3CL3D

Crystal structure of a vflip-ikkgamma complex: insights into viral activation of the ikk signalosome
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
QQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF K13
publication title Crystal structure of a vFlip-IKKgamma complex: insights into viral activation of the IKK signalosome.
pubmed doi rcsb
source organism Human gammaherpesvirus 8
molecule tags Viral protein/signaling protein
total genus 24
structure length 59
sequence length 59
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3cl3D00
3EQ2A 3CL3D 2YKPA 3L4FA 2YKQA 2W6BA 3BRTB 1JOCA 2YKOA 3BRVB
chains in the Genus database with same CATH superfamily
1HTLC 1QGKB 3MHVA 4C7NA 1SQXD 4DT0A 3L35A 3HD7C 5DJUB 1MUUA 3D71A 2P10A 3L70D 1CZQA 1SQBE 2OYHA 1OIPA 3FX0A 4W80A 3H32A 2YMKA 1L4AA 2M0BA 3ABVC 1LJ2A 2E74B 1NYHA 1NVOA 2KZIA 1FE6A 3JSVC 2QJPC 2NZ2A 4TLFA 3VOPA 4H0LC 1KQFB 5AVRB 2OARA 3V2QA 1G2CB 2WPVB 2J59M 3H1LD 5APVA 1AA0A 3G4SP 1W5CE 3JCUE 4H13B 2IZ1A 3H1KE 4EYYQ 2XKMA 1UIXA 3M0AA 3CWBD 4EIJA 1NO4A 3IFMA 2IBZG 1S1CX 3RK2C 2JEEA 1AVYA 2Y0DA 5KLVG 3CPWO 2Z5IA 3L74J 5KAIH 1T8ZA 3AE1C 3HE4B 1OX3A 1SQQK 4RJTA 1EXIA 3HTKB 2E75B 4DOJA 1T6AA 1KILA 2W27A 3UIAA 4IFFA 4PV1B 3MP7B 2AXTH 3L72G 2IYPA 3CCLP 1JB0J 1ZP0C 3TGUE 1LGHB 2ZYGA 1M1KQ 2LKMA 2O01N 3AE5C 1FZEA 3O6QA 2A06E 3CCSP 3SWFA 1Y9BA 3L70E 1JCDA 3FXEA 2SPZA 1L2PA 3M0DA 2E74C 1L4AD 2R3CA 1URQB 1GL2A 1SQBJ 1K05A 4GT1A 4BRYA 3Q1MA 4OGQD 3CXHE 1IJDB 4R4MA 3EWKA 1HGVA 4L76A 5GTIE 1M1JA 5BVZA 3Q3DA 1MKMA 1EC5A 3PP5A 4GOEA 2LR2A 5AW0B 1FZFA 3B5NB 2JKVA 1RH5B 2P58A 4MN4C 1R5LA 3I56P 3H1LE 1L0ND 2FXMA 1QL2A 1RQVA 1VQ7P 2KZJA 1Z56A 2PAJA 1KFMA 5TJHA 1T2KD 5KAFE 1LT9B 3HE5B 1KQSO 2Y0EA 2W83C 3AE9C 4EOTA 1ZR4A 3JCUH 4O9BA 3H1ID 2WTYA 1S72P 3WUTA 3BCCE 1KILD 1A02F 1E5WA 1S4XA 2QJKB 2POHA 4YPCA 2E42A 3TGUJ 1RF0C 1ZN5A 2W6AA 4OWFA 5AW7B 1X22A 2ZFCA 4PD4H 1KTMA 1URQC 5AW4B 2H8PD 2N1TA 1YJ9P 1JEKA 3JC22 1KYOI 1M90Q 1NU1J 1SQVD 1X9VA 5E79E 2FYZA 1MFZA 1RF1B 1SFCA 3B5NC 2FFDC 4A7PA 1N73A 3AEGC 1R8EA 2FYUK 2WSCJ 3M9QA 3GF7A 3CXHH 3LIEA 1FDMA 3PLNA 4BWNA 5GTIH 2XU6A 2WSCH 3HUSB 1Q90D 4LLHA 3U59A 2NPSA 3L71G 1HGZA 1AJYA 1LT9C 4UB8H 2XNDH 5AW9B 2P67A 1PGOA 5APYA 2QIWA 1KB9H 1VQKP 2K9JB 3MD0A 2C9NY 2D2CB 2LXCB 1NGMB 1ZV8A 3L74G 3WU2E 5B5EH 1NTMD 2HLOA 5KAFH 1L0LK 4JQ0D 2JDIH 3HD7A 5KLVE 1S9KD 1EZVI 1NTZG 1Q86Q 4HH2A 2QJKC 3RK3B 1ZLLA 2G3AA 2E76D 5CJ4A 1ZMEC 1PGQA 2FKWB 2O1KA 2R3SA 3E1IA 1N7LA 3K5BA 2XZRA 1QX8A 2A45G 1LP1A 1HVVA 3MUDC 3F5HA 5APSA 4GIFA 1H88A 1RF1C 2QEXP 1BE3G 5AVTB 1EDIA 1K04A 1BGYG 4ZKPA 3L73G 1Q82Q 2ITAA 2CPSA 4HB1A 3HUSC 5E79H 1JY2O 3GLMA 1FJKA 1FC2C 2IDBA 3M9BA 2L5GB 1JMMA 1K73Q 5BU5A 5KKZB 2OQQA 3VMYA 5KJ7C 3IN6A 2HG5D 3C8VA 3G3ZA 1OZHA 3OA7A 4RO0A 3FGAD 2D2CC 1IFJA 2OYIC 5AVYB 2KLVA 1H89A 3GHGA 3CX5E 5H2FE 4D6TG 1LTJB 2KS1B 2OGUA 5AVQB 3P7KA 2Q3EA 1RE3C 3KDPB 1PFIA 3RK3C 2VRSA 4ZNCA 4U3FG 1CSBA 3CMEP 5CCGC 3L74D 1S9KE 2V7QJ 5KTBA 5APTA 5KLVJ 3A0BE 3WU2H 2V7QH 1YTZI 3FXDA 1NTKG 2NRGA 3L72J 1SQXK 1VQ4P 1P84H 3T97B 3W68A 1G2CA 1NU1G 1PPJG 1SQBD 5BU8B 2ZYDA 4OVNF 3Q5RA 1CW5A 1VQMP 5EFWB 3TF5A 3BASA 4Y28J 1Q2NA 5KKZC 2B87B 3RK2D 3TNUB 1VQ6P 1Q7YQ 3A7OA 1FBMA 4XA4A 3L71E 3HTKA 2Q5UA 2Q1KA 3G71P 4DZOA 1LWUC 3VMAA 1HF9A 4GKGA 2N9BA 2QE7H 2WVRA 2YXQB 3CCQP 1PP9G 3CLQA 3ZDMA 3L74E 3CX5H 5H2FH 1X8YA 4C46A 1DIPA 2KUBA 1RHZB 3H1HG 2O3JA 2BEZF 2FBWC 1NTZE 1GU4A 1HH0A 3D6YA 2Y9ZA 1QL1A 3V2PA 1YI2P 2C0WA 3R4YA 5L8RJ 2QG4A 5AW2B 4PD4D 3B4SA 3A0BH 3TGUD 1XTGB 4JPZB 1SQPG 2M3EA 1RQUA 2FFDA 5AW8B 1U57A 2K88A 2A06D 1Y47A 1NKZB 2C0XA 3AECC 1FDIA 3B71A 3WMM0 5AW5B 3OW2O 3L36A 1PPJD 3D6ZA 2L91A 1BE3E 3A2AA 2H7HA 1M56D 1OWAA 5AVSB 3KPEA 1BGYE 3L73E 3CXHD 2YIUB 3L75G 4WY4B 2B89A 2OTKE 2M5AB 1FZGA 1L0NK 1R5SA 1QVGO 1BCCJ 1VQ5P 