3CL3D

Crystal structure of a vflip-ikkgamma complex: insights into viral activation of the ikk signalosome
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
QQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a vFlip-IKKgamma complex: insights into viral activation of the IKK signalosome.
pubmed doi rcsb
source organism Human gammaherpesvirus 8
molecule tags Viral protein/signaling protein
molecule keywords ORF K13
total genus 24
structure length 59
sequence length 59
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3cl3D00
3EQ2A 2YKQA 1JOCA 2YKPA 3BRVB 2YKOA 3L4FA 3BRTB 3CL3D 2W6BA
chains in the Genus database with same CATH superfamily
3L73D 3CPWO 5CCHC 3G4SP 1OW6A 1Y8AA 2HPCA 1OX3A 2KK7A 3GHGA 5AVXB 1U7MA 1S9KE 4H0LB 1G1JA 1OXZA 3CC4P 1CW5A 2K9JA 1NTMJ 1NTMD 1FZGA 1QVGO 4EOTA 1GZLA 3TGUD 4HJGH 3GG2A 2Q3IA 3H1HG 1VF5B 4R4LA 1JY3O 1KB9D 1JY2O 3L73J 5AVVB 3B5NA 3RK2B 3V2NA 4C7NA 5KLIB 3N7NA 4K3AA 1ZLLA 4AUWA 2JR8A 1NH4A 1FU1A 4N78D 2XNDH 4Y99B 5AVSB 2WT7B 3CD6P 1NU1G 4PD4H 2KUBA 1JTHB 4Y99C 1DH3A 2NPSC 3U1CA 1JMBA 1LTBC 3LW5J 1KB9E 2O01J 1PPJD 2W83C 3M0DC 4ZNCA 3WUVA 1NGMB 3CC7P 5KLVD 1NU1J 2WZ7A 2Y0EA 3H1IJ 5CHXA 4WWIA 5CCHA 3C1LA 1NTME 2RMZA 5AW6B 1H88A 1H8AA 2ZVOB 2K1AA 1URQA 2E43A 4CPGA 2Q1KA 2BCCD 2YKPA 4HB1A 5CMZA 2FXMA 2QJYB 3H1LD 3L74G 3SWYA 1BCCG 2LKMA 2QJPC 1Q90D 3L73E 1NTZD 4JQ0D 1WMKA 2E74B 2PAJA 1J1EC 1PP9J 4WY4C 1YHQP 4I7ZC 3A0BE 5B66E 2FFDC 2QJKC 1KFNA 2PRRA 2OTJP 3ABVC 1K04A 2E74D 3H32B 1ZXGA 4IFMA 1OZHA 5C39A 3TF5A 3U59A 1FOSE 1DD4A 1IFPA 2J5UA 3S4RA 2P1JA 2YXQB 3VMZA 2ZJSE 1LWUA 4YPCA 1EXIA 2OTLP 2E76B 1S4XA 2IZ1A 3GW6A 2KP8A 1M90Q 2OYIC 2NPSA 1RF1A 2WPSA 5AW4B 1FDMA 1LTAC 2IYOA 1EDLA 2HPCB 2P2UA 1QL2A 2Q6QA 2VRSA 3AEAC 3CXHH 3H1KG 3MHVA 1YQ4C 1M8OB 3CX5H 3H1JG 2QG4A 4WY4D 1J1DB 4GKGA 3V4QA 1NTZE 1HGZA 1PP9E 2JEEA 2IBZD 3BCCD 1BE3G 3L70G 3M9QA 5CJ0A 3VP9A 1K73Q 1IJDB 3FXEA 1LTSC 2OQQA 4M3LA 4XFJA 1JB0J 1VQMP 1HH0A 3VMXA 4BWNA 5K5GB 3L72J 2Z5HA 5APTA 3T97B 3VOPA 3AE9C 1L4AD 1VDFA 1Q86Q 3VN0A 2H89C 4YXWH 3L70J 2QJYC 1OFCX 4DJGA 3GHGB 3CCSP 1BGYD 1PGOA 5KTBA 3V6IA 2WT7A 1L0NJ 3LIDA 2XNXA 1KTMA 3OW2O 4GT1A 1PPJE 5KJ7D 2WSCJ 2KSJA 2W27A 4H44C 2N1TD 1URQB 1EZVI 3G3ZA 1RF0A 5TISE 5AW5B 4OH8B 3VP8A 3OAKA 4W7YA 2NPSD 2QSIA 3B4SA 1MUUA 1SQQK 3N4XA 3W67A 1VQNP 2FXOA 2XZRA 4AQRD 5DJUB 4I2LC 1SQQD 2QA4P 1NTZJ 3GF3A 1KQGB 4DT0A 2OARA 3M91A 1XTGB 4JBZA 3QWOC 5AW1B 3L35A 2IBZG 3L70D 3Q2YA 3BCCG 1H89A 1EXJA 3TGUE 1LTJC 5GTIH 3MIWA 1LTTC 1YJNP 1DD3A 1FC2C 2YMKA 1SQVG 2FYUD 4U3FG 3VMAA 2C0XA 2C9LY 1EDKA 4H0LC 3D71A 1EZVD 4UB6E 2WSSH 1SFCA 3BCCJ 3HD7B 1M1JC 1YTZT 2LXBA 2JWDA 3BATA 3Q5RA 2C9NY 3V5BA 3F5HA 4RJTA 1RF1B 1GTWA 4ZKUA 4YXDC 5KLVK 1HWTC 1KFMA 1L4AB 1SQPG 3HD7D 2FBWC 3HE5B 3R2PA 4RO0A 5AW0B 5BVZA 1EZVE 3HUSC 1LTIC 2HG5D 1LWUB 1VF5D 2A45I 3TSIA 3KZIH 3RL0g 3TNUA 2ZT9B 4UB8E 1LT9A 3RGUA 1SQPJ 1SQXJ 4KHXA 2LXCB 2QM7A 2KYVA 2Y9YA 4QMAA 1MZ9A 1SQBK 1MFZA 3TK1A 3MP7B 1FZBA 1KB9H 1BCCD 2AXCA 2ZYGA 5CCGD 1JY2P 1OMIA 4WVZA 4GIFA 2Q5UA 2Z5IA 5KAIE 4N78E 5TISH 2HR3A 3F89A 1BE3D 3A3YB 4PD4D 1L0LJ 4KT0J 1S5LX 3CWBE 4WBAA 2D2CD 1W2EA 3M9BA 3IN6A 3TGUG 2P7JA 3P32A 1N2DC 3AEDC 3HE4A 5AVZB 1BGYE 1WT6A 3NXSA 2XKMA 4AYCA 4DOJA 2QVAA 3C9IA 2AEJA 3CL3D 4GDOA 4TLFA 1PL5A 2Y0DA 1M1JA 1RE4A 2R5DA 3LIEA 1KILA 1SQPE 3H1ID 1URQD 1NU1D 1SQXE 1JCCA 1X9VA 2FYUK 1EZVG 2XV5A 1Y9BA 2JP3A 4GOEA 2WSCH 1DEEG 5APUA 2ZYAA 3TDKA 2W6BA 1QVFO 1L0LD 1NJIQ 3CXHE 3HUSA 3O6QA 1PGPA 1DEBA 1SP4A 2A06G 1JEKA 2B88A 5AW9B 5KAFH 4I6MC 4IL6X 1BCCJ 5B66H 2LR2A 3VYIA 1X8YA 2FYUE 1KQSO 1YI2P 3FWLA 1CI6A 3CWBJ 3CCEP 2JWAA 2Q3EA 4N6JA 1GL2A 1SFCD 3AE1C 2NPSB 1NKNA 1NTKJ 1IZNB 2BEZF 2JDIH 3A0HH 1JCDA 1L0ND 1JY3P 2IZ0A 3B5NC 1BGYJ 1W5CE 3RBZA 3L74E 2O01H 4EIJA 4I7ZB 1IFMA 4H13C 1SFCB 2QJKB 1N73B 3PRJA 