3CLMA

Crystal structure of transaldolase (yp_208650.1) from neisseria gonorrhoeae fa 1090 at 1.14 a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
352
structure length
352
Chain Sequence
GMTILSDVKALGQQIWLDNLSRSLVQSGELAQMLKQGVCGVTSNPAIFQKAFAGDALYADEVAALKRQNLSPKQRYETMAVADVRAACDVCLAEHESTGGKTGFVSLEVSPELAKDAQGTVEEARRLHAAIARKNAMIKVPATDAGIDALETLVSDGISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFFISRVDSALDATLPDRLKGKTAIALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYPDTLYVDSLIGVHTVNTVPDATLKAFIDHGTAKATLTESADEARARLAEIAALGIDVETLAARLQEDGLKQFEEAFEKLLAPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transaldolase (YP_208650.1) from Neisseria gonorrhoeae FA 1090 at 1.14 A resolution
rcsb
source organism Neisseria gonorrhoeae
molecule tags Lyase
molecule keywords Transaldolase
total genus 150
structure length 352
sequence length 352
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2008-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3clmA00
3OVRA 4MZ8A 1F73A 4IGHA 3NM1A 5K9XA 5BMWA 1TPDA 4KFPA 3LCGA 3PAJA 1I8JA 2WJZA 5DCBA 2G96A 1EB3A 3DFPA 3F03K 1W37A 1UASA 3S1VA 1ZJIA 1WBJA 5FI8A 1G7VA 2RDTA 1W3IA 5G2HA 3GXTA 1OX6A 1JCJA 1ADOA 3LHYA 4CQAA 3G1HA 3LOTA 1G69A 2C3ZA 1QDSA 3LCWA 1WXJA 4JY9A 3RFAA 3TW7A 4Z1BA 1P0NA 2C18A 1X7FA 2GJLA 2G97A 1MSSA 3NL2A 1PV8A 2J9ZA 4Z1AA 3HPSA 1K7FA 4JN6A 4K7YA 1JCXA 4JTJA 2PC4A 3P80A 3WJZA 1W5MA 4BFAA 3GDLA 4PA8A 1AL7A 1ZCOA 4GXMA 4CLMA 4WXZA 2E6YA 4IQLA 4DQWA 1K7XA 1W3NA 4OU1A 5CSSA 4AXKA 2YFNA 4BK9A 2QKFA 1ONRA 4K8EA 4BWLA 1OK6A 3PVFA 3GDKA 2HS6A 3BW4A 4FX6M 4GNJA 5CZJA 1ML1A 3GLCA 3ATZA 2X2GA 1F6KA 3NQFA 1Z48A 4JIPA 4JTSA 5FEPA 2GVJA 5LKYA 2DP3A 1H7OA 3LV6A 3O06A 3OBKA 4XQ6A 4LTSA 1H7WA 2C19A 4O4VA 3QW3A 4IMCA 5LNUA 2QCDB 1KFKA 1TIMA 4MLJA 4UTUA 2TRSA 4PL2A 1G4SA 2JGYA 1TCDA 4NNBA 3MP3A 2RDUA 3TJXA 4HPJA 3E0IA 4O1CA 3DKLA 4BF9A 4HNVA 2J6XA 1U5JA 1EWDA 4KWWA 4LVFA 3LV5A 5AHNA 3BG9A 5SWUA 4NVTA 3MJYA 1SO4A 2DZWA 2NX1A 1Q6RA 4O13A 2C13A 1IXPA 1KM1A 3LRKA 3P62A 1XBZA 3CU2A 3NZRA 2VC6A 1LZOA 1H1YA 4K8HA 4UTKA 1JRBA 1Y0EA 5AB3A 2IQTA 4O53A 4Z1CA 2HS8A 3DI1A 3Q2DA 3KRZA 3G0XA 2JKPA 1XL9A 4LC8A 2NUYA 4XWUA 5AOUA 5F4WA 4O57A 1H63A 3RMJA 2JKEA 5AHLA 4AWUA 3NQCA 5AFDA 1QO5A 2WQPA 3BLIA 4TO8A 2V0TA 4UUIA 1GVQA 3BG5A 1PCWA 3LRMA 4O4WA 1TV8A 3I7QA 3W7KA 4DO6A 3P84A 4FNUA 4CCDA 3M5VA 3OA3A 3FJLA 3BGGA 5EY5A 3R8RA 4K37A 4N4QA 2VEIA 3QRHA 3ABRA 4WX2A 4P2VA 3NM3A 5DY2A 1OFAA 2GUUA 3PSWA 3LLDA 4CQ9A 4FXSA 3GAYA 3T7VA 2DZUA 3S5NA 3HJZA 5FEXA 3TCEA 2NXHA 3MP4A 2NXGA 2VEMA 3LM7A 1AW5A 1FWRA 3G8EA 2ZRWA 1TO3A 1VLWA 2E5DA 3QMSA 5IBXA 3FEMA 3LHTA 4XKYA 2QCFA 5D2TA 4O1DA 3WK0A 4UTWC 3SI9A 4O19A 4H3DA 3FS2A 1XDMA 4ZMGA 3VFLA 3S8HA 2V9DA 4JTEA 2RKXA 4QJ1A 2WV8A 1R47A 4G1KA 2OT0A 3DZ1A 3TW6A 3W1XA 3W7DA 5LZLA 4X2RA 5IM51 4UFIA 4X3ZA 4O1BA 3S0CA 4FNPA 5HNRA 4FF7A 1QO2A 4UTTC 4WD0A 5LHEA 3SGUA 1I45A 4HNUA 7TIMA 4JDBA 4S2CA 1LBFA 4FXRA 5CZ0A 3LTPA 3DENA 3M47A 5CZSA 3CEUA 5FF0A 1DQXA 4KKXA 3LX9A 4IXHA 3U8GA 1S3HA 2V8ZA 1FCVA 1KTBA 3N34A 4R7JA 5K9CA 4N9CA 4LC6A 4ORIA 3MHUA 2TMDA 5CPNA 3QEZA 3THAA 1UCWA 1JUKA 1HTIA 3O05A 4MYAA 1P1XA 3M5YA 5EL1A 2Y70A 1LRQA 1L6SA 2NXIA 2W0UA 2YXGA 3FYOA 1DQWA 3LCFA 4IMEA 4TR9A 2ALDA 1C29A 3BG3A 3IVUA 2C6QA 1EP1A 1KA9F 4MZYA 3UPBA 4A2RA 2CW6A 4GUHA 3RNDA 3U6WA 1G6CA 1TTPA 1VGAA 3PULA 3EB2A 1LBMA 5HINA 1MEWA 3LRLA 3C2EA 4MUZA 1YTKA 4N9DA 1OX4B 3BPWA 5D2YA 3L2IA 3STEA 3A21A 1NF7A 1ME9A 2QCEA 5G4EA 4JX6A 2V2CA 3Q58A 4U28A 1PHWA 4AHPA 1O5KA 1T96A 2F7FA 4N2YA 3WJSA 3CEPA 1LOSA 2OZ0A 5E1QA 1EA0A 2I9EA 3LCHA 1H7PA 2FDSA 2Y89A 3N9RA 3L21A 3L5AA 1WOBA 2WNNA 4AAJA 1BTMA 3VNDA 2EHHA 5TBOA 3PUDA 3W6YA 3DFSA 3M6YA 3MI2A 1OFPA 3NOEA 3IIPA 3AJXA 3B0UX 4MKNA 2YYUA 2QUVA 1KFEA 1LTDA 1RR2A 5C5YA 3LXBA 1M7OA 3A5FA 3HGJA 2Y62A 2Q3RA 4LV9A 1YXCA 3A23A 4LRTA 2CZEA 3DI0A 2TYSA 3GIYA 1QNVA 4MFEA 1O94A 1KLZA 4ZZ9A 4ZQRA 4GWEA 1TTQA 2X1TA 2ZRUA 3PBWA 5HUPA 3GDTA 3RU6A 3UD6A 3N73A 4O0KA 2R91A 3NO5A 4NJJA 4O14A 3BVJA 3P5ZA 4XKYB 2CLKA 1ZY9A 2A6NA 1SW7A 2B7QA 1JUEA 3HF3A 4YLWA 2AQWA 3KVMA 3NQ2A 4S2BA 1SZEA 4CNPA 2C16A 4QNWA 3U2OA 4GC4A 4RJEA 4JXCA 3WJXA 3W84A 3SY5A 3UWQA 1OFQA 1OX4A 4FNSA 4QISA 4MIMA 3QC3A 1LBLA 3BARA 2VFFA 5FF2A 1ICSA 1QCWA 4IMGA 2P1FA 4YL2A 3W7QA 1I2NA 3G0SA 2BTMA 1XKYA 2HMCA 3ZS4A 5G1YA 3GK0A 4K6AA 4PCFA 4O11A 1RPXA 2A7NA 3GX9A 3T55A 3BW3A 3HG5A 3W7OA 3PG8A 4AWSA 4PTNA 3RK8A 1H51A 4POCA 5F1VA 3GYEA 3NPWA 5HUOA 1RQHA 5G2WA 1SZGA 4M7TA 5BRBA 1KFCA 1H5YA 1B3OA 3W07A 3SIZA 4AVFA 2YGYA 3W1MA 2YPIA 5K9DA 4IJBA 4MLRA 1OFOA 1EUAA 1WAUA 1WX0A 1RQEA 3NQAA 3G1FA 1W3TA 5AHFA 2XFWA 1XUUA 1KV8A 3QQ0A 3HBLA 3T4CA 1W5NA 1NFBA 2JGQA 3LI1A 4MY9A 3PBYA 3DFTA 1QPOA 1FWWA 2QCNA 2ZZ1A 3QYQA 3HG4A 3NPXA 1JCLA 4O1AA 1ALDA 3LXCA 4XBSA 1N55A 4UFKA 4RK8A 1R2TA 5D2XA 3G1AA 1HUVA 1OK4A 1TPFA 5K3VA 4LS1A 5AYZA 3NXFA 4U4MA 4AF0B 2BWGA 5DCDA 3A22A 4O50A 4HNNA 2I14A 2A7PA 1DV7A 4I7VA 2ISWA 3HGOA 1RV8A 3MHGA 1JQVA 2HTMA 1V7YA 1EPXA 3E96A 5D30A 2YW3A 1H7NA 3FKKA 3W2MA 3THQA 4DBDA 4DELA 2VFEA 4UTHA 1FWSA 3R2GA 2YCEA 4CQ8A 2GPTA 1XUZA 3CTLA 2CLEA 2B7NA 3IIVA 3DHFA 1FQ0A 1D9EA 4DF0A 