1VF5D 3L71J 2QJYB 2WT7B 1KB9D 2ZVNB 3AEEC 4K35A 3VN0A 2FYUJ 1FS0E 3AEBC 3M91A 2MJZA 1IFIA 1AVOA 5AVVB 5GTHE 4D6TE 2ZAEB 1IO4A 3OAKA 2K3RA 3H1JJ 3H6PA 3MUDA 2YNYA 2E5TA 3BCCD 3C9IA 2KNCA 1OFCX 2YKPA 1NTZJ 4JF7A 3RL0D 1TU3F 3GW6A 2YMYA 1JY3O 1H0TA 4PD4E 1YQ3C 3P8CE 3BATA 4GDOA 2PP6A 1NTKE 5CMZA 1SQQG 1QVFO 1BSNA 2IFMA 2W8ZA 3E1RA 2WSFJ 1ZR2A 3HUSA 3M9HA 5APUA 1YIJP 5C39A 2CK3H 1NU1E 1N7SA 1SQVK 2A45H 1PPJE 2WSFH 3SSUA 2YKQA 4XFJA 2GA1A 2YIUC 1FOSF 1BE3J 3EFGA 3AEFC 2PGDA 1BGYJ 2K9JA 3IAOA 3L73J 2XV5A 2OYIA 1QEXA 2ZYAA 4UB8E 2QJYC 2HODA 1BDCA 3SWYA 4H13C 4KHXA 3EQ2A 2KXPB 1KB9E 1GK6A 3FWNA 3RL0B 2P1JA 4C7NB 3L37A 2QM7A 2Q9IA 4Z1MH 2BCCG 2YKOA 5B5EE 4KJMA 1CI6A 4UB6H 1KMIZ 2PRRA 2OYHB 1NTMK 4D6TJ 1J1DB 2IBZD 1PP9E 2E75C 2R5BA 1GD2E 3H32B 2WMMA 1L4AB 4PV1C 4U3FJ 5GTHH 5KLVD 3H1HE 1KC8Q 2J58A 4OGQB 2CPBA 1JO5A 2ZT9D 1JY3P 3CCVP 1BDDA 2OTJP 3LIDA 1P84D 3PJSK 1NAYA 4B86A 3L72D 5M1BA 3KQGA 1NTKJ 1SQPE 1GDTA 1N7SD 2IPPA 1GL2D 3II6A 1PL5A 4L73A 2AXCA 4RESB 5APQA 1S2EA 1NOHA 3V5BA 1D7MA 2HPCA 2KIKA 1IK7A 1T3JA 2RKLA 1LWUA 4GOFA 2Z5HA 3AE6C 3L75E 5AVWB 3MTUE 2GUSA 3TK1A 1BCCG 1KILB 2RH0A 3WUUA 2P7JA 2N9YB 1EDLA 1WMKA 4XE5B 2ZT9B 2Q7CA 2FYUG 2WPRA 3AEAC 3O6QB 2JWAA 2G8YA 4ZMDA 4RKUJ 2KYVA 4L75A 3CX5D 2R44A 3H1JG 1VQOP 2IBZE 2H43A 2FYNB 4OGQC 1FOSE 3C1LA 4BRYB 2ZXEB 3FWLA 1PP9J 3Q5SA 1M1JB 3H1HJ 2FXOA 3CC7P 1S5LX 4JBZA 1WRGA 1P84E 4N6JA 1VQNP 1RY3A 4HKZH 3SFDC 3L72E 2HFED 1YBKA 1L0LG 3GF3A 1X79B 3NTNA 2N1TD 4H44D 3NMDA 1SQQE 1SQPJ 1T2KC 1JM0A 3KYQA 4YXWH 2E5YA 1SQBK 1ZRTE 1EZVG 1SFCD 1N8RQ 1VQLP 1AV1A 1M57D 3A5TA 4WBAA 1E79H 3CMAP 1KILC 3PTZA 3CCUP 1KQGB 1GMJA 3F89A 3L75J 2NPSD 3RK3E 2W90A 1T3UA 1DEEG 1BCCD 1DEBA 2E76B 3L71D 4DCKA 2FY8A 2Q3IA 1JNMA 3E7KA 4IL6X 2KK7A 4IFMA 2Z4EA 2H89C 2N1TB 2BCCE 4M3LA 1UIIA 1VDFA 4ASVA 3L4FA 4PD4I 3HD7D 3H1JD 1M1JC 1H8AA 3H1KG 3BVHA 3RL0g 1IFPA 4I6MC 1LNQA 4ASWA 1N73B 3M06A 1NTZD 5KLIB 1U7MA 4I1LA 2KI7B 3MGNA 2IYOA 3EFFK 1XTCC 5CBOA 1RE4C 4U7JA 2NPSB 2MKVA 3CXHI 2KLUA 1LTGC 2KSEA 4H0LD 1KZUB 1SQQJ 2QSIA 1JY3N 3AE8C 1GU5A 3CCEP 1SQXG 2B9BA 4Y99B 2Y9YA 1LTSC 1BE3D 1EDKA 1W2BO 1IC2A 2WITA 1BGYD 1KB9I 4N78D 3L73D 1JY2P 2DW3A 3RBZA 4R4LA 3AE4C 3CC2P 2E76C 1YTZT 1BCCE 2J5UA 3HE4A 3PRJA 3S1KA 2FYUE 2K37A 1LP1B 1LTJC 5AVXB 3A3YB 1FZBA 1IZNB 1JOCA 1OXZA 3LW5J 2BCCJ 4H0LB 5APXA 3R2PA 4D6TD 3H1JE 1AQTA 1N73C 1RF0A 3LW5H 2E43A 4U3FD 1FZCB 1URQA 3CWBG 1W2EA 2E74D 2JJLA 2ZVOB 1MZ9A 3RBXA 1J1EB 3P8CD 4TT3H 1L0LE 2HR3A 1NTKD 1JTHB 3RK2B 3B5NA 1JCCA 3VP9A 2AEMA 4Y99C 3AE2C 2KOGA 1OVUA 4IL6H 1MFTA 3G9RA 2PFXA 3VTPC 1NU1D 4H13D 1DH3A 2RMZA 3A0HE 3VMZA 1YQ4C 3GHGB 5AW6B 1VQ9P 1EZVE 2WPSA 3VMXA 1G1JA 2IZ0A 1LT9A 4N78E 3HE5A 1Y8AA 3AEDC 1KD1Q 4NPDA 1PGPA 2E75D 2WSEJ 5DJTB 4PV1D 4AUWA 2RN0A 2IBZI 2IFNA 4UB6E 2M3BA 1J2JB 2WSEH 1JMBA 1OMIA 2AEFA 2UWJE 1L0NG 1YJWP 1KYOH 4N3YB 4DJGA 1LTTC 4EI2A 3D70A 2JWDA 3HRNA 1P84I 1FZCC 2K1AA 1URQD 4U3FE 5CCHC 1PP9D 3N4XA 5KLVK 1NWQA 2JR8A 1J1EC 1SS1A 2KB7P 1BSHA 1FU1A 3H1HD 3H1IG 5AW1B 1GTWA 1RF1A 3MZWB 4YTPC 2YXRB 4WWIA 4W7ZA 3PHLA 3Q5PA 3B5ND 3S9OA 1HJBA 1L0LJ 1SQPD 2JO1A 4IOIH 4K3AA 5AVZB 1M8OB 3GHGC 3IF4A 1USDA 1VF5B 1OVVA 1SQXE 5KJ7A 2ZJSE 4WY4C 3USSA 4EDFA 3A0HH 1SQVG 3BRVB 3L75D 1PV3A 3AE3C 3CX5I 1RE3A 1EDJA 3ITKA 1JY2N 3P8MC 5CCGA 1K9MQ 1LTIC 4JYCA 2FFDB 4AQRD 1USEA 1YYCA 5B66E 5TISE 1KFNA 1DD4A 4HYTB 1N86A 1PZQA 2P2UA 5CJ0A 1RE4A 1U7JA 2R32A 3G6EP 3H1KJ 4JYBA 5APWA 3CWBE 3V2NA 3VYIA 2V4HA 2BEQD 1NTMG 1VPCA 3BRTB 1IFMA 1VF5C 1FZAA 3TDKA 2O01J 4IFDK 3PH0A 1EQ7A 1SQQD 3IR9A 4PJ0E 2O01H 3NFQA 4GODA 3U1CA 5KJ7D 1ZRTD 1SQXJ 4I7ZB 3WUVA 4ZKUA 2D2CD 3AE7C 3GMAA 3L70J 5CHXA 1LTJA 2KS1A 2YO2A 1LT1A 1FDOA 3V4WA 1IK9A 5AVUB 4C7RA 2KNCB 2IX7C 3RL0C 1ZOYC 2GUVA 2C9LY 3RK3D 2QM8A 1OVRA 4QMAA 5CCGD 1KN7A 1YJNP 1H0TB 1GK4A 1IFDA 3N7NA 3KZIE 