3CL3D

Crystal structure of a vflip-ikkgamma complex: insights into viral activation of the ikk signalosome
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
b'QQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF K13
publication title Crystal structure of a vFlip-IKKgamma complex: insights into viral activation of the IKK signalosome.
pubmed doi rcsb
source organism Human gammaherpesvirus 8
molecule tags Viral protein/signaling protein
total genus 24
structure length 59
sequence length 59
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3cl3D00
2YKPA 3CL3D 3L4FA 2YKQA 2W6BA 2YKOA 3BRTB 1JOCA 3EQ2A 3BRVB
chains in the Genus database with same CATH superfamily
5AVWB 1PP9J 2E42A 2N9YB 3CCSP 3QWOC 3L71J 2IBZG 2W27A 4GIFA 4H13B 3A7OA 3JSVC 1GZLA 3CX5E 3A0HE 3Q2YA 1OIPA 2OYIC 2Q6QA 3RK3B 2WQYC 5B66E 1IFJA 2O01J 2W6AA 4NPEA 1ZOYC 1ZMEC 1RY3A 2YIUB 3HE4A 3FX0A 1PZQA 4EI2A 3II6A 5CBOA 5AVSB 2J59M 1KV4A 1KFNA 3MD0A 2M0BA 1BDCA 3G4SP 2P67A 3MP7B 2XNDH 3L73E 4MN4C 5AVUB 2KSJA 1CSBA 2E5YA 4DZOA 2AEJA 1MZ9A 1EZVI 3AE4C 5TISE 1LTBC 2YO3A 3BATA 1OWAA 1SQPG 3GF7A 1BCCJ 3SSUA 3G71P 3D6ZA 4WY4B 2ZT9D 4YPCA 1SQBD 4C7NB 4WBAA 1NAFA 3MIWA 2WSSH 3M9QA 2KUBA 5AVXB 1BDDA 1JCCA 3I56P 1HUCA 5APUA 4U3FJ 3CX5D 4C7RA 2B87B 3FGAD 3RL0B 2LXCB 2YKPA 1LJ2A 1FC2C 3KXDA 3PLNA 3PP5A 3HD7C 2Z4EA 3GHGC 1NTME 3HUSB 4HYTB 2M5AB 1CZQA 3GMAA 4DCKA 1FE6A 2LR2A 3L73D 3MHVA 1KB9E 2KK7A 1KILE 3P8CE 1RQUA 4D6TE 2WITA 1JOCA 2QJYB 1NTKG 3H1JE 1SP4A 2AXCA 2BEQD 2QE7H 1S5LX 2E76C 1L0LE 1JO5A 1VL2A 3CLQA 2FYUK 3OA7A 1L2PA 2K9YA 2XU6A 1NTZG 2KB7P 1JMMA 1FZCC 5CHXA 5APXA 2VRSA 1K73Q 2J58A 4OGQB 1GL2B 1D7MA 1GU4A 3PTZA 1SQBG 2E74D 1KQFB 3V2RA 2OYOA 2E75D 2ZFCA 1A02F 1M1JA 2HR3A 4UB6E 1N7SA 2D2CD 1FZFA 2C0XA 3EQ2A 3C8VA 2XV5A 1KILA 1LT9A 2YXQB 3V4WA 3AE8C 2A45H 1KMIZ 1A02J 1NTMD 1K04A 1FZAA 1P84H 1KYOH 1BGYJ 4L76A 3B71A 1EDLA 2PRRA 3KZIE 5KJ7A 1SVFA 1N7SD 1YBKA 1EC5A 3BCCE 1KILD 3IR9A 1SQXG 4D6TD 1FZEA 3H1JD 1MKMA 1SQQJ 2IYOA 2OYIB 2J5UA 1L0LD 5AW8B 2A45I 1NTMK 2YXRB 1KC8Q 4GDOA 5AW2B 5GTHH 2Q1KA 2KS1A 1G2CA 1P84I 2P1JA 1KYOI 1RH5B 1N7LA 5KJ7D 1JNMA 1IFDA 3A0BH 1R5LA 2W6BA 1SQVJ 1FZBA 1VF5D 3IF4A 5C39A 1VQKP 1L0LK 3NTNA 2KZIA 3CWBJ 1S4XA 1RE4C 4RESB 2HYNA 1N73A 2N9BA 1IK9A 2O1JA 3CD6P 1OW6A 1DIPA 3B5NA 2N1TC 1H88A 2B9BA 1SQVK 3KYQA 3AEGC 4L75A 2IZ1A 1XTCC 2FXPA 3P8MC 3BCCD 3G3ZA 1R5SA 3H1LG 2Q3IA 4JBZA 1M57D 5KAIE 4PD4E 2QM8A 1WMKA 5TJHA 4D6TG 1NGMB 2ZYAA 3D71A 2LKMA 5KLVJ 4ZMDA 3H1ID 1IK7A 1FJPA 2IBZI 1BE3E 4ASWA 3HD7B 1XTGB 3GHGB 1S2EA 2G8YA 2IDBA 3H1KJ 2GM4A 2H7HA 2QM7A 1IO4A 5B5EH 2O1KA 4HB1A 1LTAC 1DH3A 1LT1A 2ZT9C 3OW2O 1G1JA 2PAJA 3M9HA 2FFDA 1NH4A 1H0TB 1CI6B 4WB4A 3ZDMA 3RK2D 4IL6X 3HTKB 1FJKA 1DEBA 3A3YB 2E76B 3N4XA 1HTLC 2ZXEB 1PGOA 1VDFA 1NAYA 1FZCB 2WT7A 1L0NJ 4DT0A 2Z5IA 3M06A 1FZGA 1KQLA 1VPCA 4BXLA 1NU1J 2P7JA 3IFMA 4PD4D 2BCCE 3BCCG 5CCGA 2NPSA 2WPRA 3OAKA 1SFCD 1AVOA 2WSFH 3L75J 2W83C 2B88A 4GODA 1ZR2A 3L70E 2GUSA 2JEEA 1BE3D 3KDPB 2XKMA 4OWFA 1U57A 2FXOA 1NWQA 1OZHA 3L71E 1RF1A 2W8ZA 3P7KA 3H1IG 1NJIQ 3RBZA 1S9KE 5CCGD 2NPSD 3KHUA 3PJSK 1KFMA 2AXTE 2HODB 5CCHA 2WZ7A 1QL2A 2Y9ZA 5M1BA 4PJ0H 1EDJA 1Q81Q 1RQVA 3AEBC 1L4AA 5H2FH 3FXEA 3SWYA 2E75C 2WMMA 2I8DA 1ZN5A 3V2NA 2D2CC 4RJTA 3S4RA 5CCHD 5GTIH 4IFFA 2NRGA 5AVZB 3E7KA 3CX5H 3BRVB 5DJUB 2BCCD 1BCCE 2R32A 5KAFE 3TSIA 1OXZA 1SQPJ 3L70D 3T97B 3W67A 1M1JC 1WT6A 1N7SC 2FYZA 2N1TB 2CK3H 1KILC 4U3FE 2AEFA 1LT9C 1NKZB 4C46A 2OGUA 2L5GB 3K5BA 2YMKA 1PL5A 1SS1A 2W90A 4H13D 4RKUJ 1JMBA 1M56D 2G3AA 3FWLA 3MZWB 3SWFA 5AVRB 5KJ7C 5TISH 1T6AA 5AW3B 1Q82Q 3CXHD 2FYUE 2WPSA 2WSFJ 4EIJA 3H1HG 1PPJG 1EQ7A 1UIIA 2ZYDA 2Q3EA 3OJAB 4WVZA 1IFPA 3SWKA 1HJBA 3HE4B 3W68A 4WWIA 1NTKJ 3L74E 4QMAA 1VQ5P 3PHLA 1BCCD 5AW0B 4JYCA 3LW5H 1YQ3C 1EZVE 2POHA 2FYNC 2QIWA 2ZT9B 