3E12A 3YPIA 1GWJA 1W0MA 1SSDA 3EWUA 4TMBA 3CQ0A 2DZSA 1GQNA 4OV4A 1Z42A 2YX0A 5U7SA 2ZZ6A 5AHIA 3QPZA 4ALDA 4DBEA 5KZDA 1Q6QA 2W79A 3IVSA 1I4NA 1C9DA 3O6CA 2ISVA 3TNOA 2PURA 3A24A 4UCGA 3TIMA 3R12A 2CLMA 2CZFA 1M6JA 1FXQA 1JUBA 4JIQA 4N4PA 1KTNA 4OE7A 3NQEA 1SSGA 2GQ9A 1JCNA 4JDYA 3C8FA 1P4CA 4GUIA 3PC0A 3A5VA 2A2IA 1FCBA 3L9CA 1QR7A 3LHZA 1GTHA 2NWRA 1KM5A 4Q32A 1YXDA 1F7BA 1C8VA 5DBUA 5AC6A 5KMYA 5AHEA 3KOFA 3W2LA 3B8DA 3QF0A 1NSJA 5A8GA 2DORA 2WKJA 3C56A 2XN1A 3ANYA 3LHWA 3DAQA 4AEOA 1YLVA 4LOCA 3V1PA 4UTMA 3NGJA 3TAKA 3O6DA 1T0OA 3UY8A 1XI3A 1W8SA 4GFSA 4YCPA 1KM3A 3C52A 1OYBA 4OV9A 1HG3A 1IIGA 4AHOA 4ICNA 1K03A 4Q33A 5LNVA 5FF3A 1SUXA 2Y7EA 3TQKA 2WSYA 3NQ6A 5KZEA 4MVAA 1ICPA 2QUUA 5F2MA 1AG1O 2Y88A 1JQXA 4LT9A 2WPBA 4IMDA 3NL6A 2NUWA 4LVBA 3OHIA 2QAFA 3GNDA 3O1NA 4BR1A 4P61A 3UWVA 2Y61A 3KXQA 1TV7A 3DH7A 2Y85A 5EKYA 1VYPX 3TA6A 3MI6A 3V75A 4WUIA 3G8RA 1UUOA 1WYIA 5KITA 2FTPA 1EEPA 1I2RA 3ELFA 1KBIA 1RQBA 4EOUA 4JTIA 4YXGA 4WQ6A 4NX5A 3TU9A 2DZVA 2QEZA 4TU1A 5F2IA 3EEGA 3G22A 1JVNA 3CHVA 3LBMA 1VYRA 4O15A 1TRIA 2A21A 2XN2A 4XZ9A 3EWXA 3TK7A 4LWWA 1ZFJA 4IX0A 1XBYA 4K39A 3L0KA 2ZZ4A 3GZ3A 1X8FA 5D09A 4E2DA 1TJPA 3HQ1A 1BEUA 1K8YA 1M7PA 1XM3A 2ZZ5A 1NAL1 4A21A 3DFQA 1ZAIA 4HNTA 1TQJA 3CPRA 3HO8A 5DBTA 1B57A 3NDOA 1H1ZA 3W1PA 1LRTA 4Z0JA 3S5ZA 1FCQA 2TPSA 3B0VC 3EX1A 2WOQA 3DU0A 3BGJA 3W7EA 1B4KA 3FA5A 4CNNA 5LNWA 1F6PA 3ABSA 3N14A 1VH7A 4UXDA 4QAIA 4MPQA 3N2XA 3CLMA 3KHJA 2QCLA 3W85A 2Z1BA 1W5OA 3W74A 1TSIA 1Q6LA 3VKJA 2B7PA 2G5WA 4WZHA 6ALDA 3S6DA 2YFOA 2Y7FA 2QCDA 3GKFA 4KFNA 3C0JA 2EPHA 2V81A 1T8XA 4R34A 3W7LA 5HJLA 2LLEA 1TRDA 4AB4A 5DXXA 4IPIA 1PHQA 1MXSA 2P10A 2C14A 2ISSA 4HIBA 2X1UA 3W70A 4QSHA 2X1RA 2OJPA 4O16A 4UIOA 1KFJA 5F1UA 3STGA 4FHAA 3NNTA 3PS7A 3KVKA 1GVFA 2B0MA 3W7RA 1KFLA 1XBVA 4UR7A 3M16A 1TPEA 4DF2A 2RDWA 4ONVA 1HO1A 1H7RA 5AYYA 4GBUA 2WSRA 1HO4A 1P0KA 3LXAA 4NQ1A 2FIQA 1FWNA 4L4MA 3LERA 3P5YA 3BLFA 3DKJA 4NJKA 1QOQA 5U4NA 4HSOA 3NVTA 3W7PA 1FBAA 3FIGA 4Y8FA 1E51A 3E9AA 1YTDA 3NL5A 1ICQA 4AH7A 2BX7A 1VQTA 5KZMA 2QCHA 3M5ZA 4UTLA 3W71A 1YDOA 3TSDA 1TPH1 3HOJA 1F05A 3HGSA 3MP5A 2WNQA 1EP3A 1FX6A 3ATYA 4HKPA 1VRDA 3HPXA 2ZCGA 4X22A 5E93A 3W87A 2A4AA 2NX9A 3VE9A 3LTSA 3W23A 1R30A 3TFXA 4QQ3A 4DO4A 4DEFA 3UYCA 1J5TA 4OHQA 3M44A 5CPMA 4JY8A 2YR1A 3B0PA 3HG2A 4LW7A 5D2VA 3GKAA 2A6LA 5AHMA 5K2ZA 2UV8G 3HIJA 4O54A 5F4SA 1JULA 1X1OA 4IWWA 2F84A 4YWIA 3NL3A 3TC7A 4K38A 4UTTA 4UMBA 4GE8A 1SU5A 5CZTA 3NAVA 3NQ8A 8TIMA 5H91A 3BV4A 1W5QA 5T26A 1DL3A 3TH6A 3DFNA 4YMZA 5LGXA 5BW6A 1WBHA 4UMAA 3PB0A 1TPC1 1WA3A 4N9BA 1O95A 4Y9AA 4FEZA 3KVJA 5D05A 4O10A 1OFBA 2OT1A 2J27A 3EWYA 2AGKA 2RHGA 3PBUA 1VCFA 4FIRA 2VFHA 2A1YA 3FYPA 3W2NA 1OYCA 3QJAA 4MFDA 3M0ZA 4ADSA 1H50A 1H7XA 1KFBA 3SECA 3W2KA 1SW0A 1ZNNA 5EMUA 1G67A 3UQNA 1L9WA 4FB7A 2DJLA 4FNQA 3IV3A 3O63A 4WOQA 4HSNA 5TIMA 3HGRA 4EVZA 2VFGA 5LGZA 1K7EA 4ZQCA 4JEQA 2NZLA 4RXFA 3T78A 1LLZA 4O52A 2VOMA 3CT7A 1DKWA 4XUGA 1JCMP 1OF6A 1R46A 1BKSA 3KRSA 3NPVA 1LM1A 2R14A 3QMTA 3SFKA 1GEQA 3UNDA 1FXPA 2FPVA 3GAKA 3UZ5A 1LP6A 3NYZA 4UTWA 1Z44A 1EIXA 3W1NA 1ZALA 3OVPA 5LHFA 1V5XA 3UWZA 5HULA 3P74A 2X16A 1YDNA 3TAOA 2Q3OA 3C61A 1G4TA 4NXKA 2CLFA 2QCGA 3B05A 5D03A 5G5IA 5CKSA 3M1ZA 4UFLA 4W9TA 1AMKA 4LV4A 2QF7A 3LB0A 4MJZA 3GDMA 3QW4B 2O7QA 4E38A 4NJIA 4JYFA 3TX9A 2CLOA 3G1VA 4H4IA 3G3DA 3TQVA 3E02A 1XDLA 2QUTA 1IXNA 1Q6OA 4HT3A 1ZENA 1SZFA 3C6CA 5CPLA 2ZRVA 2Y7GA 3NQMA 3DGRA 3N9SA 3MMTA 3TSBA 1F76A 3ZWSA 5F2LA 5I3HA 4BI6A 4NJHA 1W1ZA 1W54A 1K8XA 5C54A 1QPRA 3ABQA 3I68A 5ABTA 2VFIA 3EX3A 3MBFA 2Y63A 3PSVA 3W7NA 3A9IA 1TV5A 4ZQPA 2ZZ7A 1KTCA 3TJLA 5TQLA 2FLIA 4C1LA 1JRCA 4N02A 1QWGA 4WJEA 1PCKA 5D04C 3IGUA 2ZTKA 3DXIA 3JR2A 5FEZA 2CFFA 2DU2A 2V82A 5HWNA 5EYWA 1KLYA 3FLUA 4O8RA 4LVGA 4GUFA 4EIVA 3S1UA 3L66A 3DFOA 2VEKA 3NG3A 3LHUA 3SJ3A 1AK5A 3C2OA 3P82A 5D32A 5HR6A 4GUJA 5BMXA 1OABA 1PE1A 4ZVJA 1J2WA 3TSMA 4BI7A 2O7SA 3BO9A 1X6UA 3MW7A 4I7WA 3WK3A 2JKAA 3MO7A 1GPWA 3W1AA 1KW1A 3EWBX 1FWTA 4FO4A 5C2XA 3IVTA 4NZJA 4E2BA 4J9JA 1YTEA 4QITA 3EX2A 3W2UA 4JX4A 1F5ZA 1GZGA 3GDRA 5D38A 2Y7DA 2Q8LA 1SPQA 2H6RA 4UFHA 5K7JA 5MHBA 3UWUA 3CC1A 5D02A 1SO5A 3B03A 2FFCA 3MI3A 5DY3A 3F4NA 1GG1A 4PFMA 1PIIA 1PVNA 4Z08A 4JTKA 5CSRA 3G18A 2BZNA 5CPOA 1P5BA 1EUNA 4JYEA 1K02A 5EPDA 4LNYA 2QDGA 3L68A 3VCRA 2E68A 2ZYFA 3HB9A 3TDFA 4AMAA 1AL8A 2ZBTA 1VYSX 4RKAA 3KX6A 4LRSA 1UJPA 4NZFA 5FF4A 3LCLA 4RLIA 1WOAA 2ABAA 4MYXA 1R2RA 3FJ6A 1K3UA 3NQGA 4M7SA 4Y96A 1TREA 3MUXA 3W7IA 3VE7A 2QAPA 2GVLA 5I3IA 5LNSA 4LU0A 3BK0A 1UUMA 4NNCA 3W7JA 3O8AA 5AC7A 5C6MA 1G7UA 4DF1A 1NVMA 3I6RA 4PODA 1FCUA 3GVGA 1GT8A 5HR7A 1KM6A 1GVOA 3KRUA 2BSLA 3VI2A 3QM3A 2C1HA 3QSRA 1EX5A 4O0ZA 1CI1A 5D2WA 3P67A 2YYTA 2CWNA 2OCZA 4LUIA 3IGXA 2GOUA 5C55A 3MWAA 4OGZA 4PC8A 3KFTA 3EX6A 5H2ZA 2B4GA 3K30A 2XN0A 1AW2A 3W76A 1W5PA 2GQAA 4Q4KA 3WJYA 5I3JA 5KSWA 1TPVA 4GUGA 4CCCA 3TC6A 4LS0A 4K36A 2VFDA 1QFEA 1H61A 3LHVA 3G24A 2QJIA 2EF9A 1IXQA 4A3UA 2FB2A 4JD4A 3DBPA 1DOSA 4OT7A 2VENA 2PRMA 3E49A 2A5HA 2YZRA 3M5XA 2ZA2A 2W6RA 3STFA 1FDJA 3TXVA 5F2GA 3HMJG 4UFJA 3CIWA 1O60A 1TMHA 2V2HA 1QPQA 2CLIA 4M19A 2QCCA 