1NJIQ 1QLED 2OYHC 1L0NE 3U1AA 1YHQP 1J1DC 3MIWA 3Q2YA 1VQPP 3H1LJ 1L4AC 1SLQA 2BCCD 1GW4A 3T97A 2LXBA 1N7SB 3I5CA 1S3JA 1OW7A 3P32A 1GL2B 5B66H 5TISH 2M8RA 3TYYA 2A45I 2I8DA 1NTZK 2B88A 1OW8A 1ZXGA 3QH9A 3H1IE 3CWBJ 1FAVA 2OYIB 3QWOC 3S4RA 2QA4P 1NHLA 1KORA 1KILE 2HODB 4CPGA 2B87A 3BCCJ 2JP3A 5CBNA 3TNUA 3CCMP 1YITP 3VP8A 4I7ZC 1PGJA 2ZXXA 3CL3D 2QVAA 2Q6QA 4PJ0H 4LC1A 3SFEC 1CI6B 1KV4A 1NH4A 2XNXA 2W6BA 1G1IA 1GW3A 1AFOA 1K8AQ 1S5LE 1SQBG 1SQVE 2ZT9C 1LTAC 1DD3A 2K9YA 2HYNA 1HJ0A 4OH8B 1FZCA 4NPFX 5CCHA 1SVFA 1KYOD 4NPEA 2YO3A 4LGDE 2QRXA 2FYUD 3KXDA 1N7SC 3M0DC 1GL2C 2FYNC 4H44B 1L0NJ 1JTHA 1DX7A 3B8EB 4WVZA 1MV8A 3KZIH 1X0TA 5K5GB 2WWWA 1JUNA 3W67A 2OTLP 1KQLA 2HPCB 1SFCB 1HWTC 2WQYC 2H88C 1LWUB 3OJAB 3KHUA 1GZLA 3V6IA 3H1IJ 1NTME 3RGUA 4IL6E 1NTKK 4WY4A 1L0LD 1ZW0A 5AW3B 4KT0J 2M5AA 2I1JA 2WSSH 2KSJA 1NU1K 3TGUG 1M7LA 4I2LC 2R5DA 1HBWA 2WT7A 1WT6A 1N2DC 2A06G 3V4QA 4WB4A 1VQ8P 1VL2A 1LTBC 4BXLA 1EZVD 2KP8A 3L70G 2WZ7A 1AQ5A 2AEJA 2GM4A 1OW6A 3HD7B 1SQVJ 3O8ZA 4L74A 1PIXA 3CI9A 1S5LH 2FXPA 3CC4P 5CCHD 2I1KA 1KYOE 3V2RA 1NKNA 2N1TC 4H44C 3CD6P 4YXDC 3TSIA 4W7YA 3CCJP 3H1LG 2O1JA 2W6JH 1A02J 2WPQA 4AYCA 2QJPB 2OYOA 2XDJA 1SFCC 1EXJA 1HUCA 1IFNA 2BASA 5KLIC 3H1KD 3CCRP 1SP4A 5KAIE 3SWKA 3H25A 2NPSC 4WY4D 1NAFA 1NTMJ 2Y0CA 3BCCG 2AXTE 1SQPK 3NXSA 1FJPA 3I55P 4HJGH 1Q81Q 3GG2A
chains in the Genus database with same CATH topology
2WPRA 1PFIA 3RK3C 2VRSA 1HTLC 1CSBA 5CCGC 1S9KE 4C7NA 5KTBA 5APTA 3L35A 3HD7C 2KYVA 1RE3A 1MUUA 1CZQA 1JY2N 1YTZI 3P8MC 5CCGA 2H43A 1LTIC 2OYHA 4JYCA 1FOSE 2ZXEB 2FFDB 1SQXK 4W80A 4AQRD 3H32A 1L4AA 1YYCA 1KFNA 1G2CA 1M1JB 4HYTB 1N86A 1WRGA 2P2UA 5CJ0A 4N6JA 1RE4A 1RY3A 2HFED 3VOPA 1X79B 5BU8B 3NTNA 2R32A 5AVRB 2OARA 3V2QA 1G2CB 2N1TD 4JYBA 3NMDA 5APWA 2J59M 1CW5A 5APVA 3V2NA 3VYIA 1T2KC 3BASA 1VPCA 3BRTB 3KYQA 1SQBK 3RK2D 3TNUB 1SFCD 3A7OA 1FBMA 4XA4A 2XKMA 1IFMA 1FZAA 4IFDK 3M0AA 1EQ7A 3IR9A 3A5TA 4WBAA 4EIJA 1NO4A 3IFMA 3HTKA 3RK2C 1KILC 2JEEA 2Q5UA 2O01H 3NFQA 4DZOA 1LWUC 3U1CA 5KJ7D 2Z5IA 2NPSD 1T8ZA 4GKGA 3HE4B 2N9BA 1SQQK 1T3UA 3HTKB 4DOJA 1KILA 4ZKUA 2W27A 3UIAA 4IFFA 1DEBA 5CHXA 1LTJA 2YO2A 2Q3IA 1JNMA 3CLQA 3V4WA 1IK9A 1LGHB 5AVUB 1X8YA 4C46A 4IFMA 2LKMA 4C7RA 2IX7C 1FZEA 2Z4EA 3RL0C 2GUVA 2C9LY 3RK3D 2N1TB 3SWFA 2QM8A 4M3LA 1GU4A 1HH0A 5CCGD 1VDFA 1JCDA 1GK4A 1QL1A 3V2PA 1IFDA 2C0WA 3L4FA 3N7NA 3HD7D 3M0DA 5AW2B 1M1JC 1L4AD 1H8AA 2R3CA 1URQB 1GL2A 3BVHA 1XTGB 4I6MC 4GT1A 2OYHC 3U1AA 2FFDA 1J1DC 3MIWA 5AW8B 1N73B 3M06A 1NKZB 2C0XA 1L4AC 1SLQA 1IJDB 3WMM0 1GW4A 5AW5B 3T97A 4I1LA 1N7SB 1HGVA 3I5CA 1M1JA 3MGNA 3P32A 5BVZA 1GL2B 3PP5A 1XTCC 5AW0B 2M8RA 3TYYA 3L36A 1RE4C 3B5NB 1FZFA 3A2AA 2A45I 2H7HA 2NPSB 1OWAA 5AVSB 3KPEA 1NTZK 1LTGC 1KZUB 2FXMA 1QL2A 1JY3N 1FAVA 2OYIB 1NHLA 1Z56A 2PAJA 4WY4B 1GU5A 1KFMA 1T2KD 4Y99B 2HODB 1FZGA 1L0NK 1LTSC 1LT9B 1IC2A 3TNUA 3HE5B 2WITA 4EOTA 1ZR4A 4O9BA 4N78D 2WTYA 1JY2P 3VP8A 2WT7B 3VN0A 3CL3D 4LC1A 1KILD 1YTZT 1CI6B 3M91A 2MJZA 1NH4A 1IFIA 2XNXA 2W6BA 1A02F 1G1IA 1E5WA 3HE4A 1GW3A 5AVVB 1AFOA 1IO4A 3OAKA 3H6PA 1LTJC 2POHA 1LTAC 5AVXB 2E42A 3MUDA 1RF0C 2YNYA 3A3YB 1FZBA 3C9IA 2HYNA 1ZN5A 1JOCA 2W6AA 4OH8B 2ZFCA 5AW7B 1OXZA 1FZCA 1URQC 5AW4B 2H8PD 2N1TA 2YKPA 5APXA 4JF7A 3RL0D 2YMYA 1JY3O 5CCHA 3R2PA 1SVFA 3P8CE 2YO3A 3BATA 1N73C 1RF0A 4LGDE 3LW5H 2PP6A 1X9VA 2E43A 1N7SC 3M0DC 5CMZA 2FYZA 1URQA 1FZCB 1MFZA 1GL2C 2IFMA 1W2EA 1RF1B 1JTHA 2JJLA 1SFCA 1ZR2A 3B5NC 2FFDC 1MZ9A 3HUSA 3M9HA 1N73A 3B8EB 5APUA 1DX7A 1MV8A 1J1EB 1N7SA 2FYUK 1SQVK 2A45H 2WWWA 3M9QA 2WSFH 1JUNA 3P8CD 2YKQA 1KQLA 3LIEA 1FDMA 1JTHB 3RK2B 2HPCB 1FOSF 1SFCB 3B5NA 1HWTC 3EFGA 1JCCA 2XU6A 2WSCH 3HUSB 4LLHA 3U59A 2NPSA 1LWUB 3OJAB 3VP9A 4Y99C 2KOGA 1GZLA 1HGZA 2XV5A 1LT9C 3VTPC 2OYIA 1DH3A 1NTKK 5AW9B 4WY4A 3VMZA 5AW6B 3GHGB 2P67A 