ2A 5AVPA 3V0BB 1WCSA 4QU2A 3U78A 1R1A3 1ZRRA 2QVSB 5A1AA 5I0DA 3O1VA 3N7MA 2W1SA 2RR13 3U1XA 2WZR1 1I9RA 4E2QA 3LA2A 3CMGA 4QMAA 5FYMA 2V5YA 1RUJ2 1ZZ8A 3I3QA 4D6RA 4Q2FA 4XBQA 2A7AA 4RS5A 3J8F3 5CIRA 5AC91 1W8TA 1WCKA 4QAWA 3OD4A 1TVGA 4LO5B 4XF9A 2VMEA 3MLJA 3PVEA 4CUAA 4HT1T 4JV4A 5J7MA 1VPHA 5LY2A 1O3QA 1CX4A 1AF9A 1FPN3 4PBOA 1QIQA 2MPFA 1V6KA 2Y6LA 4ZS2A 3TEYA 1XYOA 3NV2A 4MGZE 2P3IA 1IQDC 1W8WA 1WGPA 4XUNA 4DRVA 3TN92 1AL23 5GZCA 4FP2A 4HONA 1WUVA 3TNPB 4WVMA 4GH4C 2CU5A 4N7IA 4KG0A 4JDMA 3GZEA 4Q4Y2 4ASKA 3J7HA 1HJGA 2JX9A 3N3HA 4NHYA 5FZ3A 4UI9L 3EXUA 4BB3A 3BTZA 1FV2A 4CEWB 2P34A 5FP9A 5A32A 3BKZA 3O0VA 1ZYBA 5BPXA 1NCRA 2QQMA 5CISA 1DQ2A 5LZ6A 4RGGA 5KHKA 5BNQA 1GNHA 1V6NA 2AACA 1VRH1 1T6BX 3FBYA 4BQ4A 5FOBB 3MGUA 2R073 4NPLA 2PHXA 3M7AA 1LOAA 1ULOA 2V09A 1H6YA 2WO1A 2XLAA 3K77A 4FO9A 4LULA 2EIGA 2VG9A 4AVAA 4QDQA 5JVVA 3T4VA 2QQLA 4A3ZA 3LCPA 5FO8B 1MS8A 2XJTA 4CDWB 2XB6C 4UW5A 4CUBA 5KHIA 2WNVA 1RYYA 3WEZA 4QX1A 5J98B 1RUG2 4YZ2A 4LT5A 1S2BA 1VALA 3ME2A 2A71A 5DZEA 5EJ1B 2VMIA 3ROUA 5CU1A 4PLMA 1RINA 5LEJA 3DYPA 2YBKA 3IAQA 1LOBA 4FOQA 4F7ZA 3MI8A 4IW3A 3RJ2X 5IHRA 1OF3A 1YYNA 1GWKA 2QQNA 3ZMOA 3AVRA 4AXOA 1MS3A 2QKDA 1I3HA 1HB3A 1H0BA 3A21A 4BYYA 3FHAA 3AFGA 1PO22 1OSGA 2IC1A 4LBQA 4MXWB 2WYSA 3SXWA 3U11A 4TLFA 3T0BA 2D6PA 4FFGA 3I3MA 1HXS2 3VDDB 3TAYA 1NLQA 2HWD2 1JYCA 4CP9B 5L9VA 1J3RA 3POSA 2PLV1 1AJOA 5JPMB 1UY1A 1HRI1 4IV1C 4RYDA 4UBHA 4QDSA 4COWA 3NNMA 2B9UA 1QJX1 2B8MA 1UOGA 2GH8A 3NNGA 2YV8A 4BQ3A 4F83A 4MO3M 3NVCA 2GNBA 2W47A 1X82A 2XQXA 3B5LB 4M01A 4NRMA 1Y9MA 4Z2WA 3OCPA 4D69A 1EYBA 3WCSA 3BU7A 3WLUA 5F2WA 1YFYA 4OUMA 5LRSA 5A3NA 5F1RA 5GJ6A 3FN9A 3CIHA 1Q43A 1QXJA 4XMAA 2G9ZA 1YJKA 4X6QB 3LZZA 4Z2AA 2XGXA 3O1RA 2GC3A 2GDFA 2AYHA 4C8DA 4N9IA 1ALYA 4AQ2A 5FO9B 4PBPA 2OPWA 3SEPA 5A1LA 3NNFA 5BNPA 2E7QA 2E33A 2QDRA 4O61A 4YM0A 4FQ4A 1VMFA 2VCCA 3EMRA 5HCAA 1GP4A 3C7EA 1SDDB 2DURA 2IWGB 2W39A 4TYSA 3I49A 1HV1A 2JE9A 4GWNA 1YRZA 1KGYA 1O3SA 3D5OA 4OYUA 3SHRA 2VJXA 1JZ7A 1J59A 2WSVA 2XL9A 3B01A 3WX5A 1OD5A 4BQ1A 4CCOA 1PMHX 1KITA 3HQUA 3ACIA 1E5RA 2XQRA 1DLCA 2EAKA 2BVBA 3POEA 3Q8AA 4DXTA 5IFPA 1VBE2 1N3PA 1POV3 3IMMA 2X05A 1LOEA 2QQKA 4AGVA 4QXCA 2K9ZA 3UGFA 4RGAA 4EWDA 1WD3A 3WHUA 4ARXA 4PIXA 2WNUA 2W9XA 4LK7A 2Z79A 5FR3A 1F8VA 3J8F1 5CFCA 3AYAA 2RHPA 4GJYA 1H8TB 1Q8VA 3AMMA 2VAUA 2VM9A 3ZPYA 4QQPA 1A8MA 1IPSA 3QLQA 3T4HB 1EV12 3B93A 4YG6A 1UZVA 4ZU7A 4XAEA 2Y38A 5EIYB 2RS52 1G86A 1D0HA 1Y9GA 2VR4A 1H8VA 3RWNA 1EPWA 4COUA 5FLHA 1G7YA 4UFKA 3J9SA 1W8UA 4CDWC 1AR62 4LBQD 2VNOA 3ILFA 2BGOA 4P9GA 4OI0A 5I0SA 2XG3A 3BTAA 4DZGA 5C9AA 2V4AA 1MQTA 3LD8A 5IAXA 3RYKA 3ZXDA 1JOJA 5KC5A 3H42B 1OVSA 4QXHA 3ALQA 2RDQA 5T55A 2CGNA 2YC4A 1SLTA 1DGRA 4RQPA 2NM1A 4DFSA 4JGYB 3BTYA 2IVIB 2Y6GA 4UW3A 3GBWA 4IE0A 4U36A 4Z1VA 1W28A 3EHKA 4HK8A 1CAUB 3F2ZA 3HR9A 4YM2A 4YVSC 3WW2A 5C3OA 3V0AB 2R0FA 4CXXA 4MGKE 3MHZA 3VDDC 3MEPA 1NCQA 3T0DA 1UZZA 4BH9A 2UY9A 3ZXAC 4QB2A 2DBIA 2JE8A 1RUI3 3NSTA 1QH7A 1DYKA 4BMBA 3AL6A 3WCRA 3MLLA 5JOYA 5ABJA 3C7GA 4AQ6A 3SITA 1HQNA 3ACGA 1XOYA 2RS12 2YGMA 3KCCA 2WRAA 2A6VA 1GWMA 3J4UH 4EN9B 3H8XA 2W1WA 2ARBA 3E6BA 3VV1A 3AKPA 2R0HA 3BIEA 1RUE3 3OY8B 2P6CA 2GU9A 1M06G 2EALA 3VBUB 1LU1A 5DN2A 3ACHA 4D94A 2R1DA 1KQRA 2VY0A 2WZPP 2WAOA 4E2GA 3H9AA 2TUNA 5FY5A 4XJ9A 1O8PA 2N7GA 3ZFGA 4BIFA 2QQWA 1O5UA 4MGTA 4DMIA 4MSVA 3DKWA 2CTVA 3K75B 4H3WA 4CEWA 1J1LA 1XNAA 2OVUA 5CG8A 2BYVE 5F2SA 2XHNA 3GALA 1ASJ2 2P3KA 2W5FA 1POQA 2AZ5A 2WDBA 4W6XA 1LGBA 1RXGA 2I07B 5FPAA 4XQDA 3AX4A 2XXZA 1VLNA 2AC1A 4XUTA 3VD3A 4B4PA 3VBOA 4DNYA 3HQXA 1CESA 3TWIA 1HIXA 4QU1A 4W6YA 4B29A 2FDGA 4PHZA 1V6MA 3RRDA 3JQXA 4LIVA 1QKQA 5DAWA 4ISRA 2PHTA 5B4NA 2W1QA 3O1SA 5JMCA 3ZYBA 4Z82A 1H8TC 1XC6A 1K5MB 1W05A 4K21A 3RPQA 2XBO3 3KS7A 2QQOA 4MX3A 3O1TA 3ST7A 1W6NB 1YI7A 1ULCA 2VCAA 1QXPA 1S1AA 2ZACA 2WUHA 1GOFA 3KMHA 1SBDA 1JZ8A 4ZS3A 1POV1 2JKBA 1PMIA 3U75A 3WY6A 2JICA 1H1AA 1JMUB 4AE2A 4CEYA 4Z92B 2DTYA 4CSWA 