1ME8A 2RH9A 3TR2A 4M6QA 3TQ0A 4EF9A 4O28A 4DPPA 2J9XA 2V30A 3UZJA 2ZZ2A 2GQ8A 4UNKA 1VZWA 3NQVA 2A85A 2QDHA 3JRKA 6TIMA 2C15A 3NR0A 3PWAA 3MYOA 2H3BA 4JICA 3UXDA 3TXZA 3ZFHA 5FF7A 4A29A 1LOLA 4Z0SA 4ADTA 3UWYA 4JTLA 4A2SA 1LCOA 3TMLA 4RZ4A 3SR7A 3EWZA 3G0UA 3W75A 3C2FA 3T40A 3PG9A 4H6KA 1OVDA 1M5WA 1GVSA 5L6UA 1KBJA 1S5VA 3H53A 5J5RA 1VHCA 3D0CA 2ATSA 4JTHA 2BXVA 3HPZA 1H62A 1KM0A 3EXSA 3OEXA 4NNAA 3USBA 2FQIA 4NXSA 1YADA 3QFEA 4TMCA 3INPA 2E09A 2WO5A 1I2PA 3LI0A 3WFAA 2H90A 4E0CA 4O18A 4UR8A 3HG3A 3QPYA 5KTLA 1MEIA 2E5CA 4I9AA 4CCEA 3UWWA 4RXGA 1VS1A 3FFSA 2Q8ZA 4AWTA 4L4LA 3W86A 4OBTA 1GTEA 2A0NA 3M43A 3IRDA 1W56A 2CLLA 4ML9A 2P0OA 5F4XA 3UPWA 3BLEA 2OX1A 3OG3A 3DHDA 2NV1A 1SFLA 1DVJA 1OG0A 1CW2A 2H8XA 5K4ZA 1MEHA 3FKRA 2PE4A 2J88A 3WJWA 3IGSA 2V5BA 5DCEA 3QH2A 1DHPA 1A53A 3S9YA 1HL2A 3M9YA 1EWEA 3GR8A 5AC8A 3L5MA 2VXNA 3ZR4A 1T99A 1D3HA 3TMQA 4S1FA 4UNLA 5E0KA 3UY7A 4RV8A 1LORA 1MZHA 2CZDA 3R13A 5HWMA 2ATMA 1SO3A 3N19B 3ABOA 1L6WA 3P60A 1B4EA 3QZEA 3W7CA 4FNTA 2PRHA 2ZZ3A 1JCYA 3W2JA 1UBSA 2NLIA 3IIXA 4NU7A 2VKZG 1GYLA 4GRSA 3W1QA 5D37A 3CWOX 2J9YA 1PL9A 3NEVA 4OQVA 4O17A 3F1QA 5L9FA 3ZWTA 1Q3NA 1VLIA 2YDAA 4UTIA 5K4XA 5GVJA 4EWND 2JK2A 1QOPA 3G1YA 1W31A 2KZHA 3PR2A 3PUEA 1OX5A 1YDVA 4Y90A 1AW1A 3LCIA 1SQ7A 1TPWA 3W7MA 1FDYA 2X30A 3L65A 2H3DA 3IIZA 1IGSA 1MO0A 5HQEA 4QIUA 3SW6A 1S5TA 3F4WA 3G1DA 2ZDRA 3OVQA 2YSWA 1BWKA 4MJMA 1O5XA 4I7UA 4GJ1A 5G2IA 1TPB1 3IIOA 2QCMA 1A5BA 5A5WA 3S42A 4PEKA 4X9SA 2TSYA 3H55A 3W72A 1DBTA 1VC4A 5DN1A 5AN7A 1GJPA 3NQ7A 5LNRA 4MY8A 5BNKA 4B5NA 3GR7A 1H60A 2E5BA 3PY2A 4WXYA 1L6YA 4JS3A 4XBKA 1KM2A 1J4EA 2GVGA 3N3MA 3P8IA 3B4UA 2RFGA 1X1ZA 1SZNA 4R53A 3I65A 3PM6A 1U83A 4XTIA 2Y6ZA 2A7RA 4JTTA 1VCGA 1Z41A 4FNRA 4FX8A 2PCQA 3R5EA 3P81A 4IUOA 2CZ5A 4DXVA 2ZQ0A 2EGZA 5G4WA 2Z2UA 1VR6A 1YYAA 3Q94A 3CWNA 4BWLC 3NQDA 1FY6A 2H8ZA 3RLVA 1KM4A 3S5OA 4MOZA 1SW3A 5J5DA 4XTDA 1ZAJA 4RR4A 3IEBA 1SR9A 5HWJA 2DZPA 5FEWA 2G95A 4MZ1A 1OFEA 3RLUA 3W7HA 5FESA 3L5LA 1FUYA 3S1XA 4NX0A 5I3FA 4DPQA 4YCOA 3W73A 4AF0A 4IPJA 4R33A 3SSJA 3W22A 3R89A 3M41A 1NEYA 2PRLA 3EKZA 1UB3A 5CG7A 2B7OA 3W3OA 2BLEA 4TX9A 3TE9A 3GXNA 1A5AA 3W83A 4RZ6A 2QJGA 1LYXA 4ZQMA 3W1UA 2FPTA 4JTFA 4M6PA 2ZA3A 1N7KA 3B06A 4KFOA 3PUOA 2C0AA 3O6YX 4HHPA 1XXXA 3P7YA 1A5SA 5EA9A 1OYAA 1RZMA 1RVGA 5LSMA 2ABBA 3EXRA 2JBMA 3RF9A 4M5PA 2ZRZA 2QJHA 3G3MA 1ZHAA 2VELA 5DXYA 4RCXA 3QQ1A 2QR6A 3Q37A 4HN4A 2E6FA 2GJNA 3JS3A 1VCVA 2E6DA 1IIHA 2NWSA 4UFMA 3EX4A 4UC5A 1D3GA 3P8JA 1I2OA 1WQ5A 3MHFA 1TTIA 2E6AA 4WY0B 2WNZA 4HPXA 2X1SA 3G1SA 3LTYA 4LVAA 5DELA 1A5CA 1O4UA 2R94A 2E1DA 4WY0F 3S5YA 5EBUA 5DLCA 4LS2A 1QPNA 2CU0A 1GG0A 2DZXA 2V5LA 3GB6A 4KWVA 2DJXA 2V2DA 3W7GA 1VPXA 3L67A 3NPUA 1DJNA 1B9BA 2ZRXA 3TUUA 3G1XA 3O07A 3MBDA 3OIXA 2NX3A 3P61A 3LCXA 3LDVA 4QNEA 4EF8A 3SZ8A 4IX2A 3CIXA 3LGEA 3GNNA 3EXTA 4JNMA 4ZL1A 4ZQNA 3B04A 5I3GA 1FDZA 4RZ5A 5IBXC 1YPIA 1JR1A 4JTGA 3PB2A 4O12A 1DJQA 5KINA 1LROA 1WV2A 1IF2A 4A22A 4JGDA 1G4EA 3STCA 1LLWA 1XC4A 4M6VA 1YPFA 4N6EA 1DORA 2ZRYA 3O15A 1F2JA 5AYXA 1TPUA 4FX7A 1L2UA 2WSQA 1JJKA 4FIQA 3W88A 2CLHA 4OWGA 3PF3A 1BWLA 3CM4A 1GYNA 4C1KA 3QMRA 3QSTA 3PBVA 4UTJA 4D2JA 1THFD 3CB8A 1HFBA 3SGZA 1TTJA 3I7SA 3GXPA 4JYDA 2NV2A 4TIMA 4JR5A 1QMLA 4LY8A 5HMSA 1TYGA 2ZTJA 3WK1A 3EWWA 3EKLA 3LLFA 1IXOA 3MYPA 4IXXA 4IMFA 1TB3A 3TV8A 4JX5A 4ADUA 3FOKA 2VEPA 4RX0A 5BOOA 3T44A 4JTUA 2DZTA 2Z0IA 4NT0A 1LRNA 3S1WA 4NUWA 1GVRA 1LOQA 1GOXA 2FJKA 5D33A 2EKCA 4N6FA 3UXAA 4ZQOA 2FB3A 3NZ1A 4PH6A 3W1RA 3C2RA 2EAWA 3O16A 1TJRA 4UMCA 1VHNA 5I3KA 3TROA 4QM1A 5G1TA 1XBXA 4LVDA 3TFCA 4DO5A 2J24A 1ZAHA 1G4PA 1LDCA 2NUXA 3C3NA 4K7VA 4LUJA 4WY0A 1SO6A 1OF8A 1WDWA 2Z6JA 1RD5A 3H54A 3LBCA 3BW2A 1KV5A 3NA8A 1N8FA 4Y6GA 3AO0A 2Z6IA 2AAMA 4ORMA 1R2SA 1XCFA 1Q45A 3W1LA 1F74A 2D73A 4MY1A 1S5WA 2ZA1A 3M7WA 1SFJA 2R8WA 4AHQA 2I1OA 4Z1DA 2HSAA 1TQXA 3W1TA 3W9ZA 2ZFAA 5CGQA 3I7RA 3WK2A 1EP2A 1CX9A 1NF0A 1YXYA 3KVLA 4PL1A 3KAOA 3L0NA 1K8ZA 1PS9A 1XFBA 3TKFA 3C4UA 4NJGA 2OMAA 1I2QA 1QAPA 4IOTA 3C2VA 1ME7A 4N9EA 4WOZA 2FPYA 3N2MA 1VJIA 1OFRA 3L0GA 1OJXA 2YW4A 4CNOA 1OHLA 2E77A 4BI5A 1A50A 1OFDA
chains in the Genus database with same CATH superfamily
4AD3A 2ZUUA 3MB9A 3CH0A 3V35A 1MFVA 3S5SA 6PTDA 3WD0A 2QGYA 2OYMA 4HCHA 3CUXA 3V5CA 2R1KA 5BXPA 3F03K 4IL0A 3SCTA 3ANVA 3T2OA 4EANA 4UNIA 3S1VA 4HTYA 2ON3A 3IJLA 1G7VA 2RDTA 1W3IA 4ZXLA 4GNKB 1WKDA 4M51A 1E0XA 4CVWA 3GXTA 1JCJA 5XINA 2C3ZA 1QDSA 3CK5A 3WN6A 4TUFA 3O7UA 4JY9A 1QUMA 3RFAA 2J13A 4Z1BA 1X7FA 3WDIA 3RLGA 1NDYA 4O8AA 4YYCA 3PZVA 2W63A 1GORA 3BUVA 4FA3A 3HPSA 4JN6A 4KPLA 1J10A 1ZBCA 2PC4A 2CNCA 3P80A 4YVVA 3GDLA 4QX4A 4P7LA 4AIUA 4AY1A 1AL7A 3QKZA 1QOXA 3BJFA 3HMCA 3CL8A 4DM2A 4CEXC 4WXZA 2YBTA 2E6YA 4IQLA 1ITUA 5E0FA 4OU1A 4L6OA 4AXKA 4BK9A 1KCKA 5I77A 1OK6A 1XIJA 2I7GA 1OWQA 4FX6M 1OY0A 5BOFA 2X2GA 3U7BA 2WSPA 4JTSA 4IGSA 5LKYA 1KD0A 2DP3A 4W7VA 2OO6A 4XQ6A 4LTSA 1UZHA 5CZKA 3PZGA 3QW3A 1V77A 5LNUA 4XZWA 4HPJA 4O1CA 2E67A 3B4YA 2GGJA 3DX5A 3LV5A 1WO2A 7XIMA 3WLJA 4P8UA 2ZOXA 2OEMA 1Q6RA 1IXPA 4CUCA 1KM1A 3LRKA 2D2JA 1XBZA 3P62A 3NZRA 3LA4A 2XWDA 4IMAA 1RLDA 3URBA 4FLQA 4K8HA 