5APYA 5AW3B 2HODA 2WPSA 3MD0A 2C9NY 3VMXA 3SWYA 1G1JA 1LT9A 4N78E 3HE5A 2I1JA 4KHXA 3EQ2A 1GK6A 2KSJA 3RL0B 1NU1K 1ZV8A 2P1JA 1M7LA 2HLOA 4I2LC 2R5DA 4C7NB 1HBWA 2WT7A 1L0LK 1WT6A 2QM7A 3HD7A 3L37A 2Q9IA 1N2DC 3V4QA 4WB4A 1S9KD 2YKOA 1LTBC 4HH2A 3RK3B 1CI6A 2KP8A 1ZLLA 4AUWA 2WZ7A 1AQ5A 5CJ4A 2OYHB 1NTMK 2IFNA 2GM4A 2M3BA 1J1DB 1J2JB 2FKWB 2O1KA 2WSEH 3HD7B 2Q7CA 3E1IA 1N7LA 2R5BA 2XZRA 1GD2E 3H32B 1L4AB 3O8ZA 2A45G 3CI9A 1HVVA 4N3YB 1LTTC 2J58A 2I1KA 5CCHD 2CPBA 1JO5A 5APSA 1JY3P 4GIFA 3HRNA 1H88A 1FZCC 3V2RA 1NKNA 2N1TC 3LIDA 1RF1C 3TSIA 1URQD 4B86A 4W7YA 5CCHC 5AVTB 3N4XA 3KQGA 5KLVK 1NWQA 2O1JA 1J1EC 1A02J 2KB7P 2WPQA 4AYCA 4ZKPA 1GDTA 1FU1A 5AW1B 1GTWA 1N7SD 2XDJA 1RF1A 2CPSA 2IPPA 1SFCC 1GL2D 1HUCA 4W7ZA 3HUSC 1JY2O 1IFNA 2BASA 3II6A 3B5ND 4RESB 1HJBA 1FJKA 5APQA 3M9BA 2L5GB 1JMMA 1NOHA 5BU5A 3V5BA 1SP4A 2HPCA 3VMYA 5AVZB 5KJ7C 1T3JA 3GHGC 2HG5D 1LWUA 2NPSC 3G3ZA 2Z5HA 4WY4D 3OA7A 1NAFA 5AVWB 3MTUE 2GUSA 3TK1A 1IFJA 2OYIC 1SQPK 3NXSA 1KILB 2KLVA 5AVYB 5KJ7A 1FJPA 1H89A 2P7JA 3GHGA 4WY4C 4XE5B 1LTJB 5AVQB 3P7KA 1RE3C 3BRVB 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQ2 A;  3CL3 D;  2YKP A;  3L4F A;  2YKQ A;  2W6B A;  3BRT B;  1JOC A;  2YKO A;  3BRV B; 
#chains in the Genus database with same CATH topology
 1HTL C;  1QGK B;  3MHV A;  4C7N A;  1SQX D;  4DT0 A;  3L35 A;  3HD7 C;  5DJU B;  1MUU A;  3D71 A;  2P10 A;  3L70 D;  1CZQ A;  1SQB E;  2OYH A;  1OIP A;  3FX0 A;  4W80 A;  3H32 A;  2YMK A;  1L4A A;  2M0B A;  3ABV C;  1LJ2 A;  2E74 B;  1NYH A;  1NVO A;  2KZI A;  1FE6 A;  3JSV C;  2QJP C;  2NZ2 A;  4TLF A;  3VOP A;  4H0L C;  1KQF B;  5AVR B;  2OAR A;  3V2Q A;  1G2C B;  2WPV B;  2J59 M;  3H1L D;  5APV A;  1AA0 A;  3G4S P;  1W5C E;  3JCU E;  4H13 B;  2IZ1 A;  3H1K E;  4EYY Q;  2XKM A;  1UIX A;  3M0A A;  3CWB D;  4EIJ A;  1NO4 A;  3IFM A;  2IBZ G;  1S1C X;  3RK2 C;  2JEE A;  1AVY A;  2Y0D A;  5KLV G;  3CPW O;  2Z5I A;  3L74 J;  5KAI H;  1T8Z A;  3AE1 C;  3HE4 B;  1OX3 A;  1SQQ K;  4RJT A;  1EXI A;  3HTK B;  2E75 B;  4DOJ A;  1T6A A;  1KIL A;  2W27 A;  3UIA A;  4IFF A;  4PV1 B;  3MP7 B;  2AXT H;  3L72 G;  2IYP A;  3CCL P;  1JB0 J;  1ZP0 C;  3TGU E;  1LGH B;  2ZYG A;  1M1K Q;  2LKM A;  2O01 N;  3AE5 C;  1FZE A;  3O6Q A;  2A06 E;  3CCS P;  3SWF A;  1Y9B A;  3L70 E;  1JCD A;  3FXE A;  2SPZ A;  1L2P A;  3M0D A;  2E74 C;  1L4A D;  2R3C A;  1URQ B;  1GL2 A;  1SQB J;  1K05 A;  4GT1 A;  4BRY A;  3Q1M A;  4OGQ D;  3CXH E;  1IJD B;  4R4M A;  3EWK A;  1HGV A;  4L76 A;  5GTI E;  1M1J A;  5BVZ A;  3Q3D A;  1MKM A;  1EC5 A;  3PP5 A;  4GOE A;  2LR2 A;  5AW0 B;  1FZF A;  3B5N B;  2JKV A;  1RH5 B;  2P58 A;  4MN4 C;  1R5L A;  3I56 P;  3H1L E;  1L0N D;  2FXM A;  1QL2 A;  1RQV A;  1VQ7 P;  2KZJ A;  1Z56 A;  2PAJ A;  1KFM A;  5TJH A;  1T2K D;  5KAF E;  1LT9 B;  3HE5 B;  1KQS O;  2Y0E A;  2W83 C;  3AE9 C;  4EOT A;  1ZR4 A;  3JCU H;  4O9B A;  3H1I D;  2WTY A;  1S72 P;  3WUT A;  3BCC E;  1KIL D;  1A02 F;  1E5W A;  1S4X A;  2QJK B;  2POH A;  4YPC A;  2E42 A;  3TGU J;  1RF0 C;  1ZN5 A;  2W6A A;  4OWF A;  5AW7 B;  1X22 A;  2ZFC A;  4PD4 H;  1KTM A;  1URQ C;  5AW4 B;  2H8P D;  2N1T A;  1YJ9 P;  1JEK A;  3JC2 2;  1KYO I;  1M90 Q;  1NU1 J;  1SQV D;  1X9V A;  5E79 E;  2FYZ A;  1MFZ A;  1RF1 B;  1SFC A;  3B5N C;  2FFD C;  4A7P A;  1N73 A;  3AEG C;  1R8E A;  2FYU K;  2WSC J;  3M9Q A;  3GF7 A;  3CXH H;  3LIE A;  1FDM A;  3PLN A;  4BWN A;  5GTI H;  2XU6 A;  2WSC H;  3HUS B;  1Q90 D;  4LLH A;  3U59 A;  2NPS A;  3L71 G;  1HGZ A;  1AJY A;  1LT9 C;  4UB8 H;  2XND H;  5AW9 B;  2P67 A;  1PGO A;  5APY A;  2QIW A;  1KB9 H;  1VQK P;  2K9J B;  3MD0 A;  2C9N Y;  2D2C B;  2LXC B;  1NGM B;  1ZV8 A;  3L74 G;  3WU2 E;  5B5E H;  1NTM D;  2HLO A;  5KAF H;  1L0L K;  4JQ0 D;  2JDI H;  3HD7 A;  5KLV E;  1S9K