1FAVA 5TJHA 4R4MA 3V2QA 1FBMA 5GTHE 1SQBG 1MFTA 1KYOI 3II6A 1PGQA 1NTMK 3L71G 1IFDA 2FKWB 5AVWB 5KLVG 2WPVB 1VQPP 4EYYQ 5EFWB 1JMMA 3AEFC 4H0LD 3CXHD 2E5YA 1FZCB 3MTUE 5KJ7A 3TNUB 2O1JA 2ZAEB 3AE6C 2KZJA 3H1LE 1KORA 2QE7H 3L71J 5AW8B 2OYIB 1FZCC 1P84H 4ZMDA 1L4AA 1AA0A 1FOSF 3S1KA 1R5SA 1BSNA 1HVVA 1S5LE 1ZRTD 2KLVA 1FJKA 1SQVK 1RH5B 2GUVA 3H1HD 3NFQA 3SSUA 3WU2E 1S5LH 3HRNA 1RE4C 1A02F 1VF5C 3MGNA 3Q1MA 1NU1K 1NTMG 2BEQD 1LT9B 2M5AB 1KILB 2UWJE 2KLUA 4OGQC 1MKMA 2CK3H 2FYZA 4RKUJ 4A7PA 1AFOA 2YO2A 1CZQA 1GW4A 3MUDA 2OYHB 4C7RA 4JYCA 5GTHH 4EI2A 1E5WA 3L73G 4IL6E 3WMM0 2QEXP 1AV1A 1Z56A 3GLMA 1PGJA 3ITKA 3H1LJ 3PH0A 2NZ2A 1RF1C 4BXLA 3H1KJ 1AQTA 2HYNA 1CI6B 3FGAD 3HD7A 1HUCA 1KV4A 2WVRA 1S1CX 2IFMA 1NTZG 2KXPB 4KJMA 1R5LA 4GODA 1Q7YQ 2N1TB 2O1KA 2YIUB 1N7LA 1SQBD 1WRGA 3L36A 3A7OA 1D7MA 1M56D 3JC22 2POHA 3RK2D 3T97A 4GOFA 4N3YB 2K37A 3M9HA 3AE5C 3V2RA 3Q3DA 2QIWA 5CJ4A 2FFDB 1FJPA 1LP1A 2NRGA 3VMYA 2N1TA 4EDFA 1K05A 1GL2C 3H1HJ 1NU1E 1SQXD 1SQPD 2JO1A 3H1IE 4K35A 4H44D 5B5EH 5KAFE 1K8AQ 1NHLA 2P58A 2HFED 3PLNA 3U1AA 4W7ZA 5KJ7C 3G71P 1OVVA 1SQVE 3OA7A 1AJYA 1K9MQ 2WSFJ 1H0TA 4L76A 2Y9ZA 3CCRP 1T6AA 2PGDA 1N7SB 3K5BA 1L4AC 1QGKB 1JM0A 3KDPB 3USSA 2L91A 5APQA 5AW2B 1RE3C 3CCUP 3WU2H 2Y0CA 1EDJA 2W90A 1LWUC 4U7JA 5CCGA 1GMJA 4L75A 1USDA 3CX5I 1T3JA 3B8EB 2GA1A 2IX7C 2XU6A 2YKQA 1QEXA 3HTKB 2OYIA 2B87A 2Q7CA 1PFIA 2M5AA 1GW3A 1VQ6P 1SQQG 1FDIA 1M1JB 2I8DA 2A45H 3H1HE 1YIJP 1IFJA 1VQ9P 3HTKA 1NTKD 2MJZA 1VQ4P 1PIXA 2M3EA 2SPZA 5CBNA 1FS0E 2YNYA 1RHZB 4I1LA 3RBXA 4DCKA 3L75D 1GL2D 1KILD 1T3UA 5KKZC 1GDTA 3KQGA 1HGVA 1JY3N 2IBZI 1KYOD 4RESB 3RL0D 1UIXA 2R5BA 2ZT9C 5AW3B 1BDDA 3S9OA 3Q5PA 1KD1Q 2E74C 1EQ7A 2R44A 3V2PA 1GL2B 4HKZH 5AVQB 3E1IA 3CXHI 4TT3H 4U3FE 5AW7B 3I56P 3E7KA 1NYHA 1BSHA 4NPDA 1EC5A 1YBKA 3BRTB 2A06D 3H6PA 1SLQA 3SFEC 1N86A 1LP1B 3MZWB 4Z1MH 4PV1C 3L72D 1VL2A 3BRVB 1LTJA 3L70E 4PV1B 3CC2P 1R8EA 2ZXXA 2RKLA 1VQLP 1L0NE 2R32A 1NAYA 4LLHA 1JTHA 3UIAA 3I55P 3KHUA 2AXTE 3CWBG 4Y28J 1JO5A 4PV1D 1FZCA 2V7QJ 3NTNA 3Q5SA 2WPRA 2OTKE 3AEGC 3KPEA 2OYHC 1ZP0C 2ZVNB 3HE4B 4OGQD 1FZFA 1G2CB 4JYBA 2WQYC 1RQUA 2B89A 1J1DC 2K3RA 3L72G 4U3FD 3P7KA 4PD4I 1ZR2A 1L0NK 2WSEJ 4U3FJ 2H8PD 3CX5D 4DZOA 1VQ5P 3I5CA 2ZT9D 5KAIH 1AQ5A 2JJLA 3RL0C 1KILC 3RL0B 2ITAA 3TGUJ 3IF4A 1P84E 3KYQA 1ZMEC 3OJAB 2ZYDA 1YQ3C 3EWKA 4XE5B 5APYA 3GHGC 1OWAA 2B9BA 4IOIH 1JOCA 5AVYB 1XTCC 1L0LK 2BCCG 1JNMA 3CCVP 1Q82Q 1GU5A 1PP9D 2G3AA 2IYPA 2KNCB 2W8ZA 3BCCE 3EQ2A 3IR9A 3QH9A 3D6YA 1LGHB 1OW7A 1NTKG 2KZIA 4H13B 1RY3A 1N7SD 3M0AA 1BGYG 2WPQA 2BCCJ 2M3BA 1L0NG 1T2KC 2FXPA 2ZXEB 3KZIE 1SS1A 4H13D 3AE3C 1NAFA 2AXTH 3GF7A 3CCJP 2XDJA 4JF7A 1KQFB 1HTLC 1VPCA 4UB8H 2PP6A 3AE2C 5KLVJ 2FFDA 4ASVA 4IFFA 3L72E 4OGQB 3H1JD 1T8ZA 1SQVD 1L0LG 2FYUG 3A0HE 1LTJB 4OVNF 5APWA 4O9BA 3CMEP 1BE3J 1VQ7P 3GMAA 1GD2E 5DJTB 2KS1A 1Q81Q 5H2FE 5L8RJ 3H1IG 1OVRA 1OIPA 4HYTB 1M1KQ 3BASA 4NPFX 1ZR4A 1L0LE 1KQLA 1MV8A 1U7JA 2BASA 3SWFA 4L74A 3A5TA 1YJ9P 2AEFA 3JCUE 2IPPA 1X79B 2KS1B 4UB6H 2BCCE 2QM8A 3RK2C 1KILE 1N8RQ 3L75E 2I1JA 1A02J 2KB7P 1YJWP 1YYCA 3HUSB 3O6QB 2A45G 3A0BH 4JPZB 5GTIE 1IK9A 2CPBA 3WUUA 2P10A 3TYYA 1GU4A 1NO4A 1JUNA 1IFIA 1PP9G 1HJ0A 1CSBA 1Y47A 4WB4A 3JSVC 5KLVE 1VQ8P 2CPSA 3PTZA 1NKZB 4MN4C 2WTYA 2M8RA 2OYHA 2B87B 3CLQA 5BU5A 5AVRB 5M1BA 2YKOA 1BE3E 1PZQA 3CI9A 3V4WA 4D6TD 1ZN5A 3H1LG 1VQKP 4XA4A 1HJBA 1KN7A 2V7QH 3RK3C 1BCCE 1QX8A 4C46A 1KC8Q 2FYUJ 4OWFA 1SQPK 2IFNA 1SQXK 1NWQA 3NMDA 2GM4A 4IFDK 1DX7A 3C8VA 5BU8B 1H0TB 2E76C 2E75D 1GK4A 1GK6A 2KSEA 1G2CA 3L75J 2AEMA 3AEEC 5KLIC 1EDIA 1UIIA 1X22A 2KI7B 3L74J 1LNQA 5CCHD 3D6ZA 1YITP 2L5GB 3PHLA 3FX0A 2O3JA 1SQQJ 1L2PA 2WMMA 1FDOA 4W80A 3CCQP 4L73A 2W6AA 1S9KD 3CCMP 1OVUA 3HD7C 3JCUH 3SFDC 1IO4A 1NTZK 5AVTB 1RF0C 1NTKK 1X0TA 2K9YA 1RQVA 2IBZE 3CX5E 3EFFK 