3CLEH

Hiv neutralizing monoclonal antibody yz23
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
b'QAQLQESGAELVRPGASVKMSCKASGYRFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARGRLSLGFDYWGQGSTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title HIV neutralizing monoclonal antibody YZ23
rcsb
molecule tags Immune system
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cleH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cleH02
2CJUH 3GSUA 2X1XR 1T83A 3GRWH 4UNUA 3O6FA 4KUZL 5I15L 3WIHH 1YDPB 4HWEL 4P2QB 2A9ML 3TBWB 2DF3A 1YNKL 1LE5B 5FYKL 3T3ME 4M62H 3G5YB 4QCIB 4U1SA 4YZFF 4U7KA 3WLWD 4M1DH 5FXCH 1T7WA 3HR5B 2JB5L 4UU9A 4H5SA 4PGEA 1BHGA 1UVQB 2NY5L 2YPLB 5FGSA 1B0GA 1DUZA 2M1KA 3BAEH 2R15A 1U58B 4Y16C 3CCHB 2NY4C 3B3IA 3QJHB 2E7LA 5CCKH 5T33L 1BGXL 2NY7L 3O45B 2OSLA 4YHOH 1NQBA 5JDSA 5A16B 3MV7B 4I0CC 3FT3B 2I9TB 3ULVC 1N3NB 2VYRE 3I02A 4P3DA 5T3XE 1MUJA 1BVLA 2PXYA 2Y7QB 4ZFOB 3NACL 4PREA 3O0RH 1QSFB 4X6CA 5DI8A 1DBKL 1J0ZA 1CTNA 2R4RH 3IU3B 2D3VA 4PV8A 4RQQA 4X6BB 2KQNA 2X4OB 2WBJD 3SCMD 3HCVB 4OIBA 4QHNB 3TJHD 4BQ8A 1N2RB 3FN0L 3KJ4C 3MRLB 5DUPL 4AEIL 1MHPH 2J8UB 5BZDA 4JKKA 3KJ4B 4F57L 3V5KA 1ONQA 4APQC 2Y5EA 1MWAA 5HDBE 3VRLE 4L3ED 4O02L 1LO5A 1VESA 1BQLL 4LSSH 3U6RB 1S9WB 1EJ6A 3PUCA 2ICWA 3GKWL 4RFOL 5E9DE 5F9OL 1Q9KB 4F9PC 4MXWL 4YHYB 1R3IH 5TE7L 5KBNC 2B5IB 4GSDL 4RGNB 4U1IA 1YEEL 4JFPB 3DO7A 3K2UL 2NTFB 1YEDA 4K9EL 3HUJF 2DKSA 3P9LB 5C0AD 2E9IA 1JYXA 4M8VA 5GRVK 2HFFB 4C57C 3AGVA 3RY5A 1FCGA 1CXLA 4ZD3L 3H3BC 1HINH 5ADPH 2AV1B 4PJFB 5AZ2L 3TBSA 3BH8B 2HRPL 3RIFK 4LKCA 2HJFA 5EO9A 3EYUL 1VFUA 4L4TA 4W70A 3L5HA 1RZFL 3QB7C 3STBA 5KSBA 1GIGL 2X70B 4GW5A 4NZTH 3BSZL 4NC2B 3K1KC 3QJFB 4I18C 3WXWH 2CO6B 2XQYG 4WI4A 4WW2B 5JW5A 5HVWA 4HG4J 2D7QA 5IP4A 3LDBB 4Z0BL 1I9RL 1GYAA 1WBYB 5HTSA 5FFLA 1RUQL 1QNZL 4G43A 4JKLA 4NQXB 4TULH 5DK3A 3KYOB 3TZVC 4PJ7E 5CP3A 3QIUA 2YK1L 4MHHI 3VI3F 3PQYD 2HN7B 4WEBH 5KG9B 3WN5C 2VDOL 3JZ7A 4G8GA 4YHMH 1QBLH 4YBHA 2AJYH 4DGYL 1QEWA 3WYRA 5CGYD 1AHWC 3SE9H 5F6IC 5M95B 4XNXH 3ORJA 3ARBC 3SBWC 3VFRA 4H1LA 1IGCL 5F6IB 3QQ3B 4Z7UB 5DHVB 4R2GC 1CFQA 1YECL 3ARBB 1UZ8A 5IEKB 3HAEH 3VMPA 4JFZL 3JV5A 3KXFA 4IJ3C 4R2GB 1NDMB 2EYRB 1RK0B 1Q9LB 3H3PH 4LP5A 1HXYB 1U3YA 3IDJB 4IJ3B 1SM3L 5LGJB 4UT7L 3BYYA 3IJYB 2RQ8A 5JR1H 5L2KB 4IDJL 1CG9A 5HHQA 2HLAB 2R8SL 4B5EA 4Z76B 2IFFL 4U4BA 2YC1A 3MRQB 2XZCL 1SEQH 1I7RB 4RMTA 4DOHB 4HUUB 1LK3L 4QXUH 4EXKA 3TBYA 1U92B 4NRZB 4XAKE 1LILA 4OI8A 4KWUA 4PYGA 2DQIL 2FJGB 4N5UA 1H8NA 3OTTA 3D85A 1ADQL 1MFEH 4JRXA 3GBLA 4KDTA 1A21A 4PJ8D 3RVVD 3PWPA 4PY7B 4X7TB 1I1CA 5D7KE 1CVSC 5DJ8A 3IFNL 3GSVB 3VA2C 1R5VA 1R24B 1WISA 4P5TC 3KNBB 4TSBL 3E6FB 4HW6A 3U4EB 1KIRB 3N1MC 4XMKH 1DLHA 3WDJA 3T3PF 1RU9H 1T0NB 4WY7H 1OGAB 2IF7A 4I2XA 1LEKA 1P7HL 2ADJA 4GQPH 1QRNE 2Q6WA 4QHMB 4F7MA 4DTGL 3NCJH 2AK4E 3RDTA 4G5ZL 1G7HB 1RZGA 3LQZA 5GS0C 3C09C 1T3FA 1BFVL 4HLZH 3MREB 5IMMA 5FIEA 3N1PC 4CMMA 3DROA 3NFNA 4NKOB 1T66C 4Z7WB 4K3EL 2JK5A 3D2UB 1NCUA 2AJ3B 4ODHH 3DSFL 1RZJH 5ESQA 5IGXH 1XCTB 5MEOB 1P4IL 2NX5E 3CSYA 4KTYA 1PYWA 4Y8DC 4YE4H 2DMCA 2G2RA 5IQ9A 1JNJA 1P6AB 1ACZA 1ZHNA 1KPRA 3RIAK 4PRNB 4WEMB 4XVTH 1CICA 1R3LB 1I75A 1EBPA 3OKYA 3BI9X 2VOTA 4R4FH 2XNAA 4YXKH 4MA7L 2YA2A 1S7QB 2B7DT 2FH6A 1INDL 4LRNL 2R1XA 3MACH 2RFXA 4GMTL 4L9LC 5F1OB 2EZ0D 3V4PH 3GHEH 1G9EA 2IFGA 1B0RA 1DQDH 1WEJH 5L88L 3HE7C 2HFGL 1JF1B 1ZAGA 4TNWK 3GO1L 3VXTB 2XTJC 1W0VA 1IAII 4FABH 2I9LB 2HTKC 3RFZC 2XTJB 4PJGA 4Y4KA 4U2YA 5DJAB 2J88H 1A7NH 2JTDA 3U79A 5HGHB 1U2CA 3ZT5A 1A1OA 2EDBA 5EIQA 4I3GA 4XNQB 5CIPH 2PYFB 5DD5L 3MLSH 4JM2A 3TFKD 3S35L 5T3XH 1A6VL 1KTRL 3LD8C 1QHOA 3AXLB 1IAIL 4U05A 1UXSB 4ZS7H 1MRDH 3LD8B 5EO1B 1A8JH 4NWTH 4LPVA 1MFDH 1JGVH 4PRIA 2SEBA 2MHAA 4DFIA 1NEZG 5F70A 2LABA 4HIEA 4M9PA 4D3CL 4UMGA 2DMKA 4LSTH 1H5BA 4P4KA 3CH1A 3SGKA 4DGVL 1K85A 1FC2D 4FQ1H 1GVIA 4MDJA 4XPTH 3UZQA 8CGTA 1CTOA 5IKCA 3TJEH 1FNSH 1I85A 4KMQA 4TSAH 1UYWH 1OWWA 5C0BE 2Q3AA 4DN4H 3BD3A 4OCSL 1UJ3A 2X09A 2ZOKB 3RKDC 3G5VB 3ZKSD 5GSRB 3J7HA 3QHFL 3MRRA 4U1GC 4M61A 1IILE 4Z7VF 3ALWA 2PTTA 1YEJH 1G9NC 4GAGH 4U1GB 2VQ1A 5B22A 1PQZA 1XGPB 1YY9D 3VH8G 1FJ1B 1Z5LB 3MV9D 4NBYB 5IR1B 3CZFB 2YN5A 1A0QL 2Q8BL 1CR9L 1EHLL 4MCYB 1DBJL 3T0VA 4PTUA 2VTFA 5CKAA 2NW2A 5E9DB 4FXGA 4YHPB 5DD6B 1FNFA 3WD5L 3VH8B 3QUMH 2IMNA 5C3TA 5F71A 1QPXA 4JFOB 4IOIA 1WUNT 3PL6A 4RIRB 1XMWA 3ARGC 4P2RA 4F8TA 5E6ID 4H8WC 3VWKD 4BK5A 3Q3GB 4H0HB 4RISL 2ED9A 1JJUA 3ARGB 4UIKL 3BEVA 3GMNB 3PG2A 3C60A 4CNIB 5LQBL 5FCUL 3AROA 3MNZA 5ITBH 2XTLA 5JA9A 2HJKA 4LCUB 4BH7B 4MJID 1RURH 4B50A 3VWJC 4K7FA 4BKLB 3C5ZC 4DEPB 4JO4L 3TLRA 3S36L 1S5HB 2FHFA 3C5ZB 4KKLC 4MAUL 4RMQA 1X5LA 3KJ6L 5HPMB 4RDQF 4NIKB 1TZIA 1JBJA 4E41D 3PHOB 4KK5D 1VGEL 1D5XA 4YUEL 2CGRL 3MPCA 1BZ9A 1N8ZA 1KCUH 3GMOB 2BC4A 5IM7A 2E8YA 1NCAH 1A7QL 3STLB 4YX2H 4YDLC 4XP5L 3REWA 1DJSA 4NFCA 5J6GB 4JFQB 1U3JA 1T1WB 2DQCH 4PJ7B 3MUHL 4JPIB 4XNZC 3RVXD 2OQJB 4PBVC 4JKWA 3N85H 5IFHL 2H8PA 2OR7A 1A6UH 2YRPA 4OUUA 4AEHH 4XNZB 3I3BA 4XNMB 1F4YL 5E2WH 4M5ZH 2BXYA 2Y36L 4EI5D 1QSED 