D;  1EZV I;  1NTZ G;  1Q86 Q;  4HH2 A;  2QJK C;  3RK3 B;  1ZLL A;  2G3A A;  2E76 D;  5CJ4 A;  1ZME C;  1PGQ A;  2FKW B;  2O1K A;  2R3S A;  3E1I A;  1N7L A;  3K5B A;  2XZR A;  1QX8 A;  2A45 G;  1LP1 A;  1HVV A;  3MUD C;  3F5H A;  5APS A;  4GIF A;  1H88 A;  1RF1 C;  2QEX P;  1BE3 G;  5AVT B;  1EDI A;  1K04 A;  1BGY G;  4ZKP A;  3L73 G;  1Q82 Q;  2ITA A;  2CPS A;  4HB1 A;  3HUS C;  5E79 H;  1JY2 O;  3GLM A;  1FJK A;  1FC2 C;  2IDB A;  3M9B A;  2L5G B;  1JMM A;  1K73 Q;  5BU5 A;  5KKZ B;  2OQQ A;  3VMY A;  5KJ7 C;  3IN6 A;  2HG5 D;  3C8V A;  3G3Z A;  1OZH A;  3OA7 A;  4RO0 A;  3FGA D;  2D2C C;  1IFJ A;  2OYI C;  5AVY B;  2KLV A;  1H89 A;  3GHG A;  3CX5 E;  5H2F E;  4D6T G;  1LTJ B;  2KS1 B;  2OGU A;  5AVQ B;  3P7K A;  2Q3E A;  1RE3 C;  3KDP B;  1PFI A;  3RK3 C;  2VRS A;  4ZNC A;  4U3F G;  1CSB A;  3CME P;  5CCG C;  3L74 D;  1S9K E;  2V7Q J;  5KTB A;  5APT A;  5KLV J;  3A0B E;  3WU2 H;  2V7Q H;  1YTZ I;  3FXD A;  1NTK G;  2NRG A;  3L72 J;  1SQX K;  1VQ4 P;  1P84 H;  3T97 B;  3W68 A;  1G2C A;  1NU1 G;  1PPJ G;  1SQB D;  5BU8 B;  2ZYD A;  4OVN F;  3Q5R A;  1CW5 A;  1VQM P;  5EFW B;  3TF5 A;  3BAS A;  4Y28 J;  1Q2N A;  5KKZ C;  2B87 B;  3RK2 D;  3TNU B;  1VQ6 P;  1Q7Y Q;  3A7O A;  1FBM A;  4XA4 A;  3L71 E;  3HTK A;  2Q5U A;  2Q1K A;  3G71 P;  4DZO A;  1LWU C;  3VMA A;  1HF9 A;  4GKG A;  2N9B A;  2QE7 H;  2WVR A;  2YXQ B;  3CCQ P;  1PP9 G;  3CLQ A;  3ZDM A;  3L74 E;  3CX5 H;  5H2F H;  1X8Y A;  4C46 A;  1DIP A;  2KUB A;  1RHZ B;  3H1H G;  2O3J A;  2BEZ F;  2FBW C;  1NTZ E;  1GU4 A;  1HH0 A;  3D6Y A;  2Y9Z A;  1QL1 A;  3V2P A;  1YI2 P;  2C0W A;  3R4Y A;  5L8R J;  2QG4 A;  5AW2 B;  4PD4 D;  3B4S A;  3A0B H;  3TGU D;  1XTG B;  4JPZ B;  1SQP G;  2M3E A;  1RQU A;  2FFD A;  5AW8 B;  1U57 A;  2K88 A;  2A06 D;  1Y47 A;  1NKZ B;  2C0X A;  3AEC C;  1FDI A;  3B71 A;  3WMM 0;  5AW5 B;  3OW2 O;  3L36 A;  1PPJ D;  3D6Z A;  2L91 A;  1BE3 E;  3A2A A;  2H7H A;  1M56 D;  1OWA A;  5AVS B;  3KPE A;  1BGY E;  3L73 E;  3CXH D;  2YIU B;  3L75 G;  4WY4 B;  2B89 A;  2OTK E;  2M5A B;  1FZG A;  1L0N K;  1R5S A;  1QVG O;  1BCC J;  1VQ5 P;  1VF5 D;  3L71 J;  2QJY B;  2WT7 B;  1KB9 D;  2ZVN B;  3AEE C;  4K35 A;  3VN0 A;  2FYU J;  1FS0 E;  3AEB C;  3M91 A;  2MJZ A;  1IFI A;  1AVO A;  5AVV B;  5GTH E;  4D6T E;  2ZAE B;  1IO4 A;  3OAK A;  2K3R A;  3H1J J;  3H6P A;  3MUD A;  2YNY A;  2E5T A;  3BCC D;  3C9I A;  2KNC A;  1OFC X;  2YKP A;  1NTZ J;  4JF7 A;  3RL0 D;  1TU3 F;  3GW6 A;  2YMY A;  1JY3 O;  1H0T A;  4PD4 E;  1YQ3 C;  3P8C E;  3BAT A;  4GDO A;  2PP6 A;  1NTK E;  5CMZ A;  1SQQ G;  1QVF O;  1BSN A;  2IFM A;  2W8Z A;  3E1R A;  2WSF J;  1ZR2 A;  3HUS A;  3M9H A;  5APU A;  1YIJ P;  5C39 A;  2CK3 H;  1NU1 E;  1N7S A;  1SQV K;  2A45 H;  1PPJ E;  2WSF H;  3SSU A;  2YKQ A;  4XFJ A;  2GA1 A;  2YIU C;  1FOS F;  1BE3 J;  3EFG A;  3AEF C;  2PGD A;  1BGY J;  2K9J A;  3IAO A;  3L73 J;  2XV5 A;  2OYI A;  1QEX A;  2ZYA A;  4UB8 E;  2QJY C;  2HOD A;  1BDC A;  3SWY A;  4H13 C;  4KHX A;  3EQ2 A;  2KXP B;  1KB9 E;  1GK6 A;  3FWN A;  3RL0 B;  2P1J A;  4C7N B;  3L37 A;  2QM7 A;  2Q9I A;  4Z1M H;  2BCC G;  2YKO A;  5B5E E;  4KJM A;  1CI6 A;  4UB6 H;  1KMI Z;  2PRR A;  2OYH B;  1NTM K;  4D6T J;  1J1D B;  2IBZ D;  1PP9 E;  2E75 C;  2R5B A;  1GD2 E;  3H32 B;  2WMM A;  1L4A B;  4PV1 C;  4U3F J;  5GTH H;  5KLV D;  3H1H E;  1KC8 Q;  2J58 A;  4OGQ B;  2CPB A;  1JO5 A;  2ZT9 D;  1JY3 P;  3CCV P;  1BDD A;  2OTJ P;  3LID A;  1P84 D;  3PJS K;  1NAY A;  4B86 A;  3L72 D;  5M1B A;  3KQG A;  1NTK J;  1SQP E;  1GDT A;  1N7S D;  2IPP A;  1GL2 D;  3II6 A;  1PL5 A;  4L73 A;  2AXC A;  4RES B;  5APQ A;  1S2E A;  1NOH A;  3V5B A;  1D7M A;  2HPC A;  2KIK A;  1IK7 A;  1T3J A;  2RKL A;  1LWU A;  4GOF A;  2Z5H A;  3AE6 C;  3L75 E;  5AVW B;  3MTU