3P8MC 1KYOH 2YXRB 1NVOA 2OGUA 2ZFCA 3MD0A 3RK3E 5H2FH 3LW5H 2HODB 2D2CB 3P8CD 1SQBE 1ZV8A 1S72P 3AE8C 1N7SA 1FE6A 3L71E 1TU3F 3R4YA 2QRXA 1LJ2A 5APXA 1FZEA 3H1JE 2RH0A 2GUSA 3VTPC 2R3CA 2KIKA 1AVYA 3L4FA 2JKVA 2Z4EA 3MUDC 1RE3A 3L74D 1IFNA 2WSEH 2WITA 2OYOA 2V4HA 3B5ND 3M06A 2H43A 3B71A 1W2BO 1SQQE 5KKZB 2Q9IA 1N73C 4ZKPA 1SFCC 3CCLP 1HF9A 3AE4C 4YTPC 3BVHA 3WUTA 2A06E 3G6EP 1IC2A 5CBOA 2E75C 1JY2N 2E76D 3CMAP 1ZOYC 3W68A 2E5TA 2N1TC 3P8CE 4D6TJ 1QL1A 1PPJG 2YO3A 3RK3D 5APVA 2QJPB 3G9RA 1KMIZ 2K88A 3AEBC 4NPEA 1SQBJ 3E1RA 3FWNA 1KYOE 2PFXA 1ZRTE 2I1KA 3IAOA 2WSFH 1J1EB 3H1KE 4WY4B 1URQC 3D70A 2KNCA 2W6JH 2YMYA 3H25A 1DIPA 4IL6H 1YTZI 1P84D 3H1JJ 2H7HA 5APSA 3A2AA 1NTKE 2MKVA 4C7NB 1IK7A 2HLOA 3H1KD 3PP5A 1HBWA 2O01N 5E79H 4BRYB 2E42A 4PJ0E 5AVUB 3HE5A 4WY4A 2FYNB 1USEA 1SVFA 1S2EA 3EFGA 4LGDE 2FYNC 4PJ0H 1LT9C 1N7SC 2K9JB 3O8ZA 1J2JB 1S3JA 2D2CC 3CWBD 3AECC 4LC1A 2WWWA 5E79E 4PD4E 2M0BA 3L37A 3SWKA 2FY8A 4BRYA 1QLED 1BDCA 2DW3A 5B5EE 1OW8A 1SQXG 2H88C 1U57A 1ZW0A 1M7LA 3IFMA 4HH2A 3ZDMA 4B86A 4D6TE 2G8YA 2J58A 3PJSK 2N9YB 5CCGC 2N9BA 1VQOP 3B5NB 1SQVJ 1P84I 2J59M 1N73A 1LTGC 4H44B 3AE7C 1M57D 3FXDA 1E79H 1LT1A 1FZAA 2P67A 3KXDA 3M0DA 4D6TG 2KOGA 2RN0A 2E75B 4ASWA 2IDBA 2R3SA 1Q2NA 1PV3A 2C0WA 3RK3B 3L71D 1G1IA 2HODA 1AVOA 3L75G 1KB9I 1KZUB 2YIUC 1NOHA 3H32A 1T2KD
chains in the Genus database with same CATH topology
2HPCA 3GHGA 5AVXB 1S9KE 1G1JA 1OXZA 1CW5A 1FZGA 4EOTA 1GZLA 2Q3IA 1JY3O 5AVVB 1JY2O 3RK2B 3V2NA 3B5NA 4AUWA 4C7NA 3N7NA 1ZLLA 1NH4A 1FU1A 4N78D 4Y99B 5AVSB 2WT7B 1JTHB 4Y99C 1DH3A 2NPSC 3U1CA 1LTBC 3M0DC 2WZ7A 5CHXA 5CCHA 5AW6B 1H88A 1H8AA 1URQA 2E43A 2YKPA 3SWYA 5CMZA 2FXMA 2LKMA 2PAJA 1J1EC 4WY4C 1KFNA 4IFMA 3H32B 3U59A 1FOSE 2P1JA 3VMZA 1LWUA 2KP8A 2OYIC 2NPSA 1RF1A 2WPSA 5AW4B 1FDMA 1LTAC 2HPCB 2P2UA 1QL2A 2VRSA 4WY4D 1J1DB 4GKGA 3V4QA 4IFDK 1HGZA 2JEEA 3M9QA 5CJ0A 3VP9A 1IJDB 1LTSC 4M3LA 1HH0A 3VMXA 2Z5HA 5APTA 3VOPA 1L4AD 1VDFA 3VN0A 3GHGB 2WT7A 5KTBA 3LIDA 2XNXA 4GT1A 5KJ7D 2KSJA 2W27A 2N1TD 1URQB 3G3ZA 1RF0A 5AW5B 4OH8B 3VP8A 3OAKA 4W7YA 2NPSD 3N4XA 1MUUA 1SQQK 2XZRA 4AQRD 4I2LC 2OARA 3M91A 1XTGB 1FZCC 5AW1B 3L35A 1H89A 1LTJC 3MIWA 1LTTC 2C9LY 2C0XA 1SFCA 3HD7B 2C9NY 1M1JC 1YTZT 3BATA 3V5BA 1RF1B 4ZKUA 5KLVK 1HWTC 1KFMA 1L4AB 3HD7D 3HE5B 3R2PA 5AW0B 5BVZA 3HUSC 1LTIC 2HG5D 1LWUB 2A45I 3TSIA 3TNUA 1LT9A 4KHXA 2QM7A 2KYVA 1MZ9A 1SQBK 1MFZA 3TK1A 1FZBA 5CCGD 1JY2P 4GIFA 2Q5UA 2Z5IA 4N78E 3A3YB 4WBAA 1W2EA 3M9BA 2P7JA 3P32A 1N2DC 3HE4A 5AVZB 1WT6A 3NXSA 2XKMA 4AYCA 4DOJA 3C9IA 3CL3D 1M1JA 1RE4A 2R5DA 3LIEA 1KILA 1URQD 2FYUK 1X9VA 1JCCA 5APYA 1HBWA 2XV5A 2WSCH 5APUA 2W6BA 3HUSA 1SP4A 1DEBA 5AW9B 4I6MC 3VYIA 1X8YA 1CI6A 4N6JA 1GL2A 1SFCD 2NPSB 1NKNA 1JCDA 3B5NC 1JY3P 2O01H 4EIJA 1IFMA 1SFCB 1N73B 1FAVA 3V2QA 1FBMA 3II6A 1NTMK 1IFDA 2FKWB 5AVWB 1JMMA 1FZCB 3MTUE 5KJ7A 3TNUB 2O1JA 2OYIB 5AW8B 1L4AA 1FOSF 5AW2B 1HVVA 5CCHC 2KLVA 1FJKA 1SQVK 2GUVA 3NFQA 3HRNA 1RE4C 1A02F 3MGNA 1NU1K 1LT9B 1KILB 2FYZA 1AFOA 2YO2A 1CZQA 1GW4A 3MUDA 2OYHB 4C7RA 4JYCA 1E5WA 3WMM0 1Z56A 1RF1C 2HYNA 1CI6B 3HD7A 1HUCA 2IFMA 2N1TB 2O1KA 1N7LA 1WRGA 3L36A 3A7OA 3RK2D 2POHA 3T97A 4N3YB 2FFDB 3M9HA 3V2RA 1FJPA 5CJ4A 3VMYA 2N1TA 1GL2C 1NHLA 5KJ7C 2HFED 3U1AA 4W7ZA 3OA7A 1N7SB 1L4AC 3KDPB 1RE3C 1LWUC 5CCGA 1T3JA 3B8EB 2IX7C 2XU6A 2YKQA 2OYIA 1PFIA 3HTKB 2Q7CA 1GW3A 1M1JB 2A45H 1IFJA 3HTKA 2MJZA 2YNYA 4I1LA 1GL2D 1KILD 1T3UA 1GDTA 3KQGA 1HGVA 1JY3N 4RESB 3RL0D 2FFDC 2R5BA 5AW3B 1EQ7A 3V2PA 1GL2B 5AVQB 3E1IA 5AW7B 3BRTB 3H6PA 1SLQA 1N86A 3BRVB 1LTJA 2R32A 4LLHA 1JTHA 3UIAA 1JO5A 1FZCA 3NTNA 2WPRA 3KPEA 2OYHC 3HE4B 1FZFA 1G2CB 4JYBA 1J1DC 1ZR2A 3P7KA 1L0NK 2H8PD 4DZOA 3I5CA 1AQ5A 2JJLA 3RL0C 1KILC 3RL0B 3KYQA 3OJAB 4XE5B 3GHGC 1OWAA 1JOCA 5AVYB 1XTCC 1L0LK 1JNMA 1GU5A 3IR9A 3EQ2A 1LGHB 