4WKFA 4UTKA 1Q7QA 1JRBA 4CD8A 2IQTA 2HS8A 3DI1A 3KRZA 5BYWA 1PZ1A 1XL9A 5EBAA 2DFAA 1IQ8A 5JQ9A 2JKEA 2XUCA 1BG9A 3NQCA 4TO8A 4H9YA 2I17A 2V0TA 4UUIA 3BG5A 2DT2A 1PCWA 2EG6A 4JKMA 3SN4A 3I7QA 3W7KA 4PMYA 1Q4WA 5E09A 4AIEA 2V5JA 3BAKA 3ECQA 3M5VA 2Z24A 4QGCA 3ALGA 2XSXA 1CGUA 4N4QA 3NURA 2PU1A 3ABRA 5D8WA 1XGEA 3SURA 2GUUA 3OZOA 1V93A 4ZSUA 3P93A 1OADA 5JIWA 4XB3A 1O1HA 3SSZA 4DUOA 4I5RA 1NOUA 1EZWA 2WSKA 2P50A 2ESCA 1VLWA 4XVEA 4C6MA 4XKYA 2QCFA 3LN3A 3VMNA 4O1DA 3WK0A 3PP7A 3S47A 3CHCA 3G1RA 1R3QA 4JTEA 3MMDA 3GU9A 3W7DA 4XISA 4X2RA 4UFIA 1ZBWA 1CLKA 4X3ZA 5BCAA 4HHLA 4O1BA 4HMNA 1JFHA 1DXIA 1QO2A 3SN1A 5M2FX 1B5TA 1E15A 4DUVA 5CZ0A 5MKGB 1TV2A 4LANA 5EFDA 5DMYA 3T05A 4DJDA 1KTBA 1EHNA 1RSCA 4N9CA 4ORIA 2HNHA 3MHUA 5CPNA 1V02A 2Z28A 1HTIA 4PMVA 4S23A 1R3YA 1LL4A 1P1XA 5LA1A 4M8UA 2Y70A 2NXIA 3FYOA 1QW8A 3UR5A 1FHLA 2C6QA 2Y5JA 1KA9F 4H01A 1J12A 1ZB5A 2ZX5A 3VMPA 3MCOA 4MZYA 4A2RA 1PX3A 5BU6A 4L4OA 1ISZA 3QYSA 1G6CA 3SEPA 2E8ZA 1LLOA 3IANA 1Z89A 4GISA 5LIKX 1Y8BA 3LRLA 3C2EA 4RPQA 1Q4NX 1X6NA 2XSBA 5D2YA 2YL8A 3L2IA 3BC9A 1BHGA 4XD6A 2DZAA 2QCEA 2WZIA 3AMDA 3APTA 3SCNA 4LQ1A 1EGVA 3M0KA 4AHPA 5CG0A 4JFWA 4HU8A 1LOSA 3WBYA 2PTXA 4R88A 2I9EA 4FOJA 2CBJA 4Z2JA 2Y89A 1HL8A 1WOBA 2CWXA 2WNNA 1PDZA 4PBEA 7REQA 3W6YA 3M6YA 6REQB 3MI2A 2UWFA 1ZJHA 1TWWA 1MWOA 1W1YA 1R3WA 5XIAA 1EQPA 3LXBA 3A5FA 2Y62A 2IQ0A 4HA3A 1UZ4A 1H5VA 5BZAA 3GIYA 4MFEA 3N1AA 4GWEA 1TTQA 2X1TA 1TZ7A 4WLCA 3CTTA 3NO5A 2XU2A 5F7UA 4O14A 1OQFA 3P5ZA 3ZJ8A 2A6NA 1SW7A 1JUEA 4W88A 4ASTA 4GIAA 1Q6DA 3HF3A 4G7FA 1H0GA 1B1YA 2JEPA 1V51A 4PRRA 1SZEA 4CNPA 1Q7ZA 3K1DA 3H23A 3GNPA 3L23A 3W84A 3UWQA 1OFQA 1ZL1A 4FNSA 4QISA 4MIMA 3BARA 3WG6A 2P8BA 4DJFC 4RNJA 2OWXA 3LENA 5HMDA 4LAKA 3V36A 3VIFA 4PBFA 4IMGA 4ZE4A 2P1FA 2GWGA 3QOMA 2FGZA 4YL2A 5IFTA 3WD2A 1XKYA 1W1A1 2NSXA 5G1YA 3ZS4A 3GK0A 1A4MA 4K6AA 2DV0A 4J3VA 1AFSA 1XKJA 3VXGA 3OU8A 2C1GA 3ARTA 4GHRA 4H8NA 1VD6A 4ZODA 4POCA 4C1NB 3GYEA 5HUOA 3EB4A 5C7HA 2WC4A 3WDQA 1OIMA 2VI0A 3G77A 1HKJA 1B3OA 4G56A 3GU1A 3W07A 2CERA 4YTQA 1MYRA 2QZRA 4MLRA 1WX0A 3ZZ1A 1RQEA 3NQAA 1RLCL 3ARXA 4RUBA 3QZAA 5AHFA 3ID7A 5M17A 3SRFA 1XUUA 1P0EA 2PDWA 3LI1A 4LBSA 3PBYA 3HG4A 2QJNA 2VTFA 3LGGA 1XPYA 1ALDA 3KBJA 3LXCA 4XBSA 1N55A 4RK8A 1R2TA 5D2XA 1J0JA 1HUVA 5AYZA 2GJRA 4GGHA 4U4MA 1IWAA 1NWUA 2G4JA 3PZQA 3KTXA 4HNNA 1MUWA 1X1NA 2PPGA 1SJCA 1EJWC 1D3CA 3MHGA 1KXHA 5IRPA 1DJWA 4ACZB 3AIUA 1EPXA 1F4HA 5D30A 4F4RA 5D9MA 1H7NA 3W2MA 4DELA 4YJ5A 3THQA 5E9AA 2XISA 3OB8A 4MNLA 4CQ8A 1Z9AA 1XUZA 1UOKA 3AZTA 2B7NA 1XYLA 3ISIX 3IJDA 1N82A 3JZUA 2VOTA 4DF0A 3YPIA 2W5FA 1W0MA 3IS4A 2CPUA 1TMLA 1E6ZA 4F2UA 4IJCA 4Q6XA 3BOXA 3VINA 1C9DA 4PN2A 2ISVA 1GQLA 1FP9A 3VOIA 1ZGDA 4AC7C 2CZFA 4GH1A 2VEGA 1KTNA 3TCSA 2YOCA 2D23A 3BURA 4CCZA 2GQ9A 4JBRA 4C6FA 4AVOA 1IR1A 3A5VA 2A2IA 4PCPA 3L9CA 2PD5A 1GTHA 4Q32A 4OVXA 3VNLA 5C9RA 2G3JA 3MMWA 4AEEA 2OGJA 4GZ7A 4YWSA 3EMQA 2OYLA 2G3IA 4GZEA 4M82A 4JNZA 3QF0A 5A8GA 1KRBC 4FR6A 2DORA 2WKJA 3PK7A 1HL9A 2XN1A 3DAQA 1UR9A 3V1PA 4ATLA 1YEYA 3CYVA 3UY8A 3ALFA 1W8SA 1SR0A 1NM9A 3TJ4A 1KM3A 4OV9A 1HG3A 1DIEA 4ICNA 1J6OA 1ZU8A 3WH9A 1SUXA 3W82A 3H6OA 3RCNA 2WHLA 3W4RA 4QDPA 3EWCA 5F2MA 4LUSA 4KMQA 2WPBA 2Z29A 3OHIA 3CS2A 4MWAD 1FWHC 5I07A 4MAZA 1TV7A 3CZEA 5DMLA 4P5UA 1U33A 1EQCA 4WUIA 1UUOA 2XVNA 1WYIA 3NVDA 4QDWA 1UROA 3A3XA 2CXEA 3T6CA 1AQ0A 1RQBA 4WQ6A 1WDQA 3GFXA 2DZVA 4TU1A 4KQNA 1JVNA 1VYRA 1TRIA 2A21A 2ISFA 2DSKA 4XZ9A 3H2OA 2FZ9A 5GNZA 3TK7A 1KQZA 4IQEA 3ZO9A 3C2YA 1E5NA 2HCVA 4I9JA 2EG8A 3GZ3A 3WL0A 4RE4A 2DSZA 5D09A 5BROA 3CAKA 3IJ9A 1BYCA 1UH3A 1XM3A 5JU6A 2J25A 3HM7A 3DFQA 1ZAIA 2W66A 1LQAA 3CPRA 3HO8A 5DBTA 1FWAC 1H1ZA 1E4LA 3K4WA 3RAOA 1PKNA 2TPSA 3P0WA 4B3KA 4LF2A 2WOQA 3DU0A 1WDSA 4JOMA 3FA5A 2GJPA 5HQMA 4UXDA 4HJFA 5CCZA 1JPDX 3N9KA 4MMWA 4KWOA 4MPQA 6XIAA 3N2XA 3CLMA 4DJFA 2Z1BA 1R5YA 1TSIA 3FGCB 4GLEA 3VKJA 1PBGA 2AKZA 3N2OA 3V0SA 3GKFA 4KGLA 4KFNA 5DF0A 3M0LA 3W7LA 5HJLA 4F0SA 3TTEA 1IWBA 3MCMA 3WMCA 2PDXA 2XH4A 4IPIA 4JL2A 4ATDA 2O9RA 5A6BA 2OJPA 3GG1A 4L5ZA 3T09A 1JGIA 2KX9A 4FHAA 1VFUA 3PS7A 4Z42C 1GVFA 5RUBA 2WHKA 4DF2A 4ONVA 1HO4A 2D0FA 3LXAA 4NQ1A 4MAVA 1MW0A 1TUFA 3LERA 2C0HA 4OOZA 3DKJA 1CCWB 3VD7A 5KETA 3IJ6A 2PGWA 3W7PA 4B5XA 4JTRA 5TD4A 4Y8FA 1E51A 2PLKA 3E9AA 1YTDA 1Z3NA 4IIEA 2QJJA 3TSDA 4Z17A 1J2BA 3VIJA 1TPH1 3HGSA 1F05A 3MP5A 5A6KA 1XIIA 1VRDA 2X40A 4DJEA 5T9CE 4HU4A 3DG6A 3THDA 3VE9A 2PTYA 1W3JA 2D3NA 3QGVA 3ZQ9A 8XIMA 1R30A 5C9WA 1FWCC 3U2EA 4DO4A 1E6NA 3UYCA 4HMCA 3M44A 4B16A 3HG2A 3WFLA 2UV8G 4H9TA 4O54A 3DGBA 1JULA 4CNSA 2F84A 3L2LA 3TC7A 4K38A 1SU5A 2ZVIA 2OQYA 3NQ8A 3MV01 5H91A 1WKYA 1V8EA 4WF7A 2DW6A 4GZIA 1GOOA 1TPC1 2VUNA 4Y9AA 5D05A 1OCNA 2Z2AA 4M56A 2J27A 1UZ1A 3EWYA 1GOMA 2IKIA 2NT1A 2AGKA 3RN6A 3ZLHA 3QGKC 1XLIA 2WMHA 3I3EA 1EXPA 3QJAA 3J7HA 1H7XA 3SECA 1KRAC 1SW0A 1LWIA 1UW9A 1G67A 2J4GA 4FB7A 3UQNA 2DJLA 3O63A 5TIMA 3LQLA 1AQMA 1TE1A 2I5GA 1EC9A 2R24A 2HZGA 3SO7A 1NQ6A 1G9HA 2V3EA 4JEQA 5CC7A 1PDYA 2NZLA 1JFXA 1IGWA 4RNFA 3QPEA 1R46A 1BKSA 4OKDA 3SFKA 1J9YA 3VNIA 1LP6A 1AH3A 2OWCA 1I9CB 1ZALA 3WBAA 4HOXA 3TAOA 2Q3OA 5A8QA 4ZE5A 2DT3A 