E;  2GUS A;  3TK1 A;  1BCC G;  1KIL B;  2RH0 A;  3WUU A;  2P7J A;  2N9Y B;  1EDL A;  1WMK A;  4XE5 B;  2ZT9 B;  2Q7C A;  2FYU G;  2WPR A;  3AEA C;  3O6Q B;  2JWA A;  2G8Y A;  4ZMD A;  4RKU J;  2KYV A;  4L75 A;  3CX5 D;  2R44 A;  3H1J G;  1VQO P;  2IBZ E;  2H43 A;  2FYN B;  4OGQ C;  1FOS E;  3C1L A;  4BRY B;  2ZXE B;  3FWL A;  1PP9 J;  3Q5S A;  1M1J B;  3H1H J;  2FXO A;  3CC7 P;  1S5L X;  4JBZ A;  1WRG A;  1P84 E;  4N6J A;  1VQN P;  1RY3 A;  4HKZ H;  3SFD C;  3L72 E;  2HFE D;  1YBK A;  1L0L G;  3GF3 A;  1X79 B;  3NTN A;  2N1T D;  4H44 D;  3NMD A;  1SQQ E;  1SQP J;  1T2K C;  1JM0 A;  3KYQ A;  4YXW H;  2E5Y A;  1SQB K;  1ZRT E;  1EZV G;  1SFC D;  1N8R Q;  1VQL P;  1AV1 A;  1M57 D;  3A5T A;  4WBA A;  1E79 H;  3CMA P;  1KIL C;  3PTZ A;  3CCU P;  1KQG B;  1GMJ A;  3F89 A;  3L75 J;  2NPS D;  3RK3 E;  2W90 A;  1T3U A;  1DEE G;  1BCC D;  1DEB A;  2E76 B;  3L71 D;  4DCK A;  2FY8 A;  2Q3I A;  1JNM A;  3E7K A;  4IL6 X;  2KK7 A;  4IFM A;  2Z4E A;  2H89 C;  2N1T B;  2BCC E;  4M3L A;  1UII A;  1VDF A;  4ASV A;  3L4F A;  4PD4 I;  3HD7 D;  3H1J D;  1M1J C;  1H8A A;  3H1K G;  3BVH A;  3RL0 g;  1IFP A;  4I6M C;  1LNQ A;  4ASW A;  1N73 B;  3M06 A;  1NTZ D;  5KLI B;  1U7M A;  4I1L A;  2KI7 B;  3MGN A;  2IYO A;  3EFF K;  1XTC C;  5CBO A;  1RE4 C;  4U7J A;  2NPS B;  2MKV A;  3CXH I;  2KLU A;  1LTG C;  2KSE A;  4H0L D;  1KZU B;  1SQQ J;  2QSI A;  1JY3 N;  3AE8 C;  1GU5 A;  3CCE P;  1SQX G;  2B9B A;  4Y99 B;  2Y9Y A;  1LTS C;  1BE3 D;  1EDK A;  1W2B O;  1IC2 A;  2WIT A;  1BGY D;  1KB9 I;  4N78 D;  3L73 D;  1JY2 P;  2DW3 A;  3RBZ A;  4R4L A;  3AE4 C;  3CC2 P;  2E76 C;  1YTZ T;  1BCC E;  2J5U A;  3HE4 A;  3PRJ A;  3S1K A;  2FYU E;  2K37 A;  1LP1 B;  1LTJ C;  5AVX B;  3A3Y B;  1FZB A;  1IZN B;  1JOC A;  1OXZ A;  3LW5 J;  2BCC J;  4H0L B;  5APX A;  3R2P A;  4D6T D;  3H1J E;  1AQT A;  1N73 C;  1RF0 A;  3LW5 H;  2E43 A;  4U3F D;  1FZC B;  1URQ A;  3CWB G;  1W2E A;  2E74 D;  2JJL A;  2ZVO B;  1MZ9 A;  3RBX A;  1J1E B;  3P8C D;  4TT3 H;  1L0L E;  2HR3 A;  1NTK D;  1JTH B;  3RK2 B;  3B5N A;  1JCC A;  3VP9 A;  2AEM A;  4Y99 C;  3AE2 C;  2KOG A;  1OVU A;  4IL6 H;  1MFT A;  3G9R A;  2PFX A;  3VTP C;  1NU1 D;  4H13 D;  1DH3 A;  2RMZ A;  3A0H E;  3VMZ A;  1YQ4 C;  3GHG B;  5AW6 B;  1VQ9 P;  1EZV E;  2WPS A;  3VMX A;  1G1J A;  2IZ0 A;  1LT9 A;  4N78 E;  3HE5 A;  1Y8A A;  3AED C;  1KD1 Q;  4NPD A;  1PGP A;  2E75 D;  2WSE J;  5DJT B;  4PV1 D;  4AUW A;  2RN0 A;  2IBZ I;  2IFN A;  4UB6 E;  2M3B A;  1J2J B;  2WSE H;  1JMB A;  1OMI A;  2AEF A;  2UWJ E;  1L0N G;  1YJW P;  1KYO H;  4N3Y B;  4DJG A;  1LTT C;  4EI2 A;  3D70 A;  2JWD A;  3HRN A;  1P84 I;  1FZC C;  2K1A A;  1URQ D;  4U3F E;  5CCH C;  1PP9 D;  3N4X A;  5KLV K;  1NWQ A;  2JR8 A;  1J1E C;  1SS1 A;  2KB7 P;  1BSH A;  1FU1 A;  3H1H D;  3H1I G;  5AW1 B;  1GTW A;  1RF1 A;  3MZW B;  4YTP C;  2YXR B;  4WWI A;  4W7Z A;  3PHL A;  3Q5P A;  3B5N D;  3S9O A;  1HJB A;  1L0L J;  1SQP D;  2JO1 A;  4IOI H;  4K3A A;  5AVZ B;  1M8O B;  3GHG C;  3IF4 A;  1USD A;  1VF5 B;  1OVV A;  1SQX E;  5KJ7 A;  2ZJS E;  4WY4 C;  3USS A;  4EDF A;  3A0H H;  1SQV G;  3BRV B;  3L75 D;  1PV3 A;  3AE3 C;  3CX5 I;  1RE3 A;  1EDJ A;  3ITK A;  1JY2 N;  3P8M C;  5CCG A;  1K9M Q;  1LTI C;  4JYC A;  2FFD B;  4AQR D;  1USE A;  1YYC A;  5B66 E;  5TIS E;  1KFN A;  1DD4 A;  4HYT B;  1N86 A;  1PZQ A;  2P2U A;  5CJ0 A;  1RE4 A;  1U7J A;  2R32 A;  3G6E P;  3H1K J;  4JYB A;  5APW A;  3CWB E;  3V2N A;  3VYI A;  2V4H A;  2BEQ D;  1NTM G;  1VPC A;  3BRT B;  1IFM A;  1VF5 C;  1FZA A;  3TDK A;  2O01 J;  4IFD K;  3PH0 A;  1EQ7 A;  1SQQ D;  3IR9 A;  4PJ0 E;  2O01 H;  3NFQ A;  4GOD A;  3U1C A;  5KJ7 D;  1ZRT D;  1SQX J;  4I7Z B;  3WUV A;  4ZKU A;  2D2C D;  3AE7 C;  3GMA A;  3L70 J;  5CHX A;  1LTJ A;  2KS1 A;  