1RY3A 1N7SD 3M0AA 2WPQA 2M3BA 1T2KC 2ZXEB 1NAFA 2XDJA 4JF7A 1HTLC 1VPCA 2PP6A 4IFFA 5APWA 1T8ZA 2FFDA 1LTJB 4O9BA 1GD2E 4HYTB 3BASA 1ZR4A 1KQLA 2BASA 1MV8A 3SWFA 3A5TA 2IPPA 1X79B 2QM8A 3RK2C 2I1JA 1A02J 2KB7P 1YYCA 3HUSB 1GU4A 2A45G 1IK9A 2CPBA 3TYYA 1NO4A 1JUNA 1IFIA 1CSBA 4WB4A 2CPSA 2WTYA 1NKZB 2OYHA 2M8RA 3CLQA 5BU5A 5AVRB 2YKOA 3CI9A 3V4WA 1ZN5A 4XA4A 1HJBA 3RK3C 4C46A 1SQPK 2IFNA 1SQXK 1NWQA 3NMDA 2GM4A 1DX7A 5BU8B 1GK4A 1GK6A 1GTWA 1G2CA 5CCHD 2L5GB 4W80A 1S9KD 2W6AA 3HD7C 1IO4A 1NTZK 5AVTB 1RF0C 1NTKK 3P8MC 2ZFCA 3MD0A 3LW5H 2HODB 3P8CD 1ZV8A 1N7SA 5APXA 1FZEA 2GUSA 3VTPC 2R3CA 2Z4EA 3L4FA 1RE3A 1IFNA 2WSEH 2WITA 3B5ND 3M06A 2H43A 2Q9IA 1N73C 4ZKPA 1SFCC 3BVHA 1IC2A 1JY2N 2N1TC 3P8CE 1QL1A 2YO3A 3RK3D 5APVA 2I1KA 2WSFH 1J1EB 4WY4B 1URQC 2YMYA 1YTZI 2H7HA 5APSA 3A2AA 4C7NB 2HLOA 3PP5A 2E42A 5AVUB 3HE5A 4WY4A 1SVFA 3EFGA 4LGDE 1LT9C 1N7SC 5APQA 3O8ZA 1J2JB 4LC1A 2WWWA 3L37A 4B86A 4HH2A 3IFMA 1M7LA 2J58A 5CCGC 2N9BA 3B5NB 2J59M 1N73A 1LTGC 1FZAA 2P67A 3M0DA 2KOGA 2C0WA 3RK3B 1G1IA 2HODA 1KZUB 1NOHA 3H32A 1T2KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQ2 A;  2YKQ A;  1JOC A;  2YKP A;  3BRV B;  2YKO A;  3L4F A;  3BRT B;  3CL3 D;  2W6B A; 
#chains in the Genus database with same CATH topology
 3L73 D;  3CPW O;  5CCH C;  3G4S P;  1OW6 A;  1Y8A A;  2HPC A;  1OX3 A;  2KK7 A;  3GHG A;  5AVX B;  1U7M A;  1S9K E;  4H0L B;  1G1J A;  1OXZ A;  3CC4 P;  1CW5 A;  2K9J A;  1NTM J;  1NTM D;  1FZG A;  1QVG O;  4EOT A;  1GZL A;  3TGU D;  4HJG H;  3GG2 A;  2Q3I A;  3H1H G;  1VF5 B;  4R4L A;  1JY3 O;  1KB9 D;  1JY2 O;  3L73 J;  5AVV B;  3B5N A;  3RK2 B;  3V2N A;  4C7N A;  5KLI B;  3N7N A;  4K3A A;  1ZLL A;  4AUW A;  2JR8 A;  1NH4 A;  1FU1 A;  4N78 D;  2XND H;  4Y99 B;  5AVS B;  2WT7 B;  3CD6 P;  1NU1 G;  4PD4 H;  2KUB A;  1JTH B;  4Y99 C;  1DH3 A;  2NPS C;  3U1C A;  1JMB A;  1LTB C;  3LW5 J;  1KB9 E;  2O01 J;  1PPJ D;  2W83 C;  3M0D C;  4ZNC A;  3WUV A;  1NGM B;  3CC7 P;  5KLV D;  1NU1 J;  2WZ7 A;  2Y0E A;  3H1I J;  5CHX A;  4WWI A;  5CCH A;  3C1L A;  1NTM E;  2RMZ A;  5AW6 B;  1H88 A;  1H8A A;  2ZVO B;  2K1A A;  1URQ A;  2E43 A;  4CPG A;  2Q1K A;  2BCC D;  2YKP A;  4HB1 A;  5CMZ A;  2FXM A;  2QJY B;  3H1L D;  3L74 G;  3SWY A;  1BCC G;  2LKM A;  2QJP C;  1Q90 D;  3L73 E;  1NTZ D;  4JQ0 D;  1WMK A;  2E74 B;  2PAJ A;  1J1E C;  1PP9 J;  4WY4 C;  1YHQ P;  4I7Z C;  3A0B E;  5B66 E;  2FFD C;  2QJK C;  1KFN A;  2PRR A;  2OTJ P;  3ABV C;  1K04 A;  2E74 D;  3H32 B;  1ZXG A;  4IFM A;  1OZH A;  5C39 A;  3TF5 A;  3U59 A;  1FOS E;  1DD4 A;  1IFP A;  2J5U A;  3S4R A;  2P1J A;  2YXQ B;  3VMZ A;  2ZJS E;  1LWU A;  4YPC A;  1EXI A;  2OTL P;  2E76 B;  1S4X A;  2IZ1 A;  3GW6 A;  2KP8 A;  1M90 Q;  2OYI C;  2NPS A;  1RF1 A;  2WPS A;  5AW4 B;  1FDM A;  1LTA C;  2IYO A;  1EDL A;  2HPC B;  2P2U A;  1QL2 A;  2Q6Q A;  2VRS A;  3AEA C;  3CXH H;  3H1K G;  3MHV A;  1YQ4 C;  1M8O B;  3CX5 H;  3H1J G;  2QG4 A;  4WY4 D;  1J1D B;  4GKG A;  3V4Q A;  1NTZ E;  1HGZ A;  1PP9 E;  2JEE A;  2IBZ D;  3BCC D;  1BE3 G;  3L70 G;  3M9Q A;  5CJ0 A;  3VP9 A;  1K73 Q;  1IJD B;  3FXE A;  1LTS C;  2OQQ A;  4M3L A;  4XFJ A;  1JB0 J;  1VQM P;  1HH0 A;  3VMX A;  4BWN A;  5K5G B;  3L72 J;  2Z5H A;  5APT A;  3T97 B;  3VOP A;  3AE9 C;  1L4A D;  1VDF A;  1Q86 Q;  3VN0 A;  2H89 C;  4YXW H;  3L70 J;  2QJY C;  1OFC X;  4DJG A;  3GHG B;  3CCS P;  1BGY D;  1PGO A;  5KTB A;  3V6I A;  2WT7 A;  1L0N J;  3LID A;  2XNX A;  1KTM A;  3OW2 O;  4GT1 A;  1PPJ E;  5KJ7 D;  2WSC J;  2KSJ A;  2W27 A;  4H44 C;  2N1T D;  1URQ B;  1EZV I;  3G3Z A;  1RF0 A;  5TIS E;  5AW5 B;  4OH8 B;  3VP8 A;  3OAK A;  4W7Y A;  2NPS D;  2QSI A;  3B4S A;  1MUU A;  1SQQ K;  3N4X A;  3W67 A;  1VQN P;  2FXO A;  2XZR A;  4AQR D;  5DJU B;  4I2L C;  1SQQ D;  2QA4 