2Y5TB 1IAKB 1CGTA 4OGXH 4OFKA 4OD2A 3O41B 4JR9L 1XCQA 3LPGA 1BJ1H 1OARH 3JBG7 4H26B 2VDML 5TE4L 2IPTL 5HI5C 3EJZC 3DUUB 4TTGA 5CSZB 4PV9B 2DBLH 2FIRT 4EDXA 2WANA 3R1GH 4KGJA 4X5WA 4HFWB 4UQ2A 5EIIB 1DBAH 5CJ8A 5TQ2H 3QEUB 4Z7NE 5A2FA 5HYEA 5DJZB 3MLXL 4FQ2H 5E2VL 4MWFA 3LS4L 5DVKA 4HIXH 2AEPL 4J8RB 3Q6GL 2BSRA 4HS8H 1U8JA 5E2TL 4YFDB 2VLJE 4JDTH 2P8LA 4GRWH 1U8KA 4L29A 1SEBA 2DLFL 3EYOA 2VN4A 2WBJA 1IFHH 3SCMA 4JFDB 4N0CD 4LSUL 1LP9E 2OMBA 4R4ND 3VW3L 1AE6H 2IG2L 3LIZH 4YGVB 3G6DH 4OLYL 2NY4D 5CZXD 3WUZA 2V7NA 4FRWA 4L3EA 2M2DA 3TIEA 5J11C 3OB0K 3DURA 4CVUA 3MBEC 3G04B 3O4LE 4GLRI 1ZANL 2Z8VC 4NZRL 1IAOB 3E6HA 3MBEB 3ULVD 3P9MB 1ZE3C 5I66B 1M05B 2GAZA 3FT4A 1FZOB 3GMMA 3CUPB 3CAFA 5D7IA 1QRNB 4JPKL 1K8IA 1FGVH 5C0AA 1IC7L 1QA9A 1KEML 2AK4B 5E6ZA 5C92A 5FDWA 2EDQA 3OX8B 1TVHB 1IGFH 4YWGH 4NNYB 1T22A 2OR9L 3CLFL 43CAB 1LDSA 3U0PB 2NX5B 4F2MA 4QHKI 4RMUA 2EDDA 5IVXF 1A4JB 3PGDB 2W65B 4APQD 5EZIL 5HXMA 5A2LH 5IQ7L 1U6AL 1UM5L 4TVPD 3U36A 4GOSA 4XRCB 1T2XA 5CP7B 2MOVA 1XT5A 1KJ3H 4X80H 4UTBL 3OXRA 3OF6D 2YD1A 1A9EB 4ZOAA 1RVFH 3D69B 4LQFH 5GGSY 4JY6A 4I77H 3BKML 5F88B 2DQGH 5DF0A 4JPWL 1J87A 2K7PA 5CSGA 3PQYA 3L5IA 4A2MA 4FQLH 5CAYB 4JFED 1S7WB 4AIZB 2QLVB 2EH8H 3SEPA 3ULUE 3DMMC 4HWBA 4R96B 2AJUL 4I9WE 4K3HA 3MBXL 5EBWB 1IM3A 5F1SA 3DMMB 3MNVB 3B5GA 4W4OC 4P59L 4WHTB 4WU5A 1OTUD 4NO3A 3MUGA 1MCKA 5DRXB 3EO1B 2CH8A 1YN7A 4QNPF 1QYGL 2YBRA 1GOGA 1JRHH 1AGCB 2HFEA 4KJWC 4MDIA 4LCWA 3FONB 2R1YA 3JWOH 4LCCA 4NO2A 2Y23A 4PRPE 1TETH 3CU1A 3PWUB 4HXBH 5KSUB 4OZFH 3ZKQD 2FX9H 3R4DA 4DQOL 1P2CB 3NPSC 5FYKU 3MXWL 4LPTA 1IZKA 1JN6A 5CEZL 4HF5H 3MOBH 1MEXL 3OGCB 5ALCL 3NPSB 3QXAA 1MPAL 3IXTB 2X05A 4WFHE 1PG7W 1GOHA 1JWMA 2JF1A 4U0RC 5ADOH 2KL6A 1MH5A 3HNTH 1BM3L 4UV7L 4ZXBD 4HDIB 4YK4C 2VZTA 4HMDA 4U0RB 3O3BA 4A6YL 1TVDA 4YK4B 1CL7H 5FO9A 5JO5A 15C8H 2EIEA 4QRQA 4Y2DC 4ZUTB 4HBCL 4PJ8A 3WFEL 2A6KB 4ZO7A 4O2EB 3HI5L 1F4WH 3HRZA 3VD9A 4KRPD 1YNLH 4ZOEA 2F5BH 3MRBB 3WJJA 5F7UA 4C4KO 4PRAA 2P7TB 3EIFA 1RUMH 2ZUTA 1BAFH 3WFCH 1FZJA 4CW1A 2QSCH 1AGBA 3UBXG 5EZLA 1G7IB 1UB5A 2ED7A 4CKVX 4F7TB 1T2QH 3MFFA 4PJ9D 5T3ZD 2VQUA 5CEXB 3QRFM 3MGAA 5T5FL 5E2UH 5J7CC 4HC1L 3JUYA 2PO6D 3IS1X 4V1DE 3IDNB 3OR7B 3UBXB 1C5DB 3OSKA 1IJ9A 4NM4H 4Q9RL 3VXMD 3NABH 4A2LA 3EDFA 4I4WB 2MCPL 2N1KA 3X13A 3D18B 3GIVA 2CMRL 1X7QA 5T5NG 3HMXH 3LRGA 3C87A 3ZYZA 5MP6L 4P9HH 5HYQB 3ILPA 3GHBH 4LLYB 1E6JL 3KS0H 4P5TD 4LSDA 4DGIH 4KJQC 5FHAH 3T4AB 1BZ7A 5JMRA 2YR3A 1MI5D 1J0HA 3DECA 2O93L 1GAFH 5DJDA 3F7RA 1U42A 4P2OD 3QISA 1YC8A 4R97C 4WFEE 4R97B 1NANI 1FYTD 3NAAH 2ZUVA 3BP7A 7FABL 4ZO6A 3WFZA 4JKMA 4XPFL 4OD1H 3QIBD 3AVEA 2CRIA 2V2XB 4ZDHA 2NQCA 3LS5L 5D5ME 1XF2B 3LHPH 5TH2A 1Q9OB 2Q7YB 5AD0B 3RNKA 1S9XB 4YFLF 4M62L 3PWVB 2QKIA 1BVKB 1YEFL 3SE4C 3MLRH 4NZUH 4PJXF 3GSXA 3LKPB 4H25B 4LKXB 2APFA 4JN2A 5C2UB 1OP5H 4I3SL 2NY6D 4Y4HD 4ZFOL 4U1HA 2OLDA 3PWNB 3CFCL 1A14H 5ICXB 3VFVA 4TUKL 3HZYB 1GPOL 4Z0XA 2DQFA 4PJEE 4PGCA 5IJKA 4S2SA 5CCKL 3D39E 5H35A 3QZWA 3GM8A 2OTUA 1NAMA 3B5HA 5ELIA 3PV6B 3O4OC 2VLJB 2VXVH 1JZ6A 4XPHL 5F7DB 2FBOJ 3C6SA 4X6DA 1SY6A 4CN1A 1F6LL 1KIUA 2GSIB 1IC5L 4KK8C 5F7EH 4KDVA 2ZUUA 2WLZA 1LP9B 1P6FA 5EA0H 1A7OH 4N8PA 2ATPB 1X5ZA 5D7LD 1RZ8B 1HXMB 1ORQA 3MV9A 3V6ZA 5I8EA 1GGCL 2WWMC 1T04A 3WS3A 1WIUA 1HEZB 3RGHA 4XAWH 3FFCE 2ADIA 2EYSB 2DICA 3RHWF 3MV8E 1DSFH 4OCWH 4CU7A 4JRYE 2NY3D 2C3WA 3O4LB 5CJXA 4N8CL 3VXNA 1J1PH 3HZKA 3HG1D 1KLGA 1V5JA 5EOQH 1LWRA 4JZNA 2VDRH 4LSSL 5BS0E 4Q74A 3NZ8B 4DZBA 4GRMB 1OP5K 1SJHB 1MFAH 2NNAB 1WAAE 3TP4A 3GSNA 2CPCA 1VFBA 3QCVL 5E6IA 3VWKA 1EVTC 5ITFA 1P1ZB 3SQOL 4LEXH 1NLDH 4WHYH 1TMCB 4EUPH 4NNPL 4YC2C 2AEQL 2JELH 1HINL 4MJIA 5IB5B 3UTOA 4KVCL 3ULUH 2J1KA 4YC2B 1WFOA 3DRTA 1AXSA 5JW4Q 3ZE1E 3F12A 4YHKL 3HC4L 4WHDA 5TF1H 4JKPH 2OL3B 1T7ZA 3MJ7A 4LSVH 4RAVA 3L3IA 5ALBL 2GSGB 4KRLB 4E41A 4EI6A 3FOLB 1JI2A 5C0FB 1FBIH 1MVUA 4QRUB 3HZMA 4AIXA 2R4SL 1U8HB 5D1XD 1YPZF 3TIDB 4EUPB 3IAGC 2XWJB 4JG0L 5DR5H 2DIAA 1HILA 2ZZUT 5BV7H 2A6DA 1DQML 4XBGA 1CIUA 4V2CB 4L5FH 2BHYA 1KTDA 1FLRL 4PJBE 1GHFL 1J11A 3DVNB 4P5MA 1NCBH 3ULSA 1HQRA 2KPNA 4CJ1A 4EI5A 1QSEA 4RAUA 3UEZA 4DN3H 3OAUH 4AM0B 1A3RH 2XZQH 2FO4B 1FCCA 4Q6IA 3VWJD 4MLSA 2WAHA 1RUKH 4PJAA 2ZG1A 1BLNA 3MLUL 1NEUA 4G8IB 2CIKB 3SO3B 4KKLD 4POZC 2P44B 1WWAX 4BELD 2X89D 5ICZB 4Y0GA 3LRSB 4HV8A 3PWJB 4PRPB 3UTPE 3TA3C 5I1DB 2E6PA 4U1NB 3QNYA 1RIHH 5BV7B 1TVBB 3L7EA 3HI1B 5IB3A 1FL5B 1FE8H 4OB5L 1UACL 1OAQH 3G5ZA 4PJCF 5GRJH 1R5IB 3VXRA 3DV4B 1EVUA 1U93A 5J3HC 4M7JL 5DC0A 2FR4A 1U3HB 2Q7NA 3LQAC 2ZCLH 4ZUUB 3VGDA 5SV3A 1IGYA 3HC3L 5C0RL 2E7MA 4I0PC 3LKNA 4JY4A 1QLFB 1EMTL 4D2NA 4Y19D 4E0RA 4I0PB 2Q86B 5DYOB 2IADB 1RFDL 2NMSA 4ORZC 3SJVD 4M8QA 3W5MA 3EJZD 3HZVB 4LLAA 3C2SA 3CVHB 3OB8A 4HS6A 4EQ3A 4YDIH 2Z8WC 1EAPB 1HOCB 1E28B 1BQHA 5GS0L 4KQ4H 4IS6A 3FQUB 3V6OC 5EUKA 2BY1A 1OP9A 3ZTNH 3FB5A 1U8PA 1MJ8H 5LAXA 4ZPTA 3INUH 1KTLB 3OPZL 1FIEA 3EW3B 4V1DB 2NY1D 2PUQT 5CLTA 5DRZB 3THMH 3SDXE 4LRIC 3GGWA 2BVEA 3DBXB 1N0LA 5IB2A 1UWGH 5FKAB 1KIQA 3JV4A 2AAVA 1Y18B 1HWGB 1F02I 3GBML 4APQA 5JPNA 