3CLMA

Crystal structure of transaldolase (yp_208650.1) from neisseria gonorrhoeae fa 1090 at 1.14 a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
352
structure length
352
Chain Sequence
GMTILSDVKALGQQIWLDNLSRSLVQSGELAQMLKQGVCGVTSNPAIFQKAFAGDALYADEVAALKRQNLSPKQRYETMAVADVRAACDVCLAEHESTGGKTGFVSLEVSPELAKDAQGTVEEARRLHAAIARKNAMIKVPATDAGIDALETLVSDGISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFFISRVDSALDATLPDRLKGKTAIALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYPDTLYVDSLIGVHTVNTVPDATLKAFIDHGTAKATLTESADEARARLAEIAALGIDVETLAARLQEDGLKQFEEAFEKLLAPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Crystal structure of transaldolase (YP_208650.1) from Neisseria gonorrhoeae FA 1090 at 1.14 A resolution
rcsb
source organism Neisseria gonorrhoeae
molecule tags Lyase
total genus 150
structure length 352
sequence length 352
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2008-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3clmA00
1R2RA 3MBFA 1YTEA 4R53A 3W9ZA 1CX9A 1BKSA 3A23A 2EHHA 1WYIA 1C8VA 3DBPA 4EF8A 1H63A 4LT9A 4NT0A 1GJPA 4E2DA 1DORA 1OYCA 3E02A 1IXNA 3OVPA 5CKSA 5EPDA 1KLZA 4OU1A 3UWUA 4RCXA 1Q6QA 3W7GA 3HG4A 3BO9A 5G1YA 3W1AA 2YR1A 2ZDRA 3LCWA 3L0GA 1O60A 2QCMA 1TRIA 4BR1A 3RU6A 1LDCA 1K8XA 5TIMA 5G2IA 1FBAA 3OVQA 3B0VC 1KFKA 3LDVA 3LCGA 1V7YA 4HSOA 5A5WA 3B4UA 1UUOA 4HNVA 2XN1A 4ORMA 3JR2A 4ADSA 5E0KA 2X1RA 2X1UA 1JUKA 4O50A 2EKCA 3QSRA 1Z44A 1QO5A 1GTHA 2X30A 4O15A 1NAL1 3W84A 4QNEA 5D38A 1WXJA 4IOTA 2Y61A 4AB4A 1EX5A 3WJZA 1R47A 2EAWA 5D09A 2Z2UA 1TPC1 3TNOA 2ZTJA 2GQ8A 1I2NA 5BMWA 4MVAA 3IV3A 4Y96A 3S5ZA 4XWUA 4CQAA 1UJPA 4AH7A 2I9EA 2VXNA 3G0UA 2B7PA 3INPA 3PS7A 1NFBA 4X22A 3EWZA 1MEHA 2QR6A 1Z42A 4DEFA 3L68A 1K3UA 2H3BA 5G4EA 1SO3A 1YDVA 4L4LA 4BI5A 4FB7A 1EP1A 3FA5A 1VPXA 3PUDA 3MI6A 2WSYA 2CLKA 3TA6A 1OFEA 2GJLA 1XDLA 2ALDA 3IIZA 4DELA 3KRSA 1FXQA 3P7YA 1D3HA 1K8ZA 3NZ1A 1VJIA 3TV8A 5IBXC 4LVFA 4IXXA 5HMSA 3W76A 1ICSA 2GQAA 4IMGA 3TCEA 1VLWA 3DENA 3NPXA 1XI3A 1X1OA 4UCGA 5KZEA 1TPDA 3A24A 3P80A 1ONRA 2C15A 4I7WA 3FKKA 2J6XA 4QITA 4UTTA 5EKYA 2WNNA 1XBZA 2B7NA 3NQAA 4UUIA 3F4WA 3UZ5A 3P60A 3DFTA 2DP3A 3GDRA 2ATSA 2FPTA 3UXAA 5FF0A 5G2HA 4R34A 2J9ZA 1RV8A 1LOLA 2NUXA 3IRDA 1A53A 1TV5A 2FDSA 4R7JA 1FCUA 3BG9A 3OG3A 1FCVA 4FHAA 1DJNA 4JX5A 2DORA 3PC0A 1SSGA 1VHNA 3M9YA 3MW7A 1OFOA 4FEZA 4O8RA 4WZHA 2VC6A 4DF0A 1JQVA 3C2FA 4QIUA 5HWNA 4M6PA 3GDMA 5AC7A 1FDYA 1SW3A 2NV2A 3GXPA 2CW6A 2QCLA 4Z0JA 3NM1A 3NQEA 1I2RA 1GZGA 4C1LA 4JTEA 2ZQ0A 4JTLA 2A0NA 1M7OA 1QDSA 1VYPX 4EIVA 1QPNA 4AHPA 3FLUA 4Y8FA 4NZFA 4LVBA 3GNDA 3L67A 3PBWA 1PS9A 5I3HA 1XKYA 3EKLA 2V2HA 3TQVA 4N2YA 2AAMA 1PVNA 1LOSA 3G18A 2VOMA 4O57A 2E6DA 4NX5A 2QCNA 4GE8A 2VEPA 3GK0A 2H8ZA 4MJZA 3GLCA 3OEXA 3PY2A 4GBUA 4JX6A 3VCRA 4WY0A 4UTKA 1B57A 1W5NA 2YXGA 1SW0A 2EPHA 4GJ1A 1XFBA 1P4CA 4XBSA 2TRSA 2DJLA 5J5DA 2ABAA 2ZCGA 4HHPA 2R14A 3N34A 2E1DA 4DQWA 5LNRA 3W7NA 2Y63A 3C2RA 3TC6A 1LOQA 4JR5A 5AHFA 5FF2A 5DXYA 1H7XA 1OX6A 4MLRA 5CZ0A 1HFBA 3C2VA 4NJJA 5GVJA 1JUBA 4BWLA 4U4MA 3P8IA 3W72A 1BWKA 3EB2A 3CC1A 5LHFA 1VQTA 4ZQOA 4MZ1A 2DZWA 4MY8A 4IMEA 1TTJA 4IWWA 4AWSA 3STGA 3W88A 4YCOA 5MHBA 1K8YA 3DHFA 1VH7A 2QF7A 3DH7A 3L9CA 1RQHA 1H62A 2E6AA 1W0MA 3NQVA 1GEQA 1ZENA 3MMTA 4UNLA 2Q8LA 3W70A 3OA3A 4JTKA 1AK5A 4DBDA 3A21A 5T26A 3STCA 2RDWA 5D05A 4PFMA 5K2ZA 3C56A 1GVQA 1WOBA 3W2NA 5HUPA 4EVZA 3QQ0A 1HTIA 4Z1AA 3LRMA 4LS0A 1PCKA 1XC4A 5K9CA 4LNYA 4LW7A 1N55A 3U6WA 2ZZ6A 3TSMA 1F7BA 1NF7A 4BF9A 3EWWA 2ZRZA 4O4WA 1VYSX 3UYCA 4JTJA 1QO2A 1J2WA 2WSQA 4CQ9A 3B0UX 3CWOX 2YX0A 3TKFA 5D03A 3KXQA 5DLCA 4UR7A 5ABTA 5CG7A 3QMTA 5L6UA 4OV4A 4MUZA 3O63A 4GUGA 3THAA 3ZFHA 3O06A 4NJGA 4O52A 2FTPA 3P84A 3LV5A 5DCBA 4JNMA 1I2QA 4DPPA 1F05A 3UWVA 1OVDA 2QUUA 1G67A 1Z41A 5CZSA 1FUYA 1H61A 3GDTA 2J27A 3MP5A 3B04A 2BLEA 3G22A 3W83A 3QSTA 3BLIA 4O11A 2A21A 3W7EA 3LXAA 2A5HA 1FDJA 3EX3A 4M5PA 4NU7A 3BW4A 2ZZ2A 5AHEA 3BK0A 3UQNA 5DN1A 1LCOA 1XUZA 3DFQA 4ZQNA 4WJEA 5TQLA 1B4EA 3WK2A 1Q6LA 3YPIA 4NXSA 2O7QA 3NNTA 2NXHA 1LBFA 4FNUA 4IMCA 3CQ0A 1N8FA 2WKJA 2JKEA 2GPTA 1ICQA 1ZHAA 4ONVA 1B9BA 4XUGA 3A22A 4PODA 4FX8A 1TV8A 4UMCA 4NNAA 1KFLA 1TB3A 2CLEA 1OJXA 3SI9A 2GUUA 3W1LA 2DZPA 1G69A 5KTLA 4XBKA 5CZTA 1BTMA 1ADOA 3E0IA 1MXSA 2J24A 4PA8A 4IJBA 5K4XA 4WY0B 5K7JA 3W74A 3RF9A 3S9YA 4KKXA 2Q8ZA 2R91A 1HG3A 2ZTKA 6TIMA 2Y7GA 1B3OA 4O1AA 3N9RA 3T7VA 3S1XA 1C29A 5EBUA 4IPIA 5LHEA 4ZZ9A 3BVJA 3E9AA 3KHJA 3TE9A 5AHLA 4KFOA 2Q3OA 4RX0A 2VFIA 3QRHA 3TH6A 4GC4A 1FCQA 1SZFA 3NQ2A 2FB2A 3OBKA 3W1MA 3NVTA 4PL2A 3PUOA 4MOZA 1OABA 3G1FA 4LUJA 4FX7A 4KWWA 5I3FA 3UWWA 3P5YA 4MPQA 2JK2A 3NQCA 1VZWA 1EUAA 5DY3A 3LM7A 3ANYA 3MI3A 4H4IA 1S5VA 4LWWA 3DU0A 2OT1A 1GG1A 3I65A 5BNKA 1BWLA 2CZEA 3TSDA 2OCZA 3TJLA 