2VZOA 1OBNA 4KWJA 3WG1A 2EXIA 5A33A 4GB33 3K4DA 2WO2A 5F3GA 5CB7A 1PVC3 1TNFA 1FATA 1AR73 3NAPA 4XDPA 3NO8A 4AAXA 2O8OA 3UL2A 2HEYF 2XVGA 1C8NA 1X33A 4IGOA 2J1AA 2ZAHA 2ZEYA 5LRRA 3PJYA 5FK8A 2P3JA 3UJQA 3BOWA 2PHWA 5FZHA 2Y0IA 4OVEA 1LHWA 2Y60A 4D3WA 4RD7A 2D43A 3UETA 2JENA 4E8CA 2HWF3 5C4WB 5DAPA 4BZ4A 1OMIA 2WZEA 2YYOA 1DGWX 2EICA 1X8EA 2WQ4A 2C26A 2ZGSA 2D6KA 2I45A 3CO2A 3WQBA 1QJFA 5CYYA 1GP6A 1SPPA 2WZ8A 3UKTA 3ZN6A 3WW1A 4KWUA 5B2GB 2LTNA 1JHJA 5DAQA 3F95A 3J7LA 1M4WA 3ZO0B 4EN6B 1PGL1 2HYKA 1RUD3 1NY72 1CAVA 3R6SA 1UYYA 4QQ2A 2MEV2 5CADA 1KRIA 2FCVA 4MHUA 3N4MA 4LO6B 1LHUA 4GKXA 4JVAA 5EPAA 2HBUA 4PQQA 1JS9A 1OVPA 1NUKA 3N7JA 5A6XA 1L7RA 1JI6A 1PZ8A 5F9TA 2WZR2 3FWEA 3HNMA 3IDBB 3VZLA 2E51A 4I0BA 4Y22A 3ZOIA 1WMDA 4GMP0 2ZX2A 3HNBM 4QX3A 4XURA 2JDHA 4BQWA 5C5TA 3MIHA 5AC92 4PIZA 2ZMNA 3LQCA 5H9RA 1K42A 2RDRA 1S0FA 2X09A 3AMHA 4FBFA 3WDTA 5BUVA 5DZGA 3ZN5A 4UYBA 2W68A 2OQ7A 2YG0A 4I2OA 1BEV3 3I3EA 1LNSA 3P6BA 3PUHA 1A78A 5CNAA 1LOFC 3ZYRA 1RUE1 4FT8A 1PO13 1QH6A 4BQYA 2F6BA 3KF3A 3MPPG 4CDXA 4O65A 3I59A 4LMFA 5A7PA 1RVF2 4XUOA 3KVBA 5FZGA 5FFOC 5LA0A 4XF0A 1O5LA 4NJ4A 5IWFA 2Q1FA 4RA0A 2ZOEB 5JI7A 1S55A 2A5ZA 4P00B 4BM8A 1VRH2 3PJQA 4JGYA 4W4ZA 1W8ZA 1XPWA 5FZMA 2ET7A 1VBB3 3DYMA 5A80A 5DG2A 2JDYA 2A73B 3AVSA 3WINE 1EP0A 2VECA 5FZEA 3ZSJA 4JRLA 2VXJA 4OHYA 1S0DA 1PIV3 5FKBA 2NPIA 1SEFA 5IJRA 4D7SA 4NUBA 2WAAA 1C3HA 1WBFA 1G8WA 2ADEA 1OQ1A 4GWJA 2ZTNA 3BYWA 4HSLA 4IEQA 2WWUA 1NXD1 4L11A 3PTYA 4RR3A 1DQ0A 5DG1A 3OPZA 4MZUA 3IT8A 2FZ1A 4B7KA 2XBO1 2OA2A 2VZTA 2VTXJ 3JZVA 1AXKA 1GR3A 5HV4A 5LATA 1IG0A 4W65A 1WLWA 1GANA 3PVOA 5FP8A 4XFCA 4GWIA 3Q8BA 2P2KA 1IKQA 2W1UA 1ONAA 3I3DA 2A3WA 3CJIA 4Y1YA 2A70A 5JOWA 2PLV2 4Q4X3 1OLQA 4FTSA 1HRI2 2QJVA 3MV11 4YG3A 1QJX2 2VMHA 1H2MA 2EF6A 2ET1A 3PUIA 4ZU4A 5DUWA 4HKLA 1PVC1 3ZX7A 2FQPA 4PI2A 1AR71 3W58A 5JCTA 3AMQA 5GZFA 1HN0A 3ABZA 3PVBB 4OULA 2FBEA 5F6KA 2KR2A 5IVYA 3WDXA 3RZMA 2W2IA 4YW2A 3ZPOA 1D4VB 1VBD3 3OSDA 5DUUA 1US3A 5HCHA 4ATFA 4KBBA 1AR81 1UX7A 4K1ZA 1CQ9A 1CAWB 1XNBA 3FBMA 5AVAA 1TME3 4AGGA 1BBT2 5HV0A 1YC61 2K46A 1DQ5A 1JZ3A 2DUOA 2JDPA 5LEKA 1LOGA 1Z7S2 5BYNA 1W9YA 3PURA 3MUZ1 1NQJA 3OEAA 1VIWB 4GWMA 1HN1A 4QPIA 2VZQA 1CJDA 3SNMA 3ZXGA 4AI8A 1JZ4A 1NXMA 1XNDA 3ZSEA 1UYXA 3N9NA 5L7OB 1QNWA 1IPJA 4YZ4A 3C7OA 4IESA 2MHFA 1A8DA 2AEYA 4P9JA 5JSPA 1FOD3 4OUEA 3T1MA 1RUD1 1AX2A 3MW3A 1MS4A 4Y5SA 2GC1A 2O1QA 3J7MA 4LBJA 3URFA 4NIHA 4Q1RA 1K5MA 1V6LA 1FYUA 1YQ8A 3HBKA 3IIAA 4XEZA 2RV9A 5D1IA 2YUEA 1O6UA 3H50A 1R1ZA 1UU4A 1F35A 4ATEA 2W95A 3VL9A 4QQHA 3VUOA 1XU2A 2BEOA 1UIJA 5HXMA 2BVVA 4O7XA 4ZY9A 1J84A 3UKNA 1JU3A 5GZDA 3RMXA 1S0EA 5IVCA 5D8AA 4BQXA 5C8CB 1HQLA 3MIEA 4MGSA 1V6IA 2WS93 4HXCA 4E27A 3K51A 1LTEA 1UIKA 3K3NA 3LE0A 5ANQA 5DDJ3 3VKLA 5KXDA 3AKTA 2VOKA 4BLJA 3VHNA 5SV5A 1O91A 4OHVA 4S2GA 5T5JA 3O1OA 2VVFA 1ND3B 1QNYA 3AP6A 2Z5WA 4E4HA 1BEV1 1LR5A 2WFPA 3BU0A 1R081 3EB7A 1GUIA 1PO11 4WM8B 1SDWA 4LQRA 4S2HA 3C7HA 5DUXA 5JOXA 5IK5A 5JR2A 3WUDA 5E6HA 3AK0A 5F6LB 3FE5A 4XIKA 3SISA 4RL7A 5A7OA 2C0ZA 4C0HA 1A3KA 1Y4WA 4ONUA 5JLVA 2ZBJA 2A6WA 1C8M1 4IV3A 4R4XA 2BW8A 3N36A 4XCBA 3BTXA 1QJU3 2H0VA 3MYXA 2DVGA 5FDBA 4HVRA 4EROA 1SLCA 1ND2C 1VBB1 2YBSA 4AFBA 1XRUA 3HEIA 4GIQA 4W8JA 4AI0A 3IN9A 1I5PA 2Q5TA 1TMF3 2ZGTA 2ZHKA 1GQGA 3DEMA 1PIV1 1XYPA 5FXVA 2Q4SA 2YHJA 5APAA 5JOZA 5LA9A 2FHRA 2GN7A 3ZYFA 4HMZA 1CPMA 2KA3A 3WQ0A 4INDA 3WNXA 1LKNA 2HWB2 1ZA7A 4QHBA 2OIIA 2FDKA 1ZZ6A 3DYOA 1LHVA 3SKJE 4M3CA 4P9WA 3O1PA 1AUYA 1W0NA 2F17A 2I2SA 1W6PB 3H8UA 3AJZA 3RZLA 2WO7A 1CN1A 1YCIA 1ULPA 2VZ3A 4MGYE 4QQOA 4XF4A 1KD7A 3RFRA 1CAXB 2X8KA 5FMCA 5I8TA 2YB7A 1KS4A 1UCXA 2QQJA 4RFRB 5FWJA 4M0NA 2B42B 2Q30A 1EUTA 2PHFA 2VBBA 3DL3A 2FD8A 2VU9A 5L7OC 1VBC3 4TTGA 2AGSA 1WA4A 5B4XA 4AQSA 4E9KA 2R043 2R1BA 4LHLA 5J1XA 1WW6A 1BZWA 3ZFFB 2GSYA 5IVFA 1PHMA 1NX9A 1NYWA 4IEYA 5FXWA 5FLJA 3JD73 2OUJA 2WKKA 3AZXA 1TME1 2R063 1T6GC 2DF7A 3PIGA 2JDMA 3ACFA 1ZREA 1J3QA 1DU3D 1IHMA 