1OVVA 3D6YA 4EDFA 5EFWB 1NTZJ 5E79H 1LP1A 2IFNA 3BVHA 2B87A 1QEXA 2KIKA 4IOIH 3AEEC 3L70G 2OYHA 1N73C 2QSIA 1FDIA 1SQBJ 3GLMA 1FDOA 1YJ9P 3B5NC 4HJGH 1NTKK 2HLOA 4JYBA 1QL1A 3L35A 3E1RA 1MUUA 1T3JA 3JC22 2A06E 3I5CA 1NTZK 3BRTB 3M0AA 3L4FA 5AW4B 2FYUD 3U59A 3CCRP 1BGYE 4LLHA 2C9NY 2BEZF 3VP9A 3Q1MA 3Q5SA 1ZR4A 1LTJA 3WU2H 2OTJP 2QEXP 1LTSC 2KXPB 2GA1A 1SQXJ 5APTA 3U1AA 1NOHA 2W6JH 3CI9A 3L74D 3AEAC 4PV1D 1T2KD 1T8ZA 1EZVD 5KLIC 3GG2A 5KTBA 3M0DA 1SQVE 1PGQA 2KYVA 2KNCA 2FFDC 4I2LC 1AV1A 1Q2NA 4OGQD 1URQC 1KD1Q 3CWBE 1IC2A 2E75B 3KZIH 4I1LA 3CC4P 1K9MQ 1GK4A 3V5BA 2D2CB 2A06D 4YXWH 1X79B 1FBMA 4IL6E 1OVRA 3LW5J 1BGYD 2XNXA 1IFMA 4K35A 3PH0A 3L72E 5CCGC 1M1JB 2NPSC 2HPCA 2FYUG 1HWTC 1KB9D 2CPBA 1N7SB 3P8CD 3TGUE 1KILB 1LWUA 1LT9B 3F5HA 3L73G 4B86A 3H1LJ 4H0LD 1JTHA 1RF1C 1HBWA 3ABVC 1N2DC 4W7YA 5KLVE 2ZXXA 1J1DC 4BRYA 4D6TJ 1EXJA 1KORA 1DEEG 3L74G 3AE6C 2QJPC 1SQVD 1VQ6P 1P84E 2PGDA 3CCJP 1USDA 2KZJA 4ZKUA 1SQQK 4RO0A 5CCHC 4EYYQ 5AW9B 2M3EA 2OTKE 3CWBD 2I1KA 2JDIH 3MGNA 4KT0J 2KS1B 1G2CB 2HG5D 1L4AC 2Y9YA 5AW1B 3TNUA 3R4YA 5KAIH 5GTHE 5BU8B 3KPEA 3JCUH 1W2BO 2FYNB 3L72D 1NKNA 1DD4A 3A0BE 1NTMG 1K8AQ 3AEDC 4GT1A 1MV8A 3WMM0 3NMDA 4OVNF 3TGUD 1GTWA 4W80A 2FXMA 2YKQA 1KTMA 1N73B 2WWWA 1JY2O 1BSNA 1NVOA 3B5NB 1VQPP 1KQGB 3VMYA 1YIJP 2YMYA 5KLVD 2P58A 3BCCJ 5AVVB 3H1JG 5CJ0A 3VMXA 2NZ2A 3AEFC 4KHXA 1L0LG 5APSA 3CCVP 2WVRA 3HE5A 1P84D 2M3BA 4N78E 1VQ8P 2RN0A 3V2PA 3H1IJ 1CI6A 3H32A 4UB8H 2K9JA 5AVQB 3VOPA 3PRJA 1Q90D 2Y0EA 5KLVK 4Z1MH 3AE9C 1MFZA 3IN6A 3O6QA 2ZAEB 4HKZH 2QJKC 1S1CX 4AYCA 4BWNA 1SFCA 4L73A 3S9OA 1M90Q 2B89A 4A7PA 2IX7C 1FOSE 4TLFA 3C1LA 5KLIB 1BSHA 2E76D 2AEMA 3AECC 2ZVOB 1YHQP 1OFCX 5BVZA 1USEA 1ZRTE 2ZVNB 1X0TA 3L72G 4OH8B 2FFDB 1J2JB 2DW3A 2K1AA 3E1IA 4GOFA 1IFIA 1URQB 3TGUG 2OYHC 3TK1A 1IJDB 1RHZB 1ZP0C 1W5CE 2H88C 1ZXGA 2H43A 2MKVA 2OQQA 1PP9E 4GKGA 1L0NK 2C0WA 1GDTA 1M8OB 4XA4A 3D70A 3EWKA 3CXHH 1JM0A 1NU1K 2HODA 1U7JA 3V6IA 2YKOA 2MJZA 4I7ZC 3VMZA 1JCDA 2NPSB 2QA4P 1LTGC 1Q86Q 1HF9A 4PV1C 1T2KC 3RK3E 1PGJA 4ZKPA 2CPSA 2YNYA 2OARA 4JQ0D 1YTZI 1M1KQ 1LTJC 1RF1B 3CMAP 2P10A 1S5LH 2E74C 3CXHI 5KAFH 2C9LY 1J1DB 1GW4A 3H1HJ 3Q5RA 3F89A 1WRGA 2QJPB 3MTUE 2Q9IA 2LXBA 1ZRTD 1VQ7P 1AFOA 5APVA 1QVFO 3M0DC 3T97A 1NTKE 1Y47A 3A0HH 1NO4A 1YQ4C 5B66H 2QVAA 1NYHA 2KLVA 4H44D 2N1TA 1YITP 1NTZE 1L4AB 3ITKA 4N3YB 1N86A 1S72P 5CBNA 1PP9D 1YJNP 2JWAA 4PJ0E 3L71D 1CW5A 2QG4A 1M7LA 1BE3G 3CCUP 5H2FE 3B8EB 3L70J 1S9KD 3CX5I 1GW3A 4H0LC 2N1TD 4YTPC 1RE3A 2YO2A 2JR8A 2H8PD 3CC7P 1SQPK 1Q7YQ 5GTIE 4I6MC 3RK3D 3H25A 1SLQA 1KN7A 3CPWO 3VN0A 1Z56A 1LWUC 1VF5C 3O8ZA 4JPZB 3AE3C 1OX3A 3WUVA 1QVGO 4R4MA 1S3JA 1J1EC 2WTYA 1JUNA 2O01N 4WY4A 1VQNP 1OMIA 1E79H 1LNQA 1X9VA 4XFJA 4C7NA 1SQXE 4LGDE 3MUDA 3LIEA 1NTKD 3GF3A 3V4QA 3VTPC 3CC2P 3RBXA 3M9BA 3AE7C 1ZW0A 1IZNB 1NTZD 2BCCG 2KP8A 4HH2A 2V7QH 3M91A 3AE1C 2K88A 2QJKB 1RF0A 2GUVA 3QH9A 4WY4D 3G6EP 4U3FD 3EFFK 4Y99C 2FBWC 1HVVA 4N6JA 3NFQA 1PP9G 1EXIA 3B4SA 3L71G 3HUSA 2M5AA 1KB9H 2L91A 3WUTA 1AJYA 2XZRA 2SPZA 2BASA 2K37A 1LP1B 1PFIA 1AA0A 2V4HA 3TDKA 1AQ5A 1JB0J 3RL0D 1PV3A 2OYHB 1SQBK 5E79E 3VYIA 1LGHB 3A2AA 1E5WA 2Q5UA 2OTLP 2FYUJ 1KB9I 1SQQE 4YXDC 1SQXD 1JY2P 4NPFX 3H1LE 5K5GB 3RK2C 4I7ZB 1TU3F 3P32A 1GL2A 4UB6H 3L73J 1H8AA 1FDMA 4GOEA 2FKWB 1QX8A 4PV1B 5CJ4A 1Y8AA 1LTTC 5CMZA 1BCCG 1VQ4P 3L74J 1LTJB 2Q7CA 4IL6H 2IPPA 2E74B 4TT3H 1SQXK 5KKZC 1GL2D 2KOGA 3WU2E 2JWDA 1SFCC 4U3FG 1VQOP 4LC1A 1G1IA 2IZ0A 4U7JA 1FS0E 1UIXA 1HGZA 1DD3A 3Q3DA 1GD2E 1R8EA 2KNCB 4DOJA 2Z5HA 3FXDA 2V7QJ 1HJ0A 2OYIA 4DJGA 5BU5A 3AE2C 4W7ZA 1NTMJ 3TYYA 1SQQD 3CCQP 2RKLA 1H89A 2R3SA 2UWJE 3IAOA 4ASVA 3H1LD 3C9IA 1GU5A 3N7NA 2R3CA 4H0LB 3CCEP 3GW6A 3L36A 2WSCH 3G9RA 2WSEH 3H1JJ 1NHLA 5AVYB 3UIAA 1AVYA 2Y0CA 2HPCB 3EFGA 5AVTB 1L0LJ 5DJTB 4XE5B 1EZVG 3H1KE 1KYOE 