3CLAA

Refined crystal structure of type iii chloramphenicol acetyltransferase at 1.75 angstroms resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
213
structure length
213
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Refined crystal structure of type III chloramphenicol acetyltransferase at 1.75 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (acyltransferase)
total genus 60
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1990-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3claA00
1Q9JA 2RKVA 3B30A 5FALA 4N72A 4G0BA 3U9BA 2II5A 4G22A 1E2OA 2II3A 2ZBAA 1XL8A 1EACA 4KECA 1PD5A 3FP0A 2JGPA 1EAEA 4HVMA 5KJVA 2XHGA 1C4TA 2BGHA 1EAAA 3FOTA 5KJTA 1XMDA 5KJSA 5FANA 1NOCB 5DU9A 5T3EA 1SCZA 1L5AA 3B2SA 1Q23A 1DPBA 3MAEA 5KJWA 2I9DA 4KE4A 5KJUA 2E1TA 2CLAA 4G2MA 1EAFA 1CLAA 2IHWA 4JN3A 3U9FA 1DPCA 4CLAA 2II4A 2VSQA 3CLAA 3L60A 1XL7A 1XMCA 1CIAA 1EADA 2XR7A 1EABA 2E1UA 2E1VA 4JN5A 5DUAA 1DPDA 2RKTA 1QCAA
chains in the Genus database with same CATH superfamily
5FALA 4G0BA 3U9BA 2ZBAA 2II3A 3FP0A 1EAEA 2FYOA 1EAAA 3FOTA 2H4TA 5FANA 5DU9A 1S5OA 4EPHA 2IHWA 4CLAA 2II4A 3L60A 1XL7A 1NDFA 2E1UA 5KJTA 4N72A 2FY4A 1T7NA 1T7QA 1EACA 2FY5A 4EYWA 2DEBA 1NOCB 1L5AA 3B2SA 1DPBA 3MAEA 4KE4A 4JN3A 1EADA 2H3UA 1EABA 4JN5A 2RKTA 1E2OA 2H3PA 1T7OA 4KECA 2FW3A 4HVMA 5KJVA 5T3EA 5KJWA 1Q6XA 2CLAA 1EAFA 1CLAA 3U9FA 2VSQA 3CLAA 1DPDA 3B30A 1XL8A 1Q9JA 2RKVA 1T1UA 2II5A 4G22A 1NDIA 2H3WA 1NM8A 1PD5A 2JGPA 2XHGA 1C4TA 2BGHA 5KJSA 1XMDA 2FY2A 1SCZA 1Q23A 2I9DA 5KJUA 2E1TA 2RCUA 1NDBA 4G2MA 2FY3A 1DPCA 1XMCA 1CIAA 2XR7A 4EP9A 2E1VA 5DUAA 1QCAA
chains in the Genus database with same CATH topology
1Q9JA 2RKVA 3B30A 5FALA 4N72A 4G0BA 3U9BA 2II5A 4G22A 1E2OA 2II3A 2ZBAA 1XL8A 1EACA 4KECA 1PD5A 3FP0A 2JGPA 1EAEA 4HVMA 5KJVA 2XHGA 1C4TA 2BGHA 1EAAA 3FOTA 5KJTA 1XMDA 5KJSA 5FANA 1NOCB 5DU9A 5T3EA 1SCZA 1L5AA 3B2SA 1Q23A 1DPBA 3MAEA 5KJWA 2I9DA 4KE4A 5KJUA 2E1TA 2CLAA 4G2MA 1EAFA 1CLAA 2IHWA 4JN3A 3U9FA 1DPCA 4CLAA 2II4A 2VSQA 3CLAA 3L60A 1XL7A 1XMCA 1CIAA 1EADA 2XR7A 1EABA 2E1UA 2E1VA 4JN5A 5DUAA 1DPDA 2RKTA 1QCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9J A;  2RKV A;  3B30 A;  5FAL A;  4N72 A;  4G0B A;  3U9B A;  2II5 A;  4G22 A;  1E2O A;  2II3 