P;  1NTZ J;  3GF3 A;  1KQG B;  4DT0 A;  2OAR A;  3M91 A;  1XTG B;  4JBZ A;  3QWO C;  5AW1 B;  3L35 A;  2IBZ G;  3L70 D;  3Q2Y A;  3BCC G;  1H89 A;  1EXJ A;  3TGU E;  1LTJ C;  5GTI H;  3MIW A;  1LTT C;  1YJN P;  1DD3 A;  1FC2 C;  2YMK A;  1SQV G;  2FYU D;  4U3F G;  3VMA A;  2C0X A;  2C9L Y;  1EDK A;  4H0L C;  3D71 A;  1EZV D;  4UB6 E;  2WSS H;  1SFC A;  3BCC J;  3HD7 B;  1M1J C;  1YTZ T;  2LXB A;  2JWD A;  3BAT A;  3Q5R A;  2C9N Y;  3V5B A;  3F5H A;  4RJT A;  1RF1 B;  1GTW A;  4ZKU A;  4YXD C;  5KLV K;  1HWT C;  1KFM A;  1L4A B;  1SQP G;  3HD7 D;  2FBW C;  3HE5 B;  3R2P A;  4RO0 A;  5AW0 B;  5BVZ A;  1EZV E;  3HUS C;  1LTI C;  2HG5 D;  1LWU B;  1VF5 D;  2A45 I;  3TSI A;  3KZI H;  3RL0 g;  3TNU A;  2ZT9 B;  4UB8 E;  1LT9 A;  3RGU A;  1SQP J;  1SQX J;  4KHX A;  2LXC B;  2QM7 A;  2KYV A;  2Y9Y A;  4QMA A;  1MZ9 A;  1SQB K;  1MFZ A;  3TK1 A;  3MP7 B;  1FZB A;  1KB9 H;  1BCC D;  2AXC A;  2ZYG A;  5CCG D;  1JY2 P;  1OMI A;  4WVZ A;  4GIF A;  2Q5U A;  2Z5I A;  5KAI E;  4N78 E;  5TIS H;  2HR3 A;  3F89 A;  1BE3 D;  3A3Y B;  4PD4 D;  1L0L J;  4KT0 J;  1S5L X;  3CWB E;  4WBA A;  2D2C D;  1W2E A;  3M9B A;  3IN6 A;  3TGU G;  2P7J A;  3P32 A;  1N2D C;  3AED C;  3HE4 A;  5AVZ B;  1BGY E;  1WT6 A;  3NXS A;  2XKM A;  4AYC A;  4DOJ A;  2QVA A;  3C9I A;  2AEJ A;  3CL3 D;  4GDO A;  4TLF A;  1PL5 A;  2Y0D A;  1M1J A;  1RE4 A;  2R5D A;  3LIE A;  1KIL A;  1SQP E;  3H1I D;  1URQ D;  1NU1 D;  1SQX E;  1JCC A;  1X9V A;  2FYU K;  1EZV G;  2XV5 A;  1Y9B A;  2JP3 A;  4GOE A;  2WSC H;  1DEE G;  5APU A;  2ZYA A;  3TDK A;  2W6B A;  1QVF O;  1L0L D;  1NJI Q;  3CXH E;  3HUS A;  3O6Q A;  1PGP A;  1DEB A;  1SP4 A;  2A06 G;  1JEK A;  2B88 A;  5AW9 B;  5KAF H;  4I6M C;  4IL6 X;  1BCC J;  5B66 H;  2LR2 A;  3VYI A;  1X8Y A;  2FYU E;  1KQS O;  1YI2 P;  3FWL A;  1CI6 A;  3CWB J;  3CCE P;  2JWA A;  2Q3E A;  4N6J A;  1GL2 A;  1SFC D;  3AE1 C;  2NPS B;  1NKN A;  1NTK J;  1IZN B;  2BEZ F;  2JDI H;  3A0H H;  1JCD A;  1L0N D;  1JY3 P;  2IZ0 A;  3B5N C;  1BGY J;  1W5C E;  3RBZ A;  3L74 E;  2O01 H;  4EIJ A;  4I7Z B;  1IFM A;  4H13 C;  1SFC B;  2QJK B;  1N73 B;  3PRJ A;  1FAV A;  5TJH A;  4R4M A;  3V2Q A;  1FBM A;  5GTH E;  1SQB G;  1MFT A;  1KYO I;  3II6 A;  1PGQ A;  1NTM K;  3L71 G;  1IFD A;  2FKW B;  5AVW B;  5KLV G;  2WPV B;  1VQP P;  4EYY Q;  5EFW B;  1JMM A;  3AEF C;  4H0L D;  3CXH D;  2E5Y A;  1FZC B;  3MTU E;  5KJ7 A;  3TNU B;  2O1J A;  2ZAE B;  3AE6 C;  2KZJ A;  3H1L E;  1KOR A;  2QE7 H;  3L71 J;  5AW8 B;  2OYI B;  1FZC C;  1P84 H;  4ZMD A;  1L4A A;  1AA0 A;  1FOS F;  3S1K A;  1R5S A;  1BSN A;  1HVV A;  1S5L E;  1ZRT D;  2KLV A;  1FJK A;  1SQV K;  1RH5 B;  2GUV A;  3H1H D;  3NFQ A;  3SSU A;  3WU2 E;  1S5L H;  3HRN A;  1RE4 C;  1A02 F;  1VF5 C;  3MGN A;  3Q1M A;  1NU1 K;  1NTM G;  2BEQ D;  1LT9 B;  2M5A B;  1KIL B;  2UWJ E;  2KLU A;  4OGQ C;  1MKM A;  2CK3 H;  2FYZ A;  4RKU J;  4A7P A;  1AFO A;  2YO2 A;  1CZQ A;  1GW4 A;  3MUD A;  2OYH B;  4C7R A;  4JYC A;  5GTH H;  4EI2 A;  1E5W A;  3L73 G;  4IL6 E;  3WMM 0;  2QEX P;  1AV1 A;  1Z56 A;  3GLM A;  1PGJ A;  3ITK A;  3H1L J;  3PH0 A;  2NZ2 A;  1RF1 C;  4BXL A;  3H1K J;  1AQT A;  2HYN A;  1CI6 B;  3FGA D;  3HD7 A;  1HUC A;  1KV4 A;  2WVR A;  1S1C X;  2IFM A;  1NTZ G;  2KXP B;  4KJM A;  1R5L A;  4GOD A;  1Q7Y Q;  2N1T B;  2O1K A;  2YIU B;  1N7L A;  1SQB D;  1WRG A;  3L36 A;  3A7O A;  1D7M A;  1M56 D;  3JC2 2;  2POH A;  3RK2 D;  3T97 A;  4GOF A;  4N3Y B;  2K37 A;  3M9H A;  3AE5 C;  3V2R A;  3Q3D A;  2QIW A;  5CJ4 A;  2FFD B;  1FJP A;  1LP1 A;  2NRG A;  3VMY A;  2N1T A;  4EDF A;  1K05 A;  1GL2 C;  3H1H J;  1NU1 E;  1SQX D;  1SQP D;  2JO1 A;  3H1I E;  4K35 A;  4H44 D;  5B5E H;  5KAF E;  1K8A Q;  1NHL A;  2P58 A;  2HFE D;  3PLN A;  3U1A A;  4W7Z A;  5KJ7 C;  3G71 