2WPQA 1LWUB 4M3LA 1KQSO 1VF5B 3H1IE 3H6PA 1JTHB 1JY3P 4NPDA 4H44C 1J1EB 3RGUA 4IFDK 1VQMP 2HFED 4BRYB 2IYPA 1GMJA 2WPVB 3Q5PA 3WUUA 4PD4H 2A06G 1YI2P 2P2UA 1L0NE 2M8RA 3R2PA 1BGYG 4H13C 1NU1E 1JEKA 4Y99B 3RK3C 1PGPA 3TF5A 3L72J 3TNUB 3HD7A 1ZLLA 3L75E 4PD4I 3GHGA 2H89C 1SQQG 1EDIA 2YIUC 3TGUJ 1X8YA 3B5ND 2ITAA 1RE3C 1QLED 2QRXA 1HH0A 3H1KD 1KYOD 3JCUE 2IBZE 3VP8A 1MFTA 1H0TA 2ZJSE 3HD7D 1SQVG 2R5BA 3HTKA 1YYCA 2IFMA 5APYA 2RMZA 1FZCA 2KLUA 3CWBG 4R4LA 1K05A 3RK2B 1AQTA 2ZYGA 4WY4C 3HE5B 1JY2N 5APQA 1OW8A 2WSCJ 2PFXA 3MUDC 2FY8A 2WSEJ 3H1HE 3RL0g 4O9BA 1PPJE 3USSA 1L0ND 2XDJA 4IFMA 3H32B 2K9JB 4K3AA 1URQA 1PIXA 4AQRD 1NU1D 2Y0DA 5AW5B 5B5EE 1N8RQ 3O6QB 2JO1A 2R5DA 5KKZB 1RF0C 4UB8E 2O01H 3L75D 3AE5C 3U1CA 1W2EA 3RL0C 1SQPE 2JKVA 1SFCB 2KI7B 3BASA 2O3JA 2AXTH 1URQD 2WT7B 3HUSC 5KLVG 4N78D 1EDKA 2PP6A 3I55P 3LIDA 2IBZD 3V2QA 2A45G 3CCLP 1BE3J 3L37A 1FU1A 1OW7A 1JY3O 3H1KG 5L8RJ 4JF7A 2QJYC 5AW7B 3CL3D 2K3RA 2JJLA 3FWNA 4KJMA 1KZUB 3CCMP 1YJWP 4Y28J 3SFEC 1FOSF 3H1HD 1PPJD 1GK6A 4OGQC 1GL2C 1IFNA 4L74A 3HRNA 2KSEA 3CXHE 3S1KA 2JP3A 3VMAA 1RE4A 1L0NG 1Y9BA 3SFDC 2I1JA 2R44A 2E43A 2RH0A 1FAVA 5APWA 1LTIC 1NU1G 1SQPD 1X22A 4H44B 4CPGA 1DX7A 3CMEP 1VQLP 4ZNCA 3A5TA 4AUWA 1YTZT 1JY3N 1OVUA 1ZV8A 2E5TA 1VQ9P 1U7MA 3L75G 2BCCJ 1S5LE 5AW6B 3NXSA 1SQBE 1L4AD 1T3UA 4EOTA 1QGKB 1HGVA 3KQGA
chains in the Genus database with same CATH topology
4ZKUA 1SQQK 5AVWB 5CCHC 2E42A 2WT7A 5AW9B 2W27A 2Z5IA 1JY2P 4GIFA 3M06A 3A7OA 1GZLA 3RK2C 1FZGA 2I1KA 1KQLA 1VPCA 2OYIC 3RK3B 3P32A 1GL2A 3MGNA 2P7JA 1IFJA 3IFMA 1H8AA 1G2CB 1FDMA 2W6AA 2HG5D 1L4AC 2FKWB 5CCGA 2NPSA 2WPRA 3OAKA 1SFCD 2WSFH 5AW1B 5CJ4A 3TNUA 1LTTC 5CMZA 1RY3A 5BU8B 1ZR2A 3KPEA 3HE4A 2GUSA 1LTJB 2JEEA 2Q7CA 2IPPA 3KDPB 2XKMA 3II6A 5AVSB 1NKNA 2J59M 1SQXK 1NWQA 1KFNA 1RF1A 1GL2D 4GT1A 3MD0A 1MV8A 2KOGA 3WMM0 3NMDA 3P7KA 2P67A 1SFCC 1GTWA 4W80A 2FXMA 2YKQA 1S9KE 5CCGD 4LC1A 1N73B 5AVUB 2NPSD 1G1IA 2WWWA 1JY2O 2KSJA 1CSBA 3B5NB 1HGZA 3VMYA 4DZOA 1MZ9A 1KFMA 2YMYA 2HODB 5AVVB 1GD2E 1LTBC 2YO3A 5CJ0A 3BATA 5CCHA 1OWAA 2WZ7A 3VMXA 4KHXA 1QL2A 4DOJA 4WY4B 2Z5HA 5APSA 4C7NB 4WBAA 1NAFA 3MIWA 2OYIA 3M9QA 3HE5A 5BU5A 5AVXB 2M3BA 4N78E 4W7ZA 1L4AA 3TYYA 1JCCA 3SWYA 3V2PA 1H89A 1CI6A 1ZN5A 1HUCA 3H32A 5APUA 3C9IA 5AVQB 3V2NA 3VOPA 1GU5A 4C7RA 5CCHD 5KLVK 3N7NA 2R3CA 4IFFA 5AVZB 1MFZA 3BRVB 3L36A 2WSCH 2WSEH 3RL0B 2R32A 3TSIA 2YKPA 1NHLA 5AVYB 1OXZA 3UIAA 2HPCB 4AYCA 3EFGA 1SFCA 3PP5A 5AVTB 3HD7C 2Z4EA 4XE5B 1M1JC 2IX7C 1FOSE 3GHGC 3HUSB 2WPQA 4HYTB 1WT6A 1LWUB 4M3LA 1CZQA 1N7SC 2FYZA 2N1TB 3H6PA 1KILC 5BVZA 1JTHB 1LT9C 1NKZB 4C46A 1JY3P 2L5GB 1J1EB 4IFDK 2HFED 4OH8B 2FFDB 1J2JB 3P8CE 3E1IA 2WITA 1JOCA 1IFIA 1URQB 1SP4A 2OYHC 3TK1A 3SWFA 1IJDB 5AVRB 1JO5A 5KJ7C 3CLQA 2FYUK 2H43A 5AW3B 3OA7A 2WPSA 4GKGA 1L0NK 2C0WA 2P2UA 2XU6A 2KB7P 4EIJA 1JMMA 1FZCC 5CHXA 2M8RA 5APXA 1GDTA 2VRSA 4XA4A 3R2PA 2J58A 1NU1K 2HODA 1GL2B 1EQ7A 1GU4A 2YKOA 2MJZA 3VMZA 3V2RA 3RK3C 4Y99B 1JCDA 2NPSB 3TNUB 3OJAB 1LTGC 3HD7A 1ZLLA 2ZFCA 1T2KC 1A02F 1M1JA 1HJBA 3GHGA 3HE4B 1N7SA 4ZKPA 2CPSA 1FZFA 2C0XA 2YNYA 2OARA 3EQ2A 1X8YA 5AW0B 2XV5A 1YTZI 1KILA 1LTJC 3B5ND 3LW5H 4JYCA 1LT9A 1RE3C 1RF1B 2POHA 3V4WA 2C9LY 2A45H 1HH0A 1J1DB 1A02J 1GW4A 2IFNA 3BVHA 1FZAA 3VP8A 1WRGA 3HD7D 3MTUE 2R5BA 3HTKA 2OYHA 1YYCA 1N73C 2IFMA 2Q9IA 5KJ7A 1SVFA 1AFOA 1N7SD 5APVA 3B5NC 1NTKK 2HLOA 3M0DC 3T97A 1KILD 5APYA 3IR9A 4JYBA 1NO4A 1QL1A 3L35A 1FZCA 1FZEA 1MUUA 2KLVA 1T3JA 2N1TA 3RK2B 2OYIB 3I5CA 4WY4C 5AW8B 3HE5B 1JY2N 2A45I 1NTZK 5APQA 1NTMK 3BRTB 1L4AB 3M0AA 4N3YB 1N86A 3L4FA 5AW2B 5AW4B 4O9BA 1G2CA 3U59A 2P1JA 2XDJA 1CW5A 4IFMA 1N7LA 3H32B 4LLHA 5KJ7D 2C9NY 1JNMA 1URQA 1IFDA 1M7LA 4AQRD 2W6BA 3VP9A 3B8EB 1S9KD 5AW5B 1ZR4A 1GW3A 1FZBA 1LTJA 2N1TD 2R5DA 1RE3A 2YO2A 1RF0C 2H8PD 2O01H 1LTSC 