4X2RA 5EL1A 2DU2A 5AOUA 1MSSA 3CEUA 3ABOA 2ISVA 2QCDA 5KZDA 3LHYA 2R8WA 1G4PA 4O54A 3FJLA 3QFEA 3TDFA 3S1UA 2IQTA 1XUUA 1O4UA 2QKFA 1TTPA 1OFRA 3AJXA 3EWBX 3I6RA 3GR7A 1KV5A 3LX9A 3M41A 1PIIA 2HS6A 1FQ0A 4AHQA 1Q6OA 1QMLA 1XBVA 1WDWA 3M16A 3NG3A 2C18A 1UASA 1OFQA 3GAYA 3O8AA 4BK9A 1SSDA 3P81A 4IX0A 2E68A 1H7WA 1TPWA 3MP4A 2A6LA 2BSLA 1H7OA 3GDLA 4UFMA 1KM5A 1GQNA 3C0JA 2VFFA 2VFEA 1G6CA 3QEZA 4IXHA 2P1FA 4X9SA 3HPSA 5E1QA 3O15A 3CIXA 3S5NA 1PHQA 5FF7A 4MJMA 2OT0A 3LHWA 2NZLA 3W87A 4RJEA 4O28A 5IM51 3CTLA 4B5NA 4M6VA 3LCLA 4J9JA 1KTCA 5C54A 4RLIA 3IEBA 4A2SA 2DJXA 5F2MA 4Z1BA 1L2UA 3T4CA 1ME7A 3W75A 3TW6A 2E09A 1FY6A 4TU1A 5LSMA 1NSJA 5AYYA 5D2XA 1NEYA 1K7FA 1XBYA 3THQA 2CLFA 5CPLA 3W3OA 5DBTA 1YXYA 4HT3A 4QAIA 1JUEA 4JTUA 4WXZA 4XTIA 2AGKA 3LB0A 4UTMA 4UTLA 3PBYA 4CNPA 2PCQA 3NEVA 3CWNA 4XTDA 2HSAA 4E2BA 1DBTA 5U4NA 2ATMA 3IGUA 4O1CA 3C6CA 3EX1A 3LCXA 1OG0A 2X2GA 2EF9A 2RDUA 4BI7A 8TIMA 1KBJA 1X8FA 5LGZA 2WV8A 4JD4A 3UWZA 2PE4A 4FIQA 1K02A 1WV2A 2CLOA 3SR7A 3KRUA 1EB3A 2QCCA 3OHIA 4O13A 2YYTA 1U5JA 4UTTC 4L4MA 3K30A 1GOXA 1YTKA 4YMZA 1ZALA 1AW1A 3HG2A 3R8RA 3VFLA 5HWJA 4RZ5A 1OF8A 3S42A 3R5EA 4C1KA 3OVRA 4MZ8A 4XKYA 3CM4A 3USBA 3HGJA 2H90A 5LNUA 3FOKA 4RK8A 3S0CA 3HB9A 2B4GA 4XZ9A 3M1ZA 4MFDA 4NNBA 1YPIA 3L5MA 2JGQA 2V0TA 1UUMA 3NA8A 3PVFA 2QEZA 3W7LA 2TPSA 4UFJA 4O0KA 1AL7A 3N73A 3BW3A 3EXRA 3GDKA 3PR2A 2QCDB 2OX1A 2FJKA 4JGDA 3GKAA 4NNCA 4N4PA 1C9DA 2C16A 2QUVA 3EX2A 4K7YA 5CZJA 4RKAA 2TSYA 2YW4A 4CCCA 5C2XA 3DHDA 4FX6M 1S5TA 4YL2A 4PCFA 4O18A 3ATZA 2ZRWA 3W7KA 3GXNA 5HWMA 3R13A 5G1TA 1I8JA 2I14A 3DI0A 4KWVA 4IUOA 5F2GA 2FPVA 5D2VA 3PM6A 1KTBA 4AHOA 5HR6A 3ZR4A 1HL2A 3MI2A 1WBHA 1PCWA 3L0KA 3NQ7A 4U28A 4DO4A 1VHCA 2A4AA 3SIZA 4FIRA 1OYBA 4CNOA 1QPQA 2RH9A 1IF2A 4I7UA 4AEOA 4KFPA 1S5WA 3ZS4A 3FKRA 4Z1DA 1TPH1 4YLWA 3IVSA 2UV8G 1IXOA 4BWLC 3PULA 3QW4B 3BGJA 4HPJA 5I3JA 1TJPA 3P74A 5D2YA 2C6QA 4AVFA 4JTHA 4OWGA 3LV6A 3W2MA 1GYNA 5CPOA 1FWTA 4RXFA 4UIOA 4N9CA 4GRSA 1SFJA 1TREA 1Q3NA 2ZFAA 1K7XA 2CLHA 3MHGA 3SY5A 5KINA 4UTIA 5BOOA 2Y89A 1J4EA 3CPRA 1I2PA 4MKNA 5I3GA 1X7FA 2V30A 1OYAA 1ZJIA 2J88A 3KFTA 3WJXA 3EWXA 3NQFA 2D73A 2E5CA 4QM1A 3BARA 3GIYA 1W5MA 3QZEA 2E77A 2G96A 2F7FA 3WJWA 4N4QA 2YFNA 4HNUA 3TFXA 3RMJA 3VE7A 1K03A 1ICPA 1H7RA 3TXVA 4UFIA 2OJPA 1MZHA 2YGYA 1OX4A 3DKLA 3PF3A 3PBUA 1KA9F 1M7PA 3Q94A 3GX9A 1KTNA 1QFEA 1UCWA 4S2CA 3T78A 1GPWA 3T44A 1EP2A 5CGQA 1GWJA 1WQ5A 4JN6A 4I9AA 4N6EA 1H50A 2Z6IA 4NQ1A 2Y85A 4ICNA 1W56A 2QDHA 1DKWA 1F5ZA 3G0SA 1FWWA 5DY2A 1VLIA 4GXMA 3IVUA 3DGRA 3TXZA 1W5PA 4WOQA 3S5YA 1YXCA 4DPQA 4OHQA 3RLUA 4LVAA 4WUIA 4XKYB 4FXRA 2Y7EA 1U83A 2CLIA 4P61A 5HULA 3C8FA 5TBOA 1ML1A 3C4UA 3RNDA 5BRBA 1SZNA 2QJHA 2G95A 4HKPA 4ADTA 1GVFA 4MZYA 3O6DA 5AYZA 1KM6A 3BPWA 1FWNA 3W1NA 3NDOA 2QUTA 4JYFA 1GVOA 3H55A 4FNTA 1YLVA 2NXGA 1AG1O 4LU0A 1P1XA 2P10A 3WK3A 5FEPA 4H3DA 3FS2A 3N19B 3P5ZA 1CW2A 2JGYA 5BMXA 1YADA 3SSJA 4FNQA 1GG0A 1F6KA 4Z0SA 1HO4A 3LXBA 1D9EA 4IGHA 4GWEA 3ZWSA 1O94A 3GAKA 3BW2A 5CSRA 1NVMA 1MEIA 3FYOA 1H1YA 1KLYA 4PEKA 4DXVA 1F2JA 4ORIA 6ALDA 2NUWA 3KAOA 4JDYA 5A8GA 1R2SA 3ZWTA 3ELFA 1AW5A 5HNRA 2WJZA 2ZA1A 3PSWA 1LZOA 5EMUA 3QMSA 3LI1A 4FNPA 4R33A 1JCYA 3W7JA 1DHPA 3FFSA 3R2GA 4JICA 2YSWA 1DL3A 3MWAA 4A2RA 4CCEA 2QCHA 2R94A 3M47A 2HMCA 3IIXA 4K37A 2B0MA 2EGZA 2VEKA 3UXDA 4AF0A 4EWND 2FQIA 1F74A 2WPBA 5AYXA 3PWAA 3BLEA 1L6YA 3HF3A 4UFLA 4XQ6A 2Z6JA 3SGUA 5HQEA 1M5WA 1XL9A 3TFCA 3I7QA 2OZ0A 1LROA 1I45A 3MHFA 2H8XA 4LC8A 1SR9A 4MY1A 2FPYA 5HJLA 2V8ZA 1GTEA 3P8JA 3G1AA 1Q6RA 4JYEA 4JDBA 3UWYA 1W5OA 2PC4A 3M43A 1F6PA 3NQMA 3C2EA 4N02A 3G1YA 4RZ4A 1XBXA 4MIMA 3WJSA 1X6UA 3TU9A 1A5SA 2A7NA 4O14A 2ZRUA 3LLDA 5F4SA 1EWEA 3W2LA 5C5YA 3L5LA 5CSSA 2W6RA 1YYAA 1OF6A 3PAJA 4K8HA 1GYLA 2V5LA 3TJXA 1L9WA 4UMAA 1EP3A 1QR7A 1ZY9A 3VKJA 1JVNA 1OX4B 3L2IA 2FIQA 1FX6A 5AHMA 3STEA 4TIMA 2FB3A 3UNDA 4CCDA 5F4WA 3Q37A 3W7HA 1IXQA 1QPRA 3QYQA 4WOZA 2W79A 3NO5A 5AC6A 3KVJA 1D3GA 4ZQPA 1SO6A 3V1PA 5G5IA 1HO1A 1XCFA 3TR2A 2V2DA 3W2JA 1I2OA 1SPQA 3SFKA 2NWRA 4LV9A 2ZA2A 3M0ZA 1O5XA 5CPMA 4HSNA 1KM3A 1OK6A 3HJZA 1KW1A 4NJKA 3TUUA 2J9YA 4YCPA 4RV8A 4AWUA 1VGAA 2Z0IA 1TPEA 2QJIA 4D2JA 2Y62A 3HGOA 3KX6A 3LOTA 2VFGA 5D37A 5DCDA 5FI8A 1RQBA 4MY9A 4AWTA 2YPIA 4GNJA 3LGEA 3LTSA 4Q32A 2NLIA 2Y88A 4GUJA 1TSIA 2A2IA 5K9DA 3MJYA 1G4EA 1JCJA 3FJ6A 4S2BA 3LTYA 2BXVA 1X1ZA 5KSWA 3M5VA 4DF2A 5DELA 2ABBA 4DO5A 1PE1A 1OFPA 2CZDA 2C13A 4LS1A 2A6NA 2XFWA 2YYUA 4FNSA 4IMDA 5SWUA 2V5BA 1ZCOA 1QOQA 3N9SA 2NX9A 5DXXA 4ALDA 2NX1A 4LOCA 3L65A 4GUHA 2CZFA 3DZ1A 4WD0A 2J9XA 3F4NA 5AFDA 1W37A 5C55A 5LNWA 2FFCA 4HN4A 3UZJA 1LP6A 4YWIA 5U7SA 3S5OA 4UFHA 1IXPA 1VCGA 1W3TA 3B05A 2GVLA 3SZ8A 3DFSA 3BG5A 2NWSA 3I68A 1LBLA 1IIHA 1G7VA 4PH6A 5FF4A 2Y7FA 1ZAJA 5AHNA 