P;  1OVV A;  1SQV E;  3OA7 A;  1AJY A;  1K9M Q;  2WSF J;  1H0T A;  4L76 A;  2Y9Z A;  3CCR P;  1T6A A;  2PGD A;  1N7S B;  3K5B A;  1L4A C;  1QGK B;  1JM0 A;  3KDP B;  3USS A;  2L91 A;  5APQ A;  5AW2 B;  1RE3 C;  3CCU P;  3WU2 H;  2Y0C A;  1EDJ A;  2W90 A;  1LWU C;  4U7J A;  5CCG A;  1GMJ A;  4L75 A;  1USD A;  3CX5 I;  1T3J A;  3B8E B;  2GA1 A;  2IX7 C;  2XU6 A;  2YKQ A;  1QEX A;  3HTK B;  2OYI A;  2B87 A;  2Q7C A;  1PFI A;  2M5A A;  1GW3 A;  1VQ6 P;  1SQQ G;  1FDI A;  1M1J B;  2I8D A;  2A45 H;  3H1H E;  1YIJ P;  1IFJ A;  1VQ9 P;  3HTK A;  1NTK D;  2MJZ A;  1VQ4 P;  1PIX A;  2M3E A;  2SPZ A;  5CBN A;  1FS0 E;  2YNY A;  1RHZ B;  4I1L A;  3RBX A;  4DCK A;  3L75 D;  1GL2 D;  1KIL D;  1T3U A;  5KKZ C;  1GDT A;  3KQG A;  1HGV A;  1JY3 N;  2IBZ I;  1KYO D;  4RES B;  3RL0 D;  1UIX A;  2R5B A;  2ZT9 C;  5AW3 B;  1BDD A;  3S9O A;  3Q5P A;  1KD1 Q;  2E74 C;  1EQ7 A;  2R44 A;  3V2P A;  1GL2 B;  4HKZ H;  5AVQ B;  3E1I A;  3CXH I;  4TT3 H;  4U3F E;  5AW7 B;  3I56 P;  3E7K A;  1NYH A;  1BSH A;  4NPD A;  1EC5 A;  1YBK A;  3BRT B;  2A06 D;  3H6P A;  1SLQ A;  3SFE C;  1N86 A;  1LP1 B;  3MZW B;  4Z1M H;  4PV1 C;  3L72 D;  1VL2 A;  3BRV B;  1LTJ A;  3L70 E;  4PV1 B;  3CC2 P;  1R8E A;  2ZXX A;  2RKL A;  1VQL P;  1L0N E;  2R32 A;  1NAY A;  4LLH A;  1JTH A;  3UIA A;  3I55 P;  3KHU A;  2AXT E;  3CWB G;  4Y28 J;  1JO5 A;  4PV1 D;  1FZC A;  2V7Q J;  3NTN A;  3Q5S A;  2WPR A;  2OTK E;  3AEG C;  3KPE A;  2OYH C;  1ZP0 C;  2ZVN B;  3HE4 B;  4OGQ D;  1FZF A;  1G2C B;  4JYB A;  2WQY C;  1RQU A;  2B89 A;  1J1D C;  2K3R A;  3L72 G;  4U3F D;  3P7K A;  4PD4 I;  1ZR2 A;  1L0N K;  2WSE J;  4U3F J;  2H8P D;  3CX5 D;  4DZO A;  1VQ5 P;  3I5C A;  2ZT9 D;  5KAI H;  1AQ5 A;  2JJL A;  3RL0 C;  1KIL C;  3RL0 B;  2ITA A;  3TGU J;  3IF4 A;  1P84 E;  3KYQ A;  1ZME C;  3OJA B;  2ZYD A;  1YQ3 C;  3EWK A;  4XE5 B;  5APY A;  3GHG C;  1OWA A;  2B9B A;  4IOI H;  1JOC A;  5AVY B;  1XTC C;  1L0L K;  2BCC G;  1JNM A;  3CCV P;  1Q82 Q;  1GU5 A;  1PP9 D;  2G3A A;  2IYP A;  2KNC B;  2W8Z A;  3BCC E;  3EQ2 A;  3IR9 A;  3QH9 A;  3D6Y A;  1LGH B;  1OW7 A;  1NTK G;  2KZI A;  4H13 B;  1RY3 A;  1N7S D;  3M0A A;  1BGY G;  2WPQ A;  2BCC J;  2M3B A;  1L0N G;  1T2K C;  2FXP A;  2ZXE B;  3KZI E;  1SS1 A;  4H13 D;  3AE3 C;  1NAF A;  2AXT H;  3GF7 A;  3CCJ P;  2XDJ A;  4JF7 A;  1KQF B;  1HTL C;  1VPC A;  4UB8 H;  2PP6 A;  3AE2 C;  5KLV J;  2FFD A;  4ASV A;  4IFF A;  3L72 E;  4OGQ B;  3H1J D;  1T8Z A;  1SQV D;  1L0L G;  2FYU G;  3A0H E;  1LTJ B;  4OVN F;  5APW A;  4O9B A;  3CME P;  1BE3 J;  1VQ7 P;  3GMA A;  1GD2 E;  5DJT B;  2KS1 A;  1Q81 Q;  5H2F E;  5L8R J;  3H1I G;  1OVR A;  1OIP A;  4HYT B;  1M1K Q;  3BAS A;  4NPF X;  1ZR4 A;  1L0L E;  1KQL A;  1MV8 A;  1U7J A;  2BAS A;  3SWF A;  4L74 A;  3A5T A;  1YJ9 P;  2AEF A;  3JCU E;  2IPP A;  1X79 B;  2KS1 B;  4UB6 H;  2BCC E;  2QM8 A;  3RK2 C;  1KIL E;  1N8R Q;  3L75 E;  2I1J A;  1A02 J;  2KB7 P;  1YJW P;  1YYC A;  3HUS B;  3O6Q B;  2A45 G;  3A0B H;  4JPZ B;  5GTI E;  1IK9 A;  2CPB A;  3WUU A;  2P10 A;  3TYY A;  1GU4 A;  1NO4 A;  1JUN A;  1IFI A;  1PP9 G;  1HJ0 A;  1CSB A;  1Y47 A;  4WB4 A;  3JSV C;  5KLV E;  1VQ8 P;  2CPS A;  3PTZ A;  1NKZ B;  4MN4 C;  2WTY A;  2M8R A;  2OYH A;  2B87 B;  3CLQ A;  5BU5 A;  5AVR B;  5M1B A;  2YKO A;  1BE3 E;  1PZQ A;  3CI9 A;  3V4W A;  4D6T D;  1ZN5 A;  3H1L G;  1VQK P;  4XA4 A;  1HJB A;  1KN7 A;  2V7Q H;  3RK3 C;  1BCC E;  1QX8 A;  4C46 A;  1KC8 Q;  2FYU J;  4OWF A;  1SQP K;  2IFN A;  1SQX K;  1NWQ A;  3NMD A;  2GM4 A;  4IFD K;  1DX7 A;  3C8V A;  5BU8 B;  1H0T B;  2E76 C;  2E75 D;  1GK4 A;  1GK6 A;  2KSE A;  1G2C A;  3L75 J;  2AEM A;  3AEE C;  5KLI C;  1EDI A;  1UII A;  1X22 A;  2KI7 B;  3L74 J;  1LNQ A;  5CCH D;  3D6Z A;  1YIT P;  2L5G B;  3PHL A;  3FX0 