1SQPK 3U1CA 1W2EA 3RL0C 4I6MC 1L0LK 5APTA 1SFCB 3NTNA 3RK3D 3U1AA 1NOHA 3CI9A 3BASA 1SLQA 1RE4C 3VN0A 4RESB 1T2KD 2HYNA 1T8ZA 1N73A 1URQD 2N9BA 1Z56A 1IK9A 2O1JA 3HUSC 2WT7B 1LWUC 3B5NA 2N1TC 5KTBA 3O8ZA 4N78D 3M0DA 1H88A 2PP6A 1SQVK 3KYQA 3LIDA 3V2QA 2A45G 2KYVA 1XTCC 1J1EC 2WTYA 3L37A 1FU1A 1JUNA 2FFDC 4I2LC 4WY4A 1JY3O 1X9VA 3P8MC 4C7NA 4LGDE 3MUDA 4JF7A 1URQC 3LIEA 5AW7B 3CL3D 1IC2A 3G3ZA 3V4QA 4I1LA 3VTPC 2JJLA 1GK4A 3M9BA 3V5BA 1KZUB 2Q3IA 2QM8A 1X79B 2KP8A 4HH2A 1FOSF 1FBMA 3M91A 2LKMA 1RF0A 2GUVA 1GK6A 4WY4D 1GL2C 1IFNA 1FJPA 2XNXA 1IFMA 3HRNA 4Y99C 3HD7B 1HVVA 4N6JA 5CCGC 1M1JB 3NFQA 1XTGB 2NPSC 3GHGB 2HPCA 1HWTC 1RE4A 2CPBA 1N7SB 3P8CD 2I1JA 2GM4A 3HUSA 2H7HA 2QM7A 1IO4A 2E43A 1KILB 2O1KA 1LWUA 1FAVA 5APWA 1LTAC 1LT9B 1LTIC 4B86A 1DX7A 1DH3A 1JTHA 2XZRA 1RF1C 3A5TA 2BASA 1HBWA 4AUWA 1YTZT 1PFIA 1JY3N 1N2DC 1AQ5A 4W7YA 1ZV8A 1G1JA 1J1DC 2PAJA 3M9HA 3RL0D 2FFDA 1NH4A 1CI6B 4WB4A 3RK2D 5AW6B 3HTKB 2OYHB 1FJKA 1DEBA 3A3YB 3N4XA 1SQBK 3NXSA 1HTLC 2ZXEB 1L4AD 1T3UA 3VYIA 4EOTA 1VDFA 1LGHB 1HGVA 3A2AA 1FZCB 1E5WA 2Q5UA 3KQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKP A;  3CL3 D;  3L4F A;  2YKQ A;  2W6B A;  2YKO A;  3BRT B;  1JOC A;  3EQ2 A;  3BRV B; 
#chains in the Genus database with same CATH topology
 5AVW B;  1PP9 J;  2E42 A;  2N9Y B;  3CCS P;  3QWO C;  3L71 J;  2IBZ G;  2W27 A;  4GIF A;  4H13 B;  3A7O A;  3JSV C;  1GZL A;  3CX5 E;  3A0H E;  3Q2Y A;  1OIP A;  2OYI C;  2Q6Q A;  3RK3 B;  2WQY C;  5B66 E;  1IFJ A;  2O01 J;  2W6A A;  4NPE A;  1ZOY C;  1ZME C;  1RY3 A;  2YIU B;  3HE4 A;  3FX0 A;  1PZQ A;  4EI2 A;  3II6 A;  5CBO A;  5AVS B;  2J59 M;  1KV4 A;  1KFN A;  3MD0 A;  2M0B A;  1BDC A;  3G4S P;  2P67 A;  3MP7 B;  2XND H;  3L73 E;  4MN4 C;  5AVU B;  2KSJ A;  1CSB A;  2E5Y A;  4DZO A;  2AEJ A;  1MZ9 A;  1EZV I;  3AE4 C;  5TIS E;  1LTB C;  2YO3 A;  3BAT A;  1OWA A;  1SQP G;  3GF7 A;  1BCC J;  3SSU A;  3G71 P;  3D6Z A;  4WY4 B;  2ZT9 D;  4YPC A;  1SQB D;  4C7N B;  4WBA A;  1NAF A;  3MIW A;  2WSS H;  3M9Q A;  2KUB A;  5AVX B;  1BDD A;  1JCC A;  3I56 P;  1HUC A;  5APU A;  4U3F J;  3CX5 D;  4C7R A;  2B87 B;  3FGA D;  3RL0 B;  2LXC B;  2YKP A;  1LJ2 A;  1FC2 C;  3KXD A;  3PLN A;  3PP5 A;  3HD7 C;  2Z4E A;  3GHG C;  1NTM E;  3HUS B;  4HYT B;  2M5A B;  1CZQ A;  3GMA A;  4DCK A;  1FE6 A;  2LR2 A;  3L73 D;  3MHV A;  1KB9 E;  2KK7 A;  1KIL E;  3P8C E;  1RQU A;  4D6T E;  2WIT A;  1JOC A;  2QJY B;  1NTK G;  3H1J E;  1SP4 A;  2AXC A;  2BEQ D;  2QE7 H;  1S5L X;  2E76 C;  1L0L E;  1JO5 A;  1VL2 A;  3CLQ A;  2FYU K;  3OA7 A;  1L2P A;  2K9Y A;  2XU6 A;  1NTZ G;  2KB7 P;  1JMM A;  1FZC C;  5CHX A;  5APX A;  2VRS A;  1K73 Q;  2J58 A;  4OGQ B;  1GL2 B;  1D7M A;  1GU4 A;  3PTZ A;  1SQB G;  2E74 D;  1KQF B;  3V2R A;  2OYO A;  2E75 D;  2ZFC A;  1A02 F;  1M1J A;  2HR3 A;  4UB6 E;  1N7S A;  2D2C D;  1FZF A;  2C0X A;  3EQ2 A;  3C8V A;  2XV5 A;  1KIL A;  1LT9 A;  2YXQ B;  3V4W A;  3AE8 C;  2A45 H;  1KMI Z;  1A02 J;  1NTM D;  1K04 A;  1FZA A;  1P84 H;  1KYO H;  1BGY J;  4L76 A;  3B71 A;  1EDL A;  2PRR A;  3KZI E;  5KJ7 A;  1SVF A;  1N7S D;  1YBK A;  1EC5 A;  3BCC E;  1KIL D;  3IR9 A;  1SQX G;  4D6T D;  1FZE A;  3H1J D;  1MKM A;  1SQQ J;  2IYO A;  2OYI B;  2J5U A;  1L0L D;  5AW8 B;  2A45 I;  1NTM K;  2YXR B;  1KC8 Q;  4GDO A;  5AW2 B;  5GTH H;  2Q1K A;  2KS1 A;  1G2C A;  1P84 I;  2P1J A;  1KYO I;  1RH5 B;  1N7L A;  5KJ7 D;  1JNM A;  1IFD A;  3A0B H;  1R5L A;  2W6B A;  1SQV J;  1FZB A;  1VF5 D;  3IF4 A;  5C39 A;  1VQK P;  1L0L K;  3NTN A;  2KZI A;  3CWB J;  1S4X A;  1RE4 C;  4RES B;  2HYN A;  1N73 A;  2N9B A;  1IK9 A;  2O1J A;  3CD6 P;  1OW6 A;  1DIP A;  3B5N A;  2N1T C;  1H88 A;  2B9B A;  1SQV K;  3KYQ A;  3AEG C;  4L75 A;  2IZ1 A;  1XTC C;  2FXP A;  3P8M C;  3BCC D;  3G3Z