1S7VA 2EDOA 4TQEH 5I1CH 3QDAA 4H88L 4Y5VB 3BDYH 1NBYB 3T0DA 1UM4H 3TH2T 4OM1H 3HFMH 1XGTA 2BVOA 2FSEA 2KBGA 4X8XA 3BKYH 4XGZB 5DJ2A 5EUOA 2G60L 4ZTPL 5IFAH 3OF6A 1BFOB 3TYFB 2CK0H 2C5DC 1TCMA 5I1AA 4WO4D 3W9DB 1DN2A 2QEJA 5GS1A 3FQRB 4D0BA 2GUOB 4UIMB 4JFEA 2W38A 5INCB 1XR8B 1DQDL 3G6AA 1K2DA 4G7YH 1EJOH 5FYLE 4OF6A 2HG5B 3TGXA 3VA6A 3WFBH 3BRGC 4JFHD 5I30H 3P4LA 2QQKH 2Z8SA 3VDAA 3C08L 2E27L 5IW1A 3MRNA 1FN4A 5CJOL 5C6PB 4X99A 3MNWA 4LAQL 3FRPG 5D5MB 1A7NL 1J8HE 1VEPA 1NGYB 5CLWA 2A77H 1HE7A 5L6YH 5I17B 1T03L 1OCWL 1FORL 4P46D 1CZ8L 1HHIA 2BNQE 2ILLA 4D9QD 3RWEB 1KOAA 2N7AA 1HI6A 1WCQA 3VI4E 5DRWA 3WL9B 1MHEA 5GISL 4Y4FD 3GMLB 4U1MA 4LMQI 3LEVH 3OJVC 4QEGA 4F8QA 4PJEB 4ZXBA 4QT5A 5T1KA 5JA8B 1ZT4B 1CGYA 2FATL 4FQ1L 1G9NL 1CE1H 1AHWA 1NC4B 1WZLA 3H0TA 2HT2C 3VFPA 1EDQA 3K8LA 4LK4A 2R0LH 4URTB 2OZ4H 5HI4C 5CILH 1K4CA 1FGNH 2NY0C 4JFFE 3MO1A 4G8EA 2HKHH 5C0NC 3MR9B 2ZSWA 3LV3B 1YMHB 2H32B 2NY0B 2V5SA 2ZG3A 4ALAL 2CKNA 4O51B 1MQ8A 5IBLD 4U1LA 4CADB 5C0EA 2GK0A 3N50A 1PEZA 1XF4B 2E7HA 3Q6FA 2W0PA 2NYYC 4PJ9A 4YLQT 3D3VD 4R7NA 3Q0HA 2VH5H 3FFCB 3OHXB 5E4EC 5CGMA 4HWZA 4IIQC 3MV8B 3ECBB 3N0PB 4IRZH 4LGRB 4JRYB 1KUMA 5E4EB 3JTTB 3TT1L 4H8WL 2PO6A 4IIQB 1OW0C 4ELMF 5CSBA 2DIBA 5DMJB 2H1PH 5SWSD 3KPRE 2CLVB 3VXMA 5C08D 4KK6D 4Y1AD 1IGJA 1PG7L 3MUY1 3DVGA 1I9IH 5TDNB 5F1NB 3H9HA 4EDWH 2B8OT 1X9QA 1GC1C 1W8NA 5ESVB 1HHJA 2R0ZL 1C16A 3AFLA 4N8VG 3H7BB 5JXEC 4NQSB 2XKSA 4JB9L 1X5YA 1NLBH 5EU3A 1I1FA 4TUJA 4P5TA 1VPOH 3EBAA 1NBVL 2VJXA 1JPTH 2YWZA 1H3WM 5IMOB 1MI5A 4FP8L 3CLEL 3BGMA 4UDUB 3TO2A 3QI9B 4FNLL 1KG0A 1BD2D 2BVYA 4MX7A 1A2YB 1WTGT 4OLVL 4P2OA 4N8VB 5KVEL 2NXYC 2C4XA 5DWUH 1SJVA 2IH3A 2AEWA 5IHUH 4F33B 1IQWL 4TUOA 3GNML 4GQ9H 1XEDA 2NXYB 3CFDA 4FFWD 4XWGH 4HK3N 4N9GB 3X12B 4N90E 3S5LA 5B39A 1JNNL 2YEZB 4NM8H 2BVUA 3N1QC 3RWGB 1FYTA 4IMKA 3PGFH 4I48A 2Z91B 3QDJD 4ZFGH 3QDME 5D2NE 2PN5A 5KSVA 1N5AB 3QIBA 4FFVC 2JCCF 3BP6B 4Q7DA 3WV0A 5E8EB 3DVFA 4PJBB 1RJLA 2DWDB 4G80B 4NJAH 1CN4A 1A9BA 3TC9A 1ZA6A 3U4AA 5I19H 2PYED 2EIDA 5CEYB 5DDHB 4P3CH 1DP0A 1LO0L 4Y4HA 3MJ8A 2VZ1A 2BVQA 1WVZA 5AUMA 3QNZB 5E24E 3HI6H 1ZSDA 4HUXA 5DA0B 1BECA 4WI7A 5C0CD 3MCG1 4L9DA 1ORSB 4M93B 3SKOB 3RWCA 5KSAB 4LHUD 1KCVL 35C8L 4MAYC 5FUOH 2PCPA 3X3FH 1YEGH 1G6RH 3RVTD 5HYSA 4KMTH 1X5FA 3L5JA 5DJ6B 5EO0A 2D0FA 4D0DA 5KVFL 5JIKA 2H3NB 3AREB 4FZEH 3OZ9L 5TDPA 5FYJD 3D1MC 2Y6SC 1OAYL 4DKDC 1RJZB 4NUJB 1T1ZB 3GI9L 1HNGA 2OJZH 5D7LA 1EEQA 3T0ED 1JMXA 1IFHL 1HQ4B 5J1AA 3V8CA 1RULH 3ESUF 3HLAA 4Z7OF 1L6ZA 3JSSA 5C07D 3KS0J 5HHVL 1AE6L 4PJHA 1CE6A 2OJEA 3BT2H 3UTTD 4ONHB 3S88L 4M48L 3NVQA 3NFPB 4Z18A 1WQVT 4LAJH 3HG1A 4AK1A 3V7AE 2O5YH 3QG7L 3DPBA 1FZMB 1G7QB 3ET9F 1T7VA 2QADD 3NTCL 4QTHB 3VGFA 3KYMA 3FHQA 1PD6A 1WK0A 4WI3A 1IKNA 1BX2B 3I50H 3K80A 1G6VK 2AKRA 5DTFB 3MRFA 1CDHA 3MRDA 3SDXB 4X9FA 1CI5A 4QHUB 3SDCB 3EFFB 1D5BB 4Y5YB 5BRZD 4LCYB 4XPBH 4CVZB 3E2HC 3IDUA 4QXWA 4Y5XA 5B21A 3OKNA 4MA8L 3TO4C 3E2HB 4PP2A 5E95B 4NQCD 1U3ZA 1PSKL 1M7DA 3O9WD 4XVUD 1RZIB 5IB4A 3NH7L 1HCVA 1T0PB 3NN8A 25C8H 5CBEA 1N5YL 4J3WA 4KVNL 3ZHDA 3T77A 2A9NL 3CXDH 8FABA 4P0DA 4QNPE 3O2DH 1GGIH 3EOTL 2Y4SA 2GTZA 2PR4H 2X7LA 3GI8H 2VDPH 2DAVA 2IPKA 1NFDF 1ED3A 2F53E 5D1XA 3GMPA 5D70L 2AJZA 3UDWA 4OZIF 3H2WA 4G42A 4XWOC 1KB5B 2F58H 2JJTC 3N1GC 3MCLH 1R5WB 4BFEA 3KPQA 3U0WL 3L9RB 1CDCA 5GRUL 3EGSA 1DQJB 1OM3L 5HHXH 3RL1A 2I60H 4HK0B 4BZYA 1JRHI 2AJSL 5I75B 1KBGL 3QWOB 5HHOD 1NBZA 2NW3A 3BISA 1YN6A 2B4CC 1J8HB 3BKJH 5IF0A 2X89A 5DMYA 5C09D 2VERN 3A6CL 3RGVC 1MHHA 4U6HB 4XMLH 3FFDA 1NGWA 2XPGB 3R06B 2X4QB 3UJIL 4RNRA 3T04D 3TT3L 3LH2H 4LPUA 1MCIA 1JHTA 1D5IL 4QRRD 3WXVL 1NKRA 4N1HB 2QSVA 5E7BA 2YPKA 5IB1A 3RY6C 3EO0A 3WDIA 1ZT1B 4U6XA 2DM4A 1LE9B 2W9DH 4PFEA 4WGVB 1NMAH 4X4ZA 3BE1L 3STZA 3DUHA 2M26A 1JHKL 1U9KA 3UBXI 5JOEA 1FO0B 3OKEB 2VZOA 1DANT 4XVSH 1FVCA 4XCCH 5JOFA 2DS4A 4Y19A 4F7EA 4YXHH 5JHLL 4X4YB 3PHQA 1V3KA 3WHE1 2I27N 3B2VH 3TBTA 5E00B 3F7VB 4ZFZB 4LFHD 1U8QA 3HC0B 3O11A 1W0WB 1KCRL 3MODL 1ZEAH 4BSWA 5L8LB 4XTRD 4FQXD 1YMMA 1KC5L 1EBAA 3JWDC 2D31B 3H7LA 2E6QA 4HKBA 2ZSVA 4QTIL 3L95B 1Q72H 3LAFA 1AO7D 4ODUA 3IAPA 4K2UH 1VACB 5CJQH 1BREA 3HMWH 5J3HD 4MD5B 4MCZB 5JNYB 3BX7C 2H6PA 4G6ML 4X6CE 4QO1A 4RMVA 4NQED 1JK8B 1H15A 1J1OL 2VLLA 3KPRB 1H0DB 3SY0A 4HKXB 2FLBT 4GG6F 1NL0L 4NYLA 3IFOB 4KGLA 1P53A 4BFGA 4FQQB 5KW9H 5GZOC 1EO5A 4QRPD 4FMFA 2ITDB 3W82A 1U8IA 3MCKB 5MENA 2DMBA 4NO5B 4NNXB 3MJ9L 4U6VH 1IGML 1KF9B 2AP2A 2WIMA 1B90A 1J0IA 3OKMB 1NCWL 3VD5A 3I6LE 5KJRH 1KIPB 1DQTA 4Z5RA 4HKJB 2O61A 1CLCA 2GYSA 1WJ3A 2I5YH 3DTXB 4OQTH 3RA7H 2I24N 2CK2A 4WO4A 2C1OA 1BEYL 4IRSD 4YHNA 1YYML 4PB0H 1XGYL 3PIQB 2FL5B 2BVPA 3BZEA 3NA9L 3TNMB 1C08A 6FABH 2H45A 1LK2B 2JB6A 2R1WA 1WCBA 5D2NC 1AGDA 5H37G 5C9JA 2FD6L 5E99L 3QDMB 4N0UE 5D2NB 1UA6L 3VXSB 1M7IA 2AABL 5IESL 2CQVA 2MWCA 2XA8H 1EO7A 4HKZB 4YO0B 1JMZA 1YA5A 3E3QC 4PGDB 4FZ8L 5IMKA 5B38G 3RVUD 1A1NB 1U8NB 4MNQD 5FGBA 1YEIH 1KPVA 1NFIA 3W39A 5I8KH 3FZUD 2EDJA 1KN4L 5DLMH 5E94A 2DI8A 2VLRE 5F89B 1N4XL 5C1MB 3LSOB 4P46A 4HUVA 3LKOB 4JPVH 4UDTB 3QCUH 