A;  2O3J A;  1SQQ J;  1L2P A;  2WMM A;  1FDO A;  4W80 A;  3CCQ P;  4L73 A;  2W6A A;  1S9K D;  3CCM P;  1OVU A;  3HD7 C;  3JCU H;  3SFD C;  1IO4 A;  1NTZ K;  5AVT B;  1RF0 C;  1NTK K;  1X0T A;  2K9Y A;  1RQV A;  2IBZ E;  3CX5 E;  3EFF K;  3P8M C;  1KYO H;  2YXR B;  1NVO A;  2OGU A;  2ZFC A;  3MD0 A;  3RK3 E;  5H2F H;  3LW5 H;  2HOD B;  2D2C B;  3P8C D;  1SQB E;  1ZV8 A;  1S72 P;  3AE8 C;  1N7S A;  1FE6 A;  3L71 E;  1TU3 F;  3R4Y A;  2QRX A;  1LJ2 A;  5APX A;  1FZE A;  3H1J E;  2RH0 A;  2GUS A;  3VTP C;  2R3C A;  2KIK A;  1AVY A;  3L4F A;  2JKV A;  2Z4E A;  3MUD C;  1RE3 A;  3L74 D;  1IFN A;  2WSE H;  2WIT A;  2OYO A;  2V4H A;  3B5N D;  3M06 A;  2H43 A;  3B71 A;  1W2B O;  1SQQ E;  5KKZ B;  2Q9I A;  1N73 C;  4ZKP A;  1SFC C;  3CCL P;  1HF9 A;  3AE4 C;  4YTP C;  3BVH A;  3WUT A;  2A06 E;  3G6E P;  1IC2 A;  5CBO A;  2E75 C;  1JY2 N;  2E76 D;  3CMA P;  1ZOY C;  3W68 A;  2E5T A;  2N1T C;  3P8C E;  4D6T J;  1QL1 A;  1PPJ G;  2YO3 A;  3RK3 D;  5APV A;  2QJP B;  3G9R A;  1KMI Z;  2K88 A;  3AEB C;  4NPE A;  1SQB J;  3E1R A;  3FWN A;  1KYO E;  2PFX A;  1ZRT E;  2I1K A;  3IAO A;  2WSF H;  1J1E B;  3H1K E;  4WY4 B;  1URQ C;  3D70 A;  2KNC A;  2W6J H;  2YMY A;  3H25 A;  1DIP A;  4IL6 H;  1YTZ I;  1P84 D;  3H1J J;  2H7H A;  5APS A;  3A2A A;  1NTK E;  2MKV A;  4C7N B;  1IK7 A;  2HLO A;  3H1K D;  3PP5 A;  1HBW A;  2O01 N;  5E79 H;  4BRY B;  2E42 A;  4PJ0 E;  5AVU B;  3HE5 A;  4WY4 A;  2FYN B;  1USE A;  1SVF A;  1S2E A;  3EFG A;  4LGD E;  2FYN C;  4PJ0 H;  1LT9 C;  1N7S C;  2K9J B;  3O8Z A;  1J2J B;  1S3J A;  2D2C C;  3CWB D;  3AEC C;  4LC1 A;  2WWW A;  5E79 E;  4PD4 E;  2M0B A;  3L37 A;  3SWK A;  2FY8 A;  4BRY A;  1QLE D;  1BDC A;  2DW3 A;  5B5E E;  1OW8 A;  1SQX G;  2H88 C;  1U57 A;  1ZW0 A;  1M7L A;  3IFM A;  4HH2 A;  3ZDM A;  4B86 A;  4D6T E;  2G8Y A;  2J58 A;  3PJS K;  2N9Y B;  5CCG C;  2N9B A;  1VQO P;  3B5N B;  1SQV J;  1P84 I;  2J59 M;  1N73 A;  1LTG C;  4H44 B;  3AE7 C;  1M57 D;  3FXD A;  1E79 H;  1LT1 A;  1FZA A;  2P67 A;  3KXD A;  3M0D A;  4D6T G;  2KOG A;  2RN0 A;  2E75 B;  4ASW A;  2IDB A;  2R3S A;  1Q2N A;  1PV3 A;  2C0W A;  3RK3 B;  3L71 D;  1G1I A;  2HOD A;  1AVO A;  3L75 G;  1KB9 I;  1KZU B;  2YIU C;  1NOH A;  3H32 A;  1T2K D; 
#chains in the Genus database with same CATH homology
 2HPC A;  3GHG A;  5AVX B;  1S9K E;  1G1J A;  1OXZ A;  1CW5 A;  1FZG A;  4EOT A;  1GZL A;  2Q3I A;  1JY3 O;  5AVV B;  1JY2 O;  3RK2 B;  3V2N A;  3B5N A;  4AUW A;  4C7N A;  3N7N A;  1ZLL A;  1NH4 A;  1FU1 A;  4N78 D;  4Y99 B;  5AVS B;  2WT7 B;  1JTH B;  4Y99 C;  1DH3 A;  2NPS C;  3U1C A;  1LTB C;  3M0D C;  2WZ7 A;  5CHX A;  5CCH A;  5AW6 B;  1H88 A;  1H8A A;  1URQ A;  2E43 A;  2YKP A;  3SWY A;  5CMZ A;  2FXM A;  2LKM A;  2PAJ A;  1J1E C;  4WY4 C;  1KFN A;  4IFM A;  3H32 B;  3U59 A;  1FOS E;  2P1J A;  3VMZ A;  1LWU A;  2KP8 A;  2OYI C;  2NPS A;  1RF1 A;  2WPS A;  5AW4 B;  1FDM A;  1LTA C;  2HPC B;  2P2U A;  1QL2 A;  2VRS A;  4WY4 D;  1J1D B;  4GKG A;  3V4Q A;  4IFD K;  1HGZ A;  2JEE A;  3M9Q A;  5CJ0 A;  3VP9 A;  1IJD B;  1LTS C;  4M3L A;  1HH0 A;  3VMX A;  2Z5H A;  5APT A;  3VOP A;  1L4A D;  1VDF A;  3VN0 A;  3GHG B;  2WT7 A;  5KTB A;  3LID A;  2XNX A;  4GT1 A;  5KJ7 D;  2KSJ A;  2W27 A;  2N1T D;  1URQ B;  3G3Z A;  1RF0 A;  5AW5 B;  4OH8 B;  3VP8 A;  3OAK A;  4W7Y A;  2NPS D;  3N4X A;  1MUU A;  1SQQ K;  2XZR A;  4AQR D;  4I2L C;  2OAR A;  3M91 A;  1XTG B;  1FZC C;  5AW1 B;  3L35 A;  1H89 A;  1LTJ C;  3MIW A;  1LTT C;  2C9L Y;  2C0X A;  1SFC A;  3HD7 B;  2C9N Y;  1M1J C;  1YTZ T;  3BAT A;  3V5B A;  1RF1 B;  4ZKU A;  5KLV K;  1HWT C;  1KFM A;  1L4A B;  3HD7 D;  3HE5 B;  3R2P A;  5AW0 B;  5BVZ A;  3HUS C;  1LTI C;  2HG5 D;  1LWU B;  2A45 I;  3TSI A;  3TNU A;  1LT9 A;  4KHX A;  2QM7 A;  2KYV