A;  1R5S A;  3H1L G;  2Q3I A;  4JBZ A;  1M57 D;  5KAI E;  4PD4 E;  2QM8 A;  1WMK A;  5TJH A;  4D6T G;  1NGM B;  2ZYA A;  3D71 A;  2LKM A;  5KLV J;  4ZMD A;  3H1I D;  1IK7 A;  1FJP A;  2IBZ I;  1BE3 E;  4ASW A;  3HD7 B;  1XTG B;  3GHG B;  1S2E A;  2G8Y A;  2IDB A;  3H1K J;  2GM4 A;  2H7H A;  2QM7 A;  1IO4 A;  5B5E H;  2O1K A;  4HB1 A;  1LTA C;  1DH3 A;  1LT1 A;  2ZT9 C;  3OW2 O;  1G1J A;  2PAJ A;  3M9H A;  2FFD A;  1NH4 A;  1H0T B;  1CI6 B;  4WB4 A;  3ZDM A;  3RK2 D;  4IL6 X;  3HTK B;  1FJK A;  1DEB A;  3A3Y B;  2E76 B;  3N4X A;  1HTL C;  2ZXE B;  1PGO A;  1VDF A;  1NAY A;  1FZC B;  2WT7 A;  1L0N J;  4DT0 A;  2Z5I A;  3M06 A;  1FZG A;  1KQL A;  1VPC A;  4BXL A;  1NU1 J;  2P7J A;  3IFM A;  4PD4 D;  2BCC E;  3BCC G;  5CCG A;  2NPS A;  2WPR A;  3OAK A;  1SFC D;  1AVO A;  2WSF H;  3L75 J;  2W83 C;  2B88 A;  4GOD A;  1ZR2 A;  3L70 E;  2GUS A;  2JEE A;  1BE3 D;  3KDP B;  2XKM A;  4OWF A;  1U57 A;  2FXO A;  1NWQ A;  1OZH A;  3L71 E;  1RF1 A;  2W8Z A;  3P7K A;  3H1I G;  1NJI Q;  3RBZ A;  1S9K E;  5CCG D;  2NPS D;  3KHU A;  3PJS K;  1KFM A;  2AXT E;  2HOD B;  5CCH A;  2WZ7 A;  1QL2 A;  2Y9Z A;  5M1B A;  4PJ0 H;  1EDJ A;  1Q81 Q;  1RQV A;  3AEB C;  1L4A A;  5H2F H;  3FXE A;  3SWY A;  2E75 C;  2WMM A;  2I8D A;  1ZN5 A;  3V2N A;  2D2C C;  4RJT A;  3S4R A;  5CCH D;  5GTI H;  4IFF A;  2NRG A;  5AVZ B;  3E7K A;  3CX5 H;  3BRV B;  5DJU B;  2BCC D;  1BCC E;  2R32 A;  5KAF E;  3TSI A;  1OXZ A;  1SQP J;  3L70 D;  3T97 B;  3W67 A;  1M1J C;  1WT6 A;  1N7S C;  2FYZ A;  2N1T B;  2CK3 H;  1KIL C;  4U3F E;  2AEF A;  1LT9 C;  1NKZ B;  4C46 A;  2OGU A;  2L5G B;  3K5B A;  2YMK A;  1PL5 A;  1SS1 A;  2W90 A;  4H13 D;  4RKU J;  1JMB A;  1M56 D;  2G3A A;  3FWL A;  3MZW B;  3SWF A;  5AVR B;  5KJ7 C;  5TIS H;  1T6A A;  5AW3 B;  1Q82 Q;  3CXH D;  2FYU E;  2WPS A;  2WSF J;  4EIJ A;  3H1H G;  1PPJ G;  1EQ7 A;  1UII A;  2ZYD A;  2Q3E A;  3OJA B;  4WVZ A;  1IFP A;  3SWK A;  1HJB A;  3HE4 B;  3W68 A;  4WWI A;  1NTK J;  3L74 E;  4QMA A;  1VQ5 P;  3PHL A;  1BCC D;  5AW0 B;  4JYC A;  3LW5 H;  1YQ3 C;  1EZV E;  2POH A;  2FYN C;  2QIW A;  2ZT9 B;  1OVV A;  3D6Y A;  4EDF A;  5EFW B;  1NTZ J;  5E79 H;  1LP1 A;  2IFN A;  3BVH A;  2B87 A;  1QEX A;  2KIK A;  4IOI H;  3AEE C;  3L70 G;  2OYH A;  1N73 C;  2QSI A;  1FDI A;  1SQB J;  3GLM A;  1FDO A;  1YJ9 P;  3B5N C;  4HJG H;  1NTK K;  2HLO A;  4JYB A;  1QL1 A;  3L35 A;  3E1R A;  1MUU A;  1T3J A;  3JC2 2;  2A06 E;  3I5C A;  1NTZ K;  3BRT B;  3M0A A;  3L4F A;  5AW4 B;  2FYU D;  3U59 A;  3CCR P;  1BGY E;  4LLH A;  2C9N Y;  2BEZ F;  3VP9 A;  3Q1M A;  3Q5S A;  1ZR4 A;  1LTJ A;  3WU2 H;  2OTJ P;  2QEX P;  1LTS C;  2KXP B;  2GA1 A;  1SQX J;  5APT A;  3U1A A;  1NOH A;  2W6J H;  3CI9 A;  3L74 D;  3AEA C;  4PV1 D;  1T2K D;  1T8Z A;  1EZV D;  5KLI C;  3GG2 A;  5KTB A;  3M0D A;  1SQV E;  1PGQ A;  2KYV A;  2KNC A;  2FFD C;  4I2L C;  1AV1 A;  1Q2N A;  4OGQ D;  1URQ C;  1KD1 Q;  3CWB E;  1IC2 A;  2E75 B;  3KZI H;  4I1L A;  3CC4 P;  1K9M Q;  1GK4 A;  3V5B A;  2D2C B;  2A06 D;  4YXW H;  1X79 B;  1FBM A;  4IL6 E;  1OVR A;  3LW5 J;  1BGY D;  2XNX A;  1IFM A;  4K35 A;  3PH0 A;  3L72 E;  5CCG C;  1M1J B;  2NPS C;  2HPC A;  2FYU G;  1HWT C;  1KB9 D;  2CPB A;  1N7S B;  3P8C D;  3TGU E;  1KIL B;  1LWU A;  1LT9 B;  3F5H A;  3L73 G;  4B86 A;  3H1L J;  4H0L D;  1JTH A;  1RF1 C;  1HBW A;  3ABV C;  1N2D C;  4W7Y A;  5KLV E;  2ZXX A;  1J1D C;  4BRY A;  4D6T J;  1EXJ A;  1KOR A;  1DEE G;  3L74 G;  3AE6 C;  2QJP C;  1SQV D;  1VQ6 P;  1P84 E;  2PGD A;  3CCJ P;  1USD A;  2KZJ A;  4ZKU A;  1SQQ K;  4RO0 A;  5CCH C;  4EYY Q;  5AW9 B;  2M3E A;  2OTK E;  3CWB D;  2I1K A;  2JDI H;  3MGN A;  4KT0 J;  2KS1 B;  1G2C B;  2HG5 D;  1L4A C;  2Y9Y A;  5AW1 B;  3TNU A;  3R4Y A;  5KAI H;  5GTH E;  5BU8 B;  3KPE A;  