5A6YA 3ZR6A 3KT1A 5FPVA 1D2QA 4K20A 4LORA 3OYWB 2BNNA 4NN0A 4MGQA 1CZTA 2W92A 4CXWA 4FOYA 1FOD1 2VOXA 5A7NA 2ES3A 1MS9A 3FJSA 2PQQA 3ON7A 1MEC3 2PAMA 3LPFA 5IT6A 4LXLA 1ND3C 4Q0PA 1OA2A 1W6QB 3RGBA 4FQZA 1GZCA 4PDWB 4RHV1 2Z42A 4WM8C 5FJHA 5FXXA 2DFBA 3ZIWA 2NP0A 2EXJA 4YZ1A 2IXKA 4CDUA 4OMCA 1XNCA 2JG9A 3MIDA 3HT2A 1YEWA 4K40A 5HCBA 1HRV1 4IV1B 1YFWA 4MYEA 1SACA 3PIJA 3ZYJB 3OF1A 5JSOA 2J1UA 2RS33 3WF4A 4AFDA 4WM7B 4NPRA 2AEZA 2DCYA 4HOOA 1AYM1 4QKDA 5DDJ1 3VZKA 3ZKUA 4ZZ5A 5K8SA 5CG9A 3WF2A 2WFF3 4DY5A 2XMLA 4QPGB 3B9CA 1OT5A 2WABA 2WT0A 3GJAA 4KGGA 2W0XA 5A7QA 2LM3A 1YIPA 3WDUA 3TBDA 4AEDB 5C3PA 1PGL2 2XKPA 4P08A 1JU4A 5FZKA 3BI3A 3BGAA 1CPNA 1REFA 3FUQA 4S2DA 4XYXA 1VBA2 2V73A 5IYYA 3NJZA 4DINB 1PMJX 2OZJA 1DGWA 4UXAA 1AXZA 5FZOB 5ACA3 5LA1A 3ACLA 4Q29A 4D6QA 1I1EA 3T08A 1Q8SA 4COZA 1UQXA 1XB9A 4YZ5A 4HL0A 3S57A 4QX8A 1BMV2 5JZGA 2VNRA 4NMIA 3LA3A 4XBLA 2J1RA 3BALA 4L0PA 1QJU1 3NKGA 1E5SA 2RG4A 2WQZC 4PJYA 3PUSA 3R4SA 2XLGA 3VLBB 3Q8FA 4IEVA 4XFHA 4YVWB 5K7PA 2DU0A 1N1VA 2XUEA 1PK6B 1WMEA 1HQWA 2GNDA 2D6OX 1TMF1 2GP3A 3OUIA 3G7DA 2G1MA 2K0GA 4GD4A 4L2NA 1WKYA 4J1XA 4CA9A 4YW5A 3LDRA 5F32A 2HH9A 3JBG3 3KHBA 1REDA 2B5HA 1REEA 2FCUA 4JGZA 3ZXJA 2XWBB 4SLIA 3MZHA 3VD5A 3THDA 3MLKA 5C8CA 3RG0A 1GMMA 2ZGUA 3ZFFC 3PDQA 2WSUA 3RZKA 4LKEA 3KCXA 5FZ1A 2OKXA 2QZ3A 4UAPA 4ASMB 5C33A 5IFTA 3MFAA 3IKWA 4LTAA 1PNGA 3L2HA 4PI0A 1AYN3 3L2YA 1XSRA 5L73A 4UW4A 4XCAA 1US2A 1NZCA 2XJUA 2ZGNA 3INAA 4EN8B 4AI3A 4M00A 1K3IA 5T54A 5I0UA 1CIWA 3OPTA 4CDQB 2YGLA 1LODA 4DXZA 1W03A 2VD7A 3KT4A 1FX5A 3DXTA 2QFEA 3VKFC 3LEGA 3RSJA 3EO6A 1D4M1 3SQOA 4NVPA 4P9XA 3K4AA 4W50A 2G19A 2VOWA 1UN1A 2DCJA 2OS2A 1EAH3 4KG8A 4FPFA 5G04L 5LWBA 3ZMNA 3DPRB 4MXVA 3VBHB 5HXVA 1TE1B 2Q1ZB 1IS3A 1K12A 2Z4FA 5FYUA 1G9AA 3WNNA 3POGA 3JD71 4YVSB 3VBSB 1RUH1 2JECA 4PDWC 2Q8EA 1NZIA 4IE5A 3MW2A 3OGRA 2GAUA 3NW4A 4B8EA 1DLLA 3I2IA 3RS6A 4V1PA 2CYFA 3JXSA 3LA7A 1YHFA 5T5LA 4H7MA 1A34A 1RUF1 5EJZB 4WM7C 2J1EA 1HW5A 4DY3A 1MEC1 4M4RA 3N7KA 4QPGC 5KWRA 4N43B 1WLTA 3IDEA 3BOPA 4UFJA 4XJ8A 5FPBA 3D0SA 1ENRA 1UW8A 2J1VA 4AEDC 5JWPA 4YW6A 3DV8A 2CGOA 2O0OA 3O5SA 4NHMA 1CWPA 2VW2A 4ZXKA 2DVBA 2BFUS 3WZ1A 1RHI3 1ZZ7A 1PVC2 2QUOA 2OUHA 2UWBA 2ILMA 2SLIA 4JC1A 1RUOA 1JYXA 2HWE3 2PELA 3M2MA 4DB5A 5FZCA 4GH4A 1RUC2 3RVHA 5FMOL 2VMGA 3O7OA 1FNYA 3H3LA 1CVNA 1QXRA 3VBFB 2UWAA 4ORFA 1YUDA 3LSEA 1OLME 4IETA 2VNVA 3LPGA 3M4FA 3VN4A 2WT2A 1NCQC 2X5IB 3OGVA 4Q5OA 1AR82 4ZONA 4X6RB 4YVWC 3WW4A 4A7ZA 1PK6C 2XKOA 3HT1A 2X10A 2EIDA 1WBLA 5EFUA 3UNPA 5G05L 5A70A 1R1A1 3LF7A 3RQ0A 1LGCA 4NAOA 1EPZA 2W46A 1K5JA 4XDOA 2RR11 3B3QE 3HOBA 4HPKA 3AP5A 5I0TA 4IERA 3HBZA 5F5IA 1SG3A 1SFYA 1UMZA 5SV8A 4HSJA 5ACA1 5IVVA 3C7FA 1TZOA 2EXKA 3OTFA 3I7DA 3KM5A 4PF5A 1ODNA 3IBMA 2KM2A 2VC9A 3IB3A 1RUD2 3H0OA 5FZLA 3USUB 5KXEA 3D4KA 1H2LA 2IXIA 2W08A 3OBRA 3ZR5A 1E5HA 2HWC3 3DECA 4LO8A 4QPWA 4D7YA 3LFIA 2VZ1A 1B35B 1VR3A 3PUQA 1FPN1 4J6GA 4ZU5A 4LOTA 2ARXA 2ZX4A 1W6QA 4GMP3 4YGDA 3QBQA 1PGW1 3PTRB 2D6MA 2D93A 4Y20A 3GZTB 4AHWA 2ADDA 2VQAA 1JODA 1AL21 2WNOA 4HETA 4Q4V2 1O4TA 4CDQC 1JHNA 1ENSA 3PMSA 4CU6A 1UPIA 4N53B 4EYUA 1JZ6A 5FO7B 1W2NA 2VO5A 1SCSA 3WNOA 1CGPA 2HYXA 4UOJA 1O3RA 1AL0G 4JTNA 2DU1A 3V65A 1S0CA 2XVKA 4JDOA 1V9U3 3WQ7A 1MS5A 3PHMA 3DPRC 2EA7A 4EQVA 3OJBA 4QHOA 3VBHC 5BNOB 2Y6HA 4FPLA 3WNMA 1OLMA 2JWPA 4YGCA 2UWCA 1BEV2 1V70A 3AYDA 3KZ4C 2BNMA 1OURA 1R082 1AYN1 1GZTA 2R071 3I8TA 4Q8LA 3VBSC 4AVTA 5I8YA 2DBNA 2RM23 3KV9A 2J22A 1LHOA 5CBLA 3LFMA 3LWCA 3V0BA 1RUJ3 4QDRA 4AEJA 2VMDA 3KV5A 1S0BA 4HN0A 4BOWA 1HJFA 1C8M2 3NJXA 1SFPA 4OFGA 3C3VA 4XJUA 1HKDA 4JKLA 1WMFA 3IM0A 4IGPA 5FZ6A 5CFDB 5TSWA 4WVVA 2YZ4A 3DCQA 3M3OA 3T0AA 2RMU3 3GHMA 3H1YA 4JX0A 4N43C 1LENA 4QKNA 4XJZA 1VBB2 4C0BA 4A42A 1WLCA 4L99A 4CP0A 3W5MA 1W2AX 1QOTA 4B7EA 4CEYC 4UF0B 3N9MA 5DABA 2CAUA 1PZ7A 3VL8A 4CCDA 4PCRA 1VAKA 3WG2A 1N3OA 4CCEA 1QOOA 2BERA 4QM8A 2TBVA 2VZSA 4FOVA 5FYVA 1LULA 5IUQA 4M3CF 3U07A 1W8FA 3V56A 