4RCAA 5I8OL 4POYA 3WFHB 3U2SB 4NDMB 5EPMB 5B38B 5H8DA 3ZKND 4M4PA 4Y4FA 3MUJA 1KN2L 2X4UB 4LLWB 4WI5A 2A74A 2K7QA 4W6YB 1H3TA 3MA9L 3IKCA 3KPSD 2IALB 1A7RL 4PJ5E 3VRIB 5F3BA 3WJLC 3W11C 4WTWA 1AFVH 1IVLA 4W4OA 1DVFC 3MRHA 4G6KL 4NSKA 1A6WL 4KK9D 2Z93B 3DARA 5FUCC 5C2BH 1DVFB 2OTPA 4E5XA 1KGCE 1WBZA 2XY2A 3KXFE 5INDA 1AGFA 1DBML 4IM8A 5IEHB 5DK0B 4OGYH 1YJDH 3ARFB 3QUYC 2CLZA 3QUYB 3D3VA 4YQXH 3JV6A 3NIGE 4G9FD 2GJJA 5CJBA 2W0FB 1S7XA 5GJSL 4Y88A 2CSPA 2NZ9C 5DJXB 2A1WH 4F37F 3KGRA 1UT9A 1CDGA 5SWSA 1RJYA 4Z78A 4KJPD 4U1JA 1DBBH 1MQKH 4MJ4A 2HVKA 4D8PA 2GK2A 4H20H 3SGJC 3QUZB 2ZUSA 3P73B 4JRXE 4PGBA 1TFHA 1WBXA 3RZCB 3SGDI 3PWPE 3HNSH 3B6SA 4QXGL 4C56D 4Z8FH 2H2SC 1QR1A 1N6QH 2A83B 4ZQKB 2OL3L 4X6EB 3JTSB 4M5YH 4I5BB 3DUSA 2R2BB 5IHBA 3KYKL 2CDEB 3D0LB 4X7EC 3M1BB 1QFHA 2KUTA 1S9YA 2D9CA 4MJ5B 1BD2A 3T09A 3FHAA 5DXWA 2Z4QA 5DA4A 1BOGB 2DQEH 2X1OA 1AD0A 1DEEA 4LOUD 4NGHH 3K46A 2BFVL 2R69H 3MRPA 5DS8B 5D6CA 1H3XA 3AS3A 3QDGD 4LLDB 4K3JH 4P23B 5JW4M 3QDJA 2N7BA 2FNBA 2YD6A 3NIDF 2F53B 2OXHA 3MYJA 1EZVX 4WWKC 3WLBB 5GHWH 2ZKHH 4BH8A 4PJCE 4KI5D 3ILQC 4XNYH 4WWKB 5SX5H 3B9VA 4U31A 1G7PB 2FJFA 5MEQA 3C5JB 1MRFH 3JVGC 4HUWA 2O5ZL 4XH2B 3ARSA 4LVHC 4WV1B 5IJVA 2CLRA 3ZMRA 1X6NA 2V7HA 5IVZA 5IVNA 4HAGA 4HWNA 5C0CA 3IDXL 3CXHK 1T83C 2J8UF 3O6FC 3CX2A 3UYRH 3GSUB 3LQAL 4LHUA 5A3ID 3O6FB 5IT2L 2DI7A 5HGGS 2VLME 4JHBA 1KLUA 2R2EA 2E7BA 3QUXA 5H2BA 5D1QB 4DW2L 3PDGA 4KROC 1ZLVK 4GAJL 1IL1A 4HZLA 4KROB 5HHPA 3GMRA 1R6VA 1FAIL 4L8BB 4U1SB 3CVHL 3DYOA 3ME0A 5A2KH 1PKQE 4WUKH 2FB4L 3RTQB 4UU9B 4H5SB 1F11A 2YWYA 3V4UL 1B0GB 4N68A 3V9FA 3FAXA 1F4XL 1L7IL 2DQDH 2E5EA 5LG1A 3D9AH 3T0EA 4PJFF 2E7LC 4LARL 5DMIH 1I7UB 3IETA 1AIFB 4U33A 1XF1A 1HYSD 5D96B 5C07A 4ETQA 1HYRC 5JQHC 4MSWA 4HCRA 3UTTA 2OSLB 5MHSD 5JDSB 1OAXH 2G9HA 4GMSH 5IW6B 1U36A 2PXYC 3BMVA 3I02B 4P3DB 1MUJB 3VGBA 3MRGA 3QEQE 2PXYB 4KI5F 4PREB 4RRPA 4WW2F 1MFCH 4X6CB 1RMFL 2CKBH 2ARWA 3NGBC 4PV8B 1V05A 4RQQB 3QEGL 1V3JA 4BA8A 2Y6SD 4MJ6B 5BRZA 4K7PH 3NGBB 1KFAH 3KLSA 3L5WB 5EBMA 1OGAD 1OSPL 4M1GH 1MIEL 4NQCA 2EICA 1ONQB 1EA9C 1MWAB 3O9WA 3T1FA 4YDVA 2F9BT 2C4FU 4KRNA 3WIIH 1M7XA 5ERWA 1MY7A 4Z7UF 2ICWB 2VITA 1I1AD 2G5BA 4OLXH 3PWLA 2CKBB 3BESR 5IHZB 3CFKA 4CDGC 1TENA 4WRLA 3QFJE 1N64H 1FV1B 3BRDA 3GZKA 3DO7B 2HAZA 1YEDB 3BZ4A 1NGPL 4P2RE 3F58H 4OIIH 1U0QA 4MXVF 5AZEL 3KR3H 3MXVH 3TBSB 4OAWB 5GQBA 5D71L 1LO2L 1E6OL 3SOBL 1T5XA 1K4DA 4C54A 2DDQH 2HJFB 2JJSA 4JO3L 4LKCB 5EO9B 4F3FA 4PJIE 3TO4D 1AKJD 3IF1B 5HHOA 4JFYA 3QCTL 3WFBL 3PP4H 3QAZC 5HGAA 1VFMA 1R3JB 4OKVA 1EGJH 2QQKL 4GW5B 2XRAL 5C09A 1NUFA 3SDAD 4MD0A 2Q87A 2BZDA 2VLRB 3S3SA 4JO1H 1KJMA 3KPLA 7CGTA 1J86A 2EH7H 4X9HA 5GRVL 5CGTA 5DMGD 3BKCL 4OI9A 3ZDZF 5B8CA 2DM3A 4QRRA 1CIDA 3DXAE 4RFNC 4H1LG 3QIUC 3V0WL 3QH3B 2DKUA 4XBEL 4WCYL 5I1EH 2BOBA 4HXAL 2CUHA 4RFNB 3QIUB 2P48B 4PJ5B 3P0YL 5LXGL 4AH2B 5GGVH 1E4XH 1B6DA 1QEWB 2VDKH 4ENED 1CCZA 1TJIH 3MRIA 4GBXD 3DO3A 4LLVA 4H1LB 3NIFF 4KUZH 4Z7WF 1ZLWK 5I15H 1NGQL 3EAKA 2A9MH 3KXFB 3FCTA 2OZ4L 3TWCH 5CILL 5T3XD 1ZHBA 3BDXA 1MIML 1FGNL 5K59F 5MEPA 4FQXA 3FQNB 4M7ZC 4UBDC 4PB9L 1JGEA 4M7ZB 2JB5H 1I1YA 4XP4L 1OAZL 2VDQL 5I1HL 1J5OL 2NY5H 1CG9B 1X4XA 3RWJA 4K7PX 2BHUA 2YC1B 3ZL4L 3FO2B 5DC4B 1GC1L 2APXA 4PLJD 4NQEA 3TBYB 3ZKXC 1TIUA 5BCAA 1AXIB 1GGTA 1DQQA 3FOMA 3KPOA 3L3KA 4POUB 5KS9E 1T4KA 3W81A 5IFJA 5T33H 1T89A 3ZKXB 4NFBA 1BGXH 4KDTC 3MQIA 3D85B 1CF8L 4JRXB 2H1PL 4LDEB 2ATKA 1S7TA 4NCDA 3PWPB 4QRPA 3TVMB 5DJ8B 3U83A 3T3MF 4NKQB 2JCCE 5D93C 1DBKH 4NP4L 1RIUL 4OFYD 4OLWL 3V6OA 3ZHLA 1CFTB 3W0WD 3RUGE 1DLHB 3PDOA 5D93B 5LKNA 5H94A 1J05A 5I18L 3P2TA 1LEKB 3FN0H 3LN5A 2GIYA 3DV6A 2IWGA 5D7IE 3RDTC 1CGSL 4IRSA 4F7MB 1GCFA 5DUPH 4AEIH 4YBQC 5HHNA 4JZOA 3RDTB 1RZGB 4YXLL 4F57H 1QBML 1T3FB 2AJVH 5IMMB 1D5ZA 4CMMB 1UKSA 2NLJA 3CMGA 3DROB 3NFNB 4O02H 2KH2B 3RWIA 3T0XA 2ORBL 5D9SA 1BQLH 3RBGA 5ESQB 3BZFB 1OP3K 1A6TA 3HE6A 3CSYB 4P4RB 5C7XL 1PYWB 4GQ9L 2G2RB 3AU1A 1EEZA 5IQ9B 3GKWH 5CKGA 4RFOH 3UTSD 5GZOD 1Q0YL 5F9OH 3WS6A 4HX1A 4ZTOL 5DUBA 1CICC 4MXWH 5TE7H 1ZHNB 2J2ZA 4GFTB 4GSDH 3GBNL 1JTPA 4GKNA 4MNQA 3S37L 1YEEH 1CICB 4K9EH 4LPCA 1YDPA 2XNAB 3IDMA 1XZ0A 3TBWA 4ZD3H 5AZ2H 4CJ0A 2HRPH 2DLEA 2R1XB 4HFUL 2RFXB 4IOFD 3BEWA 1C8PA 1B0RB 5F9WC 1RJCA 5LGHL 3EYQC 3NMEA 4G6FD 1RZFH 2YPLA 5F9WB 2D4FA 3RX7A 4KKBC 3PQYE 1W0VB 4WNQA 3LOWA 2IGFL 1GIGH 4Y4KC 3ZKMC 3BSZH 2WW8A 3GRWA 2HYMA 2PTUA 4K8RC 4JM2C 1NCDL 4NKDB 4PP1C 3WIHA 4Z0BH 1I9RH 1BIHA 5FUOL 9CGTA 1BQUA 3O45A 3QUKA 1RUQH 1PKQB 5K33A 1QNZH 3U0TB 1ZHKB 4KMTL 4K07A 3FT3A 3VFWA 2I9TA 3UTZA 1N3NA 3AY4A 1RZKC 2BHZA 3G6JA 2YK1H 5DD1L 4YHIA 2IJ0C 3EOYG 4NWUL 4PRIB 1TCRA 3BGAA 4NKIL 2MHAB 4P4KC 2VDOH 3SGKC 4MA1C 4HIEB 3UZVB 4DGYH 4N1CA 1KACB 2LQRA 2NR6C 1H5BB 4P4KB 5F7FA 3IU3A 4D9LL 4MA1B 4G9FA 4MDJB 1JYNA 1IGCH 3HCVA 1I85C 5IKCB 1GZPB 1YECH 1ODAA 5DJCB 3RPKA 3MRLA 4P2CG 4JFZH 2J8UA 1UJ3C 1OQOA 1SM3H 3QEQB 5D7KD 4UT7H 1B4JL 4D0CA 2VISB 2EC8A 4YR6B 4DJMA 3OKLA 3U6RA 1JUFA 2J6EL 1S9WA 3MRRB 2YD7A 4M61B 4C56A 4IDJH 2IPUK 1NFDE 1QFWL 2NTSP 2R8SH 1Q9KA 2IFFH 