3LI0A 4UXDA 4WY0F 1QOPA 1UBSA 3UPWA 1JCMP 3PG8A 2NV1A 4HNNA 4AF0B 4QJ1A 3M5XA 1QAPA 2QCFA 2JKPA 1TCDA 4JS3A 5F4XA 1OFDA 2WNZA 3QPZA 3LRKA 3S1WA 2V81A 1WAUA 4I7VA 5LKYA 1KFBA 1TRDA 5HINA 1H5YA 3M5ZA 1TYGA 1W3IA 3RK8A 2XN2A 4TR9A 1A5AA 3S1VA 1K7EA 3IVTA 3IIVA 2A7PA 3HO8A 3N14A 5LNSA 2GOUA 4UTWC 3P61A 5D02A 3DKJA 4GUIA 5FEXA 4TO8A 2RFGA 3TSBA 4MFEA 1T99A 1EIXA 1DVJA 2X1SA 3O05A 2NX3A 3DFOA 1Z48A 1KM4A 1DQWA 2LLEA 1VR6A 5LZLA 1OK4A 3BG3A 3W7CA 1ZAIA 5C6MA 3B03A 4M6QA 3CT7A 5BW6A 3EXTA 3N3MA 4W9TA 3CEPA 1YDNA 4POCA 3QC3A 1B4KA 4E38A 4Y9AA 2XN0A 2F84A 3L21A 4JXCA 4P2VA 3O07A 4QQ3A 4JTSA 4Q4KA 1RR2A 1LLWA 3DAQA 1GVRA 3EX4A 4HNTA 1VYRA 3LBCA 5D33A 1JQXA 1TMHA 4WX2A 1AL8A 3NPUA 3UY7A 3MHUA 3EXSA 4NXKA 3AO0A 3FYPA 2YDAA 4GFSA 2FLIA 4LVGA 4M7TA 2PRHA 2Y7DA 3GR8A 3G1VA 4YXGA 3U2OA 1VRDA 4A21A 5FEWA 4AAJA 4FXSA 2B7QA 2QDGA 3R12A 3V75A 1WOAA 4OQVA 3H54A 1OX5A 2G5WA 3NQ6A 3DI1A 1GT8A 4RZ6A 4RR4A 1JCLA 3C52A 2GVGA 4UTWA 3GKFA 4UFKA 2ZRXA 2E6YA 3CU2A 5K3VA 4FO4A 3G8RA 1FWSA 3M6YA 4S1FA 2ZZ3A 5DBUA 2BX7A 3NR0A 3NGJA 1JULA 2ZZ4A 4DBEA 3BV4A 4NUWA 1MEWA 2P0OA 2WNQA 2ZA3A 2NUYA 4UC5A 3WK0A 4CQ8A 1TJRA 2ZZ7A 1TPUA 4LRTA 4ADUA 1LRQA 3GVGA 1A50A 4IPJA 4N9EA 3W1RA 4O1DA 3EWYA 3NYZA 1W8SA 3STFA 1EUNA 1ME9A 4CNNA 4TMCA 1TIMA 3QQ1A 2ZRYA 1ZFJA 3A5FA 1P0NA 3PBVA 2YZRA 1W1ZA 3LCFA 3O16A 5E93A 1FXPA 1YXDA 4A29A 1VCFA 2GQ9A 3ABSA 1P5BA 2YFOA 2ZZ5A 1TV7A 1QNVA 4WQ6A 3R89A 4GUFA 3L5AA 4ZQRA 3TK7A 3EEGA 2A85A 1ALDA 3I7SA 3NZRA 2ISSA 2B7OA 2C1HA 3IGXA 3Q2DA 4K38A 1AW2A 1F73A 5H91A 4ZL1A 2VEMA 3UY8A 5I3KA 4O53A 5D04C 2CFFA 2PRLA 5HUOA 3DFPA 3FIGA 1HUVA 3W85A 2Q3RA 5FEZA 3EX6A 4E0CA 3HOJA 4ZQCA 1H7PA 5CPNA 2C19A 1YPFA 4UTUA 3LHVA 5D30A 5H2ZA 2CLMA 1N7KA 2AQWA 2RHGA 2BZNA 5L9FA 3NOEA 3C61A 2ZRVA 2CU0A 3EKZA 3I7RA 3G1HA 3HBLA 1O95A 3PB2A 2VFHA 3P62A 2A1YA 3SJ3A 2DZTA 4PC8A 2HTMA 3IIPA 4K6AA 3W2UA 2G97A 3NL2A 3E96A 3ABRA 4JTTA 5FF3A 4LTSA 3DXIA 3KOFA 4UR8A 3HPXA 3Q58A 3W1XA 1V5XA 4H6KA 4QSHA 3B8DA 1PL9A 3O6CA 3NQGA 3PB0A 4LS2A 3W7MA 3L0NA 1QWGA 5G2WA 5D32A 4EOUA 4JTGA 3G0XA 3PUEA 4UMBA 1KFEA 1TPFA 2VEIA 1WA3A 4ML9A 5IBXA 3CHVA 3IGSA 3G1XA 1LLZA 3ATYA 3CB8A 4K8EA 3UPBA 3E49A 3G3MA 3SECA 1SZEA 1XM3A 1R2TA 4LY8A 1H51A 5K9XA 4UNKA 3C3NA 3NPVA 5J5RA 1JCXA 2VENA 2V2CA 3KVMA 3QW3A 2TMDA 3P82A 2ZBTA 1S3HA 2V82A 4G1KA 1TQXA 4Y90A 3QJAA 3LCIA 3QPYA 5EA9A 1SU5A 2WSRA 4JIQA 3FEMA 3TROA 2JKAA 3KVKA 4BFAA 3GXTA 2E5BA 3W86A 3HG3A 2GVJA 5FESA 1G7UA 1G4TA 1RD5A 1J5TA 1PV8A 2WO5A 1OFBA 1DOSA 1R30A 3MBDA 3DFNA 4OV9A 3W71A 1TPB1 1LBMA 5F2LA 2OMAA 1L6SA 4ZMGA 3CLMA 3NQDA 1EA0A 1TQJA 4JY8A 1KFCA 1EEPA 1OHLA 3G8EA 2X1TA 4Y6GA 1MO0A 3HIJA 3O1NA 1SQ7A 4QNWA 2BTMA 3GYEA 1L6WA 3QF0A 3NL5A 3T40A 1UB3A 4MYAA 1KM2A 3TX9A 4CLMA 4IQLA 4LRSA 4MYXA 4O12A 3MYOA 2GJNA 3LERA 5I3IA 5F1UA 1LRNA 4TX9A 4NJIA 3PG9A 4HIBA 3LXCA 3W6YA 3BGGA 2QCEA 2JBMA 4ZQMA 1LORA 1O5KA 3TMQA 5KZMA 3HGSA 4ZVJA 3LHUA 1M6JA 3PSVA 5AN7A 4NZJA 3W22A 4LUIA 1QPOA 2TYSA 1KM1A 3TC7A 4N9BA 1ME8A 4UTJA 4DO6A 5KMYA 1DV7A 3HPZA 5F2IA 3S6DA 1KV8A 4N9DA 2DZUA 2PURA 1H60A 3N2XA 2Z1BA 3HGRA 2CLLA 5EY5A 2I1OA 1SW7A 3JRKA 5F1VA 3TW7A 3QM3A 1E51A 3B06A 3LCHA 4O0ZA 3TMLA 4KFNA 2HS8A 1JJKA 4OGZA 2QAPA 2BWGA 3T55A 4A3UA 2CWNA 3NQ8A 1IIGA 4JYDA 1XDMA 1T8XA 3G24A 1F76A 2DZXA 3L66A 1JRBA 1R46A 4BI6A 1RQEA 1KBIA 5KITA 1LTDA 4N6FA 2VELA 1KM0A 3W7OA 3MP3A 3E12A 4NJHA 3TAOA 4O17A 4K7VA 1TTQA 3SW6A 2ISWA 4MLJA 4Q33A 5D2TA 1VCVA 1ZAHA 4OBTA 2YW3A 2QCGA 3HQ1A 3LHTA 3W23A 3NAVA 1T0OA 3F03K 1SO4A 3GNNA 3W1TA 5D2WA 3G1SA 2DZVA 4FNRA 4M19A 3TQKA 3W7QA 3M7WA 1BEUA 1AMKA 4NVTA 1PHWA 1JRCA 3MO7A 4AXKA 3MUXA 2H3DA 1TPVA 4IX2A 5LNVA 2C3ZA 4TMBA 1FDZA 1H7NA 3QMRA 3LRLA 3NPWA 4LVDA 3W1QA 1A5BA 1G4SA 5EYWA 3G3DA 3NL3A 3NM3A 4Z08A 2CZ5A 2YCEA 2C14A 1XXXA 2WQPA 4OE7A 1W3NA 2E6FA 1CI1A 3GZ3A 1Q45A 1OFAA 1SO5A 1W5QA 1WX0A 2NXIA 3RFAA 1DQXA 3M5YA 2VFDA 3GB6A 1I4NA 1SUXA 1RVGA 2WOQA 3B0PA 4FF7A 1RZMA 4PL1A 1RPXA 1DJQA 4PTNA 3A5VA 3NXFA 3QH2A 4DF1A 1LRTA 3W7IA 4Z1CA 1EWDA 5LGXA 2A7RA 4EF9A 3D0CA 3NL6A 3TAKA 3P67A 4JX4A 1TTIA 1QCWA 4JTIA 2QJGA 4HPXA 3N2MA 3WFAA 1H1ZA 4K39A 1A5CA 3W7DA 4O1BA 2ZYFA 4JTFA 4RXGA 3W1PA 4NX0A 2C0AA 2PRMA 1W54A 1YTDA 1LM1A 3H53A 1SZGA 4JIPA 3W7RA 1IGSA 2Y70A 1P0KA 4AMAA 1JR1A 2W0UA 4UTHA 5HR7A 3C2OA 3EWUA 4OT7A 3ABQA 3HG5A 2O7SA 7TIMA 1SFLA 3OIXA 2V9DA 4WXYA 3LHZA 3VNDA 1TO3A 3HMJG 3LLFA 4LV4A 3IIOA 1EPXA 3KRZA 3SGZA 2H6RA 2VKZG 4M7SA 1NF0A 4O16A 3W7PA 3LBMA 1VC4A 1T96A 1THFD 3TIMA 4IMFA 3W2KA 1VS1A 3RLVA 2E5DA 3JS3A 2KZHA 3LTPA 1ZNNA 3UWQA 3W07A 4QISA 4X3ZA 4O4VA 2Y6ZA 3W73A 4O10A 1W31A 1JCNA 3WJYA 1YDOA 1FCBA 2DZSA 3KVLA 2RDTA 3M44A 1Y0EA 3TQ0A 3W1UA 5AC8A 2ZZ1A 3G1DA 4LC6A 3O6YX 1FWRA 3MYPA 1KFJA 2RKXA 4JEQA 5DCEA 3U8GA 3VE9A 4A22A 4JY9A 1WBJA 3BLFA 5K4ZA 3F1QA 4O19A 2QAFA 3UD6A 1GVSA 3VI2A 5AHIA 3A9IA 3WK1A 5G4WA 4K36A 3CIWA 1LYXA 2X16A 5AB3A 3S8HA