2ZGMA 2LRPA 4LKDA 2YC2A 2PXJA 1G9DA 1HX6A 2ZGOA 4TLGA 1LB2A 1KS5A 2EIEA 2JG8B 1H6XA 2YY1A 4QB6A 1ZRIA 2ZHLA 4WZCA 3VBFC 1S4CA 3M1HA 1JYIA 5EZWA 1C28A 3BCWA 1UU5A 4AK3A 4D0QA 5A7WB 5FBZA 3ZFEB 4NWVA 4E4DX 5KC6A 5L19A 2X5IC 3R05A 3D82A 1UZWA 5F3CA 1QMJA 3VB9A 5FYTA 1N1YA 3R4UA 2ZGQA 3LDBA 2D3SA 2VQUA 1QJY2 2PHUA 3ETQA 3ZYGA 5IK7A 2BBVA 2E63A 1Q8QA 2WN3A 2PHDA 5BNNB 1HDKA 2IFRA 4A2UA 1DP0A 4CDWA 1RUG3 3UGGA 2HWE1 3VGIA 3TYJA 4XZUG 1KJLA 1RL3A 4QWNA 5EWSA 3VBRB 2AENA 1SLAA 2UYAA 4QX5A 3CU7A 5JUVA 4AG4A 2BU9A 3GBFA 1KDMA 4XFGA 4YGEA 3MIGA 4LBOA 4KMQA 2W87A 1FMD2 5FZ0A 4BCUA 5M0TA 3QH6A 3WG4A 4IDZA 3GDBA 4AHXA 4AVVA 5FMBA 3WG3A 1B35C 1PO23 1ST8A 4ITCA 1TME2 3AKSA 4LLOA 1W6MB 1H1IA 2R32A 4MXWA 5LBEA 1FXZA 1NAEA 2PA7A 2GNTA 2HWD3 5I0RA 4JCKA 3VHPA 2CAVA 3B7MA 3VDDA 2BOJA 4YGBA 2RE9A 3MF6A 4CP9A 4N53C 5D21A 2B7YA 1B09A 2LUWA 1WCUA 1HV0A 1OFSA 3NKTA 3CDZB 5FY8A 4HK9A 2EVXA 1FOD2 1YWKA 1U0AA 4CCKA 1C1LA 3ZSMA 4BPZA 1GBGA 2VPVA 5BNOC 1NA1B 2HEVF 4ZZ8A 2HWC1 2WLQA 2ZZQA 3K48A 3M70A 4D7TA 1JBCA 3WP4A 3IMNA 1Y9QA 2P6HA 1C5IA 5IVEA 1IZ3A 1DG6A 1W6OB 4GMP1 4L8QA 1XJAA 4RHV2 4IQPA 4WV8A 5E8AA 1DYPA 5A3WA 3VZOA 4A7YA 5KR7A 2ZGPA 4NIGA 5GLWA 1HRV2 1YFXA 3ZXEA 4OHZA 4XW3A 1ZM1A 4HKOA 4L97A 1C57A 1F4HA 4FPJA 1YI9A 1SZBA 4GXLA 1UAIA 4Y1XA 5FZIA 3ZVXA 5C3QA 3SH5A 2WL1A 1AYM2 2V4VA 5CFDC 3THTA 3B9IA 4XF3A 1V9U1 3PL0A 5DUVA 5T50A 3UJOA 1QEXA 2QQIA 5LA2A 1ZRCA 1ACCA 2CV6A 4RSUA 4LNVA 4DXSA 2YROA 3MIFA 4P9YA 2ZABA 1SHWB 1R092 4U2AA 3AL5A 3G6JB 3MV01 2YU2A 4LHKA 1ZBE3 2JD4A 1DCSA 2RM21 2OPKA 1FAYA 3WSOA 4OZXA 1DQ6A 2P37A 2VTFA 3S7IA 4FPCA 3O12A 1Q8OA 3B00A 1RUI1 3IPVB 1PX4A 3PLQA 1U5IA 4PF1A 2PHLA 5IVJA 1MACA 1POV0 4FFHA 1LEDA 4IEZA 3Q9OA 2I74A 2VOVA 2CSGA 3ILRA 4LLFA 5HCFA 2JG8C 2LS6A 1OFNA 4Y1ZA 5IK4A 1O7FA 1W2TA 3WDWA 1XU1A 5LK5A 1ZRDA 5GKAC 1H8TA 2RMU1 1IG3A 1BCXA 3ZFEC 2WWSA 1EV13 4V2WA 2A6ZA 2WYFA 4LKFA 4I02A 4AWDA 4R4ZA 3UT0A 1Y3TA 3WP6A 2E9QA 2RS53 1C5HA 1TMF2 4QM9A 3VHRA 4K3UA 3IZOA 2D3PA 5BNNC 4FPKA 3J26N 2VQTA 4LA2A 4KWLA 4LKSA 3ASIA 4MOAA 3EJKA 4Y5TA 5LBFA 3SCFA 4EZ4A 3VBRC 4F8AA 1NT0A 1LOCA 1YQ5A 5DMYA 4R8HA 1PGSA 3KB5A 4D8MA 1UOFA 3OBTA 3GXUA 4IEPA 2W52A 5FPZA 3HAGA 3ORJA 3OG2A 4QD2A 4X8NA 1H9PA 3HWJA 5IVBA 3BUCA 1UMHA 3A7QA 3CF6E 2Q8CA 1CAUA 5ANNA 5FYHA 1SFNA 3LIGA 1JW6A 3V0AA 4DEVA 4LHNA 3AZZA 5I8SA 2W3JA 2BWCA 4UWDA 5FTTC 1SLLA 3PU8A 1RUG1 4CCNA 5JXJA 1D4M2 5E89A 4XE9A 4WVWA 2JEMA 2QQPA 3CHXA 3LGRA 4CE8A 2R49A 2P5BA 5E1RA 3O1UA 2DDUA 1NA1C 4BXSV 4LPLA 1L3JA 1UMIA 2K2SA 4I0WB 1DZTA 2NMOA 1ND2B 1PO21 1XBFA 1RUH2 3IIIA 3SH3A 3WXPA 2XDVA 1S0JA 5K0UC 5FZDA 2VZVA 2DTWA 3CJXA 3KGZA 3IAPA 4AVSA 4DXRA 1OOPB 2A3YA 2R30A 3OY8A 3VBUA 3RDIA 1UU6A 3D3AA 4GB31 1MZEA 4PLOA 1JYTA 1DHKB 1RUF2 3HN3A 4LA3A 3ECQA 3M8LA 2GN3A 2JDKA 1MVQA 5FIXA 1VAVA 5FJKA 1JYVA 3AKQA 2ZX0A 2UU8A 4I01A 4JRAA 2ERFA 4LBKA 2KD7A 3ZDSA 2QE3A 1OA3A 3QACA 5LCWL 1Z78A 4FP3A 1ASJ3 2B45X 5A6ZA 4FTBA 1LGNA 2D98A 2HWF1 4DEQA 5C7GA 3U14A 3U4XA 2PYTA 3ZN4A 1DQ4A 4MGIE 2Y34A 4RGKA 4CYDA 1RB8G 5JXIA 1WCDJ 1AZDA 3MDPA 3GBGA 1YNAA 4NE9A 1ENQA 5C6CA 4HG6B 3HD8B 1QWRA 2A75A 1BXHA 2VTXA 2BNOA 1ZZBA 2ARCA 4MLOA 1OH4A 3K3OA 4AI1A 1SLBA 3ES4A 5FYSA 3H3ZA 1TQ5A 4C91A 4DOUA 1U5XA 1KDKA 4AEMA 3EBRA 3WDVA 5FZFA 4I09A 2X29A 5EV7A 4GULA 1CONA 1XYNA 1ZBE1 3KQRA 1R1A2 1W6NA 3HIFA 1IOAA 3QH7A 4OMDA 3SH4A 2RR12 3T2PA 5C8WA 5ACA2 4YRDA 5FYZA 4ISQA 2ZPXA 3RYRA 4AI9A 2TNFA 2JIGA 3J8F2 3JUUA 4JTOA 1OI6A 4B4RA 2VBPA 4XQ4A 2EIBA 1S2EA 4CXYA 4QQLA 1O4ZA 3ZIXA 1PVXA 3WT3A 1GU3A 2P4EA 4KU7A 4XILA 2YC0A 1W8NA 1Y7BA 2QTWB 3OGGA 3P3NA 1X9PA 2IXHA 5FMDA 1FPN2 4UW6A 5FAXA 4Y33A 5FPLA 1PGW2 1KFUL 3Q8CA 3CZUA 3I4IA 1AL22 4WVMB 1K45A 4XHXA 3TEWA 4OI1A 5C4WA 1Y43B 4HVOA 3NRUA 4GAZA 3TOJA 5H9PA 2F4LA 4PLNA 3ELNA 3WP5A 5F7UA 5A32B 1MS0A 1SBFA 4OI4A 1ODMA 1NCRB 2VUJA 2R6QA 3FMGA 4LE4A 1UOJA 5JXHA 1O3TA 3USSA 1UXZA 3GNEA 3HJRA 1W04A 4E2SA 1IKPA 2R072 1S0IA 2BRTA 2GMPA 1SQ4A 3KV6A 3CKHA 2YXSA 1RIRA 3RZZA 