2B31A 3WEZA 2QCGA 2E40A 1UJQA 5D03A 5G5IA 4LV4A 2QF7A 1S2TA 1PAMA 1LG1A 4MJZA 3W01A 2UY3A 3QW4B 2PDNA 4D8LA 4NJIA 4JYFA 3I3DA 5HMEA 4H8HA 2CLOA 4CD5A 1YBQA 2QUTA 1Q6OA 3I6TA 3N11A 1WZKA 3VNYA 1YMYA 1TELA 3TSBA 2HNEA 4F0KA 3ZWSA 5GNXA 2OLAA 4QS6A 1O66A 1OEPA 1W54A 1K8XA 2HPIA 3GS6A 5C54A 4YTTA 3ABQA 2ICSA 2ZX7A 3EX3A 3MBFA 2Y63A 3B9DA 4C65A 1XCXA 1OZMA 1QWGA 3IGUA 3JR2A 2R1NA 1TA3A 2BNJA 5HWNA 4BCEA 5EYWA 3B9OA 2AL2B 2PCEA 4RE0A 4X2PA 3FDKA 3GM8A 5I79A 4F9JA 4F2BA 3A9BA 3OPSA 3SJ3A 3OHMB 4FZIA 4Y2WA 3MUZ1 4O0QA 5D32A 2QV5A 3GE7A 1OABA 1PE1A 1TJ1A 1J2WA 3WK3A 2WHMA 2GUBA 2JKAA 2HWGA 3W1AA 3EWBX 1HW6A 9XIMA 3IVTA 3WQ6A 5DMNA 3EX2A 1C91A 1F5ZA 2CBIA 1C93A 1JXJA 2AMXA 4H7VA 4Q4RA 1CBGA 4QR6A 3UWUA 3CC1A 3EZ4A 4MDPA 3B8WA 3F4CA 5B7YA 5DY3A 4PFMA 1PIIA 1YNQA 1T41A 2VZOA 3VNKA 1P5BA 3AIBA 1XF0A 1Z69A 4HP5A 1UWIA 4WDTA 3TWAA 2E68A 2ZYFA 4JFSA 3SY1A 4JTCA 3UR2A 3GYCA 2R1MA 3L12A 1AL8A 2ZBTA 3DECA 5FF4A 3TN5A 1UIPA 1XYCA 2ABAA 3FJ6A 4QE1A 1K3UA 3OBAA 5LNSA 3K1GA 4LU0A 3BK0A 3O8AA 5AC7A 4AD5A 2O9OA 4GI4A 3I6RA 4C6JA 1U1HA 5I00A 1GT8A 3B9NA 1QU4A 5HR7A 3KRUA 1FH9A 3K8MA 3WUBA 3QM3A 1CI1A 3C5QA 4GO9A 3P67A 2YYTA 3DDMA 4LUIA 1X97A 3AYVA 1VFLA 1RJRA 4M3PA 4OGZA 3EX6A 5T91A 3KOYA 1AVAA 4KEZA 3W76A 4OIFA 2GQAA 4J1OA 5I3JA 3C8NA 3PZOA 4Q8NA 5DANA 2J7CA 2DSVA 2VZSA 3CQJA 4XAGA 1QNOA 1IXQA 4AIBA 4A3UA 3RR4A 3DBPA 3OG2A 2V69A 3GNXA 4GK8A 2A5HA 4BA0A 1HJQA 3RIKA 3M5XA 2A3EA 2W6RA 3TXVA 1FHDA 3MA8A 5F2GA 3E1F1 3CIWA 5M03A 3DFHA 1TMHA 4HK7A 1QPQA 2CLIA 2QCCA 1DJYA 1GYMA 1XIBA 2EO7A 1OT2A 2J9XA 3ITGA 2ZZ2A 2ZX6A 4W5UA 4WDUA 3NQVA 1EO7A 4ZTYA 2GUYA 3JRKA 1KCZA 4MPKA 1E5JA 2H3BA 1HQTA 4JICA 1JEZA 3UXDA 3TXZA 2CEQA 1XYAA 1LOLA 4Z0SA 2G3MA 4A29A 4ADTA 3W29A 1TX2A 3PNZA 3VZYA 4Y9OA 4LNCA 3KOZA 4DJDD 2R82A 1AH4A 3T40A 4Z2HA 1FH7A 5TF0A 4H6KA 3CWHA 2DSWA 1CZ1A 4DUXA 5J5RA 1VHCA 2ATSA 3RRXA 4F8XA 3BGAA 2AL1A 1NDZA 1C7TA 2HVMA 4GQBA 2FQIA 3QFEA 2E09A 3KDOA 5FSDC 2WO5A 4A8LA 1BPLB 1PKLA 1I2PA 5CAKA 3D6NA 1WKEA 4KETA 2H90A 2IXUA 1KGWA 2PBOA 3N4FA 2E5CA 2X42A 3AIQA 3LG3A 4JQ1A 4CCEA 1SVDA 4IGMA 4AZCA 3T0BA 1N8IA 4IG2A 3VIPA 4NZ4A 4RXGA 3OYZA 1E3ZA 2OZ8A 3IGHX 3T08A 4L4LA 3M43A 3IRDA 2CLLA 2P0OA 3ONBA 3UBPC 1DVJA 1IT8A 2H8XA 5K4ZA 2CXGA 2PE4A 3T07A 2EPMX 1CXHA 1A53A 3CYJA 3CMFA 1EKOA 4JCLA 1DJXA 3K46A 4NF7A 2JF7A 3BCDA 4GNVA 3ZR4A 4S1FA 4UNLA 5E0KA 3K5XA 1HF6A 1XLCA 4JIEA 2YA2A 1B4EA 1A4LA 5I7GA 1JCYA 2VKZG 3WUEA 5D37A 4HHMA 5AVNA 1PZ3A 1ZP3A 2PWDA 3ZJKA 3ZWTA 2IPJA 1A3XA 5K4XA 3PTDA 4UTIA 4EWND 2KZHA 3PR2A 4FMVA 1R8LA 3DOPA 4Y90A 1AW1A 1UKOA 3W7MA 5CJ5A 4ACYA 2X30A 1MO0A 1S5TA 3G1DA 2VMFA 2NVCA 2YSWA 3TTQA 1O5XA 2GVYA 3VGFA 4DVOA 3UXIA 2QCMA 2PWUA 4XUYA 3WUGA 1QK0A 4PEKA 1D7FA 2TSYA 4UZSA 3W72A 1DBTA 1VC4A 2VGIA 3EOOA 3HV8A 1Q6FA 2E5BA 3PY2A 6TAAA 1L6YA 4CQCA 4NZCA 3N3MA 4PTXA 3WLOA 3B4UA 2RFGA 1X1ZA 3CUFA 2BGQA 2FZDA 4HMDA 3CGTA 4DZIA 2A7RA 2PA6A 1UWAA 3BE7A 3U4AA 4FNRA 2QPXA 1T7LA 4LF1A 1GK8A 3PAOA 3RPTA 2ZQ0A 4S3EA 3OGVA 1T5AA 1VENA 5G4WA 1VR6A 4BWLC 1FY6A 3RLVA 3GBDA 3MU7A 2CYGA 3QV7A 1PX8A 4S3JA 2AMGA 2ZXBA 3MVIA 1EJRC 4HZ6A 4YTUA 3N2TA 4OUEA 2E7FA 5I3FA 4LSBA 1W2PA 4S38A 1KR0A 1FFQA 1E6SM 2PDHA 2DVXA 3W73A 4AF0A 4IPJA 4R33A 3W22A 1EIBA 2PRLA 4GYKA 3GXNA 3IUDA 2QJGA 1LYXA 3AOFA 4WK9A 2PZNA 4KFOA 2BV9A 3PBGA 1XXXA 3AI0A 2OEJA 3P7YA 3TYCA 4K1GA 4GY7A 5A6AA 1OYAA 1RZMA 4ERIA 1RVGA 4I3GA 2VC7A 4PULA 4M5PA 2ZRZA 3WLQA 5DXYA 2WM1A 1QNQA 4HN4A 4NRRA 2EKGA 1DEDA 3VILA 3U7VA 3Q67A 1DPMA 3B97A 3EX4A 2G37A 1DJHA 1D3GA 3CO4A 1WQ5A 3MHFA 1XIDA 2E6AA 5LIYX 4S3FA 1IEWA 2X1SA 3G1SA 3LTYA 5DELA 3BMXA 3NCOA 3WH8A 4ZO6A 2R94A 3H21A 5IOBA 1UR2A 3WF1A 3GUGA 1JF6A 4F79A 4QROA 2C1IA 3AHZA 3L7RA 2V5LA 3F5KA 1XYBA 3L67A 2WLYA 4GACA 2GWNA 3WQGA 3LCXA 2E4TA 3AYTA 4EXQA 3LDVA 4QNEA 4DX3A 3EXTA 1WZLA 1S39A 5I3GA 1FDZA 3MSYA 3PHAA 5J04A 1VEPA 5A8MA 3SBFA 1EDTA 2IQDA 2ZX8A 2ZXAA 3VKAA 1G4EA 3S2JA 1XC4A 3WO8A 1PTAA 1ADDA 2ZRYA 3O15A 1L2UA 3FVDA 5DX7A 2XHYA 1AQFA 1BWLA 3S46A 3QMRA 5A6JA 2UY5A 1DIKA 1HFBA 1TTJA 4H04A 4BQ3A 3NDYA 3SIMA 3POCA 1UR3M 2J74A 4JR5A 5HMSA 2ZTJA 3WK1A 1IXOA 4IMFA 1YW1A 4ICCX 2W61A 4RX0A 2D20A 4BJHA 2Z0IA 4EAMA 4RPPA 1KR1A 2ZC8A 5D33A 3GHSA 2BODX 3WQVA 4N6FA 3WNMA 2EAWA 3O16A 1QVBA 3UJEA 4GC3A 4QM1A 1XBXA 1B90A 1H2JA 2FGLA 3W02A 4K7VA 1ZAHA 3C3NA 3VX0A 1SO6A 2VCCA 3H54A 2DZBA 3NA8A 4UR9A 4GQGA 4Y6GA 1XISA 4DAFA 4D6DA 2PDCA 5HA7A 3TWBA 3CMGA 2PAJA 1MW1A 1F74A 4H1ZA 1S5WA 2INEA 4AHQA 1SFJA 3BSHA 2YXXA 5B7ZA 3MUCA 1XG4A 1LWHA 2HSAA 1TQXA 2ZFAA 3LM3A 4E8DA 3KVLA 3L0NA 3UETA 3TR9A 1PS9A 1BG4A 3AISA 1C90A 1V08A 3T0TA 1QAPA 2ZX9A 4IOTA 4N9EA 3L0GA 1BSLA 4CNOA 3VGHA 3ZVIA 4BI5A 3OVRA 4MZ8A 4REQB 5LXXA 5BMWA 3SUSA 3ZT7A 3PAJA 5M5DA 2WJZA 1P43A 1UD3A 3DFPA 4GD0A 1TE6A 1W37A 2ZVRA 3CJPA 4WKHA 1CGVA 1UASA 2J78A 5HPOA 1ZJIA 1J18A 4AZHA 1M03A 5A8PA 5G2HA 5JIPA 1OX6A 4JHMA 4CQAA 3LOTA 1UP2A 1G69A 1EFZA 1WXJA 3VM5A 3WEOA 3BQ5A 1GJUA 4WJ8A 5HPCA 3UESA 3PBMA 3MZNA 3V3WA 4FOUA 1MSSA 1E43A 3OBEA 4Q8QA 4J28A 5A6MA 3H12A 4ZXOA 4L64A 4K7YA 3WDHA 1F61A 1JCXA 1XRTA 1KWGA 4BFAA 1W5MA 1ZCOA 1IWPA 4DY1A 5DT7A 2OB3A 2QUNA 1QBAA 1HVQA 1B3ZA 4BWLA 4H2HA 4PTWA 