4R7DA 1QQDA 2VQ1B 2XZCH 1CGXA 4I8DA 3OG4B 4PJ7F 1LK3H 1HNFA 1A3QA 1QRND 2YMXH 3ZE2E 2KZWA 2UY6A 2AK4D 2HFFA 2DQIH 2QTEA 1UKTA 5KZCD 5EFIA 1KB5L 1ADQH 2AV1A 4PJFA 2EXWD 4PTUB 3BH8A 2IQAB 3QXTA 1ZTXL 4XC3L 3QDGA 5FYLL 2JJWA 3C8DA 2NW2B 4FXGB 2W0LA 3IFNH 5HYFA 3PL6C 3QFJB 2ZP0T 2JE8A 5C71A 1AH1A 4IOIB 1ZS8A 2MJWA 1CXIA 4P2RB 3C60C 3EHBC 2B4CL 1OGTA 3BFOA 2R23A 3BEVB 4WW2A 3EYSL 3WHE0 5CJ5A 5JHDD 5GPRA 2APWA 3VE0A 4DTGH 1WBYA 2FX8L 4NHCH 4PJIB 3VDBA 4G5ZH 4K23L 1BFVH 1JPGB 4NQXA 4QWWC 2I60L 3KYOA 4K3EH 1JWUA 3DSFH 1P4IH 5KG9A 5T1LD 1XF5A 3AB0B 3ARQA 1FO0L 1UH4A 4KKCD 5L8KB 1A02N 1BZ9B 1N8ZB 5FA3A 2GITB 2BC4B 5IM7B 3IJHA 2Z8RA 5J9PA 1RZ7L 3REWB 2A6IA 1OOAA 4MA7H 2MKLC 5IG7A 1NDMA 3NCMA 1RK0A 3WLWC 1ZT7B 2F19L 1HXYA 1INDH 4LRNH 3ILQD 4GMTH 3CPLB 2H8PB 4OUUB 3EZ8A 5L88H 2YXMA 3LB6D 1QD0A 1CLOL 2HFGH 3OKKA 5K9JL 3GO1H 5TPWL 3D25A 3JWDL 1XCQB 3MRJA 4XPAL 4OZGE 3MRQA 1EEUA 4XVSL 3TESA 3CXHJ 1GGYA 1DQLL 4GG6E 1B9ZA 2QHRL 3PGCB 4NRZA 4EDXB 4Q2ZA 3HAEA 4UQ2B 5C0BD 5DD5H 1B3JA 4FTVE 5JOPD 1A6VH 4YHLL 2LAAA 1TPXB 4MWFB 1WZ1L 4F7CA 3ABZA 1IAIH 2BSRB 4PY7A 4X7TA 5DEFA 5E5RB 3HPLB 3NCBB 4EN3D 2VE6A 1U8JB 3OL2A 4JQIL 2O5XL 2P8LB 1A4KA 2QQLL 1Q72L 1CLYL 1U8KB 4L8DA 4X6DE 4D3CH 3SCMC 5FO7B 3TJHC 5KS9B 2WBJB 3U4EA 1KIRA 3JUZA 4DGVH 3V6BR 2DYPB 1FZKA 1T0NA 1FH5L 1OGAA 1KPUB 3LVEA 4QHMA 3MV9E 4FA8A 4P5KB 3VG0H 1G7HA 4E9LA 5BJTA 3K81A 4OCSH 4HBQA 4NKOA 5E7FA 3SPVA 3C9NB 3QHFH 3SQBA 1QBBA 5DK2A 2GKIA 5AAWA 3RUGB 1I1AA 3KPTA 5CEZE 1Q9WA 3FT4B 2OXGA 1OT2A 3F6IA 2XWTB 3GMMB 5BMFH 4JJ5B 5EOCH 5D7IB 5ACLA 5FEBA 1K5NB 2A73A 1K8IB 1QA9B 2VABA 1S78D 3BOVA 5E8OA 5E08L 3V4VL 1A0QH 1MREL 3AUVA 2Q8BH 4XCEB 1CR9H 1EHLH 4OCRH 1T1XA 1DBJH 5D72L 3B9AA 2P1YA 4NCC2 2K3TA 3DSNA 4AY0A 3P4NA 4F2MB 1AKJA 2GY5A 3TH4T 2VXQL 4MJIE 2F8XC 3WD5H 5GGTL 3ARZA 4U3XA 4QXTA 1HCFX 1JTOA 5F8RC 3U36B 4P9MH 4HZAA 3SDAA 5J4MA 5AYUL 2VDNL 3GJFH 5DJAA 5HGHA 5IBTH 4UIKH 3ZTJG 4E41E 5LQBH 5FCUH 3IS0X 2EYTA 3OXRB 5DLML 5B4MD 1RD6A 1CS6A 1JNHA 3I9GL 3S7GA 5D6DA 4JY6B 5DQDL 3GEWB 2APTA 3QPQD 3PQYB 4JO4H 4MB5A 5EO1A 3S36H 5CGYC 1WF5A 3IB4A 4OJFL 3KJ6H 2PW1A 3DYMA 1IM3B 5DMKA 1ZLUH 5GS3A 3SKNA 4YFEA 3ARVA 2DQTL 2X4PA 4GBXA 2V5TA 1AXTL 5KANI 3GJFB 1VGEH 2X4TA 3MLTB 4NO3B 4WU5B 3MUGB 4YUEH 1A3LH 5F7MC 4ZUWB 3S35X 4LCCC 2LVCA 5CIPA 1KJ2L 4U1KA 1A7QH 4DZ8B 1F8TL 4XP5H 3BPCB 1S3KH 2GJZB 5E5MA 2R1YB 4LCCB 3SE3A 1ZK9A 5DJ0B 2F8OA 1XIWD 3QQ4B 3UO1L 5IFHH 4P2QE 2LTQC 1H8OA 1T21A 1WITA 2ZOKA 4K71C 4LSRH 1F4YH 4FXKB 4WU7A 3T2PA 2Y36H 3IJSA 1YJDL 3TF7C 2DWEB 2MPAL 4K71B 4FQIL 2ZJSL 5EBLA 3EOBB 4JR9H 4X83A 1JWMB 1II4E 2VDMH 3L3DA 5TE4H 3WO4C 5T5NF 2IPTH 3O3BB 4GH7B 5IOPA 2QR0A 4PJ8C 3RVVC 3U7AA 2Y1VA 1FDLL 4MCYA 3VGGA 5ILTL 4MQ7B 3MLXH 4WTZG 3WJJC 5TE6L 5E2VH 3HRZB 3LS4H 3MZGB 2AEPH 3O4LD 4QGYA 3Q6GH 3B8SA 2IBBA 3NIDE 4H20L 1ZHLA 5DD6A 4PRBB 4WW1A 5E2TH 3GJEB 3MV7E 4PRAB 4ERSL 3U7YL 1FZJB 2BSED 1AGBB 4AT6B 4Q9QL 4OFYA 5EZLB 4HIJA 2R9HC 2DLFH 3AAZB 4K94C 1NCCL 3TCLA 1N26A 1I8IA 3QQ9D 3ULVE 3MFFB 5FUZH 1QSFE 4LSUH 3GMNA 1FC1A 3VW3H 2IG2H 3GSWB 1RUAL 4OLYH 3VXOB 1P4LB 4JQVA 4BH7A 3BQUB 4NGHL 3OXSB 4BKLA 1JTTA 2C3VA 2V9TA 1AP2B 1M6OA 1EO8L 4P48A 5E8PA 1S5HA 4XC1L 3QUMA 3DX7A 4ONGL 4Z7NF 4M00A 1ZANH 4GS7C 3X13B 3UTSA 2MQ3A 3GIVB 4NZRH 1X7QB 5HPMA 3WKML 4QRSB 4GS7B 2WM0A 5M7QA 1CD9B 3VFMB 3ILPB 4TVPE 4JPKH 1IC7H 2RHEA 1KEMH 2A0LC 3GMOA 1GL4B 3L3GA 4BUGA 3S34H 2UWEF 5DGQA 5J6GA 2EZ0C 4JFQA 1QRKA 3KDMA 3L3OA 2HVJB 2OR9H 4J4PD 3CLFH 3S36X 5BOZG 5EUOE 1LP9F 3WO3B 5MI0C 3ZE0E 5DJDB 5C6TL 4UILL 3FB8B 3ULUD 3B9KD 3O3DB 4FG6D 5MI0B 4I9WD 3NCEB 3WEXB 4ELKB 5EZIH 1OQXA 1DDHA 5IQ7H 1UM5H 2B1AL 1R3HA 3H9YA 2NXZC 3DGGA 5D7SL 4H26A 3CDCA 3TFKC 3DUUA 3EFDL 1A6AB 4R26L 4YEEA 4PRPD 4UTBH 3LEXA 4HFWA 3T1WA 1Z9LA 3VXPA 1TDQA 1YC7A 3SDYL 5TH2B 4LGSB 2BDNL 3BKMH 4JPWH 4NJ9L 4ODXA 2E9BA 3QZWG 4OZGB 3GK8L 2G75A 5EOTB 5F72S 2ZPKH 2AJUH 2P42B 4HUMB 3MBXH 4QY8A 4U1HB 1U3HD 4GG6B 3VFVB 3B8YA 3C8KA 4P59H 4Q9BA 4QOKE 2D7MA 4Z0XB 1TJHL 5TGBA 4FTVB 5IJKC 2ICWI 4KZDL 4BQBA 5FHBL 2DQFB 4UTAL 1QYGH 4S2SB 3TN0D 4YGVA 5H35B 3QZWB 3DX6A 4YFLI 1I8KA 3OV6A 1XGRB 3CFEB 4DQOH 2AXFA 1MWAL 3GB7B 4X6DB 3MXWH 5CEZH 1MEXH 2GCYA 4QHLA 5ALCH 5E8DL 3QXDA 1YY9C 1MPAH 1B6UA 1C12B 2AI0L 3FMGL 1OPGL 4EIZC 4F9LA 1E4KA 1FZOA 1RHHA 4UV7H 1BM3H 1QRNA 3RQ3A 3MV9B 3V6ZB 4A6YH 3MMEA 2AK4A 5J13C 5T3ZE 2MCG1 1T04B 2I07A 3WS3B 1TVHA 5F3HB 2ADIB 4YIQB 5I1KL 4NNYA 5CJXC 4U7MA 2AQ2A 2FHBA 4HBCH 3U0PA 3MRKA 2GJ6E 3HI5H 5ID0B 2P8MB 1X4YA 3VXNB 5GSVA 3HZKB 4RFEA 1KLGB 2W65A 2V2TB 1UEYA 4LL9A 4FQHB 5E6IC 5DFVD 3VWKC 1WICA 3DETD 3GSNB 2WIIB 5E6IB 1GSMA 5ITFB 1FRGL 5CP7A 3FQTA 4ZOCA 1F5WA 4A6YB 5JHDA 4HC1H 5I2IB 4ONOA 4MJIB 5F88A 1Y6NR 2LFGA 4Q9RH 1IBGL 1XGQA 1P69B 2AJXL 3F12B 3U1SL 4AIZA 2MCPH 5T1LA 3NIFE 4KK5C 3L6FA 2CMRH 3MJ7B 3MNVA 4RAVB 3L3IB 5F97E 4E41B 5MP6H 2ZUQC 2PNDA 1QO3B 1RK1A 5FV1L 3PL6D 4WHTA 3FT2A 4GUPA 4NKMA 2UUDH 1CU4L 1E6JH 5DRXA 1MVUB 2ZUQB 3EO1A 1T5WB 1DL7L 1T7YA 1YQVL 3RVXC 3CMOL 1AGCA 4K3DH 3KLAB 5ID1A 2CDGA 2ITCA 3C60D 1HILB 3EHBD 2AQ3A 3PWUA 3IVKA 3RJDA 