chains in the Genus database with same CATH superfamily
1MXGA 3MBFA 1YTEA 3IS4A 2CLPA 3W9ZA 3OZPA 1Y5WA 1R3QA 3H7RA 5CEWA 1Q8JA 1C91A 1WYIA 3DBPA 3VIGA 3OYXA 2UY4A 1GJPA 1DORA 1OYCA 2D3NA 4G8TA 1FH7A 3E2SA 5FCZA 1KLZA 4F9JA 2HE8A 4S3FA 2C0HA 3CV7A 2YR1A 3KWSA 1VEPA 3L0GA 1O60A 1GHSA 4BR1A 1FFRA 3NXLA 3RPDA 1KFKA 2QHAA 1V7YA 4W86A 2ZOXA 3B4UA 1UUOA 4DIAA 3GHRA 1J6PA 1TA3B 4DJFD 2VRQA 2AMGA 2DT1A 3AJ7A 3QSRA 3CNYA 5T9CE 3VK5A 2XFYA 4ZFCA 5D8WA 4O15A 3W84A 4U5KA 1LWIA 1WXJA 3EOLA 1UKOA 4KGJA 3WJZA 3SQMA 2EAWA 5D09A 8XIMA 4H83A 3M0IA 2ZTJA 3AIQA 5BMWA 4NZ5A 1WUEA 3WUEA 2E40A 4Y96A 5CC6A 4XWUA 2P76A 4AH7A 2VXNA 2Z25A 3GTFA 3VD9A 1NFBA 4X22A 3THCA 3QPEA 1Z42A 2H3BA 4PCPA 1YDVA 3EPOA 3UA4A 4BI5A 2XIIA 4IPLA 3PUDA 2BVWA 3PHAA 5JUVA 7REQA 3TA6A 3KBSA 3V3WA 3IIZA 4DELA 4DO7A 1FXQA 1QPKA 3UR7A 1E4MM 1XQLA 3KL5A 3VKDA 3SDOA 3V16A 2E8ZA 5HMSA 3NJ3A 2HISA 4PFHA 1J8VA 3W76A 2HVMA 4IMGA 4QFUA 1U22A 1VLWA 2FHBA 3N9KA 4UCGA 4PSPA 4KBXA 2PWEA 3TTSA 3KDOA 3P2VA 7ENLA 2J6XA 4UTTA 4MWAE 1ZP4A 1UA7A 1I0BA 4UUIA 4GIYA 3H2FA 5I23A 4EXBA 3VC5A 1FKXA 5G2HA 3GRIA 3B4YA 4R7JA 2OEJA 6CGTA 3OG3A 1DJNA 3XISA 1SSGA 1ELSA 4FEZA 3BAXA 3PUGA 3C2FA 1SYTA 3CUHA 3I3BA 2NV2A 3K8LA 1A5LC 2QPSA 3VIFA 3NQEA 1GZGA 2HZGA 2ZQ0A 3T05A 2A0NA 2X7WA 5JBDA 3WMSA 4ZO8A 3V7PA 4LVBA 3VABA 1PS9A 4FR1A 5I3HA 1PVNA 2QLYA 2VOMA 1RJPA 4AD1A 2XWDA 4JQ2A 3PJTA 1B57A 4B4FA 4PB3A 3AUJA 3EDJA 3PPFA 1W17A 3GVWA 1M9HA 2EG6A 3W7NA 3P3BA 4OBSA 3B0YA 1LOQA 4JR5A 2YLAA 1ISZA 1R3TA 2VWTA 3OQEA 3C2VA 1SVDA 2A3BA 3CHEA 3LY0A 2OO6A 2HK1A 1CGUA 3SN4A 1TTJA 1TV3A 1ZP3A 4AWSA 3W88A 5MHBA 2YDSA 3QXBA 3RHGA 1DE5A 1VH7A 1PX4A 2QF7A 3CO8A 3DH7A 4AX7A 1RQHA 1ZS2A 3MMTA 2BXYA 3W70A 1GZ1A 1AK5A 4DBDA 3WBWA 4UTFA 5FSEC 5CPQA 3ERPA 3FK4A 3MUAA 2Y5SA 3STCA 3A47A 4PFMA 3QYSA 3VM7A 5K2ZA 1FHUA 3C56A 1GVQA 3W2NA 1B5TA 1HTIA 3LRMA 4Y9OA 1HKVA 1XC4A 4LW7A 3BLLA 3TSMA 3NGFA 3AQUA 1F7BA 3OZYA 2YA1A 4DZIA 1E5NA 4IIEA 1LJYA 1ADSA 1NIUA 1J2WA 2YX0A 1H49A 4FXFA 3KXQA 3NSNA 3RJXA 3O9NA 3QMTA 3RPMA 4OV4A 2ZADA 4QS6A 4MUZA 3THAA 4DX3A 1AQHA 4NJGA 1XD1A 4QAWA 3AISA 1EX1A 3LV5A 1I2QA 4DPPA 1OVDA 3K4DA 2QUUA 1Z41A 3W82A 5H1WA 1FUYA 1DJZA 3N25A 4AEFA 4DBUA 1E1CA 2D22A 1UR0A 3WEMA 3QSTA 2A21A 5EFFA 3LXAA 4QGCA 4M5PA 4NU7A 1MXDA 2I5QA 1DJGA 3BK0A 4O1EA 1KR0A 2YXXA 1SM9A 1B0IA 4DJFC 1Q6LA 2BMBA 2O7QA 1PX3A 5HNUA 4GZJA 2ESCA 1CGTA 4GIEA 2EBNA 3A22A 1TB3A 3SI9A 2DZPA 2VZVA 2X41A 2R1LA 2WLYA 4XD3A 1BTMA 4WHBA 4PA8A 3UXIA 4IJBA 4A3RA 2MUCA 4H6EA 4KKXA 2Q8ZA 3N6QA 4IM4A 2PTZA 2CBUA 4EXAA 1BG4A 3N9RA 3T7VA 1XYAA 5XINA 3CASA 5EBUA 1EIBA 5LHEA 1E6ZA 2D0FA 1M01A 1L6GA 3MVTA 3EWDA 2OO0A 4E2OA 5AHLA 4KFOA 2QJNA 5AVHA 4AYGA 2VFIA 3PPCA 4S38A 2F38A 3IACA 1UKPA 3NQ2A 4P7RA 3VYLA 2PGWA 4ACZB 3NVTA 4OBRA 4PTVA 1ISXA 2PD5A 4MOZA 3AIVA 3EDEA 4PBGA 5I3FA 2QULA 4FOJA 3P5YA 4MPQA 1EC8A 2IXVA 1REQA 1HJQA 1H0IA 1WO2A 3KP1A 4I5UA 1VZWA 4DJFA 2GUYA 3GH7A 3LM7A 4IFRA 5BROA 1US0A 2OT1A 4DM1A 5A8PA 2PWHA 5HBFA 1C92A 2AQVA 2CHRA 3TJLA 2P0IA 4F2BA 3HFYA 3LPPA 4QE4A 4XKMA 3LUTA 3APYA 2GVEA 1MSSA 3ABOA 5KZDA 4O54A 3T09A 4N7QA 3QFEA 3TDFA 3RCNA 3U5UA 2BVYA 3VNMA 2ASHA 3GR7A 4H7ZA 3R8GA 4CVUA 4BEQA 1FQ0A 4AHQA 3MUIA 2ZWZA 1UASA 3WELA 4IX0A 2P50A 3WDQA 1H7WA 1TPWA 2A6LA 1R3VA 3HTWA 2QXWA 2FMNA 4RE2A 1KM5A 1GQNA 1K9EA 4JIHA 2QW5A 2VFEA 3LU2A 3WQ6A 1G6CA 3QHOA 5M1TA 1H3GA 2XIMA 2PS2A 3S5NA 2PDQA 3H21A 3HA1A 3D6NA 2NZLA 3W87A 1XLKA 4LFYA 4O28A 2Z2BA 4W8AA 4WIWA 3T0AA 3ME3A 4J9JA 3W4RA 4XVEA 3GU1A 2XH2A 3UXLA 4WSJA 3TW6A 1J0ZA 3WENA 3OZOA 3GWQA 2XFRA 2UWFA 4TU1A 3S1GA 5D2XA 3WCZA 1K7FA 1XRSA 3S2JA 1Q5MA 4JTUA 5REQA 1ODZA 4JHOA 2HSAA 2I56A 1NELA 4E2BA 4CD7A 5U4NA 3E3HA 1OG0A 2X2GA 3WY1A 4Q8MA 8TIMA 1IR2A 4M6UA 2HE5A 4Q3MA 4JD4A 4FS9A 4PUDA 1WV2A 5LIWX 3OHIA 3NYDA 1NARA 1GQIA 4L4MA 4XSLA 4PBEA 2QDDA 1TR9A 1PJ9A 3TVAA 1ZALA 4HZ6A 2VX4A 4CD5A 3CZKA 1R7AA 3COTA 3HG2A 3SQSA 4ATWA 2D69A 1SJBA 4RZ5A 2QPXA 4LCSA 3O2LA 3CM4A 4AU0A 3OYZA 5LNUA 3S0CA 3HB9A 1PX8A 3OG2A 3RR1A 2FHFA 2ZE0A 1YPIA 1UUMA 3NA8A 1B2YA 1TX2A 4J5NA 3LQLA 1X39A 3B9EA 3GDKA 2WBGA 1L8NA 3V35A 2ZXDA 3WQ8A 2DZAA 1LUCB 1ZSXA 2XSAA 3FCPA 3VM5A 1V0KA 3MY9A 3GKAA 4XZLX 1XLGA 4LUYA 5CZJA 3SUTA 2PWVA 4RKAA 4WRHA 3DHDA 4V27A 4PCFA 3BJFA 1YBQB 3K2GA 5CBBA 3RX3A 2PDCA 3B0XA 2I14A 3VCNA 4KWVA 4IUOA 1XLHA 1TG7A 3KLKA 5I0DA 1YE6A 1EC9A 4EAMA 3IRSA 2QNEA 2VTFA 3FGCA 1UJQA 5EMYA 1VHCA 3SIZA 4PTXA 1FHLA 3ZLFA 1OYBA 3EMZA 2RH9A 4G7EB 4GKLA 4IP7A 1A0EA 3ZQ9A 3M0MA 4Z1DA 4YLWA 3IVSA 1JF6A 3REQB 2QIWA 1MDRA 3PULA 4HPJA 1TJPA 4V2XA 1KRAC 2DT3A 5CJNA 3HPAA 3WNPA 4JTHA 4XSMA 5CPOA 4GYPC 1PXGA 5BXPA 3M0YA 3KP0A 1TREA 4D72A 4UTIA 5BOOA 3CPRA 4US6A 1I2PA 3A6OA 