3PVFA 1KKRA 2OSYA 3GDKA 5I0DA 1S46A 3BW4A 3QY7A 1PPIA 3NQFA 5LA2A 1Z48A 3LV6A 2B81A 5E9XA 3OBKA 5CPTA 3GW0A 3XINA 4HBKA 4IMCA 2E3ZA 4HB7A 4UTFA 3R58A 1HZYA 2TRSA 1G4SA 4OBRA 1TCDA 3W81A 2OFJA 2XJ7A 2NQLA 4U10A 4BF9A 4PSRA 2J6XA 4DM1A 1EWDA 3BG9A 2YXOA 3MWCA 1HT6A 2NQJA 4IIDA 1SO4A 3MT1A 1TZ9A 3N2BA 3WF3A 3FXGA 2C13A 1DWJM 3CU2A 1J6PA 1LZOA 1TV4A 1H1YA 3RM8A 3PPCA 3RDKA 3WH7A 4D1IA 1Y0EA 5AY7A 3SCVA 4O53A 4Z1CA 5DRCA 3Q2DA 3T1GA 4H8VA 2JKPA 1CEOA 1CYGA 4XIMA 4O57A 3N04A 3RMJA 2OWWA 5AFDA 1QO5A 3BXWA 2XIOA 4PMJA 2Z1VA 4HA1A 3JU2A 1BXCA 4XBJA 4WSHA 5HNTA 4L1WA 3WELA 5ECUA 5C2GA 1XD1A 3IK2A 2X05A 1UPMB 1UWSA 3BGGA 2GZXA 4TXEA 3QRHA 4WX2A 4P2VA 1JD7A 3NM3A 1LT8A 1OFAA 4H2CA 4Q8OA 2VVSA 4P7RA 3V5OA 3ITTA 3GAYA 3BLLA 1KO0A 1V3JA 1JPHA 5FEXA 5DO8A 1OD8A 3Q65A 3NOYA 3TCEA 1EO5A 3IJQA 1R3TA 3SAZA 2NXGA 2VEMA 3LM7A 5A3HA 1AW5A 1FWRA 2WC7A 2ZRWA 1TIWA 3FEMA 3FJNA 3E2SA 4LBUA 4W84A 2OTDA 3V16A 2OOFA 2WMJA 4O1EA 3SI9A 3AMLA 4H00A 4H3DA 4E8CA 4GX9A 1XDMA 2VCAA 4ZMGA 2V9DA 3AU2A 2J7HA 1M3UA 1R47A 2OT0A 4G1KA 3C0QA 2DVTA 4B91A 3H4GA 3KL0A 3A4XA 4FALA 2OZ3A 4FNPA 3KM8A 4PCNA 1DJZA 4UTTC 4Z2GA 4WD0A 5LHEA 2V3DA 3SGUA 4S2CA 1LBFA 2VR4A 4C6PA 3LTPA 1IEIA 3DENA 3M47A 1BGAA 5CJNA 5IDZA 2QQ6A 1DQXA 1ISYA 4GI8A 4KKXA 3LX9A 1S3HA 4EKJA 2G8ZA 4TV6A 3N34A 5K9CA 4LCQA 3C0LA 3THAA 1UCWA 5FJTA 3M5YA 5EL1A 1LRQA 2W0UA 4IQDA 3WF4A 1NJJA 2F6KA 5C2CA 3AS0A 4WHBA 1CTNA 1J11A 4EWJA 1PZ0A 3UPBA 3A64A 2CW6A 2OQHA 1W1TA 3II1A 1S2UA 3EB2A 3HQPA 5HINA 1MEWA 4MUZA 1YTKA 4KRZA 4AZGA 1CGXA 4BY3A 4KERA 3GC5A 3HZ3A 1TCMA 1KGUA 4JX6A 2V2CA 3GVQA 3ME3A 3WQEA 4AMCA 1PHWA 1F3XA 3WF2A 3EDEA 4IFOA 5FJRA 2F7FA 3SCQA 2OZ0A 1NOWA 5E1QA 4DI9A 1D2KA 1MQQA 4J40A 1H7PA 2FDSA 1QI5A 3L21A 1UKPA 1EYEA 2EPOA 4PMZA 3EDJA 1BTMA 3VNDA 3ARVA 1DE6A 3QBUA 4ZB5A 4PYSA 3IUIA 1TA3B 4OBSA 1S1RA 3SCUA 1A0EA 3EB3A 1FH8A 3KE0A 3B0UX 3VZZA 3H4XA 4PFHA 2YYUA 1S2WA 3XIMA 1LTDA 3GD6A 3GG8A 3PJWA 1WUFA 3A23A 4H7CA 1XLLA 2P8CA 3DI0A 4D6GA 1QNRA 7REQB 4XD5A 2PUZA 3E6EA 3ES8A 1O94A 1KLZA 2WK2A 5FCZA 5CGMA 2ZRUA 3WFZA 3AZSA 1W3LA 4QFUA 5HUPA 3GDTA 4DJEC 2A3HA 3WLTA 3W0KA 1R6WA 3ARPA 2KAUC 2WM0A 1XGZA 2VC5A 3BVJA 4XKYB 1ZY9A 5A2BA 4TTGA 3B8TA 1HX0A 4ACZA 2IKGA 3LYEA 1U2YA 1VKFA 2VGGA 3NQ2A 1US3A 2C16A 1NFGA 4Y7EA 5KEZA 1F4AA 1YRRA 3N15A 3LPPA 3WJXA 5MF5A 2Z4GA 5FIPA 2XVGA 3GY1A 4DN1A 4UQAA 1LBLA 1JZ3A 2CITA 4GBDA 3VKKA 1TZZA 3WUFA 3UJSA 3W7QA 1I2NA 2HROA 2BTMA 3WLIA 2VGBA 1QHZA 3GX9A 1R3RA 3T55A 1P48A 2POZA 1UBPC 1H51A 3ARUA 1SZGA 4LUSB 5BRBA 4F9DA 3SUVA 4C7FA 2FJUB 2PF0A 2YGYA 2CHRA 5H6HA 5K9DA 4IJBA 1S3TC 4MG4A 1OGBA 2XZ9A 1W3TA 3ZT6A 1J0HA 1KFWA 3HBLA 2A79A 2Z2BA 3QQ0A 1P6BA 2JGQA 3F5LA 4GX8A 4S3AA 3DESA 3TW9A 1FWWA 3NPXA 4RDVA 2DQXA 2E9LA 1LT7A 3S9ZA 1OK4A 4LS1A 4AF0B 5DCDA 4W87A 2A7PA 1WZAA 3HGOA 4E4PA 3S9IA 1F3TA 3EDDA 2HTMA 2C79A 1V7YA 3E96A 4GQQA 2WQDA 3FKKA 1JZ5A 1NARA 1FWSA 4ZO9A 4LJ3A 4JN8A 4UQCA 2GPTA 5PTDA 3IIVA 2RJHA 4DBSA 1JYNA 1D9EA 3QFWA 4TMBA 3CQ0A 4XO7A 4W5ZA 5U7SA 1EH9A 2G0WA 4ZSTA 4JEJA 4LEQA 1KRCC 1T6MA 3GUWA 3B0XA 5KZDA 1I4NA 1A5MC 3IAQA 3U4FA 1SMAA 4M6UA 1TG7A 5C9ZA 2BGNE 3E0FA 4UCGA 3WENA 3TIMA 1FXQA 4JIQA 4OE7A 1FWDC 3NQEA 1MW2A 1JCNA 2RDXA 2XVPA 4JDYA 4MTVA 3C8FA 1P4CA 2MANA 2Y2WA 4AW7A 4EX4A 3LHZA 1NY1A 3M46A 2NWRA 1KM5A 4IUGA 3OVGA 1RP9A 3SQSA 4W93A 2V3FA 2P5NA 3DYPA 4JTAA 2XTKA 4X0VA 5AHEA 2J77A 3W2LA 2RJGA 1NSJA 2BHZA 3UG4A 2ZICA 3BLOA 4IFRA 1YLVA 1S5NA 4UTMA 4XAYA 3EDKA 3O6DA 1RHCA 1T0OA 1TWSA 1XI3A 4H8UA 4MDOA 3BLKA 5FJOA 4KCUA 5AECA 3CLWA 4HK5A 1IIGA 5BOEA 4AEFA 2FH6A 4KEMA 4Q33A 4U5IA 5FOOA 4UOZA 2WSYA 1B3WA 1U1JA 5KZEA 1ICPA 2QUUA 3W6MA 1TVPA 3BDKA 3LSBA 4LT9A 3AMCA 3NL6A 5CLTA 2NUWA 3M0HA 1QW9A 3O1NA 1XHGA 1V6UA 3SCOA 4P61A 3UT0A 2Y61A 7PTDA 2FH8A 4MWAB 4B2DA 1RJQA 3LZ5A 1PWMA 1FFRA 2Y85A 1S5MA 1VYPX 1B54A 3MI6A 1Y7VA 4H6QA 2GK1A 5KITA 3ELFA 4EOUA 2YBUA 2VRJA 4NX5A 1M7JA 2QEZA 5F2IA 2XGZA 3A4AA 3CHVA 4HHHA 1JDEA 4O15A 4QS5A 1XLJA 3AC0A 3QV6A 5BU9A 4RDZA 3PZNA 3HPAA 4LWWA 1Q8AA 3I4KA 3GXMA 1XBYA 3URNA 3L0KA 4DO7A 3W6LA 1XICA 3GHTA 3AMGA 1SYTA 2O55A 4XO6A 4CNTA 1BEUA 1K8YA 4JTDA 5REQB 4FLSA 4AX6A 1IV8A 3BWWA 3T8QA 1B57A 2V3GA 4D8ZA 3NDOA 1JDAA 4F3HA 1LRTA 2Z25A 2VO5A 3QOKA 3B0VC 2ZWYA 3QXBA 1WCGA 4CEUC 1F6PA 1V4YA 3ABSA 3N14A 3HU7A 5GJPA 4L1GA 3USZA 4QAIA 4KGJA 2NQ5A 3DC8A 3KHJA 3AMKA 2WWDA 1E0TA 1W5OA 3W74A 4IF2A 3OTRA 3P2VA 6ALDA 1SGJA 4PMRA 4R34A 3MUIA 3RX2A 3WQPA 1MDLA 5CPQA 1PHQA 4WDWA 3BLDA 1NOFA 1VBJA 2C14A 4DWSA 4K3ZA 3W70A 4O16A 1W17A 2VM8A 2G41A 1IT0A 3KVKA 3UERA 2B0MA 3W7RA 4W7WA 1XBVA 2CIPA 4UR7A 3N2CA 3RITA 3M16A 4QJ3B 1GVYA 2RDWA 2R1PA 1WB0A 1WXYA 1F07A 1FWNA 5CSUA 3P5YA 1EF2A 4M0XA 5I03A 4I6KA 1E9YB 4NJKA 2PDMA 4TTUA 1QOQA 1EDQA 2DDXA 3KLKA 1EF3A 3SY8A 3VOGA 1FA2A 1QI4A 3DUGA 3NL5A 1DTUA 1FHVA 1VQTA 2V5CA 5KZMA 3GIQA 5J8LA 1CGWA 3PFMA 2HE5A 4B92A 2V5DA 5TNVA 1XCWA 2ZCGA 4X22A 2F6UA 3H8AA 1V6YA 1UUQA 3W87A 2NX9A 2Q71A 3W38A 3W23A 1QNSA 4DEFA 2WW5A 1J5TA 3RILA 2OODA 2YR1A 3B0PA 4ZO8A 3VKDA 5AHMA 4J35A 3BOFA 1DXEA 1W3HA 5A8NA 4UTTA 4UMBA 3A47A 3NAVA 4LCSA 4IJRA 8TIMA 3WDJA 2HVNA 3CV1A 5CEWA 1DL3A 3DFNA 4PUJA 5BW6A 4UMAA 