2X4SB 1RIVL 4EI5C 1P2CA 1KTDB 4XI5D 2XQBL 1J7VR 4Q6IC 3ULSB 2IBZX 5D2LF 2F15A 3UZEA 1HQRB 4ORGB 5EU7C 4HHAA 1QFPA 2QQNH 3OGCA 4Q6IB 4PJAB 1BLNB 5EU6E 3IXTA 3S4SA 3KWWB 3NCCB 2VDKL 1I1RA 7FABH 1TJIL 1T1YA 4YEFA 4HV8B 2AERT 3D39D 1O5DT 4HT1L 4XPFH 4XCYA 5C0BA 5SWZD 2YUWA 5E2JA 5JXAL 3NFSL 2G5RA 2XTJE 3QNYB 4XCFL 3LS5H 4DKEL 1JGUL 3L7EB 4BQ6A 1QFUL 4OT1L 4OZFA 3RAJL 3TWCL 4CUCA 4O2EA 1Z3GL 5IROA 4EN3A 3M8OL 1YEFH 1NANH 3MLPA 3CC5A 3MRBA 1S7RB 4DVBA 2DOCA 2P7TA 3ULVH 4ZAKD 4F37K 4I3SH 1SYSB 1G7IA 4N0CC 3CFCH 2UY7A 3PHSA 1IGYB 3RU8L 4R4NC 3UCRA 1H3PL 4TUKH 1EFQA 1PJ9A 1A6ZA 3LKNB 4F7TA 4JY4B 1GPOH 4NQUA 4E0RB 2YZ1A 5CZXC 3FFCD 3DVIA 4Y16B 1HH9A 2BJML 3UJTL 5DJYA 1CQKA 2NY4B 2XYCA 3M07A 5SWQA 4ZSOA 2OR8A 3X11A 4LIQL 1F4AA 3OR7A 1GZQB 2KDGA 1XH3B 1AI1L 3D0VA 4PJHE 5BS0D 4XPHH 2E3VA 3NBNA 4X4ME 4HULB 1OWRM 1EX0A 4O00A 1ROWA 4IS6B 1C1EL 5D5MF 1L0YA 5EUKB 1IC5H 2QQQA 1IT9L 5FK9A 4Z77B 4FN0A 3Q5TA 3D18A 2VXUL 2EDYA 2P5WE 5F9DC 4HEPG 1U8PB 4HPYL 4XXCA 4B7LA 5LAXB 5LVEA 1FPTH 5EU5B 3VGHA 1CVRA 3QEHA 4GXUN 1G7LB 4LLYA 4RWHA 1ND0A 1J9CT 1CFVL 1GGCH 3KPMB 4OCXH 5DZLA 3VJ6A 4ZNCD 3DRQA 4RGOL 4MB4A 5K9QG 3GIZL 2VIRB 2JKXA 1UH3A 2XXCB 5HI3D 3QI9D 5IB2B 4AZ8A 3T2OA 3JV4B 1KIQB 2AJVL 1MCDA 4N8CH 4PJEF 4J3XA 5JPNB 4APQB 2F74A 1S7VB 5JZ7D 3FN9A 3VXQA 3VCLA 3HMXA 3N9GL 4KKAD 1CD1A 3QCVH 1XGTB 3RIFF 3P30L 4O9HL 3RX8A 5DJ2B 5EUOB 3SQOH 4B7IA 2V2XA 4NNPH 5GS1C 5I1AB 5LCVL 5A2JH 1XF2A 2AEQH 3GKZA 4K8RL 2Q7YA 4KVCH 5GS1B 4BYHA 3PWVA 4D0BB 1UCTA 4ZNEA 3EYFA 4JFEB 1YYLL 4F15C 3LKPA 3PXHA 4AL8L 3U9UA 4H25A 5F1IA 4YHKH 3HC4H 3NA4A 1RZKL 1OTUC 1U8OB 1J1XH 5ALBH 1JZ7A 5ICXA 2J3SA 1MLCB 2ADGA 3FO1A 3HZYA 3MNWB 3ARTA 1ZMYA 4CBPA 2R4SH 5KSAD 1WAAF 4I18B 5DHVH 4JG0H 2YD3A 3O3EA 4GXVL 1XIWA 1DQMH 1HHIB 4DVRL 3PV6A 1U8LA 3WSQL 2VLJA 5D1ZD 1FLRH 2ZCHL 1KV3A 1GHFH 5F7DA 1MHEB 4LBEB 2GSIA 4U1MB 1B2WL 4OLUL 3TZVB 4ZXBC 4QOKB 4X98B 3MLUH 1QPPA 5F7LB 2ATPA 4QT5B 1NDGB 1ZLSL 4MQXD 1VFAA 3WN5B 1JPST 4UT9L 4DCQA 3ZE1F 1RZ8A 3VD7A 1AHWB 4KUCF 3CIQA 1FIGL 1FL6B 4KRPC 2EYSA 2AEIT 1IM9D 4LCWD 1K4CB 1TLKA 4YBLC 3SJVE 4OB5H 1IC4L 3MO1B 1UACH 2B39A 4R3SB 4WVRA 4G8EB 3O4LA 1A5FL 1VENA 4UI2A 4UQ3B 2ZSWB 3HPJA 3T65A 4KTDL 3V7MA 5IIEB 5HVHC 2XT1B 1MCFA 5JW3L 1WZMA 2VB5A 3ISWA 4XHJD 4M7JH 4U1LB 2BRRL 4GRMA 5C0EB 4PJ9C 1SJHA 1PAMA 3Q6FB 5HHME 1CFBA 4S1DD 2W9EL 3HC3H 4PJBF 5DVNA 4PJ9B 2CDFA 3ZO0A 4JQXA 5C0RH 2OI9C 1EMTH 1P1ZA 2PO6C 1XGUB 2C7UB 5IWLA 2YMXL 1RFDH 2GJ6B 1CQYA 3FRUA 2HT4C 4JFDE 1D9KD 1NSNL 3LCYA 2AV7A 1ZGLM 3WIFA 5C0GB 1IGJB 5KOMC 1LEIA 2HWZL 4MQTB 5GS0H 3H9HB 3UMTA 1F6AA 3O2WH 3TM6A 1HHJB 1C16B 5I6XC 2HT3C 3ROOB 1JNLL 2GSGA 1RUPL 3OPZH 4TUJB 4P5TB 1JI1A 5B39G 2R9HD 3S5LG 5JTWA 2YKLL 4FQPA 2RR3A 1I7ZB 1PY9A 3TIDA 1MI5B 4EUPA 1ZVSA 2XWJA 4J4PA 5TQ0L 4P2OC 4NHCL 4JY5L 4MX7B 5JORA 3B9KA 4P2OB 1X5KA 4M6AA 3DVNA 2IH3B 3GBMH 3C09B 4IMKC 3QNXB 3CFDB 5FM8A 2YN3A 5B39B 2FO4A 3V79C 12E8L 2H41A 1HZHL 2R0KL 4H88H 4W81A 4IMLA 1LEGA 4I48B 3P0GB 1MJ7L 4WENB 1JPSL 4G8IA 4JFHE 1KNOA 3QIBC 2D2OA 3T08A 5KSVB 4PRPA 3PP3H 3QP3A 3IFPB 3O6KL 2G60H 4ZTPH 4U1NA 2BNQD 4BUHA 4JAMA 1RJLB 3RPIB 4PYHA 2A0LD 1A9BB 5FECA 5I71C 4UUJA 4WI9A 3DV4A 4XPGL 2NY6C 4Y4HC 3SDXF 4D9QE 1QG3A 1ZGLB 5EU6B 1PX4A 5I71B 3BPOC 4M7KH 4L9LB 4M6NL 2NY6B 2EDWA 1TQBC 3MJ8B 2COQA 1U3HA 3BPOB 2BVQB 4ODSL 4CN4A 2EEBA 3HE7B 4HUXB 1TQBB 3C08H 3P0VL 2E27H 5CJOH 1QLFA 1EEYB 4JM4L 2BMKA 5DSCB 3O2VL 4LAQH 3RWCB 3KVQA 1CBVL 3TN0A 2IADA 2NXZD 4X5XA 4NOBA 4JFFD 1T03H 1OCWH 4TTDD 1FORH 4GG8A 1CZ8H 1KT2A 4NHUB 3P4OA 5EO0B 5FA4A 1PZ5A 4O4YL 5DT1L 1E28A 4ONFL 5GISH 3X3GL 5TDPB 1OF2B 2GEEA 4EBQL 3LZFL 2VZ3A 1W72B 2R0WL 3LN4B 3BPLC 4HIHB 1UEMA 1WWCA 1LGVA 1IARB 2FATH 5J1AB 5DQ9B 3UC0L 2FJHA 1G9NH 3HLAB 2R39A 3D3VE 3ZSTA 2FECL 2NY3C 3V0VB 2DLTA 4PJHB 4OGZA 2OJEB 2NY3B 5FM5M 3VG0L 4OUOA 1NEZB 1Z2KA 5GJTH 3HG1B 1UM6L 1L7TH 2VO5A 1Y18A 2P5WB 4ALAH 1IKNC 1FQ9C 3RI5K 5BVJA 5C08E 5DQJB 4Y1AE 3KYMB 1QR4A 4Y5VA 1NBYA 4G7VL 3V5HA 3ROLA 1IC1A 1IKFL 1T6WA 3WFDL 3MRFB 3MRDB 3VI4F 4W68A 1JL8A 4LDOB 5BMFL 5EOCL 4Y5XC 2VR5A 1BBDL 5DVMA 1F90L 3MZTA 3TT1H 4R8WL 4H8WH 3TYFA 3OKNB 3NZHL 3U9PL 3W9DA 4OCRL 4XXDA 1MF2L 2ARJB 3HS0A 1PG7H 5IB4B 5BXFB 2ESVD 5CBEB 5INCA 3Q2CA 2R0ZH 2LV4A 8FABB 4HWBL 1LO4L 2Z31D 4K9EC 4PTTA 5F1KC 5B3NA 2BNUB 4JB9H 4P9ML 5D1XC 3UDWC 3QDJE 4JJHA 5KAQF 2IPUG 5D5MA 1NBVH 2IPKB 1D7FA 5D1XB 3DI2B 5IBTL 1F3DH 4G42B 1NGYA 4WUUE 4FP8H 3CLEH 3KPQB 3MLZL 4ZPVB 1YY8B 2ADFL 3EGSB 4WEUD 4FNLH 3LRHA 3E0GA 3RL1B 2RJMA 4OLVH 4KJYB 5EC1A 2J4WH 1GGBL 5KVEH 2EDXA 3MV11 1IQWH 1LD9B 2PYEE 3GNMH 3VWJB 3FO9A 1NBZB 2DLHA 1JNNH 2R2HA 1YN6B 1N7ML 5IF0B 5E0QA 1FAKT 1I8MA 5HYJE 3D39A 5GGUA 4FFZH 5C0CE 1KEGL 1MHHB 1A3LL 5SWZA 3FFDB 2X41A 1NGWB 3I6KB 4JGMA 4PS4L 4LCIL 3UJJL 1ZOXA 2Z35A 4RNRB 5CD5D 5EORL 1S3KL 3FQWA 1JHTB 3C2AL 4ZUVB 3K8MA 4AIOA 3GSRA 4YDLB 1UENA 1JZ8A 5IB1B 3OAZH 3LKRA 3HUJA 4PG9B 4MHHG 4LSRL 3STZB 4ZAKA 2IAMC 1LO0H 2ZCKL 4BQCA 2DKMA 3ARFD 4CADA 3SN6N 1PFCA 1PVHA 5FYJE 5DHYA 5A40E 3IFLL 4LU5L 4KZEL 5CD3B 2VXSL 5JOFB 2CUIA 5DHXB 4Y19B 2BCKB 4F7EB 4PUBL 