3F5KA 3NURA 4J3XA 3GU2A 3RG6A 1ZBKA 3BLKA 3NQFA 4DUOA 4GIAA 4JNYA 1WXYA 1I1WA 3GIYA 2E77A 2F7FA 5BCAA 1XLIA 2YFNA 2YBUA 4HNUA 1GCYA 3VE7A 4YIWA 3ARTA 3POHA 4KCVA 3PBUA 1KA9F 1M7PA 3R25A 1KTNA 1UCWA 1NWUA 2PP1A 4I9AA 2YDRA 4DLFA 2Z6IA 4NQ1A 2WPGA 3AMGA 2BODX 4WJXA 2OPJA 1W56A 3H2AA 2CITA 1DKWA 1W1A1 3KS5A 1EBGA 4NKCA 1MDLA 3CAVA 3ITVA 3KBWA 3TXZA 2WZEA 5G1MA 1PKLA 3DN5A 3RLUA 4MADA 1QW8A 4XKYB 1Y5VA 4S3AA 4M1RA 9CGTA 1ML1A 3C4UA 3GXMA 4GYPA 5H8UA 5BRBA 2VR2A 1BVWA 2G95A 4GACA 3BPWA 1AQMA 4PGLA 3H55A 4LU0A 5A6MA 3R4IA 4KPLA 5JQ9A 5BMXA 3SSJA 1GG0A 1F6KA 4Z0SA 1D9EA 3ICJA 3CUFA 3ARYA 4B3LA 3BTNA 4J35A 3VILA 1UMYA 1A80A 4AEEA 4L7ZA 1D2KA 1H1YA 1V02A 1E43A 3VTRA 2Z7KA 2NVDA 4DXVA 3QOMA 4LX4A 3BV7A 3KAOA 5A8GA 4JL1A 4GQGA 3M0HA 1XGEA 3A3WA 5EMUA 3LI1A 3DECA 4JICA 3MWAA 2OWXA 4CCEA 1E71M 1E6RA 3MV01 3M47A 2VP8A 3IIXA 4K37A 2B0MA 2EGZA 1VKFA 2XGBA 1IZCA 1LL7A 4MJ4A 4XZWA 3U2EA 3K5XA 5HQEA 3DHUA 4Y9NA 3VNJA 4HMCA 4QG6A 2FPYA 2V8ZA 3KCJA 4GQRA 2DPEA 4JYEA 3R7MA 1AQFA 4W7WA 3NQMA 1OZMA 3G1YA 3TU9A 3TYAA 3W2LA 5C5YA 3LLDA 3L5LA 1E6NA 1OF6A 3QGAC 3VKAA 4K8HA 1GYLA 2QJJA 4KCUA 1L9WA 4F0MA 4UMAA 1EP3A 3VKJA 2Q71A 3HQNA 2EO7A 4WKHA 4R7OA 4NRRA 4AZIA 5F4WA 2YOCA 3QYQA 4WOZA 1P6CA 1FFQA 3KVJA 4K1GA 1MZRA 3V1PA 1EEXA 1XCFA 1XIGA 2PDYA 2V2DA 3U4AA 1I2OA 3SRKA 1OZQA 3AU2A 4R5EA 3KWXA 1X7IA 3BJSA 5CPMA 3JZUA 4F48A 1OK6A 2VDIA 2J9YA 3MTWA 2Z0IA 3ARPA 3WLKX 1TPEA 2WYSA 3KX6A 5FI8A 4AWTA 1UC5A 4REQA 2NLIA 2A3AA 4GYJA 1PUDA 5D9OA 4RL3A 3GO2A 3H8AA 4HU8A 1JCJA 3FJ6A 1S3TC 2BXVA 1X1ZA 4GNKB 3SRDA 4YVVA 2BFGA 4LS1A 2YYUA 4IMDA 5SWUA 2YL5A 3C0QA 4IP5A 5DXXA 3VD7A 4D1JA 2NX1A 2POZA 4LOCA 3L65A 3WF0A 2WJEA 3IUDA 2YA2A 4AWEA 4WD0A 2J9XA 2DSKA 5KETA 4P7QA 4UFHA 1VCGA 5D4YA 2PODA 2GWGA 3QV6A 3H6OA 3DFSA 5DQPA 2NWSA 1IIHA 3RLHA 3FHQA 2W62A 2WB5A 1ZAJA 2CBJA 2FZBA 2WZTA 1YHTA 5H8PA 1FOBA 1JCMP 3D47A 3GM8A 1ZPTA 4XO6A 2YDQA 2JKPA 1MFUA 4PTMA 4FPSA 4G56A 1J5SA 4F0SA 3LRKA 4Q8PA 1KFBA 5HINA 3M5ZA 2V69A 5HDRA 3FVMA 4C65A 1EC7A 4BF7A 3HO8A 3N14A 4G7FA 3VMPA 5LNSA 3FY1A 2GOUA 4UTWC 1QOXA 3P61A 4I6KA 3C0LA 5C9RA 1MMFA 1EIXA 3DFOA 1KM4A 1DQWA 1JZ8A 1G5AA 2C1IA 1FWHC 1OK4A 5C6MA 5M3WA 4FLRA 3N3MA 3EA2A 4D6JA 4Y9AA 2F84A 1PZ0A 4PCSA 3I6TA 4E2VA 3V5OA 4QQ3A 3CL6A 3WH9A 2DT0A 1POJA 1GVRA 4MAVA 3BOFA 2GLKA 4B2DD 2J6VA 1TMHA 1UKTA 3B9NA 3UY7A 4ATLA 4DWSB 5I79A 1NFPA 5A8NA 2YCJA 2FLIA 4QLLA 1HGYA 3R43A 1R87A 1BGGA 1GOWA 5FEWA 1VENA 1BVZA 2B7QA 3SUUA 3H54A 3A13A 4JL2A 3N2CA 1GT8A 4GI4A 2JFEX 4IFKA 4JIRA 1XG3A 2GVGA 4UTWA 2V5JA 4UFKA 3KOYA 3O3RA 3UR8A 1PKYA 3AIEA 4GPNA 5M17A 1JGIA 3OPSA 2WM1A 1PB0A 2X0YA 2Z27A 3BV4A 3W37A 1MEWA 4XAYA 1U2YA 3FXGA 2OOGA 3WK0A 2ZZ7A 1TPUA 1MQPA 4EACA 1CWYA 3QN3A 4WDWA 5DMMA 1RY0A 3VC6A 5HPCA 1ZB5A 3BE7A 4O1DA 1RSCA 3EWYA 1NWRA 3NYZA 1K4GA 4TMCA 2J7FA 2GDQA 3OB8A 3WL0A 2YCKX 4YS1A 3SCNA 3A5FA 2VZSA 3UFYA 1Y5XA 3O16A 1VCFA 4H8UA 2PWDA 4WQ6A 2Y0FA 1GVYA 3WX7A 2O0TA 1Q6FA 4ZQRA 2J7CA 3VNYA 4ENLA 1J0KA 2ISSA 4CNUA 4Q7IA 2PC8A 4YJ5A 2B7OA 1QNPA 3IGXA 4Q6XA 4S3KA 4GI9A 1AW2A 1J79A 2PTYA 2R1PA 5I3KA 3BAJA 3P93A 2CFFA 5MKGA 1GUVA 1F3XA 1LWHA 4M8UA 4MTVA 3ITTA 5HUOA 4C7DA 1JCTA 1AD4A 4UTUA 1ISWA 4DWDA 1JPHA 1LQ2A 3KL0A 2IQ0A 2AQWA 2BZNA 4KERA 2IPFA 3CHDA 1XG4A 4TTUA 2PGRA 3CL8A 3HBLA 5BOFA 2ZXAA 2GJPA 3WD4A 3BDKA 1TMQA 2A1YA 3KBJA 1AFSA 2Z1XA 1AJ0A 5HJXA 1OT2A 4LJ3A 4K6AA 1UR9A 4NAFB 3AWOA 3NL2A 3ABRA 4X9YA 3ZVIA 3B8DA 2Q02A 2PF0A 1QATA 3L0NA 5D32A 2D2GA 3PUEA 1KFEA 1TPFA 3BANA 4LB3A 2W3ZA 4ML9A 5IBXA 5IHRA 1LLZA 3WD2A 3G3MA 2XSBA 2A3HA 4LSBA 1SZEA 1XM3A 1R2TA 3FAXA 4E5TA 1H51A 3GNPA 3TTYA 1DIDA 1W9UA 2PDUA 2EPOA 2OEMA 4H2CA 3VZZA 5K9XA 1WKDA 1CXIA 4K8GA 2J66A 3P82A 1ZL1A 2ZBTA 1S3HA 1PZ3A 3WQCA 4XD6A 5DT7A 4TVDA 2R82A 3DFHA 1UQYA 1SU5A 3RX4A 3L2LA 4JIQA 1EF2A 3GFXA 2BOEX 4BFAA 2PWUA 4W8BA 5FESA 1JDEA 2X0SA 5JVLA 3EAUA 3USZA 4RW5A 4UB9A 1Z9AA 4PUKA 2YB4A 3CLMA 3NQDA 4YTUA 3RM8A 3V0SA 3BCJA 4WGXA 1JZ7A 1MO0A 2OOFA 3KCLA 4QNWA 2BTMA 3GYEA 3QF0A 4HN8A 1HQTA 1EGMA 1KM2A 4YN5A 2FDMA 3F2BA 3MYOA 4EWJA 3NZPA 3LERA 4HHHA 1TZ7A 2XZ7A 1KWKA 4DAIA 2G0WA 3PG9A 3LMZA 3CZ8A 3AXHA 4C5YA 1NDVA 3W6YA 3EGJA 3BGGA 1US3A 3O7UA 3P14A 5EMJA 2WMGA 2OZTA 3TMQA 5KZMA 1V3HA 4ZVJA 3G6MA 3LHUA 5TNVA 4JFTA 1AVAA 3PSVA 2WHMA 3Q65A 5AN7A 4Y7EA 4LUIA 3TC7A 4DUVA 1KRBC 1ME8A 4IG2A 2CWXA 1Z69A 4H8HA 4M29A 1DV7A 3HPZA 3S6DA 3A9BA 1KV8A 4N9DA 5HANA 5C0QA 3W26A 3N2XA 2R24A 4PEEA 3RILA 3JRKA 4LAZA 2WW5A 4O0ZA 3UA3A 1JFHA 4C60A 1CZ1A 2PZ0A 4KQNA 3BWWA 4JYDA 1XDMA 1JRBA 1IWBA 1KBIA 4YVPA 2DSZA 2FZNA 4DZAA 3E12A 2DIEA 5M03A 3BQ5A 1ONXA 3GDBA 3SW6A 2F6XA 4MLJA 4PMYA 5AYIA 4J4KA 3ABXA 3AHXA 2VX7A 4OBTA 2QCGA 2XVLA 1SO4A 1B90A 5D2WA 3G1SA 2DZVA 1GHRA 1KXVA 4NVTA 1JRCA 3TLQA 3MO7A 4B2DA 4JFWA 1TKKA 4LBUA 2OSWA 