3OD0A 4Y3OA 3TRSB 2CL2A 2WNVB 3ZSLA 1QJEA 1AXYA 1OOPC 2WZR3 3ZXKA 3I3BA 1RITA 5AFBA 4LO7A 3AZVA 1YFUA 4QHZA 5GZEA 4MV2A 4TSVA 1CJPA 2ETEA 2F4PA 1LU2A 1W2UA 3IPVA 1IS5A 2Q8DA 3WF1A 2VUAA 5AC93 3FUOA 1LJ7A 3H1WA 1X36A 2R7EB 1GICA 4LBQB 5ERLA 4XIOA 2P3YA 3E5QA 4HZFA 1UOBA 1UY4A 1UO9A 5C71A 1ZX5A 2RJLA 5A7SA 4CDUC 3FZ3A 2JG9C 3RI8A 4QT6A 4QB1A 4CUGA 2E31A 5FPXA 2DUPA 2VCBA 4Q4X1 4OQ8A 3A22A 3VZMA 1GSLA 3X29B 1RMU3 1JXNA 1UF2C 4JDNA 5DQ0A 4BWOA 4BQ2A 1RVF3 1STMA 3PU3A 4XMIA 2CWMA 1SLIA 2D7FA 4NRQA 1H9WA 1DZQA 5LBCA 2J7MA 1ULFA 4I3PA 5FY9A 2XJVA 4QPYA 1VAMA 3AMNA 4X8PA 1X9TA 4H55A 2CWSA 1TG7A 1XNTA 4ES9A 1VRH3 3AP4A 1D7PM 1VBD1 3E6DA 1ASJ1 1ZBA3 2XJQA 1UPSA 4A3XA 1D0GA 1GWLA 1GYKA 2ZX3A 2IXLA 1C4RA 4L9BA 3B02A 4RN5A 4XTPA 5BNPB 5J36A 3A23A 5GALA 4FSJA 2QNKA 3KCYA 3S5AA 4Q26A 1W0PA 1YO8A 4RS5C 3VKMA 4NIIA 5JPNB 3R0RA 5F3EA 5F39A 3OB8A 4AQTA 1OQEA 4UFMA 4A6SA 4ES8A 1W06A 2FDIA 1WMXA 1GP5A 1UL9A 2PN5A 2Y33A 2CY6A 4BU2A 1LECA 4KH9A 2WN2A 3RZJA 4CVUA 2GALA 4CP2A 5IK8A 3FHIB 4K7JA 4PIYA 1L7LA 4AFMA 4LJHA 4KU8A 1F4AA 5GLTA 5A3LA 1MZ5A 1RGSA 4XXAA 4J25A 1FI2A 1PM7A 3TNQA 2Y64A 1DIWA 5A3MA 5FZBA 3UV9A 3S0MA 5FCCA 3O14A 5DAXA 1SCRA 1GLHA 3R4DB 4ZHNA 3NQHA 2ZMKA 4KBZA 2HLEA 3QOPA 1IS4A 2ZCWA 4JGZC 4YFZA 5CFCB 2E32A 1CD3G 2LW8A 2CDOA 2CDPA 1F31A 1W9FA 2ZZJA 4K8FA 1NCRC 2PHRA 2WS91 1AX0A 3JCIA 3VD4A 3I2GA 1MVEA 3MIBA 4URTA 3WVJA 2ZAAA 2Q8OA 3E5UA 2HWC2 4KQ7A 3FX3A 5FY0A 4NO4A 2BJSA 4C90A 5K4LA 3KF5A 2J1SA 5LK7B 3WV6A 4CU8A 2WNVC 1BBT3 1CAWA 5C9AB 1MQTB 1Z7S3 5GM0A 4E4ZA 3RZHA 2BUKA 3M3QA 2ORZA 3RZGA 1O8SA 1J1TA 4RQPB 3GJBA 4B1LA 2OXBA 2C6SA 4YFWA 4YW1A 1GZ9A 3VD7A 1BK0A 1JN2P 1JH5A 1OUSA 3N9QA 1GNZA 1F5FA 1W8OA 2ARAA 5L7OA 3H1MA 3ZM8A 1JOBA 1JOPA 4M0HA 1NY71 3ZYHA 3OGJA 2BGPA 2OZ6A 2ZHMA 1I6XA 2QDNA 2XWJB 4KNCA 2VW0A 4P9IA 1NCQB 3S30A 3W5NA 3AC0A 3NJYA 2RM22 2JB8A 3GF6A 4P5YA 4Y24A 3MPBA 3SCHA 1KJRA 1NKGA 1RUI2 2ZMLA 3POJA 1W99A 4P5HA 4XJAA 5ABJB 4RFT0 3W9AA 1NLRA 2B39A 3IWZA 1GQPA 1W39A 4COYA 5EXOA 5EP9A 5FMOS 1ULDA 5LY1A 1XE8A 1W0OA 1UY3A 2RMU2 4G3YC 3MW4A 3OGSA 4GKYA 4QXBA 1BHGA 1COV3 5CVRA 4S2FA 1JZ5A 2SBAA 4FVVA 4B3NA 4IE6A 5CEHA 1RUE2 1ND3A 4NIDA 1YQ6A 4B4QA 5A3TA 1O4YA 5BNPC 5GLZA 1E5IA 1JUHA 2AH2A 3ILNA 4GZ9A 4WM8A 1RMU1 2RJKA 3I2DA 2DYCA 1VMJA 4NWWA 1I5ZA 4WZFA 2ORXA 3KGLA 1RVF1 1VB4A 3ZFGB 4W6WA 3ZYPA 4CCJA 5FZ7A 1VBC1 4EE2A 2R041 2BDRA 1ZZ9A 5BY5A 1WA6X 4GQ7A 4DIQA 3JU9A 2VZUA 3LSDA 4AVCA 4CZSA 3SMHA 3L9JT 1RTVA 4IGQA 2GNMA 2ATFA 2YMZA 4Q0UA 4FI9A 1ZBA1 3H3UA 4NHXA 1LRHA 3VBOB 5ISLA 3AB0A 5CAZA 3T30A 4I3GA 2R061 5T5OA 3NL1A 5DAVA 2XVLA 2WNUC 5FXZA 3I2OA 4JKKA 5IATA 2WA3A 1U12A 3I97A 5CFCC 2ZJCA 4COVA 3GYDA 3T3YA 2JDUA 2PTMA 5F5AA 3UKVA 3VZNA 1Q3EA 4LBMA 4XFIA 3ZKYA 3PMEA 1AR93 2A1XA 2E26A 2HWB3 2Z69A 3GCXA 5JDBA 5E16A 1V0AA 5A1FA 2XBO2 2DCKA 3K4ZA 2ID4A 2LALA 2BTVC 3H7YA 4HVQA 1YIFA 3LOBA 2Y26A 2DVFA 1WD4A 5FPUA 3J7NA 4CEYB 5FZ9A 5BV6A 2C1FA 5I93A 5KBFA 4PT6A 3VDAA 2B9VA 3OOXA 4N9HA 3AJYA 3E1F1 1W6PA 2W94A 4K6BA 2HJIA 1VP6A 2R16A 3CNAA 5EYYA 1MQTC 5A33B 5EHDA 5C9AC 4ZPIA 4GB32 3CZJA 4H2AA 3NAPB 1CAXA 1G9FA 2JKXA 2XJRA 4V2VA 5BXXA 3S7EA 1DGRN 1NOVA 3U4SA 4BJ0A 1AR72 4KI5M 3AMPA 1IPKA 3OBZA 4RQPC 5KXCA 3VD9A 2RS31 1QDCA 2Q1MA 2Y8KA 3BB6A 4IL7A 5FWEA 4OQ9A 3WUCA 5KHJA 2O8QA 4QGLA 3GM8A 5F5CA 2WC2A 4META 3EQEA 1T2XA 2WFF1 3OEBA 2VL4A 2QZ2A 1HB1A 5GLUA 3TEXA 4YSFA 2DV9A 2VH9A 1BLZA 2RDSA 2VQ0A 5FY4A 4BXFA 3ZFFA 1BVP1 1VMHA 3S5QA 2HWF2 2J42A 3A0KA 3NJVA 4LITA 4D6SA 1AX1A 1WLDA 4TXWA 1BBT1 2G9GA 1PM4A 4UT5A 4DS0A 5C70A 2H6BA 1QQP3 1W3XA 5E88A 1DZRA 1OLRA 1Z7S1 3ZN6B 1PNFA 1SPPB 4XBNA 2YFUA 4ET7A 2CNAA 3BN6A 1PX3A 3HNYM 4AFAA 5ABJC 2IFWA 2ZXQA 3AFKA 2GMEA 2MNGA 3OYWA 4FAHA 1CAVB 1W8HA 5L9RA 1FV3A 4XETA 3A0NA 4OZOA 1RJ7A 1G9BA 1RXFA 2JDNA 4Y26A 4DPNA 5I91A 3H8RA 1VRBA 1RUNA 4NAMA 1DDLA 2CHHA 2WLPA 3POWA 1CIYA 2VNGA 4LBNA 4P02B 1ZBE2 3AYCA 2ZA9A 2WQ8A 1GQHA 4FPHA 4UFLA 1W2OA 4Y22B 4Q4W3 2WIIB 3FL7A 4I30A 2VGDA 4PDWA 