2YO2 A;  1LT1 A;  1FDO A;  3V4W A;  1IK9 A;  5AVU B;  4C7R A;  2KNC B;  2IX7 C;  3RL0 C;  1ZOY C;  2GUV A;  2C9L Y;  3RK3 D;  2QM8 A;  1OVR A;  4QMA A;  5CCG D;  1KN7 A;  1YJN P;  1H0T B;  1GK4 A;  1IFD A;  3N7N A;  3KZI E;  1NJI Q;  1QLE D;  2OYH C;  1L0N E;  3U1A A;  1YHQ P;  1J1D C;  3MIW A;  3Q2Y A;  1VQP P;  3H1L J;  1L4A C;  1SLQ A;  2BCC D;  1GW4 A;  3T97 A;  2LXB A;  1N7S B;  3I5C A;  1S3J A;  1OW7 A;  3P32 A;  1GL2 B;  5B66 H;  5TIS H;  2M8R A;  3TYY A;  2A45 I;  2I8D A;  1NTZ K;  2B88 A;  1OW8 A;  1ZXG A;  3QH9 A;  3H1I E;  3CWB J;  1FAV A;  2OYI B;  3QWO C;  3S4R A;  2QA4 P;  1NHL A;  1KOR A;  1KIL E;  2HOD B;  4CPG A;  2B87 A;  3BCC J;  2JP3 A;  5CBN A;  3TNU A;  3CCM P;  1YIT P;  3VP8 A;  4I7Z C;  1PGJ A;  2ZXX A;  3CL3 D;  2QVA A;  2Q6Q A;  4PJ0 H;  4LC1 A;  3SFE C;  1CI6 B;  1KV4 A;  1NH4 A;  2XNX A;  2W6B A;  1G1I A;  1GW3 A;  1AFO A;  1K8A Q;  1S5L E;  1SQB G;  1SQV E;  2ZT9 C;  1LTA C;  1DD3 A;  2K9Y A;  2HYN A;  1HJ0 A;  4OH8 B;  1FZC A;  4NPF X;  5CCH A;  1SVF A;  1KYO D;  4NPE A;  2YO3 A;  4LGD E;  2QRX A;  2FYU D;  3KXD A;  1N7S C;  3M0D C;  1GL2 C;  2FYN C;  4H44 B;  1L0N J;  1JTH A;  1DX7 A;  3B8E B;  4WVZ A;  1MV8 A;  3KZI H;  1X0T A;  5K5G B;  2WWW A;  1JUN A;  3W67 A;  2OTL P;  1KQL A;  2HPC B;  1SFC B;  1HWT C;  2WQY C;  2H88 C;  1LWU B;  3OJA B;  3KHU A;  1GZL A;  3V6I A;  3H1I J;  1NTM E;  3RGU A;  4IL6 E;  1NTK K;  4WY4 A;  1L0L D;  1ZW0 A;  5AW3 B;  4KT0 J;  2M5A A;  2I1J A;  2WSS H;  2KSJ A;  1NU1 K;  3TGU G;  1M7L A;  4I2L C;  2R5D A;  1HBW A;  2WT7 A;  1WT6 A;  1N2D C;  2A06 G;  3V4Q A;  4WB4 A;  1VQ8 P;  1VL2 A;  1LTB C;  4BXL A;  1EZV D;  2KP8 A;  3L70 G;  2WZ7 A;  1AQ5 A;  2AEJ A;  2GM4 A;  1OW6 A;  3HD7 B;  1SQV J;  3O8Z A;  4L74 A;  1PIX A;  3CI9 A;  1S5L H;  2FXP A;  3CC4 P;  5CCH D;  2I1K A;  1KYO E;  3V2R A;  1NKN A;  2N1T C;  4H44 C;  3CD6 P;  4YXD C;  3TSI A;  4W7Y A;  3CCJ P;  3H1L G;  2O1J A;  2W6J H;  1A02 J;  2WPQ A;  4AYC A;  2QJP B;  2OYO A;  2XDJ A;  1SFC C;  1EXJ A;  1HUC A;  1IFN A;  2BAS A;  5KLI C;  3H1K D;  3CCR P;  1SP4 A;  5KAI E;  3SWK A;  3H25 A;  2NPS C;  4WY4 D;  1NAF A;  1NTM J;  2Y0C A;  3BCC G;  2AXT E;  1SQP K;  3NXS A;  1FJP A;  3I55 P;  4HJG H;  1Q81 Q;  3GG2 A; 
#chains in the Genus database with same CATH homology
 2WPR A;  1PFI A;  3RK3 C;  2VRS A;  1HTL C;  1CSB A;  5CCG C;  1S9K E;  4C7N A;  5KTB A;  5APT A;  3L35 A;  3HD7 C;  2KYV A;  1RE3 A;  1MUU A;  1CZQ A;  1JY2 N;  1YTZ I;  3P8M C;  5CCG A;  2H43 A;  1LTI C;  2OYH A;  4JYC A;  1FOS E;  2ZXE B;  2FFD B;  1SQX K;  4W80 A;  4AQR D;  3H32 A;  1L4A A;  1YYC A;  1KFN A;  1G2C A;  1M1J B;  4HYT B;  1N86 A;  1WRG A;  2P2U A;  5CJ0 A;  4N6J A;  1RE4 A;  1RY3 A;  2HFE D;  3VOP A;  1X79 B;  5BU8 B;  3NTN A;  2R32 A;  5AVR B;  2OAR A;  3V2Q A;  1G2C B;  2N1T D;  4JYB A;  3NMD A;  5APW A;  2J59 M;  1CW5 A;  5APV A;  3V2N A;  3VYI A;  1T2K C;  3BAS A;  1VPC A;  3BRT B;  3KYQ A;  1SQB K;  3RK2 D;  3TNU B;  1SFC D;  3A7O A;  1FBM A;  4XA4 A;  2XKM A;  1IFM A;  1FZA A;  4IFD K;  3M0A A;  1EQ7 A;  3IR9 A;  3A5T A;  4WBA A;  4EIJ A;  1NO4 A;  3IFM A;  3HTK A;  3RK2 C;  1KIL C;  2JEE A;  2Q5U A;  2O01 H;  3NFQ A;  4DZO A;  1LWU C;  3U1C A;  5KJ7 D;  2Z5I A;  2NPS D;  1T8Z A;  4GKG A;  3HE4 B;  2N9B A;  1SQQ K;  1T3U A;  3HTK B;  4DOJ A;  1KIL A;  4ZKU A;  2W27 A;  3UIA A;  4IFF A;  1DEB A;  5CHX A;  1LTJ A;  2YO2 A;  2Q3I A;  1JNM A;  3CLQ A;  3V4W A;  1IK9 A;  1LGH B;  5AVU B;  1X8Y A;  4C46 A;  4IFM A;  2LKM A;  4C7R A;  2IX7 C;  1FZE A;  2Z4E A;  3RL0 C;  2GUV A;  2C9L Y;  3RK3 D;  2N1T B;  3SWF A;  2QM8 A;  4M3L A;  1GU4 A;  1HH0 A;  5CCG D;  1VDF A;  1JCD A;  1GK4 A;  1QL1 A;  3V2P A;  1IFD A;  2C0W A;  3L4F A;  3N7N A;  3HD7 D;  3M0D A;  5AW2 B;  