3RJYA 5B7YA 4QEEA 2H3DA 2VC5A 4TMBA 1FDZA 3RITA 3MB9A 1VBGA 1W2PA 3UCQA 4LVDA 4Y9MA 1A5BA 2NSOA 3R94A 4Z08A 2YCEA 1W1PA 4L9YA 4JTRA 2WNWA 2IKGA 1W3NA 1JG9A 3T6CA 1Q45A 2X05A 4KGLA 1WUFA 2NXIA 3VZYA 3UCCA 3UJSA 4CCZA 2VFDA 4TOQA 4FF7A 1RPXA 1TA3A 4PTNA 3QH2A 2OQLA 4I9MA 3A3XA 4TXEA 3S46A 3VIIA 4UQDA 4IMAA 1A4MA 5LGXA 2HK0A 3B8IA 4JPGA 3F5JA 4Z2KA 2V38A 1BVNP 3P67A 1BG9A 1TTIA 4HCLA 2HPIA 2QJGA 4GABA 1VRXA 4HPXA 3AI0A 1E55A 4GZEA 4BF5A 4CN6A 4WDXA 3ABZA 1UR8A 4O1BA 3PFMA 2C0AA 5C2GA 1JYWA 3CJPA 1JFXA 1W54A 4H9UA 1DYSA 1EDGA 3W7RA 2WHJA 3FV9A 4QS5A 1JR1A 1E5JA 3VCCA 1V0LA 5CJMA 1CNVA 3EWUA 2E28A 2O7SA 3CS2A 4NZCA 1SFLA 2IW0A 4DN1A 3R10A 4WXYA 1J0YA 1XYZA 1ZBVA 4PN2A 2OODA 1QRQA 3KOZA 3VNDA 1UR1A 3TCSA 1TO3A 4L4PA 2PZNA 4YHGA 1X97A 3W7PA 1VC4A 1HW6A 1VS1A 2JF7A 2WCAA 1ZNNA 4R27A 4QISA 5FJTA 2Y6ZA 1JCNA 3M0KA 1S46A 3GNRA 4H2HA 3KVLA 1UP3A 2CC0A 1FH9A 5AC8A 3WMCA 3MYPA 1KFJA 2J7HA 3CZJA 2KX9A 4JEQA 1XLJA 1WBJA 2J7DA 5K4ZA 3WF4A 1E4LA 2QAFA 2VQTA 4AISA 3OHMB 3ALGA 3WK1A 4QCEA 4GMEA 1FH8A 3ZZ1A 2NT1A 3CZGA 4R53A 5CLTA 1CX9A 8XIAA 1BKSA 4IISA 3A23A 2EHHA 2ZIDA 1QI0A 1ITQA 4NAEB 4C91A 1H63A 4EF8A 4NT0A 4C6FA 3E02A 3QBUA 2B81A 1FHDA 1TJ1A 3VOGA 3W7GA 5G1YA 3W1AA 4KEZA 2ZDRA 3LCWA 5HQLA 4J3UA 1Q6DA 5G2IA 3VNZA 3B0VC 1US2A 1HP4A 4P8XA 3QR0A 4ORMA 3JR2A 3PP7A 5E0KA 2X1UA 3NZGA 2R6OA 1REQB 3W81A 1GTHA 5ABFB 1V3KA 2X30A 4LUSA 4WGHA 1UWRA 4IOTA 3MDWA 2Y61A 1EX5A 1R47A 3WDHA 3PBMA 5E70A 3B40A 2PGFA 2Z2UA 1TPC1 2GQ8A 3A4XA 1HJUA 1I2NA 1X38A 2XSXA 3S5ZA 2XGIA 2B7PA 3INPA 1QU4A 1R3SA 1LL6A 1MEHA 4IP4A 4DEFA 2E3ZA 1QASA 4PMNA 4PUUA 4OVXA 4AIEA 2WSYA 2FKPA 1UZDA 3ZT6A 3KRSA 2RAGA 3OJGA 3NZ1A 1C9WA 4ERIA 3EDFA 2J74A 3DENA 3PZIA 4GX9A 3IGHX 1X1OA 3LGDA 4PRRA 5KZEA 2D0HA 2EKGA 1CLKA 2HJPA 4I7WA 1UP0A 4FF5A 4ROQA 4L1XA 1XBZA 3NQAA 3F4WA 1HL8A 2ACRA 2ACUA 1VPQA 2CKRA 2DP3A 2XZ9A 3GDRA 2FPTA 3ZT7A 4HZ8A 5FF0A 2BVTA 1RV8A 1LOLA 2NUXA 2PDKA 2J7BA 2FDSA 5D9PA 1XRTA 1FCVA 4FHAA 4U33A 2DORA 3MW7A 4W5UA 4XBJA 4DF0A 4M6PA 3GDMA 4AY8A 4W4QA 1CPUA 2Q09A 1J0HA 1I2RA 4MDPA 3CQHA 4JTEA 1M7OA 4AD4A 5EB8A 1VYPX 1AH0A 4HA1A 4AHPA 1EJVC 3BH4A 1QT1A 1XKYA 3RO6A 3TQVA 5C7VA 2AAMA 1LOSA 3HU7A 2ISFA 1S2TA 1KRMA 3DDMA 3GLCA 4GBUA 4Q22A 1W5NA 1T6MA 1SW0A 1E3XA 1XFBA 1XKJA 3VA8A 1W3HA 1E6SM 2NLYA 4BJHA 4GCXA 4CD8A 2DVTA 3C2RA 4RDZA 4U3AA 5AHFA 5FF2A 1OX6A 4EPEC 5CZ0A 1RCQA 4MGGA 1JUBA 5GVJA 4BWLA 1BWKA 1NQKA 1VQTA 4ACZA 5LHFA 3CBWA 4MZ1A 1FWIC 4MY8A 4IWWA 3S6TA 4GGBA 1X8CA 4WKAA 1K8YA 1RY8A 3SN1A 3TP4A 4H9ZA 2E6AA 1W0MA 3NQVA 4C6KA 1XIMA 3ORWA 1OIMA 4PUMA 3URQA 3URBA 1QHPA 5D05A 4XG1A 2WVUA 2ANUA 5HUPA 4LS0A 3DYOA 3OODA 4GY7A 4W7VA 4CU6A 2G3JA 3GTIA 3LLXA 4LNYA 3LGGA 3WLMA 1N55A 5I7GA 1NF7A 2PA6A 3EWCA 2XVGA 3EWWA 4LYPA 3WBYA 3QQWA 5FA5A 5HPOA 3B0UX 3B3DA 4O1FA 5DLCA 1S2UA 3E0VA 4UR7A 1WCGA 3BSMA 3OU8A 2OGYA 2A79A 2QV4A 4B5TA 5FAGA 3GE7A 4GUGA 3C8NA 3Q67A 2GUBA 3O06A 4M0XA 2FTPA 3P84A 1EFZA 1CYGA 1LQ0A 2IKHA 5LIXX 5DCBA 5CZSA 1G67A 3R1ZA 1L6FA 3B9DA 3SCPA 4FLQA 2QGYA 3VDGA 2EPLX 8RUCA 3HURA 3W83A 3W7EA 1NOFA 3BW4A 3QHMA 5AHEA 3L4UA 3WG6A 1VJZA 3DFQA 4Q4PA 4ZQNA 1B4EA 1S2WA 3WK2A 4HTBA 3YPIA 7CGTA 4IMCA 3CQ0A 2D24A 2JKEA 1ICQA 1ZHAA 3IJ8A 4PODA 1JEZA 1TV8A 4UMCA 1KFLA 5IXEA 1RD6A 4HNOA 3RRAA 1FA2A 3VO0A 3BZJA 1ADOA 1FWEC 3E0IA 1MXSA 4QROA 3K8KA 4WY0B 2I7GA 5K7JA 2AMXA 3S9YA 3M0VA 2FTYA 2R91A 1IEXA 3F4DA 4KS0A 1A3XA 3S1XA 1C29A 4IPIA 2OKTA 2Y4SA 1ZGDA 4MKSA 3KHJA 3TE9A 1KBLA 4PMQA 3MU7A 3WBAA 1IYXA 3TH6A 4GC4A 1FCQA 5BXTA 3KM8A 4PL2A 4MNLA 4WEVX 1PAMA 2C91A 1Q13A 4KWWA 3UWWA 2DEPA 4H01A 1S1RA 3AFBA 1MW3A 4URIA 1PTDA 4NZ3A 4Q8OA 1XCWA 4PMJA 3W02A 1S5VA 1VJSA 4KIEA 4KEUA 4HGXA 1BWLA 4GIRA 3TSDA 4UR9A 3QLLA 5EL1A 4P7LA 1TV4A 1ONEA 4AVOA 3VD4A 3LHYA 3ID7A 1G4PA 1QW9A 3FJLA 5E6ZA 2VL4A 1KRCC 1O4UA 2QKFA 1V79A 1W1B1 4Z1YA 4I8YA 3AJXA 1NOUA 3A3HA 4RNIA 2XWEA 3I6RA 3WMLA 1KV5A 3M41A 3DYPA 1Z7AA 1YBQA 1OINA 4H04A 5TAOA 1WDWA 1TV2A 3PJXA 3M16A 3NG3A 2C18A 4L80A 1XLBA 4BK9A 4A35A 4ZODA 1CXFA 3MCNA 5C9WA 2W61A 1H7OA 4UFMA 2VFFA 4IXHA 2L5HA 5I77A 4YU1A 1L8PA 5E1QA 3SCWA 3LHWA 1X98A 1K6WA 4RJEA 2HBXA 4B5NA 4M6VA 3LCLA 2OYLA 1IZJA 5C54A 3IEBA 4A2SA 2DJXA 1R7OA 3GFZA 1L2UA 1ME7A 1T7LA 3WQ4A 1UH2A 4PMXA 1I1XA 3WLTA 1IE7C 4BQ3A 4UCFA 4MDOA 5AYYA 1UD2A 4JIEA 1A5MC 2FVKA 2PSNA 5CPLA 5DBTA 3WNKA 4HT3A 1W1VA 5AYBA 4UTMA 2PD9A 4NL1A 1XIJA 4CNPA 2DUAA 4XTDA 3CGTA 4KW2A 1RCXB 3EX1A 3LCXA 4YYCA 3TNBA 2TAAA 1TZ9A 2VEGA 2D3LA 3SM0A 4DJED 2EF9A 2RDUA 3AS2A 4BI7A 1V7AA 1SMDA 1JI2A 1RBAA 1ISVA 3GBEA 1OEPA 3T0TA 4XAGA 1L2QA 2WV8A 2J79A 4R88A 4FIQA 1GK8A 3SR7A 3NO3A 3WDIA 4HU3A 1TWDA 2YYTA 1JL8A 1GOXA 4AZ7A 4WJ8A 2GGEA 1JNEA 4I9JA 3VKCA 3MZ2A 1AW1A 4Q8WA 3ARSA 4QCFA 1ZTVA 3R8RA 3GBDA 4XZHA 1W6TA 3PWIA 3OVRA 4MZ8A 1BSIA 4XKYA 