5L9BA 1QDOA 4CCCA 2GC0A 1KEXA 3JBG1 3ZFGC 1DGLA 4URAA 4IV1A 1CZSA 1WZXA 4CEWC 2DCZA 2D3RA 3QD6A 4FPYA 2AUYA 2DFCA 5FUIA 3KD4A 5GLVA 1QY4A 4WM7A 2XR4A 1J58A 1F2NA 4AEKA 1N3QA 4SBVA 1OH3A 3BPSA 4HKWA 1UY0A 1AJKA 1COV1 3CEWA 4N7UA 2J1TA 1S0GA 4QPGA 4XUQA 3WD5A 3CLPA 3VBOC 4CDXB 2C24A 3I2HA 1W9WA 1PO12 3I59B 1GV9A 4R9CA 4YPJA 1X8MA 1APNA 2A6YA 3HVDA 5EQUA 4AEDA 3C8XA 4YW4A 1VBA3 4Z8BA 4AVBA 4AL9A 4QGMA 2Q0AA 3VDCA 1DQ1A 1OUXA 5FZOA 2JIJA 2ZKNA 4M4PA 3GGLA 3LIHA 3WHTA 3VZJA 4KWKA 3MFCA 4CTEA 1DYOA 1E57A 1EAH1 4A41A 4CPBA 3KT7A 1NG0A 3FFZA 4LE3A 3NV4A 4EWEA 3DUIA 5DPNA 2UURA 3N7LA 2XOMA 4Y4YA 2VMCA 4XABA 1G6NA 4IUGA 3NWKA 4LK6A 4XF1A 3PNAA 4YVWA 3ZYIB 2BV4A 2BFUL 3CBNA 1PK6A 4JQTA 1PIV2 2PFWA 4XPVA 3TN93 3U37A 4FXGB 5JI9A 3NAPC 4BQ5A 1F5JA 2VZPA 1MS1A 4O9GA 4YLZA 4XHBA 4EJRA 2ZGLA 4HFSA 3DGTA 4RR3B 5A3UA 1A6CA 4Q4Y3 2A3XA 5FKCA 4R9AA 1AR91 2ZGKA 3UK9A 3BPZA 3OPWA 2HWB1 2PAEA 2AR6A 2PMWB 4DQAA 1NE4A 1QF3A 3MBWA 1ULGA 4XAAA 4JAAA 4DUXA 2UYBA 3W59A 5T3NA 4E4SA 5GZGA 1H2KA 2D5HA 3CJIB 2G4IA 3O0WA 2FMYA 3I2KA 1UNBA 4CP1A 2PQSA 4LUMA 1H2NA 3THPA 3GZUC 4CRQA 5JIUA 1DBNA 3K46A 4Q4X2 4XOGA 4ZKTB 3O1MA 1OPOA 1OPMA 4YW3A 4YW7A 4KGQA 2ENRA 1ZZCA 4QKFA 1GOHA 1MR5A 1EUUA 1RHI1 5J37A 1X50A 4XZPA 4CDQA 2GC2A 4OCTA 4FFIA 3GZAA 3KHCA 1RC6A 2Y6KA 3DXUA 2DCTA 3POBA 5LB6A 4A45A 2G9FA 1HB4A 1MZ6A 3N9LA 4JHTA 3ZXLA 4OHXA 2FDHA 1VBD2 1BYHA 5FREA 5FBJA 2WR9A 3DPRA 3T09A 3VBHA 4LOSA 1HLCA 1OKOA 1ZNPA 4IEWA 2DVDA 3GCWA 2P17A 4R9DA 4ARYA 4BA6A 3N9OA 1HXS3 2C4XA 3U0ZA 2OW4A 4YVSA 1QQP1 4ZXEA 4QPIB 3VBSA 2QBXA 3ETPA 4EV0A 2FDJA 1HB2A 3P3PA 1JUIA 2KXLA 2YFZA 1ENXA 1GZWB 5LW9A 4HLTA 2HBTA 1WCQA 2XH6A
chains in the Genus database with same CATH topology
3RI9A 5F5QA 3NV1A 4I0AA 2H0BA 4G4FA 3WQ1A 4P9LA 4CDXC 4N43A 1PZ9A 2VULA 1WW4A 5T5PA 4Q4W1 2GH2A 2XL7A 5D8AB 1Q8PA 1AVBA 5KXBA 4BHPA 3SCGA 1BVVA 2WS92 1N1TA 1BK1A 1RUC3 2FMDA 1TNRA 3AXEA 2JDZA 2A6XA 5DDJ2 3LB9A 4JGYC 5H9SA 3RYPA 4TZDA 5H9QA 4H7LA 1QJZA 2IXCA 2EXHA 1N47A 4XXPA 1FT9A 2Z2SB 3VBFA 3VHOA 4YG0A 1AR83 3FC0A 5HBAA 2X5IA 5CA6A 1VBE3 1UX6A 2E7AA 1PGL1 1V6OA 3CL1A 3LAGA 3O0XA 3S6PA 1VBA1 3TB0A 4Q0QA 1LCLA 2WNEA 1RUJ1 4IV3B 4FPEA 4FOWA 1CR7A 4RR3C 1V6JA 4AHZA 1LEMA 1BMV1 1QJU2 4HBNA 4AF9A 4QGNA 1N1SA 1BKZA 3USUA 3CJIC 3BODA 4OI2A 3JB8A 4IEOA 4Q0VA 4J1WA 4Y1VA 3VBUC 5JR7B 1B35A 4DRRA 2GZWA 3AP7A 4Q4V3 4OHWA 3TN91 1AR63 2YDEA 2WT1A 1UD1A 3FLRA 3RJRA 4TWTA 3DN7A 1H4GA 4Q4Y1 4N53A 4AHYA 1URXA 3JB4C 3AZWA 3MF9A 4M3CB 2C5DA 4IEXA 2XLFA 4Q8KA 5BNOA 4NHKA 1H4HA 1OKQA 4YM3A 3LOIA 1R083 2AREA 3VKNA 4QPIC 1RMU2 2OYZA 4BIOA 4WBBA 1QGLA 4YM1A 5J96B 3APBA 1VBC2 1DFQA 2R042 1C8M3 1F9KA 4XQWA 1K5MC 4EN0A 2D5FA 1Q5OA 5CFDA 2E6VA 4WVZA 2RS13 1S2KA 4ASLA 1ZBA2 3JD72 1H30A 1ZRFA 1KXGA 2R062 2ZGRA 3FLPA 1HXS1 4AFCA 4FAGA 2E7TA 2HWD1 3HN1A 5D8AC 3AXDA 5FLIA 4C1WA 3QCWA 2IXJA 1FNZA 4IXLA 1KFXL 3JQWA 1OA4A 1YXWA 4UBGA 3ZXFA 4LO4B 2BPA2 2NLRA 1MEC2 2JG8A 5AFEA 2JE7A 3D6EA 1YJLA 4C1XA 1WW5A 1Q56A 1SMVA 1WW7A 3ZFEA 5C4WC 2JJ6A 4CDUB 5JPNB 2JG9B 2D6LX 1QJY3 5JAXA 4YNIA 3FLTA 4FCAA 1IS6A 4BMEA 1LOFA 4KL1A 4PQ9A 5K9YA 5FQ0B 4G9SB 5BNNA 4IV3C 2XPJA 2BGCA 2IZWA 5L36A 3NV3A 2RS32 2NMNA 3C2UA 1TEIA 1RUC1 4GA9A 3VBRA 2WFF2 2QCSB 2ZHNA 4GALA 5T52A 1FMD3 4MVTA 2VVEA 2BQPA 2EAAA 3T1LA 1JTZX 2WJSA 1VBE1 1NLSA 4O9EA 1LHNA 3B94A 1W6MA 1XE7A 1ULEA 1IGOA 3E97A 1EY2A 4A7KA 4RS5B 2ZS6B 4AGRA 3B69A 5JZGB 4FPGA 4MUVA 1RJ8A 2E53A 3POYA 2DUQA 1U5ZA 1GZWA 3GHNA 1C1FA 5KHHA 5DXDA 2XUMA 3BIWE 1EV11 1NA1A 4XFFA 3E6CC 3HMYA 2WA4A 4RHV3 2RS51 1U5YA 4Q0SA 3KSCA 1W6OA 4Q4V1 5K0UA 4YYOA 1AR61 2X53S 1OQDA 3WOGA 1HRV3 4BE3A 4JGZB 1X7NA 2XHKA 2WINB 3JBG2 3U10A 1QU0A 1V00A 4XJWA 1XNKA 1ZA4A 4NR1A 2GMMA 3IDCB 1AYM3 4FPOB 2TEPA 3WW3A 2XJSA 4M3CE 1DF0A 1COV2 5EYXA 3T2TA 2MEV3 1AYN2 1R093 3ZSKA 3A4UA 1OHFA 4R9BA 3WDYA 4XTMA 4FTEA 2C9AA 4L92A 5J48A 2PAKA 1AHSA 3D8CA 4NHLA 1IQAA 2NYYA 1BQPA 1EAH2 1UZYA 2BWAA 2UY8A 3ATGA 4EN7B 1GFF2 4XDQA 1LESA 2RS11 4LEJA 