5I24A 1US2A 1O1ZA 4DWDA 3FN9A 2FVMA 3TC3A 2WJFA 2DGAA 4E3TA 4O10A 1OFBA 2OT1A 4Q4MA 2VD8A 3GVRA 3VTRA 2W91A 1W9PA 3LNMA 3PBUA 1D8WA 1CT5A 1RCXB 3EPNA 4W8LA 1BLIA 3M0ZA 4MFDA 1H50A 3TJIA 1C8QA 1HP4A 5EMUA 1D7KA 1L9WA 4GQ0A 3WLNA 4DRSA 4IP4A 3HGRA 4EVZA 4L80A 2XVKA 3UZYA 5LGZA 1JZ8A 2CHOA 3VDHA 3R1ZA 4RXFA 1LLZA 1UYQA 2X7WA 3ERPA 3H2MA 4XUGA 3KRSA 3NPVA 2R14A 1DXFA 2F6XA 4KBXA 3UZ5A 1D8CA 3NYZA 1PX4A 3SRHA 1EIXA 3GW3A 3W1NA 3OVPA 5HULA 3UGVA 2X16A 4WIWA 2OLHA 1YDNA 3GTNA 4CN1A 4C91A 4NXKA 3V0TA 2CLFA 1L8PA 1XSIA 4MJ2A 3B40A 2DSUA 3M1ZA 3GG7A 3LB0A 3GDMA 3GO2A 3VIGA 3PWIA 1VPYA 4GYJA 3SDOA 2E28A 4C6DA 4OTKA 5B80A 3E02A 1GW1A 2PDGA 4HT3A 1MRQA 1GGOA 1ZENA 2TODA 5CPLA 3VDAA 3CUJA 3MTWA 4TX8A 2J8GA 5F2LA 1J93A 4DBWA 1RY8A 4AXNA 4BI6A 1XIGA 2W9MA 1QPRA 3I68A 5ABTA 5DT5A 2I57A 3PSVA 1TV5A 4QRNA 1KTCA 5TQLA 3F5JA 4C1LA 1AJZA 4IFKA 4WJEA 1PCKA 4S3CA 3DXIA 1TFVA 5FEZA 4P7QA 2DU2A 4XZNX 2I9UA 1KLYA 4DZ5A 3MVTA 4O8RA 4LVGA 4X63A 4EIVA 3S1UA 3DFOA 4DB7A 2VEKA 7CGTA 2DVUA 1K9TA 4R3UA 2Z7GA 1Q13A 3VOCA 1JCTA 2J8TA 3P82A 4GUJA 3W53A 5BMXA 1FRBA 5D9PA 4BS0A 3TSMA 4I5XA 2WZTA 3BL3A 3MUY1 2QUMA 2DY3A 3EA1A 5C2XA 1ESWA 3OA5A 1JPMA 4NZJA 4HOZA 2R9RA 2VR5A 3WD4A 1YTEA 2PMQA 3BAWA 1GHSA 2F2KA 3W2UA 4A3QA 1EEXA 2F2HA 2IKHA 4XZMX 1VFFA 1SPQA 2H6RA 3S2MA 4D6CA 4E5TA 5MHBA 4IG2B 1SO5A 1UQZA 2VT0A 3WKZA 2FFCA 3EOUA 3VFCA 3F4NA 3KP1A 4J7RA 2BHUA 1CNVA 1O5QA 2BZNA 1JZ6A 3PTKA 4G5DA 1EJVC 3E2VA 2V63A 4JYEA 4WDXA 1R3VA 3AHYA 2HBXA 3QY8A 2XYLA 3GXDA 2FKPA 2QJMA 1VYSX 3KX6A 4LRSA 4NZFA 3LCLA 5H8PA 2ACSA 3TN3A 3BMWA 1YIXA 1R2RA 4K2SA 4Y96A 3RO8A 1WNOA 4MNJA 5I3IA 4HNCA 1G7UA 1XV8A 4R27A 1MUMA 3TZFA 2Q8XA 4PODA 3IWPA 1KM6A 2ZUWA 3GTFA 3CNYA 3CH9A 3VI2A 3JUGA 2C1HA 3QSRA 4XK2A 5D2WA 2CWNA 2FFIA 3IGXA 3MWAA 1PKMA 2XN0A 1AW2A 1NQKA 3AIRA 2NV9A 2VZTA 4HZ7A 2E8YA 4GUGA 4MWAA 1XIMA 4XSLA 2BP1A 4MB3A 1HKVA 4LUTA 1NFPA 3G24A 2PDQA 3QLLA 4IIGA 4DXXA 4JIRA 4ZFCA 2FB2A 1DOSA 3REQB 2VENA 1R7AA 3E49A 1VBHA 3AYSA 3CZKA 1FDJA 1YNPA 1RD6A 4QLLA 2V2HA 4TQTA 1CXLA 4AQLA 4GVHA 2PDJA 4HTBA 4KH2A 3ZR6A 3N4EA 2VWTA 2FVLA 2A85A 4DAIA 1UR0A 1ZP4A 2BY3A 4IHCA 1TR9A 5HBFA 1VB9A 4JTLA 3GXFA 2OU4A 3UJFA 5CGTA 2PBGA 4QLKA 1PTDA 3SCWA 3FYYA 3TMLA 5EGRA 1ECQA 4M80A 2NT0A 4YHGA 3A4WA 3W75A 3C2FA 3UPMA 4FI4A 1HGWA 1TVNA 1M5WA 2Y1HA 2WZEA 5L6UA 1S5VA 3QZ6A 4G2DA 3H53A 1AQHA 2EPNA 4Q8TA 2BXVA 3VCCA 2GGHA 2D0HA 2VDGA 1BRLA 4NNAA 3OJGA 4NXSA 4TMCA 1O68A 4PB4A 5GPRA 3QHMA 1XLKA 4E0CA 4O18A 5KTLA 3C86A 1MEIA 4I9AA 1HXJA 5I3DA 1VS1A 4PR4A 3FFSA 3W86A 4K68A 3NSXA 1GTEA 2H9AA 4ML9A 3UPWA 2VP8A 3OG3A 3IJ7A 1SFLA 4PMNA 4WGHA 1OG0A 4CQDA 3WJWA 2V5BA 3CT2A 3QH2A 5DCEA 4HMEA 1UPPA 3S9YA 3PNUA 2RGLA 2GSEA 3LQGA 2WAGA 3VZXA 2WNWA 2YCKX 1UH4A 4D1JA 3OLEA 2VXNA 4QSFA 4XD3A 3TMQA 3BCJA 3UY7A 1LORA 1MZHA 2CZDA 3DHPA 1NTHA 1Q2SA 1O12A 1SO3A 3N19B 3ABOA 4FNTA 3O2LA 1X39A 4B5UA 2F38A 4LBRA 3IIXA 1GYLA 3W26A 1R86A 2J9YA 4J3UA 3NEVA 2I16A 1UMLA 3GR4A 1UC5A 5L9FA 1REQB 2AKMA 3FDGA 5EMKA 1DWAM 4GVGA 2JK2A 3G1YA 1W31A 1UZDA 3F7JA 1OX5A 4I9TA 1SQ7A 4HPHA 4LYPA 1UWQA 1FDYA 2EQDA 4QP0A 3ZM8A 4LH8A 5HQEA 3SW6A 3PFRA 1JZ4A 2WZHA 3H2AA 1BWKA 4MJMA 4R9XA 3WEMA 1W2VA 2ALRA 2EPLX 3A13A 1OC7A 5JBDA 5A5WA 3RR1A 2JF6A 5DMMA 2P53A 1EBHA 3H55A 3EA3A 2YDRA 4HK6A 4B5NA 2BY0A 2XFYA 1H60A 2QVHA 4YHEA 4WXYA 1AH0A 1MQPA 1BFNA 4YNGA 2GVGA 3D3AA 3IAPA 5DEZA 1YE4A 4HN8A 3P3BA 3CIVA 4XTIA 2EG7A 1H4PA 3UNTA 1VCGA 1Z41A 1WDRA 4CNUA 3BZGA 5E6YA 1UP0A 5T8GA 1XLBA 2X2YA 2Z2UA 3N18A 3WYZA 3CWNA 3ZJ6A 3ITOA 2H8ZA 3WLLA 2JFEX 4C6IA 4C6QA 3ZOAA 5FEWA 2YBVA 3UF9A 3FEQA 4G8TA 3S6TA 2E9BA 1IZCA 4XZBA 3L5LA 3S1XA 1SFSA 2HEJA 2CLPA 4DPQA 1XH2A 4C6LA 1XIHA 3SSJA 3R89A 4X0NA 3T2PA 3O0FA 2B7OA 3W3OA 3UWEA 4E3VA 4J3XA 1ITCA 3W83A 2AL2A 4NAFA 2ANUA 1CWYA 1EOMA 4F0MA 3O6YX 1OM0A 2V67A 1A5SA 5EA9A 2BXZA 2PP0A 5LSMA 3WQCA 2ABBA 4HZ8A 1BXBA 2JBMA 1W1PA 2FHFA 3G3MA 1UKTA 4KIRA 2QR6A 2YDSA 3Q37A 4M81A 4P7OA 4PUWA 5HATA 1B3XA 1GOQA 5D9OA 3T0AA 2QW5A 1VCVA 1JI2A 2E6DA 1IIHA 4C6OA 4Z2IA 1UIOA 4DWSB 1I2OA 2WCGA 4LYRA 3QTPA 4ZA0A 5LXEA 1O4UA 4WY0F 2HJPA 2OQLA 4ZCWA 5EBUA 2Z7KA 4UOJA 4JZ5A 2CETA 3R94A 1K1DA 1RH9A 3R79A 3F4DA 2DZXA 3VKCA 4NIRA 2W27A 2V2DA 3W7GA 1N2VA 2G50A 5FSEC 1DJNA 1EXBA 3G1XA 1BKHA 1RBAA 1KXQA 3MBDA 3IACA 4GPNA 3WQFA 4U33A 2XZ7A 4KIEA 3SZ8A 2XFRA 3VIMA 4PUKA 3LGEA 2YCJA 1NU5A 4JNMA 4ZQNA 4ZL1A 3QVQA 3KBWA 3B04A 4RZ5A 1YE6A 5IBXC 1YPIA 4MJ4A 3KWSA 3PB2A 5EMMA 3MMUA 1LROA 1IF2A 1DE5A 3G5EA 3CV7A 1YPFA 5AYXA 1WDDA 5CLWA 3W88A 4JKLA 3AUJA 4OWGA 1U30A 4C1KA 2PWEA 5AKQA 3QSTA 3PBVA 4UTJA 4DNHA 3SGZA 4PCTA 3MSDA 4W89A 5HNUA 1QMLA 4AYGA 4LY8A 1NP2A 3EWWA 2JEQA 3EKLA 3SUUA 3WLRA 4LEFA 6XIMA 3I4EA 2DZTA 3S1WA 1LRNA 5FL1A 1GVRA 4US6A 4JQ3A 5A6LA 3C2RA 2CBVA 1VEOA 1FTXA 1VHNA 3RCMA 2IPWA 1J96A 1IE7C 5G1TA 3WL1A 4D6IA 4DO5A 1G4PA 4Q3MA 4REQA 4AU0A 1G5AA 3QTGA 2XH7A 1N8FA 3HN3A 3AO0A 4JIIX 2AAMA 4MB1A 2WKGA 3S83A 4B2DD 1GKQA 3CHDA 4MKVA 4MY1A 1AD1A 1YHTA 3LLXA 2ZA1A 1KXTA 1PO9A 2XG9A 4A6GA 3S4TA 3M4HA 7ODCA 1EC8A 3KTSA 4PL1A 1K8ZA 2IS7A 3TKFA 3LPOA 4RDYA 4LAMA 2OMAA 3HQOA 1I2QA 1EX1A 3C2VA 1ME7A 2RGMA 4MNKA 5LIXX 5CC3A 1E6XM 