2HDJA 3USBA 3IV8A 3AMDA 3FOKA 3RPTA 2PLCA 1QWKA 5GNYA 5AY7A 2CIPA 5A6BD 4XZ9A 4MFDA 4QHRA 7PTDA 3OGVA 2JGQA 3N12A 3W7LA 1RJQA 4RV3A 4UFJA 3DYMA 1AL7A 3MDUA 2QCDB 1UH3A 3EB4A 4F0HA 1TJ2A 2OX1A 2BDQA 1TE6A 2FJKA 4JGDA 4N4PA 1C9DA 4LGXA 4K7YA 4ICMA 3PNUA 3V0UA 2YW4A 5DFAA 1UPMB 3VIPA 4NSBA 5C2XA 5CPTA 1OWQA 2UY2A 1PYMA 2Y2WA 3ALFA 3I10A 3IJDA 3GXNA 5HWMA 5AKQA 5IDIA 4D6EA 2G4FA 3KE0A 4GVGA 5F2GA 1XV8A 4DUXA 1BFNA 3SJNA 3ZR4A 4M80A 5C71A 1PTAA 1PCWA 2GGIA 3TWBA 4DO4A 2A4AA 1EF3A 4KEMA 3ZJ6A 3GC5A 3FA4A 4ZB5A 4PCTA 1IF2A 4HOWA 1VBRA 1IHIA 2F61A 4KFPA 3ZS4A 2HQAA 3WQGA 1IXOA 1Y7VA 2C79A 5LYRA 2J62A 3CXOA 5I3JA 2X7VA 1DEDA 4WSKA 1EOKA 3P74A 3WN6A 3S9ZA 3SCQA 4AVFA 1SJDA 3MCMA 3L4WA 3W2MA 2GVYA 1FWTA 2F8QA 2ZC8A 4N9CA 1UWTA 2OSYA 5LIUX 2ZFAA 3IARA 3TYCA 1K7XA 3MHGA 5KINA 2Y89A 5I3GA 1XW8A 1X7FA 2J88A 1XSJA 2POTA 2D73A 3L4XA 3RAOA 1VIWA 4J3VA 1TE1A 3UCDA 3N11A 4QM1A 4TQTA 3QZEA 1W5MA 2VDGA 3SBFA 4L6DA 4QSFA 1F3TA 3WJWA 3TFXA 1ICPA 3TXVA 4IL0A 1GYMA 1F8IA 4HA4A 1HVXA 4XD4A 3L12A 3IJQA 3Q94A 1K9FA 4L1GA 4F79A 4S2CA 3G1RA 3T44A 1GWJA 4QJ5B 2WM0A 2ZKMX 5DX7A 1H50A 4HCDA 1EGZA 1V8EA 1F5ZA 2O9OA 3G0SA 2PDIA 3GTNA 1J01A 4RNJA 2ZX8A 5C9XA 4S3CA 2OX4A 4GH3A 1W5PA 4WOQA 2PI6A 6XIMA 4JCLA 4WUIA 3CUZA 4IFKB 1VAHA 3M07A 3CQIA 5TBOA 1XICA 5ABEA 3RNDA 3VD3A 1JPDX 1GVFA 3C2YA 3SAZA 4DBSA 3O6DA 4ZE5A 3W1NA 1UUQA 3NDOA 4HB7A 1T8QA 2QUTA 1GVOA 4FNTA 1CXKA 2NXGA 3OLDA 1AG1O 4Q8QA 3QR3A 4H3DA 3FS2A 2AAAA 1ZBCA 3Q4DA 4PSRA 5CSYA 5LA0A 1V0MA 3UJRA 4GWEA 3VGGA 1ZCCA 4HBKA 3GAKA 2BHUA 5CSRA 1NVMA 3L7RA 1G1YA 4L6HA 4RDYA 4DBWA 4S23A 4PEKA 1BTCA 2QF8A 5HQMA 3WNLA 4KESA 3MT1A 3EPNA 3GIQA 6ALDA 3URAA 1R2SA 4ECLA 1UIOA 3MKCA 3PSWA 4E8GA 1EXBA 1R3RA 3R2GA 4XZIA 4A2RA 4LEQA 1HN1A 4DJEC 4JQ1A 3VUPA 2VEKA 5HOSA 3UXDA 1Y8BA 1F74A 3QFWA 3PWAA 3BLEA 1NFGA 1BAGA 4XQ6A 2AL2B 1S39A 5FL1A 2AKMA 1M5WA 1XL9A 3CMGA 1LROA 1I45A 2VQUA 4MY1A 4PRWA 3KW3A 5HJLA 4U10A 1RLCL 1E6PA 1GTEA 3SCRA 1PZ2A 5CGMA 2WMHA 4JDBA 4PUEA 3RU8X 1XCXA 1F6PA 1XGDA 2GSHA 3A64A 3C2EA 5FIPA 1UKSA 3N6JA 2ZXQA 4X60A 1F4AA 4O14A 5F4SA 2ZRUA 1BQGA 3HFTA 2EPMX 4AZCA 1B3XA 3GD6A 1YYAA 3UR5A 1AUSL 1H0GA 2V5LA 4HOXA 3TJXA 4V1YA 1PBGA 1QR7A 3OZMA 5GNXA 4H7VA 1OX4B 1QK2A 3L2IA 3WLJA 5GJPA 2FIQA 2V63A 1HJXA 3STEA 4MNMA 3VDHA 4TIMA 1XIHA 4WKFA 1LF1A 4CCDA 3ZM8A 4JFUA 2XM1A 3W7HA 3QR1A 1QPRA 3KBNA 1IV8A 2W79A 4ZO7A 2WLZA 5AC6A 1M1BA 4ZQPA 1HO1A 2OXNA 3TR2A 2HNHA 2X09A 1VBHA 3N4AA 3MZNA 3R79A 1SPQA 3JW7A 4QJ4B 1EYWA 2CPUA 3M0ZA 1TZZA 4HSNA 1KM3A 3THDA 1M7XA 2WWDA 4JAWA 1JPMA 5FJOA 1BD0A 4RV8A 3NQBA 1VGAA 2QJIA 1V02E 1V6YA 3LOTA 4XZBA 4CVWA 1FP9A 4MY9A 3T0CA 5FSDC 4GNJA 1F61A 5E9AA 3LTSA 3LPFA 4IHCA 2D2JA 1XHGA 2Y88A 3MSRA 3N6HA 3N17A 1G4EA 4C6LA 2HPMA 2Z1SA 4W85A 3WKZA 4PMZA 1ISYA 5KSWA 2Z00A 3M5VA 4DF2A 3UPMA 2X8RA 4DO5A 1OFPA 4FNSA 4HYRA 1D3CA 4H9YA 1JXKA 5A6BA 3FXYA 2FVMA 1RHCA 1ESWA 1EZ2A 1F6YA 3ANVA 4IICA 3DZ1A 2OLHA 4HD5A 3FSUA 4FLOA 2QT3A 4IGSA 5C55A 1D8WA 4CD4A 1B54A 4HN4A 4H8NA 3H22A 2VO5A 3NIYA 3PJUA 2GVLA 1YW1A 2OG9A 1YE4A 2Y8VA 2DIJA 3I68A 1GKQA 2MNRA 5FF4A 1N8WA 3SY8A 5AHNA 2CKSA 4UXDA 1U1UA 2ZX6A 3PG8A 4Q4RA 2NV1A 4AF0B 4QJ1A 1QAPA 3M5XA 2QCFA 4ZOCA 2ALRA 4MMWA 3MC5A 2O9PA 4JS3A 4BQ2A 1RXOB 1XISA 7TAAA 1OFDA 4HTYA 5BRQA 3QPZA 3ZXWA 3DFYA 1HJSA 3PZ9A 5C2CA 1TYGA 3WIJA 2O9TA 3RK8A 1K7EA 1BGAA 3WBXA 4JN8A 1KCLA 3DKJA 3T08A 3CPGA 2F6UA 2FHCA 4GUIA 4TO8A 3VDAA 2RFGA 1T99A 3LBOA 4GD0A 3O05A 1OQFA 2EJ1A 5EMMA 1VR6A 1HL9A 4UQAA 4HYWA 2JQXA 3B03A 4M6QA 1XP3A 5JMUA 3VGEA 5EMLA 2BHYA 1MQRA 4W9TA 2PF8A 3CEPA 3K1GA 1A4LA 1ZU8A 1VF8A 4PMOA 4IGNA 2RGMA 4JXCA 1EJSC 3S2CA 1KNWA 1OCBA 4Q4KA 5FKYA 2PDHA 3MUCA 4EANA 4FLSA 5D33A 1JQXA 1AH4A 3PPHA 4WX2A 3RXZA 1C7TA 3NPUA 3MHUA 3UG4A 3EXSA 3VOFA 2XJ7A 4DY1A 3CH9A 2YDAA 3F2DA 1TMLA 4GFSA 1E70M 3VXGA 1A5KC 1XIFA 4WCJA 2Y7DA 3KL3A 2X0HA 1V93A 1XR2A 3JUGA 1CBGA 3UGRA 1ITUA 1M53A 3A4JA 2GOKA 3AHZA 1Z32X 1XS2A 3DI1A 1JCLA 3C52A 4H8VA 3HQPA 1O1ZA 3CU2A 2E6YA 3G8RA 4DZHA 3M6YA 5CAKA 2BX7A 1OC5A 2IQDA 4XX6A 4GYKA 1N2VA 1CXEA 3TJIA 3UGVA 3C86A 5FACA 2V3EA 5JU6A 1XX1A 1IWAA 4CQ8A 1TJRA 4N9EA 3GUGA 1MWOA 4PULA 4F0LA 3UESA 3GTXA 2VGIA 3WYZA 4M56A 1X96A 1KQYA 2QPUA 2VT0A 3M0JA 2YZRA 3PBVA 1JAKA 3I3EA 4A3HA 3HN3A 2GQ9A 1YNQA 5BXSA 3EEZA 1BYAA 2YFOA 3GXFA 2ZZ5A 4KRUA 2PAJA 2YCLB 4GUFA 3L5AA 3TK7A 1Q6CA 2H9AB 2VZTA 1ALDA 4LYQA 3SY1A 2ON3A 3BCFA 5GNZA 2C1HA 3WQPA 4LALA 3MUZ1 1PKNA 2VJXA 4DAFA 1F73A 1KFWA 2VEMA 3UY8A 2PRLA 3DFPA 3FIGA 3AHVA 1NH6A 4ICCX 1AJZA 1OD8A 2ADAA 3L4TA 1YPFA 3LHVA 3LM3A 2RHGA 3NOEA 4IH3A 3T2PA 4QRNA 2ZRVA 3EKZA 3I7RA 5DO8A 2PEVA 2GFTA 3G1HA 4KT2A 4B5SA 3K46A 3PB2A 4AIOA 3LG3A 5IDZA 1H5VA 3I6EA 4PZVA 3NSMA 2DT2A 4AD0A 1XYMA 4I9TA 3W00A 1U30A 3SJ3A 1W9VA 2DZTA 4H9VA 4PC8A 2HTMA 2D2OA 