4EWAA 3D0JA 2YPJA 4NOTA 2D40A 3ENRA 3WR0A 4AYUA 2VVDA 2CGPA 1NE6A 3VKOA 1XQNA 1Z0HA 1UKGA 5JIAA 1AR92 3M3IA 3AM2A 2NN8A 5JSRA 5FOJB 4LBLA 4H14A 4HN1A 5J3UA 2JXAA 2HEWF 1UKRA 3AP9A 5KHGA 1QHDA 1QJY1 2ZKLA 5FRAA 2FZ2A 1YLLA 2DWRA 4YARA 1RHI2 2VW1A 3ES1A 3AYEA 4Y5Z0 4GH4B 2HWE2 3E5XA 5JZGC 3M3CA 1D4M3 1XXNA 3DF0A 1QOSA 5HI0A 3V64A 3SLIA 4Y1UA 3PVNA 2XJPA 1FMD1 1ZVFA 4XFBA 1J3PA 3N35A 1RUH3 2NZ9A 2DVAA 3FFQA 3LKJA 4F3JA 1ND2A 3KLSA 1QQP2 4HPKB 4K1YA 2PLV3 2WNUB 3AZYA 1GKBA 1HRI3 4HANA 3AKRA 2VXRA 4Z07A 1OOPA 1QJX3 5C8CC 1SBEA 1G9CA 5EJ3A 1RUF3 2ZX1A 4MH0E 4OLLA 3WP3A 2D44A 1MZFA 2Y0OA 2HKXA 4OUSA 4XFAA 4AW7A 4Q1PA 4Y20B 1BJQA 3M3EA 4K9SA 4LUKA 4Q4W2 4BLIA 4JQRA 1D2SA 3MICA 5DZFA 4Q27A 1VB2A 4R52A 2D97A 4N90A 3RMYA 5FQ0A 3H7JA 1H1MA 4P14A 2B46X 1V9U2 4YZ3A 2D6NA 2NQYA 3I54A 4QXKA 4AI2A 1NQDA 4LR4A 5J09A 4IEUA 2H6CA 1R091 2MEV1 4FXKB 3RNSA 1VJ2A 5AVPA 3V0BB 1WCSA 4QU2A 2QVSB 1R1A3 1ZRRA 3N7MA 2RR13 2WZR1 1I9RA 4E2QA 3LA2A 4QMAA 2V5YA 1RUJ2 1ZZ8A 4Q2FA 4XBQA 2A7AA 4RS5A 3J8F3 5CIRA 5AC91 1WCKA 3OD4A 4LO5B 4XF9A 3MLJA 3PVEA 4HT1T 4JV4A 5J7MA 1O3QA 1CX4A 1AF9A 1FPN3 4PBOA 2MPFA 1V6KA 1XYOA 3NV2A 4MGZE 2P3IA 1WGPA 4DRVA 3TN92 1AL23 5GZCA 4FP2A 1WUVA 3TNPB 4WVMA 4GH4C 4N7IA 4KG0A 4JDMA 4Q4Y2 3N3HA 2JX9A 3EXUA 1FV2A 4CEWB 2P34A 5A32A 3O0VA 1ZYBA 5BPXA 1NCRA 1DQ2A 4RGGA 5KHKA 5BNQA 1GNHA 1V6NA 1VRH1 3FBYA 5FOBB 3MGUA 2R073 2PHXA 3M7AA 1LOAA 2V09A 2XLAA 4SBVA 4FO9A 4AVAA 4B7EA 4LULA 2EIGA 2VG9A 5JVVA 5FO8B 3LCPA 1MS8A 2XJTA 4CDWB 2XB6C 4UW5A 5KHIA 2WNVA 5J98B 1RUG2 4YZ2A 4LT5A 1S2BA 1VALA 3ME2A 2A71A 5DZEA 3ROUA 2VMIA 5CU1A 4PLMA 1RINA 5LEJA 1LOBA 4FOQA 4F7ZA 3MI8A 3RJ2X 1YYNA 3ZMOA 4AXOA 1MS3A 2QKDA 1I3HA 1H0BA 4BYYA 3AFGA 1PO22 1OSGA 2IC1A 4LBQA 4MXWB 3SXWA 3U11A 4TLFA 2D6PA 1HXS2 3VDDB 3TAYA 2HWD2 1JYCA 1J3RA 3POSA 2PLV1 1AJOA 5JPMB 1HRI1 4IV1C 4UBHA 4COWA 2B9UA 1QJX1 2B8MA 2GH8A 2YV8A 4F83A 3NVCA 2GNBA 1X82A 3B5LB 4M01A 4Z2WA 3OCPA 4D69A 1EYBA 3WCSA 3BU7A 3WLUA 5LRSA 1YFYA 4OUMA 5F1RA 5GJ6A 1Q43A 1QXJA 4XMAA 1YJKA 4X6QB 3LZZA 2XGXA 2GC3A 2GDFA 2AYHA 4N9IA 1ALYA 4AQ2A 5FO9B 4PBPA 5BNPA 2E7QA 2QDRA 4YM0A 4FQ4A 5HCAA 2DURA 2IWGB 2W39A 4TYSA 1HV1A 2JE9A 4GWNA 1YRZA 1O3SA 3D5OA 3SHRA 1J59A 2WSVA 2XL9A 3B01A 3WX5A 1OD5A 4BQ1A 1KITA 2EAKA 2BVBA 1VBE2 1N3PA 1POV3 1LOEA 4AGVA 2K9ZA 4RGAA 4EWDA 1WD3A 3WHUA 4PIXA 2WNUA 1F8VA 2Z79A 3J8F1 5CFCA 3AYAA 2RHPA 1H8TB 1Q8VA 3AMMA 3ZPYA 4QQPA 1A8MA 3QLQA 1EV12 3B93A 4YG6A 4ZU7A 2Y38A 2RS52 1G86A 1D0HA 3RWNA 1H8VA 1EPWA 4COUA 5FLHA 1G7YA 3J9SA 4CDWC 1AR62 4LBQD 2VNOA 3ILFA 4P9GA 4OI0A 5I0SA 2XG3A 3BTAA 4DZGA 5C9AA 1MQTA 3RYKA 3ZXDA 1JOJA 5KC5A 3ALQA 5T55A 2CGNA 1SLTA 1DGRA 4RQPA 2NM1A 4DFSA 4JGYB 4UW3A 3GBWA 4Z1VA 4U36A 3EHKA 4HK8A 1CAUB 3HR9A 4YM2A 4YVSC 3WW2A 3V0AB 2R0FA 4MGKE 3VDDC 3MEPA 1NCQA 1UZZA 4BH9A 2UY9A 3ZXAC 1RUI3 3NSTA 1QH7A 1DYKA 4BMBA 3WCRA 3MLLA 5JOYA 5ABJA 4AQ6A 3SITA 1HQNA 2RS12 2YGMA 3KCCA 2A6VA 4EN9B 3J4UH 2ARBA 3E6BA 3VV1A 3AKPA 2R0HA 1M06G 1RUE3 3OY8B 2GU9A 2EALA 3VBUB 1LU1A 4D94A 2R1DA 1KQRA 2VY0A 2WZPP 4E2GA 3H9AA 2TUNA 4XJ9A 2N7GA 3ZFGA 4BIFA 1O5UA 4DMIA 4MSVA 3DKWA 2CTVA 4H3WA 4CEWA 1J1LA 2OVUA 5CG8A 2BYVE 3GALA 1ASJ2 2P3KA 2AZ5A 4W6XA 1LGBA 2I07B 4XQDA 3AX4A 1VLNA 4B4PA 3VBOA 4DNYA 3HQXA 1CESA 3TWIA 1HIXA 4W6YA 4B29A 3RRDA 1V6MA 3JQXA 1QKQA 4ISRA 2PHTA 5JMCA 4Z82A 1H8TC 1K5MB 3RPQA 4K21A 2XBO3 3KS7A 4MX3A 3ST7A 1W6NB 1YI7A 1ULCA 1QXPA 1S1AA 2ZACA 3KMHA 1SBDA 1POV1 2JKBA 1PMIA 3WY6A 2JICA 1H1AA 4AE2A 4CEYA 4Z92B 2DTYA 3WG1A 4KWJA 2EXIA 5A33A 4GB33 5CB7A 1PVC3 1TNFA 1FATA 1AR73 3NAPA 3NO8A 2O8OA 3UL2A 2HEYF 2XVGA 1C8NA 1X33A 2ZAHA 5LRRA 3PJYA 3UJQA 2P3JA 3BOWA 2PHWA 2Y0IA 4OVEA 1LHWA 4D3WA 4RD7A 2D43A 2JENA 2HWF3 5C4WB 4BZ4A 1OMIA 2YYOA 1DGWX 1X8EA 2WQ4A 2ZGSA 2D6KA 2I45A 3CO2A 3ZN6A 3UKTA 3WW1A 5B2GB 2LTNA 1M4WA 3ZO0B 4EN6B 2HYKA 1RUD3 1NY72 1CAVA 3R6SA 4QQ2A 2MEV2 5CADA 1KRIA 3N4MA 4LO6B 1LHUA 4GKXA 4JVAA 3N7JA 1PZ8A 5F9TA 2WZR2 3FWEA 3IDBB 3VZLA 2E51A 