1M1J C;  1L4A D;  1H8A A;  2R3C A;  1URQ B;  1GL2 A;  3BVH A;  1XTG B;  4I6M C;  4GT1 A;  2OYH C;  3U1A A;  2FFD A;  1J1D C;  3MIW A;  5AW8 B;  1N73 B;  3M06 A;  1NKZ B;  2C0X A;  1L4A C;  1SLQ A;  1IJD B;  3WMM 0;  1GW4 A;  5AW5 B;  3T97 A;  4I1L A;  1N7S B;  1HGV A;  3I5C A;  1M1J A;  3MGN A;  3P32 A;  5BVZ A;  1GL2 B;  3PP5 A;  1XTC C;  5AW0 B;  2M8R A;  3TYY A;  3L36 A;  1RE4 C;  3B5N B;  1FZF A;  3A2A A;  2A45 I;  2H7H A;  2NPS B;  1OWA A;  5AVS B;  3KPE A;  1NTZ K;  1LTG C;  1KZU B;  2FXM A;  1QL2 A;  1JY3 N;  1FAV A;  2OYI B;  1NHL A;  1Z56 A;  2PAJ A;  4WY4 B;  1GU5 A;  1KFM A;  1T2K D;  4Y99 B;  2HOD B;  1FZG A;  1L0N K;  1LTS C;  1LT9 B;  1IC2 A;  3TNU A;  3HE5 B;  2WIT A;  4EOT A;  1ZR4 A;  4O9B A;  4N78 D;  2WTY A;  1JY2 P;  3VP8 A;  2WT7 B;  3VN0 A;  3CL3 D;  4LC1 A;  1KIL D;  1YTZ T;  1CI6 B;  3M91 A;  2MJZ A;  1NH4 A;  1IFI A;  2XNX A;  2W6B A;  1A02 F;  1G1I A;  1E5W A;  3HE4 A;  1GW3 A;  5AVV B;  1AFO A;  1IO4 A;  3OAK A;  3H6P A;  1LTJ C;  2POH A;  1LTA C;  5AVX B;  2E42 A;  3MUD A;  1RF0 C;  2YNY A;  3A3Y B;  1FZB A;  3C9I A;  2HYN A;  1ZN5 A;  1JOC A;  2W6A A;  4OH8 B;  2ZFC A;  5AW7 B;  1OXZ A;  1FZC A;  1URQ C;  5AW4 B;  2H8P D;  2N1T A;  2YKP A;  5APX A;  4JF7 A;  3RL0 D;  2YMY A;  1JY3 O;  5CCH A;  3R2P A;  1SVF A;  3P8C E;  2YO3 A;  3BAT A;  1N73 C;  1RF0 A;  4LGD E;  3LW5 H;  2PP6 A;  1X9V A;  2E43 A;  1N7S C;  3M0D C;  5CMZ A;  2FYZ A;  1URQ A;  1FZC B;  1MFZ A;  1GL2 C;  2IFM A;  1W2E A;  1RF1 B;  1JTH A;  2JJL A;  1SFC A;  1ZR2 A;  3B5N C;  2FFD C;  1MZ9 A;  3HUS A;  3M9H A;  1N73 A;  3B8E B;  5APU A;  1DX7 A;  1MV8 A;  1J1E B;  1N7S A;  2FYU K;  1SQV K;  2A45 H;  2WWW A;  3M9Q A;  2WSF H;  1JUN A;  3P8C D;  2YKQ A;  1KQL A;  3LIE A;  1FDM A;  1JTH B;  3RK2 B;  2HPC B;  1FOS F;  1SFC B;  3B5N A;  1HWT C;  3EFG A;  1JCC A;  2XU6 A;  2WSC H;  3HUS B;  4LLH A;  3U59 A;  2NPS A;  1LWU B;  3OJA B;  3VP9 A;  4Y99 C;  2KOG A;  1GZL A;  1HGZ A;  2XV5 A;  1LT9 C;  3VTP C;  2OYI A;  1DH3 A;  1NTK K;  5AW9 B;  4WY4 A;  3VMZ A;  5AW6 B;  3GHG B;  2P67 A;  5APY A;  5AW3 B;  2HOD A;  2WPS A;  3MD0 A;  2C9N Y;  3VMX A;  3SWY A;  1G1J A;  1LT9 A;  4N78 E;  3HE5 A;  2I1J A;  4KHX A;  3EQ2 A;  1GK6 A;  2KSJ A;  3RL0 B;  1NU1 K;  1ZV8 A;  2P1J A;  1M7L A;  2HLO A;  4I2L C;  2R5D A;  4C7N B;  1HBW A;  2WT7 A;  1L0L K;  1WT6 A;  2QM7 A;  3HD7 A;  3L37 A;  2Q9I A;  1N2D C;  3V4Q A;  4WB4 A;  1S9K D;  2YKO A;  1LTB C;  4HH2 A;  3RK3 B;  1CI6 A;  2KP8 A;  1ZLL A;  4AUW A;  2WZ7 A;  1AQ5 A;  5CJ4 A;  2OYH B;  1NTM K;  2IFN A;  2GM4 A;  2M3B A;  1J1D B;  1J2J B;  2FKW B;  2O1K A;  2WSE H;  3HD7 B;  2Q7C A;  3E1I A;  1N7L A;  2R5B A;  2XZR A;  1GD2 E;  3H32 B;  1L4A B;  3O8Z A;  2A45 G;  3CI9 A;  1HVV A;  4N3Y B;  1LTT C;  2J58 A;  2I1K A;  5CCH D;  2CPB A;  1JO5 A;  5APS A;  1JY3 P;  4GIF A;  3HRN A;  1H88 A;  1FZC C;  3V2R A;  1NKN A;  2N1T C;  3LID A;  1RF1 C;  3TSI A;  1URQ D;  4B86 A;  4W7Y A;  5CCH C;  5AVT B;  3N4X A;  3KQG A;  5KLV K;  1NWQ A;  2O1J A;  1J1E C;  1A02 J;  2KB7 P;  2WPQ A;  4AYC A;  4ZKP A;  1GDT A;  1FU1 A;  5AW1 B;  1GTW A;  1N7S D;  2XDJ A;  1RF1 A;  2CPS A;  2IPP A;  1SFC C;  1GL2 D;  1HUC A;  4W7Z A;  3HUS C;  1JY2 O;  1IFN A;  2BAS A;  3II6 A;  3B5N D;  4RES B;  1HJB A;  1FJK A;  5APQ A;  3M9B A;  2L5G B;  1JMM A;  1NOH A;  5BU5 A;  3V5B A;  1SP4 A;  2HPC A;  3VMY A;  5AVZ B;  5KJ7 C;  1T3J A;  3GHG C;  2HG5 D;  1LWU A;  2NPS C;  3G3Z A;  2Z5H A;  4WY4 D;  3OA7 A;  1NAF A;  5AVW B;  3MTU E;  2GUS A;  3TK1 A;  1IFJ A;  2OYI C;  1SQP K;  3NXS A;  1KIL B;  2KLV A;  5AVY B;  5KJ7 A;  1FJP A;  1H89 A;  2P7J A;  3GHG A;  4WY4 C;  4XE5 B;  1LTJ B;  5AVQ B;  3P7K A;  1RE3 C;  3BRV B;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...