A;  1MZ9 A;  1SQB K;  1MFZ A;  3TK1 A;  1FZB A;  5CCG D;  1JY2 P;  4GIF A;  2Q5U A;  2Z5I A;  4N78 E;  3A3Y B;  4WBA A;  1W2E A;  3M9B A;  2P7J A;  3P32 A;  1N2D C;  3HE4 A;  5AVZ B;  1WT6 A;  3NXS A;  2XKM A;  4AYC A;  4DOJ A;  3C9I A;  3CL3 D;  1M1J A;  1RE4 A;  2R5D A;  3LIE A;  1KIL A;  1URQ D;  2FYU K;  1X9V A;  1JCC A;  5APY A;  1HBW A;  2XV5 A;  2WSC H;  5APU A;  2W6B A;  3HUS A;  1SP4 A;  1DEB A;  5AW9 B;  4I6M C;  3VYI A;  1X8Y A;  1CI6 A;  4N6J A;  1GL2 A;  1SFC D;  2NPS B;  1NKN A;  1JCD A;  3B5N C;  1JY3 P;  2O01 H;  4EIJ A;  1IFM A;  1SFC B;  1N73 B;  1FAV A;  3V2Q A;  1FBM A;  3II6 A;  1NTM K;  1IFD A;  2FKW B;  5AVW B;  1JMM A;  1FZC B;  3MTU E;  5KJ7 A;  3TNU B;  2O1J A;  2OYI B;  5AW8 B;  1L4A A;  1FOS F;  5AW2 B;  1HVV A;  5CCH C;  2KLV A;  1FJK A;  1SQV K;  2GUV A;  3NFQ A;  3HRN A;  1RE4 C;  1A02 F;  3MGN A;  1NU1 K;  1LT9 B;  1KIL B;  2FYZ A;  1AFO A;  2YO2 A;  1CZQ A;  1GW4 A;  3MUD A;  2OYH B;  4C7R A;  4JYC A;  1E5W A;  3WMM 0;  1Z56 A;  1RF1 C;  2HYN A;  1CI6 B;  3HD7 A;  1HUC A;  2IFM A;  2N1T B;  2O1K A;  1N7L A;  1WRG A;  3L36 A;  3A7O A;  3RK2 D;  2POH A;  3T97 A;  4N3Y B;  2FFD B;  3M9H A;  3V2R A;  1FJP A;  5CJ4 A;  3VMY A;  2N1T A;  1GL2 C;  1NHL A;  5KJ7 C;  2HFE D;  3U1A A;  4W7Z A;  3OA7 A;  1N7S B;  1L4A C;  3KDP B;  1RE3 C;  1LWU C;  5CCG A;  1T3J A;  3B8E B;  2IX7 C;  2XU6 A;  2YKQ A;  2OYI A;  1PFI A;  3HTK B;  2Q7C A;  1GW3 A;  1M1J B;  2A45 H;  1IFJ A;  3HTK A;  2MJZ A;  2YNY A;  4I1L A;  1GL2 D;  1KIL D;  1T3U A;  1GDT A;  3KQG A;  1HGV A;  1JY3 N;  4RES B;  3RL0 D;  2FFD C;  2R5B A;  5AW3 B;  1EQ7 A;  3V2P A;  1GL2 B;  5AVQ B;  3E1I A;  5AW7 B;  3BRT B;  3H6P A;  1SLQ A;  1N86 A;  3BRV B;  1LTJ A;  2R32 A;  4LLH A;  1JTH A;  3UIA A;  1JO5 A;  1FZC A;  3NTN A;  2WPR A;  3KPE A;  2OYH C;  3HE4 B;  1FZF A;  1G2C B;  4JYB A;  1J1D C;  1ZR2 A;  3P7K A;  1L0N K;  2H8P D;  4DZO A;  3I5C A;  1AQ5 A;  2JJL A;  3RL0 C;  1KIL C;  3RL0 B;  3KYQ A;  3OJA B;  4XE5 B;  3GHG C;  1OWA A;  1JOC A;  5AVY B;  1XTC C;  1L0L K;  1JNM A;  1GU5 A;  3IR9 A;  3EQ2 A;  1LGH B;  1RY3 A;  1N7S D;  3M0A A;  2WPQ A;  2M3B A;  1T2K C;  2ZXE B;  1NAF A;  2XDJ A;  4JF7 A;  1HTL C;  1VPC A;  2PP6 A;  4IFF A;  5APW A;  1T8Z A;  2FFD A;  1LTJ B;  4O9B A;  1GD2 E;  4HYT B;  3BAS A;  1ZR4 A;  1KQL A;  2BAS A;  1MV8 A;  3SWF A;  3A5T A;  2IPP A;  1X79 B;  2QM8 A;  3RK2 C;  2I1J A;  1A02 J;  2KB7 P;  1YYC A;  3HUS B;  1GU4 A;  2A45 G;  1IK9 A;  2CPB A;  3TYY A;  1NO4 A;  1JUN A;  1IFI A;  1CSB A;  4WB4 A;  2CPS A;  2WTY A;  1NKZ B;  2OYH A;  2M8R A;  3CLQ A;  5BU5 A;  5AVR B;  2YKO A;  3CI9 A;  3V4W A;  1ZN5 A;  4XA4 A;  1HJB A;  3RK3 C;  4C46 A;  1SQP K;  2IFN A;  1SQX K;  1NWQ A;  3NMD A;  2GM4 A;  1DX7 A;  5BU8 B;  1GK4 A;  1GK6 A;  1GTW A;  1G2C A;  5CCH D;  2L5G B;  4W80 A;  1S9K D;  2W6A A;  3HD7 C;  1IO4 A;  1NTZ K;  5AVT B;  1RF0 C;  1NTK K;  3P8M C;  2ZFC A;  3MD0 A;  3LW5 H;  2HOD B;  3P8C D;  1ZV8 A;  1N7S A;  5APX A;  1FZE A;  2GUS A;  3VTP C;  2R3C A;  2Z4E A;  3L4F A;  1RE3 A;  1IFN A;  2WSE H;  2WIT A;  3B5N D;  3M06 A;  2H43 A;  2Q9I A;  1N73 C;  4ZKP A;  1SFC C;  3BVH A;  1IC2 A;  1JY2 N;  2N1T C;  3P8C E;  1QL1 A;  2YO3 A;  3RK3 D;  5APV A;  2I1K A;  2WSF H;  1J1E B;  4WY4 B;  1URQ C;  2YMY A;  1YTZ I;  2H7H A;  5APS A;  3A2A A;  4C7N B;  2HLO A;  3PP5 A;  2E42 A;  5AVU B;  3HE5 A;  4WY4 A;  1SVF A;  3EFG A;  4LGD E;  1LT9 C;  1N7S C;  5APQ A;  3O8Z A;  1J2J B;  4LC1 A;  2WWW A;  3L37 A;  4B86 A;  4HH2 A;  3IFM A;  1M7L A;  2J58 A;  5CCG C;  2N9B A;  3B5N B;  2J59 M;  1N73 A;  1LTG C;  1FZA A;  2P67 A;  3M0D A;  2KOG A;  2C0W A;  3RK3 B;  1G1I A;  2HOD A;  1KZU B;  1NOH A;  3H32 A;  1T2K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...