4I0BA 4Y22A 1WMDA 4GMP0 2ZX2A 3MIHA 5AC92 4PIZA 2ZMNA 5H9RA 3AMHA 1S0FA 4FBFA 3WDTA 5BUVA 5DZGA 3ZN5A 2W68A 4I2OA 1BEV3 5CNAA 3ZYRA 1A78A 1LOFC 1RUE1 4FT8A 1PO13 1QH6A 2F6BA 3MPPG 4CDXA 3I59A 1RVF2 5FFOC 4XF0A 1O5LA 4RA0A 2ZOEB 5JI7A 1S55A 2A5ZA 4BM8A 1VRH2 3PJQA 4JGYA 2ET7A 1VBB3 5DG2A 2A73B 3WINE 1EP0A 2VECA 3ZSJA 4JRLA 4OHYA 1S0DA 1PIV3 2NPIA 1SEFA 4D7SA 1C3HA 1WBFA 1G8WA 1OQ1A 2ZTNA 4HSLA 4IEQA 1NXD1 4L11A 3PTYA 4RR3A 1DQ0A 5DG1A 3OPZA 4MZUA 3IT8A 2FZ1A 4B7KA 2XBO1 2OA2A 3JZVA 1AXKA 1GR3A 4W65A 1WLWA 1GANA 3PVOA 4XFCA 4AEKA 2P2KA 1IKQA 1ONAA 2A3WA 3CJIA 4Y1YA 2A70A 5JOWA 2PLV2 4Q4X3 1OLQA 4FTSA 1HRI2 2QJVA 4YG3A 1QJX2 2VMHA 1H2MA 2EF6A 2ET1A 4ZU4A 5DUWA 4HKLA 1PVC1 3ZX7A 2FQPA 3W58A 1AR71 5JCTA 3AMQA 5GZFA 3PVBB 4OULA 2FBEA 5F6KA 3WDXA 4YW2A 1D4VB 1VBD3 5DUUA 4ATFA 4KBBA 1AR81 4K1ZA 1CQ9A 1CAWB 1XNBA 3FBMA 5AVAA 1TME3 4AGGA 1BBT2 1DQ5A 2DUOA 5LEKA 1LOGA 1Z7S2 5BYNA 1NQJA 4GWMA 1VIWB 4QPIA 3SNMA 1CJDA 3ZXGA 4AI8A 1NXMA 1XNDA 3ZSEA 5L7OB 1QNWA 1IPJA 4YZ4A 4IESA 4P9JA 2MHFA 1A8DA 5JSPA 1FOD3 3T1MA 1RUD1 1AX2A 3MW3A 1MS4A 2GC1A 2O1QA 4LBJA 3URFA 4Q1RA 1K5MA 1V6LA 1FYUA 3IIAA 4XEZA 5D1IA 2YUEA 3H50A 1R1ZA 1UU4A 4ATEA 3VL9A 4QQHA 3VUOA 1XU2A 2BEOA 1UIJA 2BVVA 3UKNA 3RMXA 5GZDA 1S0EA 5D8AA 5C8CB 1HQLA 3MIEA 1V6IA 2WS93 4E27A 3K51A 1LTEA 1UIKA 3VKLA 5KXDA 5DDJ3 3AKTA 2VOKA 4BLJA 3VHNA 5SV5A 1O91A 4OHVA 4S2GA 5T5JA 2VVFA 1ND3B 1QNYA 3AP6A 2Z5WA 1BEV1 1LR5A 2WFPA 1R081 1PO11 4WM8B 1SDWA 4S2HA 5DUXA 5JOXA 5IK5A 3WUDA 3AK0A 5F6LB 3FE5A 4XIKA 3SISA 4RL7A 2C0ZA 4C0HA 1A3KA 4ONUA 5JLVA 2ZBJA 2A6WA 1C8M1 4IV3A 4R4XA 2BW8A 3N36A 1QJU3 2H0VA 3MYXA 2DVGA 5FDBA 4HVRA 4EROA 1SLCA 1ND2C 1VBB1 4AFBA 1XRUA 4GIQA 4AI0A 3IN9A 2Q5TA 1TMF3 2ZGTA 2ZHKA 1GQGA 1PIV1 1XYPA 2Q4SA 2YHJA 5JOZA 2FHRA 2GN7A 4HMZA 1CPMA 2KA3A 3WQ0A 4INDA 3WNXA 1LKNA 2HWB2 4QHBA 2OIIA 1ZZ6A 1LHVA 4M3CA 4P9WA 1AUYA 2I2SA 1W6PB 3H8UA 3AJZA 1CN1A 1YCIA 4QQOA 4XF4A 4MGYE 1KD7A 1CAXB 2X8KA 5I8TA 1KS4A 1UCXA 4M0NA 2B42B 2Q30A 2PHFA 3DL3A 2VU9A 5L7OC 1VBC3 2AGSA 1WA4A 4AQSA 4E9KA 2R043 2R1BA 4LHLA 1WW6A 1BZWA 3ZFFB 2GSYA 1PHMA 1NYWA 4IEYA 5FLJA 3JD73 2OUJA 2WKKA 3AZXA 1TME1 2R063 1T6GC 2DF7A 1ZREA 1J3QA 1DU3D 1IHMA 3KT1A 1D2QA 4K20A 3OYWB 2BNNA 4NN0A 4FOYA 2VOXA 1FOD1 2ES3A 1MS9A 3FJSA 2PQQA 1MEC3 2PAMA 5IT6A 1ND3C 4Q0PA 1OA2A 1W6QB 4FQZA 1GZCA 4PDWB 4RHV1 2Z42A 4WM8C 3ZIWA 2DFBA 2NP0A 2EXJA 4YZ1A 2IXKA 4CDUA 1XNCA 2JG9A 3MIDA 3HT2A 4K40A 5HCBA 1HRV1 4IV1B 1YFWA 4MYEA 1SACA 3ZYJB 3OF1A 5JSOA 2RS33 4AFDA 4WM7B 4NPRA 5K8SA 2DCYA 5DDJ1 1AYM1 3VZKA 5CG9A 2WFF3 4DY5A 4QPGB 3B9CA 2WT0A 4KGGA 2W0XA 2LM3A 1YIPA 3WDUA 3TBDA 4AEDB 1PGL2 2XKPA 1CPNA 1REFA 3FUQA 4S2DA 4XYXA 1VBA2 2V73A 3NJZA 4DINB 4UXAA 2OZJA 1DGWA 1AXZA 5ACA3 3ACLA 4Q29A 1I1EA 1Q8SA 4COZA 4YZ5A 4HL0A 1BMV2 5JZGA 2VNRA 3LA3A 4XBLA 3BALA 1QJU1 3NKGA 2WQZC 4PJYA 3R4SA 2XLGA 3VLBB 4IEVA 4XFHA 4YVWB 5K7PA 2DU0A 1N1VA 1PK6B 1WMEA 1HQWA 2GNDA 2D6OX 1TMF1 3G7DA 2K0GA 4L2NA 4J1XA 4YW5A 3JBG3 1REDA 2B5HA 1REEA 4JGZA 3ZXJA 2XWBB 4SLIA 3MZHA 5C8CA 3MLKA 3RG0A 2ZGUA 3ZFFC 2WSUA 3KCXA 2QZ3A 4ASMB 5C33A 3MFAA 3IKWA 4LTAA 1PNGA 3L2HA 1AYN3 3L2YA 5L73A 4UW4A 1NZCA 2XJUA 2ZGNA 3INAA 4EN8B 4AI3A 4M00A 5T54A 5I0UA 1CIWA 4CDQB 2YGLA 1LODA 4DXZA 3KT4A 1FX5A 2QFEA 3VKFC 3RSJA 3EO6A 1D4M1 4NVPA 4P9XA 2VOWA 1UN1A 2DCJA 4KG8A 1EAH3 4FPFA 3ZMNA 3DPRB 4MXVA 3VBHB 5HXVA 1TE1B 2Q1ZB 1IS3A 1G9AA 3JD71 4YVSB 3VBSB 1RUH1 2JECA 4PDWC 3MW2A 2GAUA 3NW4A 4B8EA 1DLLA 3RS6A 4V1PA 2CYFA 3LA7A 1YHFA 5T5LA 4H7MA 1RUF1 4WM7C 1HW5A 4DY3A 1MEC1 3N7KA 4QPGC 5KWRA 4N43B 1WLTA 3IDEA 3BOPA 4XJ8A 3D0SA 1ENRA 1UW8A 4AEDC 5JWPA 3DV8A 2CGOA 2O0OA 3O5SA 4NHMA 2VW2A 4ZXKA 2DVBA 2BFUS 3WZ1A 1RHI3 1ZZ7A 1PVC2 2QUOA 2OUHA 2SLIA 2UWBA 2ILMA 4JC1A 1RUOA 2HWE3 2PELA 3M2MA 4DB5A 4GH4A 1RUC2 5FMOL 2VMGA 3O7OA 1FNYA 1CVNA 1QXRA 3VBFB 2UWAA 4ORFA 1YUDA 3LSEA 4IETA 3M4FA 3VN4A 2WT2A 1NCQC 2X5IB 4YVWC 3WW4A 1AR82 4A7ZA 4X6RB 1PK6C 2XKOA 3HT1A 5EFUA 1WBLA 1R1A1 3RQ0A