A;  2ZBA A;  1XL8 A;  1EAC A;  4KEC A;  1PD5 A;  3FP0 A;  2JGP A;  1EAE A;  4HVM A;  5KJV A;  2XHG A;  1C4T A;  2BGH A;  1EAA A;  3FOT A;  5KJT A;  1XMD A;  5KJS A;  5FAN A;  1NOC B;  5DU9 A;  5T3E A;  1SCZ A;  1L5A A;  3B2S A;  1Q23 A;  1DPB A;  3MAE A;  5KJW A;  2I9D A;  4KE4 A;  5KJU A;  2E1T A;  2CLA A;  4G2M A;  1EAF A;  1CLA A;  2IHW A;  4JN3 A;  3U9F A;  1DPC A;  4CLA A;  2II4 A;  2VSQ A;  3CLA A;  3L60 A;  1XL7 A;  1XMC A;  1CIA A;  1EAD A;  2XR7 A;  1EAB A;  2E1U A;  2E1V A;  4JN5 A;  5DUA A;  1DPD A;  2RKT A;  1QCA A; 
#chains in the Genus database with same CATH topology
 5FAL A;  4G0B A;  3U9B A;  2ZBA A;  2II3 A;  3FP0 A;  1EAE A;  2FYO A;  1EAA A;  3FOT A;  2H4T A;  5FAN A;  5DU9 A;  1S5O A;  4EPH A;  2IHW A;  4CLA A;  2II4 A;  3L60 A;  1XL7 A;  1NDF A;  2E1U A;  5KJT A;  4N72 A;  2FY4 A;  1T7N A;  1T7Q A;  1EAC A;  2FY5 A;  4EYW A;  2DEB A;  1NOC B;  1L5A A;  3B2S A;  1DPB A;  3MAE A;  4KE4 A;  4JN3 A;  1EAD A;  2H3U A;  1EAB A;  4JN5 A;  2RKT A;  1E2O A;  2H3P A;  1T7O A;  4KEC A;  2FW3 A;  4HVM A;  5KJV A;  5T3E A;  5KJW A;  1Q6X A;  2CLA A;  1EAF A;  1CLA A;  3U9F A;  2VSQ A;  3CLA A;  1DPD A;  3B30 A;  1XL8 A;  1Q9J A;  2RKV A;  1T1U A;  2II5 A;  4G22 A;  1NDI A;  2H3W A;  1NM8 A;  1PD5 A;  2JGP A;  2XHG A;  1C4T A;  2BGH A;  5KJS A;  1XMD A;  2FY2 A;  1SCZ A;  1Q23 A;  2I9D A;  5KJU A;  2E1T A;  2RCU A;  1NDB A;  4G2M A;  2FY3 A;  1DPC A;  1XMC A;  1CIA A;  2XR7 A;  4EP9 A;  2E1V A;  5DUA A;  1QCA A; 
#chains in the Genus database with same CATH homology
 1Q9J A;  2RKV A;  3B30 A;  5FAL A;  4N72 A;  4G0B A;  3U9B A;  2II5 A;  4G22 A;  1E2O A;  2II3 A;  2ZBA A;  1XL8 A;  1EAC A;  4KEC A;  1PD5 A;  3FP0 A;  2JGP A;  1EAE A;  4HVM A;  5KJV A;  2XHG A;  1C4T A;  2BGH A;  1EAA A;  3FOT A;  5KJT A;  1XMD A;  5KJS A;  5FAN A;  1NOC B;  5DU9 A;  5T3E A;  1SCZ A;  1L5A A;  3B2S A;  1Q23 A;  1DPB A;  3MAE A;  5KJW A;  2I9D A;  4KE4 A;  5KJU A;  2E1T A;  2CLA A;  4G2M A;  1EAF A;  1CLA A;  2IHW A;  4JN3 A;  3U9F A;  1DPC A;  4CLA A;  2II4 A;  2VSQ A;  3CLA A;  3L60 A;  1XL7 A;  1XMC A;  1CIA A;  1EAD A;  2XR7 A;  1EAB A;  2E1U A;  2E1V A;  4JN5 A;  5DUA A;  1DPD A;  2RKT A;  1QCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...