1OHLA 4MKSA 4WRHA 1SFTA 1F73A 1ISWA 3CHEA 5K9XA 4HNLA 4B4HA 1OCBA 1TPDA 4KFPA 4GMEA 3UG3A 3LCGA 1BTCA 3TYDA 5DCBA 4HPNA 3FW6A 2DEPA 4IT1A 5BXRA 3F2DA 3UZWA 5FI8A 2RUSA 4BKNA 1QHOA 4Q6JA 4EP8C 4AISA 4NY2A 1MXGA 2QYGA 4A8IA 1ONEA 2XDFA 3OGSA 2BOFX 1KXVA 1ADOA 3LHYA 3LGDA 3G1HA 3GH7A 1CLVA 3SCSA 3LCWA 1HN1A 1W9XA 4H9XA 3RPDA 3VGDA 1V79A 3B9AA 1XRSA 4W8AA 2HK1A 2G97A 2BHYA 3VMOA 1HJVA 4W7UA 2J9ZA 4Z1AA 2WMKA 4WR3A 1NWTA 5EFFA 2GDVA 4L9XA 3HJEA 4QCFA 5D8ZA 1RK6A 4LB4A 4PA8A 5BXSA 2ZUMA 4CLMA 3UU0A 5BRPA 3CZLA 2FMOA 3QC0A 5HQLA 5CSSA 1IHIA 4PTMA 2QKFA 1ONRA 4K8EA 3VUSA 3DG7A 1ML1A 1QNPA 3ATZA 1F6KA 4JIPA 2GVJA 2Y24A 1H7OA 4LY4A 3O06A 1H7WA 4AD0A 2C19A 4O4VA 9XIAA 2QCDB 1GQJA 1Q63A 1TIMA 4ZFMA 4UTUA 1XYFA 4NP7A 2O56A 3CZJA 3ENLA 2JGYA 2VQUA 3MP3A 3N12A 2RDUA 3AIEA 3GIPA 1TKKA 3VVGA 3SCRA 1UOZA 4CQBA 1U5JA 3AHTA 1CGYA 2IUZA 4LVFA 1YNYA 5AHNA 3BJSA 5JMUA 4E2OA 3MJYA 2BGSA 2GK1B 3XISA 1AODA 2DZWA 2YL9A 3HTWA 3L4VA 2BOEX 2I5QA 3T9PA 4HYVA 1H1NA 1R9XA 3M0IA 1U22A 3EMZA 3SRDA 4FAMA 4KS0A 4GJJA 3T0CA 4RW5A 3QV8A 3KRBA 1YKWA 4NAEA 4XWUA 2NUYA 2PGEA 4OFCA 4QAWA 1JL8A 1P0DA 1E70M 5AHLA 4AWUA 3AALA 1GVQA 1M65A 4NAFB 4O4WA 1TV8A 3KL5A 1UD6A 3L4TA 3P84A 3QQWA 1YDYA 4FNUA 4CCDA 1HKIA 2O9PA 5IXEA 1RBOB 2WMIA 3EMCA 3FJLA 3ARQA 5EY5A 3R8RA 1J0YA 2ZUNA 3VIHA 2ACQA 1XLMA 2Q01A 3UP8A 7TAAA 3K8LA 3LLDA 4CQ9A 4FXSA 3K8KA 4DJED 3T7VA 3S5NA 3IJ8A 2X0YA 3QHOA 3BOLA 3CMJA 1XP3A 2OKTA 2PP1A 3G8EA 4XZHA 2F61A 1TO3A 4HOWA 2E5DA 3U0HA 2VQTA 3QMSA 5IBXA 3WF0A 3LHTA 4Y9NA 3IK4A 3UG5A 3CPGA 5D2TA 4UTWC 1N8WA 3KHDA 4O19A 2E25A 3FS2A 2J79A 3VFLA 4R7WA 4M1BA 4PBGA 2RKXA 4QJ1A 2WV8A 2ZXQA 3DZ1A 5LZLA 5IM51 4GXPA 2SFPA 5HNRA 4FF7A 3B0YA 5ABGA 4HNUA 7TIMA 4JDBA 3S2CA 5CZSA 3CEUA 1UA3A 3W00A 4MADA 3U8GA 2J7EA 1LL7A 2QIWA 5M3WA 4R7JA 4V1XA 1KNWA 1DHKA 2TMDA 6ENLA 4KEVA 2I56A 2DW7A 3VD9A 2YXGA 4GKLA 3KP0A 1DQWA 3LCFA 4TR9A 2ALDA 1C29A 2X09A 3BG3A 3IVUA 1EP1A 2OOGA 3NEHA 1G01A 1E4NA 4Q22A 3U6WA 5I02A 3L2MA 3EKGA 3PULA 4D9PA 1J0ZA 2PDIA 2FZ8A 1OX4B 3BPWA 1GEHA 4EPKA 2ADAA 4C7DA 3A21A 4F2TA 3VDBA 1NF7A 1ME9A 3A6OA 1A5LC 2OPJA 1RAKA 4S3KA 5G4EA 4FOKA 3Q58A 4U28A 1O5KA 1BSIA 4JCMA 3OZYA 3KBVA 4N2YA 3KBNA 1YX1A 5I2UA 1HJWA 1EA0A 1FP8A 3N9RA 1CENA 1QI2A 3LUTA 3L5AA 2G4FA 1Q65A 4X60A 2NVAA 3DFSA 4IM4A 3T0DA 2PC8A 4MKNA 1G0CA 1SMDA 1X98A 1XR2A 4ATWA 1J0IA 2QUVA 1KFEA 4AD1A 2GOKA 3HGJA 4LV9A 2Q3RA 5IFPA 4Q8PA 2E9MA 4J3WA 1K9DA 2O9TA 1WZMA 4R7OA 3UG8A 3MY9A 3AJ7A 3PBWA 2GDUA 3ITVA 3RU6A 3UD6A 1XSJA 3D3FA 4PUNA 3WLKX 4GCAA 1WXZA 3VKBA 2PODA 4YLWA 2AQWA 3LPGA 1UR8A 5A8OA 4QNWA 4XG1A 4GABA 2G3FA 4GY1A 4GC4A 4JXCA 1FKXA 3SY5A 4N0RA 2REQA 1OX4A 2XM2A 1JDCA 5DFAA 5FF2A 3CO8A 4ZTXA 1E71M 3ZLGA 1JAKA 1ICSA 2PB1A 3BH4A 3WLHA 1RPKA 1EJTC 3UJRA 3IPWA 2AAAA 1RALA 1XG3A 3PG8A 1FWIC 4AWSA 4PTNA 1E1FA 3V4BA 3RK8A 4C6KA 2REQB 4XAFA 5F1VA 3NPWA 4V27A 1E40A 5G2WA 3PZUA 4JFVA 3BV7A 1H5YA 2OX4A 4I8DA 4NILA 3W1MA 3NSNA 1UD2A 1E9ZB 1EUAA 1TJ0A 5C9UA 5LIWX 3VABA 2NLYA 3M0VA 3T4CA 3CAVA 1NFBA 3KWXA 4UQ9A 3AIWA 4LGXA 2QCNA 2ZZ1A 3QYQA 4PUDA 1L0PA 1XYMA 1JCLA 4AFYA 4AZ6A 3RM4A 5D4YA 1K9FA 3NIYA 2DH3A 3OZPA 4H9VA 3RGTA 4EXAA 3AWOA 3SN0A 4DUWA 4S3DA 3FSTA 2NQ9A 2DH2A 4LAUA 4O50A 4G7EB 2I14A 2P76A 2YL6A 1PKYA 1DV7A 4I7VA 1RV8A 2QMJA 3CUHA 4J2MA 1EBGA 1JZ2A 1A80A 2YW3A 4DBDA 2VFEA 3R2GA 5ECVA 2Z27A 4AYSA 3CTLA 3PZTA 3DHFA 1FQ0A 3E12A 3EWUA 4FK9A 1W32A 2DZSA 2YX0A 4GKTA 4ALDA 4BF5A 4DBEA 2W79A 2X0SA 4AX7A 1M01A 1L6FA 5D9NA 4RW3A 4K1WA 4RE3A 3A24A 6REQA 3GXIA 3N29A 2CLMA 3R12A 3F2CA 1M6JA 1KKOA 4S3GA 1XLGA 1SSGA 4PTVA 1ZPTA 4GUIA 4DWSD 3S6OA 3WZ0E 1A5NC 1FCBA 3UYIA 1MMFA 2WC3A 2DPEA 2D1ZA 1YXDA 2ZWZA 3MS8A 4G1NA 1F7BA 4ROPA 2OKOA 5DBUA 5AC6A 2PWHA 2GL5A 1AUSL 1PB0A 1OC6A 1E3XA 3MDWA 3T2QA 4B9ZA 3B8DA 1PIFA 1Q66A 4PUEA 1NWRA 1UG6A 4HYRA 4WGXA 4KEUA 1PXGA 1E4IA 4AEOA 4DZHA 2YA0A 4LOCA 3DIPA 5LA0A 1G1YA 4QG6A 3KLLA 3N17A 1A5KC 5C8BB 3ZMRA 4NKCA 2WCSA 4GFSA 3EBVA 4YCPA 1MNSA 3BAIA 4AHOA 5FF3A 1F3EA 1TVLA 3JZEA 3TQKA 1OIFA 2O92A 4GGBA 4MVAA 3APGA 4GYFA 1BXNA 3S1GA 3VAVA 1JQXA 4LAZA 2CKRA 4Y9MA 5C7VA 4LVBA 2QMKA 1B2YA 4PMQA 5GNYA 4URIA 2HE8A 2QAFA 3GNDA 2PU0A 3ES7A 4R85A 3VOFA 4BR1A 3N4AA 4ES4A 7ENLA 3WNNA 3COTA 3KXQA 3OIHA 2FGBA 2FYMA 3DH7A 4ROQA 5EKYA 4J3ZA 1AD4A 3FVMA 2QLYA 3G8RA 2FTPA 1KBIA 2YCIX 1ECEA 3R6IA 1O6IA 3TU9A 3GNRA 3KBSA 3EEGA 4F0HA 1GCYA 1GKPA 4EE9A 3LBMA 2XN2A 2ZUSA 4BQ4A 3EWXA 3W37A 5HK4A 4IX0A 3ZSTA 1CPUA 2ZZ4A 1Q6CA 2BOGX 1Y5WA 2CKSA 3U3HA 4FXJA 4E2DA 4PRWA 1TJPA 3QHNA 4QQUA 3ZIZA 3V0UA 2ZZ5A 1NAL1 2QDEA 1XH1A 4LX4A 4HNTA 3VIOA 1E9LA 4AZ7A 2NQHA 1CDGA 2CZVA 3R25A 4AUBA 3W1PA 1GOIA 1CXEA 1MVYA 4B5TA 4NYUA 3S5ZA 2PTWA 1FCQA 3I6EA 1PYFA 3R8GA 3RX3A 4CNNA 4US5D 4G7EA 1BYBA 3ITYA 3OZMA 1VEMA 5E70A 3TYUA 4CVUA 1QK2A 2V38A 2PI6A 1I6NA 3W85A 2WXDM 2XINA 4C6EA 1XLFA 1Q6LA 3TP4A 2B7PA 3GHUA 2G5WA 3GFYA 1ZQ5A 4WZHA 2YFOA 2Y7FA 2QCDA 3C0JA 2EPHA 4PEEA 1T8XA 3APYA 1V0MA 4J4KA 4BQ5A 1E73M 2LLEA 1TRDA 4ILSA 5DXXA 2PGFA 8A3HA 1MXSA 2P10A 2ISSA 4Y9PA 2X1RA 5I09A 1KFJA 5F1UA 1JDDA 3DERA 2ACRA 3IV8A 3VCNA 1ZBVA 3FCPA 1TPEA 1HO1A 1JIBA 5AYYA 5HNNA 3UCQA 4P8XA 1DP0A 2GJXB 3SRKA 1P0KA