3JCU H;  1W2B O;  2FYN B;  3L72 D;  1NKN A;  1DD4 A;  3A0B E;  1NTM G;  1K8A Q;  3AED C;  4GT1 A;  1MV8 A;  3WMM 0;  3NMD A;  4OVN F;  3TGU D;  1GTW A;  4W80 A;  2FXM A;  2YKQ A;  1KTM A;  1N73 B;  2WWW A;  1JY2 O;  1BSN A;  1NVO A;  3B5N B;  1VQP P;  1KQG B;  3VMY A;  1YIJ P;  2YMY A;  5KLV D;  2P58 A;  3BCC J;  5AVV B;  3H1J G;  5CJ0 A;  3VMX A;  2NZ2 A;  3AEF C;  4KHX A;  1L0L G;  5APS A;  3CCV P;  2WVR A;  3HE5 A;  1P84 D;  2M3B A;  4N78 E;  1VQ8 P;  2RN0 A;  3V2P A;  3H1I J;  1CI6 A;  3H32 A;  4UB8 H;  2K9J A;  5AVQ B;  3VOP A;  3PRJ A;  1Q90 D;  2Y0E A;  5KLV K;  4Z1M H;  3AE9 C;  1MFZ A;  3IN6 A;  3O6Q A;  2ZAE B;  4HKZ H;  2QJK C;  1S1C X;  4AYC A;  4BWN A;  1SFC A;  4L73 A;  3S9O A;  1M90 Q;  2B89 A;  4A7P A;  2IX7 C;  1FOS E;  4TLF A;  3C1L A;  5KLI B;  1BSH A;  2E76 D;  2AEM A;  3AEC C;  2ZVO B;  1YHQ P;  1OFC X;  5BVZ A;  1USE A;  1ZRT E;  2ZVN B;  1X0T A;  3L72 G;  4OH8 B;  2FFD B;  1J2J B;  2DW3 A;  2K1A A;  3E1I A;  4GOF A;  1IFI A;  1URQ B;  3TGU G;  2OYH C;  3TK1 A;  1IJD B;  1RHZ B;  1ZP0 C;  1W5C E;  2H88 C;  1ZXG A;  2H43 A;  2MKV A;  2OQQ A;  1PP9 E;  4GKG A;  1L0N K;  2C0W A;  1GDT A;  1M8O B;  4XA4 A;  3D70 A;  3EWK A;  3CXH H;  1JM0 A;  1NU1 K;  2HOD A;  1U7J A;  3V6I A;  2YKO A;  2MJZ A;  4I7Z C;  3VMZ A;  1JCD A;  2NPS B;  2QA4 P;  1LTG C;  1Q86 Q;  1HF9 A;  4PV1 C;  1T2K C;  3RK3 E;  1PGJ A;  4ZKP A;  2CPS A;  2YNY A;  2OAR A;  4JQ0 D;  1YTZ I;  1M1K Q;  1LTJ C;  1RF1 B;  3CMA P;  2P10 A;  1S5L H;  2E74 C;  3CXH I;  5KAF H;  2C9L Y;  1J1D B;  1GW4 A;  3H1H J;  3Q5R A;  3F89 A;  1WRG A;  2QJP B;  3MTU E;  2Q9I A;  2LXB A;  1ZRT D;  1VQ7 P;  1AFO A;  5APV A;  1QVF O;  3M0D C;  3T97 A;  1NTK E;  1Y47 A;  3A0H H;  1NO4 A;  1YQ4 C;  5B66 H;  2QVA A;  1NYH A;  2KLV A;  4H44 D;  2N1T A;  1YIT P;  1NTZ E;  1L4A B;  3ITK A;  4N3Y B;  1N86 A;  1S72 P;  5CBN A;  1PP9 D;  1YJN P;  2JWA A;  4PJ0 E;  3L71 D;  1CW5 A;  2QG4 A;  1M7L A;  1BE3 G;  3CCU P;  5H2F E;  3B8E B;  3L70 J;  1S9K D;  3CX5 I;  1GW3 A;  4H0L C;  2N1T D;  4YTP C;  1RE3 A;  2YO2 A;  2JR8 A;  2H8P D;  3CC7 P;  1SQP K;  1Q7Y Q;  5GTI E;  4I6M C;  3RK3 D;  3H25 A;  1SLQ A;  1KN7 A;  3CPW O;  3VN0 A;  1Z56 A;  1LWU C;  1VF5 C;  3O8Z A;  4JPZ B;  3AE3 C;  1OX3 A;  3WUV A;  1QVG O;  4R4M A;  1S3J A;  1J1E C;  2WTY A;  1JUN A;  2O01 N;  4WY4 A;  1VQN P;  1OMI A;  1E79 H;  1LNQ A;  1X9V A;  4XFJ A;  4C7N A;  1SQX E;  4LGD E;  3MUD A;  3LIE A;  1NTK D;  3GF3 A;  3V4Q A;  3VTP C;  3CC2 P;  3RBX A;  3M9B A;  3AE7 C;  1ZW0 A;  1IZN B;  1NTZ D;  2BCC G;  2KP8 A;  4HH2 A;  2V7Q H;  3M91 A;  3AE1 C;  2K88 A;  2QJK B;  1RF0 A;  2GUV A;  3QH9 A;  4WY4 D;  3G6E P;  4U3F D;  3EFF K;  4Y99 C;  2FBW C;  1HVV A;  4N6J A;  3NFQ A;  1PP9 G;  1EXI A;  3B4S A;  3L71 G;  3HUS A;  2M5A A;  1KB9 H;  2L91 A;  3WUT A;  1AJY A;  2XZR A;  2SPZ A;  2BAS A;  2K37 A;  1LP1 B;  1PFI A;  1AA0 A;  2V4H A;  3TDK A;  1AQ5 A;  1JB0 J;  3RL0 D;  1PV3 A;  2OYH B;  1SQB K;  5E79 E;  3VYI A;  1LGH B;  3A2A A;  1E5W A;  2Q5U A;  2OTL P;  2FYU J;  1KB9 I;  1SQQ E;  4YXD C;  1SQX D;  1JY2 P;  4NPF X;  3H1L E;  5K5G B;  3RK2 C;  4I7Z B;  1TU3 F;  3P32 A;  1GL2 A;  4UB6 H;  3L73 J;  1H8A A;  1FDM A;  4GOE A;  2FKW B;  1QX8 A;  4PV1 B;  5CJ4 A;  1Y8A A;  1LTT C;  5CMZ A;  1BCC G;  1VQ4 P;  3L74 J;  1LTJ B;  2Q7C A;  4IL6 H;  2IPP A;  2E74 B;  4TT3 H;  1SQX K;  5KKZ C;  1GL2 D;  2KOG A;  3WU2 E;  2JWD A;  1SFC C;  4U3F G;  1VQO P;  4LC1 A;  1G1I A;  2IZ0 A;  4U7J A;  1FS0 E;  1UIX A;  1HGZ A;  1DD3 A;  3Q3D A;  1GD2 E;  1R8E A;  2KNC B;  4DOJ A;  2Z5H A;  3FXD A;  2V7Q J;  1HJ0 A;  2OYI A;  4DJG A;  5BU5 A;  3AE2 C;  4W7Z A;  1NTM J;  3TYY A;  1SQQ D;  3CCQ P;  2RKL A;  1H89 A;  2R3S A;  2UWJ E;  3IAO A;  4ASV A;  3H1L D;  3C9I A;  