3FFCA 4K94L 5GRZA 3MV8A 1KCVH 35C8H 3SJVB 2NZIA 4NC0B 3JTTA 1UQSB 4OZHE 2OZ4A 1U8QB 2ERJC 4EJ1C 5C07E 3O11B 2WINA 3R0MA 3IDIB 4BSWB 5BS0A 3C5SA 2CLVA 4M9OA 5D4QA 1T80A 5KVFH 3P77B 4HKBB 2ZSVB 5HHMB 3VXRD 5CZVL 1P4BL 3OZ9H 2P8PA 1OAYH 3RZCD 4ODUB 2EC9U 1LO3L 4JFXB 5I1LB 3GI9H 5JPMB 3H7BA 2NY1C 1IQDB 1ZWIA 2UWEE 4JDZA 4N0RA 1UFUA 2D7NA 5DC9B 3GUTA 2H6PB 1TZGL 4JCLA 5FUZL 3EDJA 2NY1B 5CINL 3BH9A 5DEZA 4BM7A 5IMOA 3SY0B 2P47B 4MVBD 5HHVH 4IEFB 1PG7X 2BSSA 4UDUA 3G5XB 3S88H 3QI9A 4M48H 4NYLB 1FFNA 3HR6A 3BXNA 1A2YA 5F44A 1R0AL 3QG7H 4NQCE 2VSCA 3NTCH 4J23A 1ZXQA 3X12A 4N9GA 5J11B 2YEZA 3KLDA 4HJ0C 4P23D 5I16A 4AG4L 4GXUM 5C9KA 2Z91A 4D9RD 5SV4A 2H2PD 3IGAA 5ENWB 4X5LA 2RIKA 4Z5RB 2VXTL 4KHXH 4WO4C 3BP6A 4MA3A 2EIBA 4WO4B 2UVFA 4MA8H 1U91A 2C1OB 3S34L 4PJBA 4YHNB 2DWDA 3O3UN 1HSBA 5T1MA 2BVPB 1SJXA 2VMFA 4MNHA 1C08B 1JGLL 1PSKH 3HKFA 5CEYA 1A47A 4JG1L 5DDHA 2JB6B 2R1WB 1WCBB 3NH7H 3V5DA 1AGDB 4ODWB 1N5YH 2BP3A 4KVNH 4OV6F 2V9QA 1EHXA 2A9NH 1M7IB 3MLVL 1JZ2A 2W07A 4OSUL 3QG6A 1CDBA 4MNGE 5FGBC 5IMKB 2UZIL 3EOTH 2MQ0A 2MFNA 3CSGA 1F2XK 1IEBB 4M7LT 1NFIB 3W39B 1XR9B 4NZJA 5KSAA 5D70H 1MCLA 1MCSA 4P46C 5E94B 1Z9SA 4MXQD 3U0WH 4ZG1A 5D1QD 4P46B 4Z7QF 5EDXA 5GRUH 1OM3H 5D1ZA 2WP3T 4O2CB 2VLKE 3H9SE 5DJ6A 3BUTA 4J3OC 4Y4FC 1NAML 2DTML 4EVNA 3S96B 4QRRE 2AJSH 4GW4B 4XVJH 2YA0A 1KBGH 1MY5A 2WUCH 2H3NA 1KJVB 1SY6L 3FKUS 1L9NA 2ZPKL 2BRQA 1I7TA 2LU3A 1V7ML 5JIPA 5F3BB 4WI2A 1I4FB 3ELAT 3A6CH 4AENB 2OP4L 1MFBL 2XWBB 1MJJB 4U3HA 4IHOB 3UJIH 4ZFFA 1G6RA 5HDQL 3TT3H 1IM9A 4MD4A 1D5IH 3JWNC 3WXVH 5HD8D 5LWYL 1KCKA 5IBLC 1AGFB 3SDDC 5INDB 1FZMA 3BE1H 1U2HA 5TF0A 1EAJA 2CLZB 1OAKL 1JHKH 3QWQB 4NC1C 1E4WH 3DLQR 5F9JA 1O7SA 3D3VB 1AO7E 5DTFA 2HKFH 3JV6B 3GSNL 3X14A 3U48A 3SDXA 5D7JD 3SDCA 3EFFA 4LLMA 1D5BA 5JHLH 5T1KD 3MYZA 1S7XB 2UVEA 4JO2L 4WTXA 4CVZA 5CS7A 1D9KA 2MSPA 4JLRA 4KK6C 1RJYB 3OAYH 4Z78B 1S5IL 4U1JB 1UJTA 1KCRH 5C08B 3MODH 4Y1AB 2HVKB 4Y2DB 2YS4A 3SKMB 1KC5H 3I75B 1L9MA 2J6EA 4PGBB 4QTIH 1V3MA 2BOCB 1WBXB 5IW3A 3AMLA 3B6SB 2IBZY 2V17L 2WMPA 3QWRD 4Y89A 4M7LL 2E9JA 4G6MH 3V6OE 4PGZA 2DQJL 4G6JL 5TDOA 1J1OH 5DRNA 5FB8B 5D2LE 1L4IA 1R5WA 4BK4A 3L9RA 5C0IA 4Z9KB 1MHCB 4BZ2L 2FGWL 1NL0H 1QVOA 1AD0B 1DEEB 2HH0L 4FFWC 5DGRA 3WNOA 2V6HA 2HT4D 3QWOA 1WV7T 3CX5K 1Q0XL 2XA3A 4OM0L 1IMHC 2H9GA 1G9MC 3QDJB 1ACYL 4J2XA 3MJ9H 2X40A 1IGMH 4JEGB 3O2DA 3CFBB 1NCWH 3MYJB 1HHGA 4WUUB 5GRYA 5BVPL 1F3JA 2VLRD 5CUSL 2AQ1A 3RBSA 1IGTB 2HT3D 2X42A 2BNQA 4MNQE 2X4QA 2RCSL 3WNMA 4Z7VA 4TYUA 4HLJA 2H26B 2J7LA 4K3DL 1BEYH 1PEWA 3CZJA 3OAYK 1YYMH 2FJFB 2XICA 5MEQB 4OFDA 4X6CF 2PYEB 1XGYH 3B9DA 4LHUG 3RWHA 3NA9H 3B4NA 3PF2A 4HUWB 4NN5C 4EXPX 5CWSA 1ZT1A 1HDMB 3BJ91 1AC0A 3FTGA 1KXQE 2CLRB 3MRMA 4NN5B 2FD6H 2V7HB 4QYOA 3CDGA 5E99H 5IVZB 2QQNL 1FFPA 2FEEI 1UA6H 1KCSL 2AABH 4HS3B 3S3JA 5HYJB 5IESH 3D6GA 5C0CB 3OKEA 5C0DB 4FZ8H 2Z9TA 3KPSE 3WCYA 3QPXL 4LHUB 4FQJL 3QUXC 4OGAC 5FF6B 5DEGB 4X4YA 3RVTC 1KN4H 4PRHD 2YXFA 2R2EB 4JFFA 5H2BB 4ZFZA 1N4XH 1IL1B 3H6JA 3HC0A 4HZLB 1XF3A 5L9DL 3GMRB 5I8OH 1W0WA 4NQVB 2MTPA 2FEEL 4O58L 5J89A 1NGZA 1CFSB 1OL0A 1KN2H 4GRLD 3L95A 3Q1SL 1JF5A 4ZYKA 4LSQL 3T0EC 3G6JE 3ULVL 5J1TC 3MA9H 1A7RH 2FEDC 1VACA 3P11L 4MCZA 1UB6A 4OKDA 4OZHB 4FFYL 4RRPG 1NH6A 4G6KH 5C07B 1A6WH 1H0DA 4MSWB 4LNRA 4NQDD 3BD4A 4WFGD 4P99A 5FYKD 2QADC 2VL5B 1ZKAA 3IFOA 3IAQA 1W0YT 1DBMH 2QADB 3BW9B 4EZMA 3BWAA 2ITDA 3QYCA 3O4OB 3TVMD 3MCKA 3TV3H 2UWEB 4G6AD 1NJ9A 4NO5A 4TVPL 2EKSA 3LKQA 5JUEH 5EG6C 3CD4A 3OKMA 1IEAA 4YDJB 1MAML 4C56E 1FPTL 1NUGA 2EDRA 2DQHL 2HRLA 1KIPA 4YDKL 2DBJA 3L1OL 3RWDA 5EBMB 2NCMA 5GJSH 3PXJA 4OCXL 1CGUA 2LE9A 4OV5A 1CT8A 3O9WC 4XVUC 4NQCB 1ZA3B 4RMRA 5GGSB 1N59A 4OFPA 3PIQA 4XP9H 1WWBX 4BZ1L 3O9WB 2X4RB 5F7KC 3T1FB 4YDVB 2V9RA 2ESVA 3VXUD 1LK2A 4WFFD 5FKPA 4LASL 3CVIL 4QXGH 2VITB 2Z31A 2G5BB 3B2UC 4HGWA 4ZS6C 3OGOE 3P4MA 4HKZA 2DLGA 2OL3H 2P24B 4PGDA 1YNTA 5L2JB 1QSVA 4HD9A 3KYKH 4Y8AA 3IU4L 4OQTA 1B88A 5F89A 4JGJA 3NIGF 2JJSC 1OHQA 5A1AA 3SGDH 1T5XB 1K4DB 2BFVH 3WFHA 4F3FB 5GGTA 5ISZE 2UZYB 4DKFL 4ODVL 3TPUB 1JYVA 4MNGB 2GFBA 2VC2L 3F8UB 4LLWA 3TPKA 1Q8MA 3VFUA 4C83B 3EJJX 4U6YA 2Y06L 5HGAB 5E4IA 2EXYD 4LHQB 1CYGA 1J1XL 5E8NA 5F8QC 4Q9CA 5EZOL 5GZNC 1KJMB 4DAGL 3DYPA 3ARDD 5B8CC 1SQ2N 2VLKB 3H9SB 1F6FB 2XACC 3RWFB 2E6JA 4ZOBA 4QRRB 3QO0B 5DURD 2IH1A 1A7PL 2VWEC 3U46A 3OJDA 3C8HA 5BO1L 2BOBB 2O5ZH 1UWXH 3PNWB 4RWYL 5DK0A 2GHWB 3ARFA 1J10A 4DUXA 2C1PA 1QOKA 4S1QL 4OCMC 3W2DL 2Q8AL 1P9MA 3IDXH 4JHAL 3DX8A 3MRIB 3V0AC 5EWIL 1TJGL 2AK1L 4U6TA 3PABA 5T3ZL 3LQAH 5IVXA 3MOAL 4OBSA 1X5HA 5IT2H 3QQNA 3VG9C 2DLIA 5KVGL 4PBWD 3ES6B 3TNNB 4DW2H 6CGTA 5F9AC 1QLRA 3H9ZA 4XTRC 4FQXC 4GAJH 4L8SA 2HMID 5C70A 3TA3B 2HTLD 5MEPB 1FAIH 5MHSE 3CVHH 3QEQD 1OD9A 1S7SB 3F7YB 4LVOC 2C3HA 2FB4H 4L3AA 1I1YB 1AO7B 1XFPA 4LVOB 3V4UH 3RZCA 2FBJL 3NCFB 4NN6C 5M94B 4HGMA 1F4XH 5L7XL 2A83A 1L7IH 4X6EA 3JTSA 4NN6B 4I5BA 5K9OA 3I85A 2IAMD 2CDEA 4LARH 1T89C 3D0LA 3M1BA 1QSZA 3KPOB 3L3KB 1DQQB 3FOMB 5IFJB 1T4KB 3CFJA 2FRGP 4TPRL 4MS8D 4R0LA 1NCTA 1BP3B 4IRJD 1ITBB 5IK3A 1F3DJ 3A67L 2C3GA 2XN9E 3E8UL 4C55A 2V5MA 1BOGA 2GT9B 3SHSA 2ATKB 1S9VA 1OB1B 1ULVA 4RGMC 1AGEA 4EEEA 3BP5A 3LEYL 1YMMD 4PBXA 3O2WL 3QO1B 4P23A 1FFRA 1I3VA 2A6JB 1CD0A 3QFJD 1Y6MR 1RMFH 2XKNA 4JM2F 1OLLA 2DM7A 2F53A 2FZ3A 1KELL 3QEGH 3PDOB 1VFOA 5HY9A 1HHKB 3SKJL 3OKOA 4PJDE 5D2LB 1J05B 4IRSC 4EIGB 1M71B 1OSPH 4IRSB 4EQ2A 1CWVA 1MIEH 1MNUL 5HHNB 4MMXC 3CU7A 2D7OA 2FX7L 4KPHL 1EXUA 4F7PB 3EKCA 1D5ZB 1JHLL 2NLJB 3HE6C 2FIKA 3RWIB 4XH2A 5D9SB 4WV1A 4TSCL 3WS6C 2FWOA 3F5WA 3RVUC 3AU1B 2PW2A 1I3GL 1MCEA 1X5AA 2GTWA 1SBSL 5MEND 2ENYA 5DUBB 4YHZL 4Q0XH 3BD5A 4LPWA 3FZUC 2ENSA 5CBAA 3MA7A 4GKNB 4MNQB 5DUML 2B20A 4HJ0D 5I0ZA 1E27B 3LKSA 5GGQL 1BJ1J 1NGPH 5A43C 2MQCA 2D7TL 2B1HL 4QF1A 3L3HA 3CNKA 4XMPL 3DXAD 1IAMA 1OTSD 3IDMB 1XZ0B 5D1QA 3IDYC 1CFNB 5AZEH 3MV01 2XI9A 5HDLA 3EZJB 5D71H 3ZKNC 1LO2H 1E6OH 3SOBH 3IDYB 2XZAL 4L8BA 1VCAA 3BEWB 4JO3H 4I3RL 2F54E 4MYWB 1JGDA 1PLGL 3EO9H 3QXVA 1FFOB 3RTQA 3WBDA 3QCTH 4M7KL 3RNQB 3KPSB 5TFSL 4WNQB 2V2WA 3FO0L 4WDIA 3TYGL 1W72L 2XRAH 4GAYA 2J8OA 4KK9C 1D5MB 5EU4B 1I7UA 1BF8A 1AIFA 1XAUA 1AR2A 1X5GA 1P84K 4P57B 3BKCH 1MFNA 3QUKB 5EN2A 3I6GA 3AY4C 1T6VN 3OR6B 3V0WH 5IW6A 4XBEH 3VFWB 3UTZB 4WCYH 4PG2A 1EUTA 4HXAH 3G6JB 1C5CL 1N0XL 4YHIB 2H32H 3P0YH 5LXGH 1TCRB 3KPNB 4MGXA 4NCC1 4PJIF 1KENL 5D7JA 2F5AL 4G9FB 4MJ6A 1WWWX 2BY2A 3F62A 2DYPD 4KV5E 4KJPC 1SYVA 1GRWA 3L5WA 1NGQH 3T8XB 4ODBD 3QHTC 4ODTL 2GQHA 1H3VA 1MIMH 4D0CB 4PB9H 1BFTA 5GJTL 1Y0LA 3BO8A 4X7SH 1L7TL 3OKLB 4LMQE 1JUFB 3W5NA 4XP4H 1OAZH 2VDQH 5I1HH 2ICES 2VAJA 4C56B 4YHYC 3SDDD 1J5OH 2B5IC 4KY1L 4RGNC 4N0FA 1U8MA 3QWRA 4HUNB 4R7DB 3RL2A 2CKBA 3ZL4H 4U0QB 1QQDB 5IHZA 1GC1H 4N5ED 2ED8A 5I0DA 1FV1A 1UCBH 2P5EE 4M3JA 4U7SA 4PJXA 3W0WE 3NOIA 5LBSL 1T0MA 4P49A 4ZUSB 5BZWB 1Z6JT 4M1CD 4XNUL 4LOUC 5EFIB 4XCNA 1Q94A 4OAWA 1CF8H 5I8CA 3A6BL 1WTLA 1RY7B 4N0UA 3QDGB 3IF1A 1ZVYA 4J3TA 1ZS8B 4NP4H 1HHHA 1RIUH 1R3JA 4OLWH 5IV2B 1F58L 4KI5C 3UTSE 4WW2C 2VLRA 5JW4N 1E4JA 3LDBC 3O6LL 3E1F1 1P7QB 2EE6A 5I18H 1OGTB 3QULA 2R23B 1FG2B 2VNCA 4XB7A 1CGSH 4PLNC 3VE0B 1PX3A 3MJGX 5ISZB 4YXLH 4J7RA 1QBMH 3BIKA 3QH3A 5KS9F 2YPVH 2VAAB 4HIIB 2J4WL 4TOYL 1JWUB 2ORBH 2BNRE 3KYNA 4PJ5A 3FQXA 5DFTA 5C7XH 4AH2A 4S1SL 4X8JA 1Q0YH 3CX5J 3MLWL 5A3IC 1XF5B 4ZTOH 5BW7A 1EGJA 2DL9A 4JN1L 3GBNH 3K7UA 2EDLA 4X6FB 3S37H 3DX9A 3VXSE 5HJ3B 4LSPL 5FA3B 4PRHA 2ZOLA 4FFZL 5IMLB 3IJHB 4U49A 5J9PB 2A6IB 4AJ0A 4LQ1A 5IG7B 2VDLL 3E3QE 4NUGL 3RUGF 4L8CA 4G9DB 5ETUB 4HFUH 3FQNA 3WHXB 5D7IF 3HAEG 4DKAA 4U2ZA 4GRLA 5LGHH 1LVEA 2FO1A 3MGTA 1F4HA 2DTSA 3OKKB 2YOCA 3GSQB 3D25B 3MRJB 2IGFH 3U4BL 3FO2A 4PY8J 4HPOL 1HYSC 2GI7A 3QRGL 3I2CL 3W9EB 1MRCL 1LNUA 1MCOL 1CD8A 3DIFB 4HWUA 1TZHB 5HGDB 1BBJA 1NCDH 3K74B 4GW1A 4Q2ZB 3HAEB 1O0VA 3U7WL 1VADA 4NQDA 3IDGB 3S98A 3QUXD 4OGAD 4MAYB 4BFIB 5ICYB 3NPZB 4NPYA 4UB0L 4F7CB 1FNGB 5DEFB 4LGPB 2VE6B 3TVMA 4LLUA 1QFWM 4M6MH 5DD1H 5EBGA 4LVNC 5FUCE 1YPZA 4NWUH 4NKIH 1A4KB 3AMKA 2IMMA 4L8DB 4LVNB 1B4RA 3QIWD 3I3DA 3RX5A 4D9LH 1CFTA 4TNVF 4GRWE 5ABDE 1FZKB 2XN9B 2FEDD 4HJJH 3O6ML 1UZ6E 5C6WH 2BSTA 3T2NL 3CK0L 3VDCA 3HNVL 1PDKA 2B2XL 2JIXD 4X4XB 1K8DA 3O8XD 1SJEA 5BJTB 4XBPA 2R56L 1B4JH 3VXUA 3BUYB 3BQUD 1OLZA 3SPVB 1T2JA 1I1AC 3BZFA 2J6EH 2XV6B 4HGKC 3PJSB 4P4RA 5DK2B 3QDHA 1I1AB 1JV5B 2J8HA 4HLZG 1QFWH 4PJDB 3VFOA 1HIML 1AQDA 1CGVA 1Q9WB 1V7NL 4PJCA 2A73B 4Z7QE 1D6VL 1R3KB 2VZSA 5ANMA 2VABB 4L4VD 2Q3ZA 4KHXL 1P7KA 5E8OB 3MFGB 3K0WA 1KB5H 1T1XB 3UAJD 5JHDE 2IAND 1RZJC 3P4NB 4FQCL 1ZTXH 4XC3H 3TO4B 1AKJB 3WNNA 5FYLH 3QHZL 3ZT6A 4TRPL 2D9QB 1EH9A 4LHJB 2D7PA 2XFXB 3S37X 1QHPA 3SDAC 1FP5A 5I1JL 4QXTB 5FOBA 2EDNA 4JHWL 3SDAB 1NC2B 5JQ6L 1VEMA 5DMGC 4S10A 3ARDA 3B2UD 2B4CH 5E1AA 4ZS6D 3KLHD 4DUWA 3EYSH 4NKDA 5D6DC 2EYTB 3HB3D 1JNHB 2FX8H 2F54B 3EOAB 4JDVA 1FL3A 4OD3L 1MELA 1PKQA 2O26U 4K23H 1WC7A 3U0TA 1ZHKA 1F97A 3ZE2F 1CXEA 3RVWD 1VSCA 1GJIA 2EIZA 4XVJL 2CIIB 4ENEC 1AR1D 4OCYL 2WUCL 4Q6YA 1I3UA 2PW1B 4GBXC 2NY2D 4OF3A 5DMKB 3SKNB 3TH3T 1FO0H 2X4PB 4GBXB 5GIRA 2X4TB 3REVA 1NKOA 2OM5A 3WUWG 4FTVD 1GZPA 4HQQL 5CIPB 3SE3C 5DJCA 4U1KB 1RZ7H 2P49B 5E5MB 3RGVB 1BPVA 5GZND 5EIVA 2F19H 3QA3A 1DUYA 5GGRY 3QEQA 2WUBH 5JOPE 4PLKD 2VISA 1T21B 1RHFA 4YR6A 5MERB 4WU7B 2IQ9H 1CLOH 1YUHA 3WUWB 3IJSB 5K9JH 1Q1JH 1BWWA 1HKLL 5TPWH 2M8XA 5EBLB 4PLJC 3JWDH 1OD7A 3G08A 1E4WL 4XPAH 2IAMA 3L3DB 2HKFL 3PDDA 1DQLH 1S8DB 3FB6A 2QHRH 1EFXD 3BN9D 3MGOB 5IOPB 2QR0B 4IRJA 5ESAB 4JCMA 3V6FA 2DB8A 3KPPA 1REIA 2VZVA 4YHLH 3C6LD 5EZJA 2IQAA 1WZ1H 3UROR 4OLZL 4ZSOE 1ZHLB 4S1RL 4HUKB 4JQIH 4WW1B 1G0XA 5C0JA 1FNEB 2O5XH 5CEZD 4D94A 2QQLH 3QFJA 4L3CB 1IGIL 1CLYH 1K6QL 2P5EB 4HIJB 4EOWL 3W0WB 3TCLB 5C8JB 1I8IB 5J57B 3ARPA 1QP1A 5CHNA 2X9XA 1G9ML 1AJ7L 1T20A 3OG6B 5I76B 4GKSA 1FH5H 2X5PA 1YEHL 4NFDA 4BQ9A 3VFGL 5HVFB 3AC0A 4M6OL 4OZGF 4JQVC 2HLFD 3ZSSA 1ADQA 4PJIA 4DEPC 2UZXB 1JPGA 3BIBX 3MRCA 2C3VB 3LQMA 2UYLA 1M6OB 2AGJL 32C2A 3VRJA 5E8PB 5KN5A 3QUMB 3DX7B 1UC6A 4LLQA 1MCPL 1NAKL 1X5XA 3UTSB 3EYVA 1INQA 1RV6X 4NT6A 5J6HA 1GH7A 4NO0B 3L7FB 3DJ9A 2GITA 3AS0A 3L3GB 3DXAA 2BY0A 5C86A 4X6DF 5E08H 3V4VH 4IOFC 1MREH