1GU5 A;  3N7N A;  2R3C A;  4H0L B;  3CCE P;  3GW6 A;  3L36 A;  2WSC H;  3G9R A;  2WSE H;  3H1J J;  1NHL A;  5AVY B;  3UIA A;  1AVY A;  2Y0C A;  2HPC B;  3EFG A;  5AVT B;  1L0L J;  5DJT B;  4XE5 B;  1EZV G;  3H1K E;  1KYO E;  2WPQ A;  1LWU B;  4M3L A;  1KQS O;  1VF5 B;  3H1I E;  3H6P A;  1JTH B;  1JY3 P;  4NPD A;  4H44 C;  1J1E B;  3RGU A;  4IFD K;  1VQM P;  2HFE D;  4BRY B;  2IYP A;  1GMJ A;  2WPV B;  3Q5P A;  3WUU A;  4PD4 H;  2A06 G;  1YI2 P;  2P2U A;  1L0N E;  2M8R A;  3R2P A;  1BGY G;  4H13 C;  1NU1 E;  1JEK A;  4Y99 B;  3RK3 C;  1PGP A;  3TF5 A;  3L72 J;  3TNU B;  3HD7 A;  1ZLL A;  3L75 E;  4PD4 I;  3GHG A;  2H89 C;  1SQQ G;  1EDI A;  2YIU C;  3TGU J;  1X8Y A;  3B5N D;  2ITA A;  1RE3 C;  1QLE D;  2QRX A;  1HH0 A;  3H1K D;  1KYO D;  3JCU E;  2IBZ E;  3VP8 A;  1MFT A;  1H0T A;  2ZJS E;  3HD7 D;  1SQV G;  2R5B A;  3HTK A;  1YYC A;  2IFM A;  5APY A;  2RMZ A;  1FZC A;  2KLU A;  3CWB G;  4R4L A;  1K05 A;  3RK2 B;  1AQT A;  2ZYG A;  4WY4 C;  3HE5 B;  1JY2 N;  5APQ A;  1OW8 A;  2WSC J;  2PFX A;  3MUD C;  2FY8 A;  2WSE J;  3H1H E;  3RL0 g;  4O9B A;  1PPJ E;  3USS A;  1L0N D;  2XDJ A;  4IFM A;  3H32 B;  2K9J B;  4K3A A;  1URQ A;  1PIX A;  4AQR D;  1NU1 D;  2Y0D A;  5AW5 B;  5B5E E;  1N8R Q;  3O6Q B;  2JO1 A;  2R5D A;  5KKZ B;  1RF0 C;  4UB8 E;  2O01 H;  3L75 D;  3AE5 C;  3U1C A;  1W2E A;  3RL0 C;  1SQP E;  2JKV A;  1SFC B;  2KI7 B;  3BAS A;  2O3J A;  2AXT H;  1URQ D;  2WT7 B;  3HUS C;  5KLV G;  4N78 D;  1EDK A;  2PP6 A;  3I55 P;  3LID A;  2IBZ D;  3V2Q A;  2A45 G;  3CCL P;  1BE3 J;  3L37 A;  1FU1 A;  1OW7 A;  1JY3 O;  3H1K G;  5L8R J;  4JF7 A;  2QJY C;  5AW7 B;  3CL3 D;  2K3R A;  2JJL A;  3FWN A;  4KJM A;  1KZU B;  3CCM P;  1YJW P;  4Y28 J;  3SFE C;  1FOS F;  3H1H D;  1PPJ D;  1GK6 A;  4OGQ C;  1GL2 C;  1IFN A;  4L74 A;  3HRN A;  2KSE A;  3CXH E;  3S1K A;  2JP3 A;  3VMA A;  1RE4 A;  1L0N G;  1Y9B A;  3SFD C;  2I1J A;  2R44 A;  2E43 A;  2RH0 A;  1FAV A;  5APW A;  1LTI C;  1NU1 G;  1SQP D;  1X22 A;  4H44 B;  4CPG A;  1DX7 A;  3CME P;  1VQL P;  4ZNC A;  3A5T A;  4AUW A;  1YTZ T;  1JY3 N;  1OVU A;  1ZV8 A;  2E5T A;  1VQ9 P;  1U7M A;  3L75 G;  2BCC J;  1S5L E;  5AW6 B;  3NXS A;  1SQB E;  1L4A D;  1T3U A;  4EOT A;  1QGK B;  1HGV A;  3KQG A; 
#chains in the Genus database with same CATH homology
 4ZKU A;  1SQQ K;  5AVW B;  5CCH C;  2E42 A;  2WT7 A;  5AW9 B;  2W27 A;  2Z5I A;  1JY2 P;  4GIF A;  3M06 A;  3A7O A;  1GZL A;  3RK2 C;  1FZG A;  2I1K A;  1KQL A;  1VPC A;  2OYI C;  3RK3 B;  3P32 A;  1GL2 A;  3MGN A;  2P7J A;  1IFJ A;  3IFM A;  1H8A A;  1G2C B;  1FDM A;  2W6A A;  2HG5 D;  1L4A C;  2FKW B;  5CCG A;  2NPS A;  2WPR A;  3OAK A;  1SFC D;  2WSF H;  5AW1 B;  5CJ4 A;  3TNU A;  1LTT C;  5CMZ A;  1RY3 A;  5BU8 B;  1ZR2 A;  3KPE A;  3HE4 A;  2GUS A;  1LTJ B;  2JEE A;  2Q7C A;  2IPP A;  3KDP B;  2XKM A;  3II6 A;  5AVS B;  1NKN A;  2J59 M;  1SQX K;  1NWQ A;  1KFN A;  1RF1 A;  1GL2 D;  4GT1 A;  3MD0 A;  1MV8 A;  2KOG A;  3WMM 0;  3NMD A;  3P7K A;  2P67 A;  1SFC C;  1GTW A;  4W80 A;  2FXM A;  2YKQ A;  1S9K E;  5CCG D;  4LC1 A;  1N73 B;  5AVU B;  2NPS D;  1G1I A;  2WWW A;  1JY2 O;  2KSJ A;  1CSB A;  3B5N B;  1HGZ A;  3VMY A;  4DZO A;  1MZ9 A;  1KFM A;  2YMY A;  2HOD B;  5AVV B;  1GD2 E;  1LTB C;  2YO3 A;  5CJ0 A;  3BAT A;  5CCH A;  1OWA A;  2WZ7 A;  3VMX A;  4KHX A;  1QL2 A;  4DOJ A;  4WY4 B;  2Z5H A;  5APS A;  4C7N B;  4WBA A;  1NAF A;  3MIW A;  2OYI A;  3M9Q A;  3HE5 A;  5BU5 A;  5AVX B;  2M3B A;  4N78 E;  4W7Z A;  1L4A A;  3TYY A;  1JCC A;  3SWY A;  3V2P A;  1H89 A;  1CI6 A;  1ZN5 A;  1HUC A;  3H32 A;  5APU A;  3C9I A;  5AVQ B;  3V2N A;  3VOP A;  1GU5 A;  4C7R A;  5CCH D;  5KLV K;  3N7N A;  2R3C A;  4IFF A;  5AVZ B;  1MFZ A;  3BRV B;  3L36 A;  2WSC H;  2WSE H;  3RL0 B;  2R32 A;  3TSI A;  2YKP A;  1NHL A;  5AVY B;  1OXZ A;  3UIA A;  2HPC B;  4AYC A;  3EFG A;  1SFC A;  3PP5 A;  5AVT B;  3HD7 C;  2Z4E A;  4XE5 B;  1M1J C;  2IX7 C;  1FOS E;  3GHG C;  3HUS B;  2WPQ A;  4HYT B;  1WT6 A;  1LWU B;  4M3L A;  1CZQ A;  1N7S C;  2FYZ A;  2N1T B;  3H6P A;  1KIL C;  5BVZ A;  1JTH B;  1LT9 C;  1NKZ B;  4C46 A;  1JY3 P;  2L5G B;  1J1E B;  4IFD K;  2HFE D;  4OH8 B;  2FFD B;  1J2J B;  3P8C E;  3E1I A;  2WIT A;  1JOC A;  1IFI A;  1URQ B;  1SP4 A;  2OYH C;  3TK1 A;  3SWF A;  1IJD B;  5AVR B;  1JO5 A;  5KJ7 C;  3CLQ A;  2FYU K;  2H43 A;  5AW3 B;  3OA7 A;  2WPS A;  4GKG A;  1L0N K;  2C0W A;  2P2U A;  2XU6 A;  2KB7 P;  4EIJ A;  1JMM A;  1FZC C;  5CHX A;  2M8R A;  5APX A;  1GDT A;  2VRS A;  4XA4 A;  3R2P A;  2J58 A;  1NU1 K;  2HOD A;  1GL2 B;  1EQ7 A;  1GU4 A;  2YKO A;  2MJZ A;  3VMZ A;  3V2R A;  3RK3 C;  4Y99 B;  1JCD A;  2NPS B;  3TNU B;  3OJA B;  1LTG C;  3HD7 A;  1ZLL A;  2ZFC A;  1T2K C;  1A02 F;  1M1J A;  1HJB A;  3GHG A;  3HE4 B;  1N7S A;  4ZKP A;  2CPS A;  1FZF A;  2C0X A;  2YNY A;  2OAR A;  3EQ2 A;  1X8Y A;  5AW0 B;  2XV5 A;  1YTZ I;  1KIL A;  1LTJ C;  3B5N D;  3LW5 H;  4JYC A;  1LT9 A;  1RE3 C;  1RF1 B;  2POH A;  3V4W A;  2C9L Y;  2A45 H;  1HH0 A;  1J1D B;  1A02 J;  1GW4 A;  2IFN A;  3BVH A;  1FZA A;  3VP8 A;  1WRG A;  3HD7 D;  3MTU E;  2R5B A;  3HTK A;  2OYH A;  1YYC A;  1N73 C;  2IFM A;  2Q9I A;  5KJ7 A;  1SVF A;  1AFO A;  1N7S D;  5APV A;  3B5N C;  1NTK K;  2HLO A;  3M0D C;  3T97 A;  1KIL D;  5APY A;  3IR9 A;  4JYB A;  1NO4 A;  1QL1 A;  3L35 A;  1FZC A;  1FZE A;  1MUU A;  2KLV A;  1T3J A;  2N1T A;  3RK2 B;  2OYI B;  3I5C A;  4WY4 C;  5AW8 B;  3HE5 B;  1JY2 N;  2A45 I;  1NTZ K;  5APQ A;  1NTM K;  3BRT B;  1L4A B;  3M0A A;  4N3Y B;  1N86 A;  3L4F A;  5AW2 B;  5AW4 B;  4O9B A;  1G2C A;  3U59 A;  2P1J A;  2XDJ A;  1CW5 A;  4IFM A;  1N7L A;  3H32 B;  4LLH A;  5KJ7 D;  2C9N Y;  1JNM A;  1URQ A;  1IFD A;  1M7L A;  4AQR D;  2W6B A;  3VP9 A;  3B8E B;  1S9K D;  5AW5 B;  1ZR4 A;  1GW3 A;  1FZB A;  1LTJ A;  2N1T D;  2R5D A;  1RE3 A;  2YO2 A;  1RF0 C;  2H8P D;  2O01 H;  1LTS C;  1SQP K;  3U1C A;  1W2E A;  3RL0 C;  4I6M C;  1L0L K;  5APT A;  1SFC B;  3NTN A;  3RK3 D;  3U1A A;  1NOH A;  3CI9 A;  3BAS A;  1SLQ A;  1RE4 C;  3VN0 A;  4RES B;  1T2K D;  2HYN A;  1T8Z A;  1N73 A;  1URQ D;  2N9B A;  1Z56 A;  1IK9 A;  2O1J A;  3HUS C;  2WT7 B;  1LWU C;  3B5N A;  2N1T C;  5KTB A;  3O8Z A;  4N78 D;  3M0D A;  1H88 A;  2PP6 A;  1SQV K;  3KYQ A;  3LID A;  3V2Q A;  2A45 G;  2KYV A;  1XTC C;  1J1E C;  2WTY A;  3L37 A;  1FU1 A;  1JUN A;  2FFD C;  4I2L C;  4WY4 A;  1JY3 O;  1X9V A;  3P8M C;  4C7N A;  4LGD E;  3MUD A;  4JF7 A;  1URQ C;  3LIE A;  5AW7 B;  3CL3 D;  1IC2 A;  3G3Z A;  3V4Q A;  4I1L A;  3VTP C;  2JJL A;  1GK4 A;  3M9B A;  3V5B A;  1KZU B;  2Q3I A;  2QM8 A;  1X79 B;  2KP8 A;  4HH2 A;  1FOS F;  1FBM A;  3M91 A;  2LKM A;  1RF0 A;  2GUV A;  1GK6 A;  4WY4 D;  1GL2 C;  1IFN A;  1FJP A;  2XNX A;  1IFM A;  3HRN A;  4Y99 C;  3HD7 B;  1HVV A;  4N6J A;  5CCG C;  1M1J B;  3NFQ A;  1XTG B;  2NPS C;  3GHG B;  2HPC A;  1HWT C;  1RE4 A;  2CPB A;  1N7S B;  3P8C D;  2I1J A;  2GM4 A;  3HUS A;  2H7H A;  2QM7 A;  1IO4 A;  2E43 A;  1KIL B;  2O1K A;  1LWU A;  1FAV A;  5APW A;  1LTA C;  1LT9 B;  1LTI C;  4B86 A;  1DX7 A;  1DH3 A;  1JTH A;  2XZR A;  1RF1 C;  3A5T A;  2BAS A;  1HBW A;  4AUW A;  1YTZ T;  1PFI A;  1JY3 N;  1N2D C;  1AQ5 A;  4W7Y A;  1ZV8 A;  1G1J A;  1J1D C;  2PAJ A;  3M9H A;  3RL0 D;  2FFD A;  1NH4 A;  1CI6 B;  4WB4 A;  3RK2 D;  5AW6 B;  3HTK B;  2OYH B;  1FJK A;  1DEB A;  3A3Y B;  3N4X A;  1SQB K;  3NXS A;  1HTL C;  2ZXE B;  1L4A D;  1T3U A;  3VYI A;  4EOT A;  1VDF A;  1LGH B;  1HGV A;  3A2A A;  1FZC B;  1E5W A;  2Q5U A;  3KQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...