2O56A 5DMNA 1WZKA 3IIPA 2AKZA 3HMCA 3FYYA 1FP8A 5FF3A 2YB1A 5EGRA 3DBNA 2XVPA 1V5XA 4H6KA 5BU6A 3O0FA 4QXIA 2DSWA 3PB0A 4LS2A 4AX6A 4UMBA 4RDVA 4Z17A 3CHVA 3E0WA 3IGSA 3PZUA 3ATYA 3CB8A 4ZSUA 4TVCA 4AZ6A 4LY8A 4L5ZA 1UWIA 1MVYA 3OOQA 1IQ8A 1M03A 3GG7A 4UNKA 5J5RA 1JCXA 5J8LA 4ACYA 5HNTA 5CC3A 4HZMA 3QW3A 4Y9PA 1V6XA 1DTNA 2V82A 4G1KA 4JEJA 1OCJA 2V3FA 1CB2A 4XAZA 2WXDM 3QJAA 3LCIA 4C6NA 2I17A 1JZ2A 5A2BA 4LUSB 2WANA 1R3WA 2FH6A 3UETA 5CXPA 4OTKA 3B97A 3HG3A 2GVJA 3T42A 1G4TA 1Q4NX 3V5CA 2WAGA 2ZX9A 1PV8A 3WUFA 1GOQA 1QHZA 1R30A 3MBDA 3K8MA 4ZMGA 4ASTA 1TQJA 1OHLA 3G8EA 4Y6GA 2Z1VA 4ILSA 5XIMA 3U57A 3HIJA 1YNPA 5AVNA 3VMNA 4P5UA 4JHMA 1B3YA 2CYGA 3MSDA 3NL5A 1DJXA 1W3KA 1FWDC 4P8UA 3T40A 3ZR5A 1UB3A 3TX9A 4CLMA 4IQLA 1KKOA 4LRSA 1EBHA 1GNXA 2GJNA 3T4WA 1H2JA 1Z3NA 3QV8A 2E9LA 4TX9A 4NJIA 3T0DA 4AYSA 4FA3A 4HK5A 3CAQA 2ISDA 2Z24A 2JBMA 1LORA 1QJWA 2P3ZA 3W22A 4A8NA 4RE4A 1XDJA 1QPOA 3LEPA 5CC7A 4F2UA 5CG0A 2WBKA 3DESA 1E9LA 1H60A 2C7FA 1W1IE 2CLLA 4PMVA 1P43A 2I9UA 1SW7A 2EPNA 1ECQA 1QNRA 1EDTA 1JJKA 2FGBA 2BWGA 4PYSA 4A3UA 3NQ8A 4B5UA 3MA8A 3IK2A 2OEKA 1T8XA 1F76A 2DZXA 4ZFMA 3T81A 1TVPA 4GY0A 2A3CA 2JIEA 2QVHA 1O1HA 1S1PA 4HU0A 2V68A 4AUBA 3W7OA 4KIRA 4FP1A 4PMUA 7A3HA 3MP3A 2PDBA 1J9YA 4O17A 4K7VA 1TTQA 1KC7A 2HCVA 5D2TA 3RCMA 1ZAHA 5EFDA 2YW3A 3TN3A 3LHTA 3W23A 3NAVA 1T0OA 3PAOA 4QE5A 1W1TA 3GHSA 2R9RA 4FNRA 3TQKA 1MRAA 1IEIA 1BEUA 1O7AA 5LA2A 1PHWA 3AIWA 3W29A 4AXKA 3M4HA 1H1NA 3MUXA 4NAEA 4Q8TA 1N8IA 2JEQA 1H7NA 3QMRA 5A8MA 3LRLA 2VDHA 3W1QA 2INFA 1GEHA 2CZ5A 1Q65A 4UBPC 3U0HA 4X61A 2WQPA 1C8YA 4OE7A 5HMEA 4C6JA 2E6FA 5LIYX 1CI1A 3OP2A 3GZ3A 4GA8A 4PCNA 1S5NA 3A4AA 1NTHA 1I4NA 4GO8A 2WOQA 3B0PA 3RM9A 2QGHA 4L9XA 3R8HA 3A5VA 1A47A 3NXFA 4XD5A 3W7IA 4Z1CA 2PDPA 4JFVA 4AG0A 1K6AA 2HEJA 3PTQA 1VFOA 5ABFA 4RE3A 3TAKA 4JX4A 3U2CA 1H09A 4JTIA 3O6AA 1EJWC 5HATA 3GC2A 3WFAA 1DXIA 5GQBA 1GQKA 4K39A 2NV9A 3HJEA 4DHGA 2WSPA 1YTDA 1LM1A 1SZGA 4MHBA 1R3YA 3BAWA 1E1FA 1IGSA 3RUBL 3T8LA 2VNCA 2IS7A 2NQ9A 1XQKA 1R9ZA 5HR7A 4OT7A 1KBKA 3VU2A 1PZ1A 3KTCA 7TIMA 4JN7A 4HZ7A 2V9DA 1Q7MA 2HVNA 1K77A 2GZXA 2XHYA 5T9BG 4E3VA 2RDXA 2PDFA 1I0DA 2PWFA 1EPXA 3KRZA 3SGZA 2BVDA 3TJ4A 1TELA 4O16A 1O5QA 5T91A 3TIMA 1UP2A 2HWGA 2E5DA 3JS3A 3ONBA 4JHZA 4Q4OA 3W07A 5C9ZA 3LENA 3AU6A 1BRLB 4X3ZA 1O5RA 1C90A 2JE8A 4O4VA 3J7HA 3W73A 1W31A 3KHDA 3TR9A 4QLJA 2TODA 4F0KA 3QVQA 1GVEA 3M44A 4Q7NA 5I02A 4BZYA 3O6YX 1J93A 4Z42C 2RKXA 4HPGA 5XIAA 1ZLPA 1E15A 2ZICA 3BLFA 3EMQA 3VIMA 2XG9A 4LAOA 3SCUA 3H7UA 1EJUC 2C71A 1UPPA 2AQOA 3W25A 5I07A 1EGVA 1EKOA 2VGBA 3EZ4A 1LYXA 2X16A 1XIIA 5AB3A 4QDMA 3WFZA 2E7FA 3EBVA 3DG3A 2G3IA 1QI4A 1DWJM 1C8VA 4DB7A 4LT9A 3DEQA 3H26A 1IXNA 3UT0A 3OVPA 4JQ3A 1S38A 5CKSA 4RNHA 4OU1A 3UWUA 1ZZMA 4RCXA 1Q6QA 1OADA 3HV8A 3BO9A 3LZ5A 2XVKA 4OECA 1LDCA 1K8XA 5TIMA 1FBAA 3OVQA 2C8NA 3LDVA 2J8TA 4XUYA 4AMCA 4HNVA 3IPWA 3ITYA 3MUY1 2XN1A 2X1RA 2W5FA 1JUKA 4O50A 1OY0A 3WH7A 2BV9A 1J18A 4QNEA 4V1XA 4AB4A 3VPLA 1T40A 1S2VA 3N18A 4UZSA 3GHTA 1QBAA 1ECEA 4MVAA 3UEQA 3AS3A 4IQEA 5RUBA 2BY1A 4IIGA 2VRJA 3G0UA 2ZUUA 2HNEA 4PTDA 4MB1A 1KGUA 2QR6A 5A1AA 1SO3A 3TTOA 4J3ZA 1MUCA 4L4LA 3U7BA 1V6TA 1EP1A 1VPXA 4OFCA 2CLKA 1Q7QA 1OFEA 2GJLA 4GFIA 2ALDA 3V18A 4NI3A 2WSKA 3P7YA 1D3HA 5FJUA 1BWVA 1VJIA 3TV8A 4D6FA 1RA5A 1MUMA 1IZKA 4IXXA 2G50A 3TONA 1MNSA 4ZTYA 2G3NA 2GQAA 3WMBA 1PWMA 2Z7GA 3NPXA 4DXXA 1UMLA 1L0PA 2OLAA 1DIKA 3BXWA 3BUVA 2Y1HA 3WQ5A 7XIMA 3B8WA 4QITA 5EKYA 1E0VA 1AD1A 2WNNA 4W87A 1FTXA 2B7NA 3APTA 1GONA 5FJIA 3P60A 3DFTA 1HX0A 3PZNA 1XGZA 3D5HA 3EA1A 3BOXA 1C7SA 2PDXA 3UU0A 4B5XA 2GQ3A 4A4AA 1A53A 1TV5A 4MJ2A 3BG9A 3OLEA 4JX5A 4U31A 3PC0A 1XLCA 1CGXA 4O8RA 3FJNA 4FMVA 1JQVA 3RCYA 3KBMA 4QIUA 4D8LA 1ODUA 4F40A 4ZOAA 1FVPA 2CW6A 4QDPA 2QS8A 1LQAA 4Z0JA 3QV7A 4G1NA 1QDSA 1U33A 3GW3A 4Y8EA 4EIVA 5BOEA 1IEWA 3FLUA 4Y8FA 2MANA 4KRZA 2XH4A 3GC4A 1XH1A 3L67A 3PBWA 1XLDA 1YKWA 1DXEA 2E1WA 2WMIB 3EOSA 1JZ6A 1EJTC 4NX5A 4FZIA 2B31A 2VEPA 3GK0A 5A95A 3AXKA 3SQLA 2D2HA 3OEXA 3PY2A 4WY0A 4UTKA 5CBJA 3CQJA 1FWFC 3E6EA 1P4CA 4XBSA 4KF1A 2DJLA 5J5DA 2ABAA 4HHPA 4C6CA 2E1DA 4LANA 5LNRA 1WXZA 1U1HA 1BYDA 4YPJA 3TC6A 4DYEA 1EZWA 1H7XA 4MLRA 3N4FA 1HFBA 4NJJA 3SCTA 4U4MA 3P8IA 3W72A 3EB2A 2ICSA 4ZQOA 3II1A 1GQLA 2NVCA 4BHYA 1MFVA 3STGA 4GXWA 5B7ZA 1YQ2A 3RYSA 3CH0A 3E2VA 4F2TA 3B9AA 3CPUA 3BSGA 3SB0A 1A49A 4Z2HA 2IPGA 4GI6A 3SCVA 1ZENA 1UZHA 4XZMX 3OA3A 8CGTA 4NRSA 4YYFA 2XYLA 2E4TA 2GYIA 1XWYA 1WOBA 4EVZA 3QQ0A 1ITCA 1KCXA 4AQLA 1PCKA 4LF2A 2GGJA 5K9CA 1GGOA 4ES4A 3VFCA 3W27A 3WQDA 1UOKA 1IWPA 1Q4WA 2ZRZA 3IK4A 4O4WA 1VYSX 2ZVIA 4JTJA 3IAQA 3NZQA 1KXTA 4RPPA 3CWOX 4ERAA 2Y24A 4QLKA 1JPKA 5CPSA 1MUWA 4CEXC 1WDQA 1E1EA 3PZOA 3ZLHA 4CN1A 3WLNA 3AYSA 1O66A 4C6EA 1V3IA 3UXKA 4MNKA 2XINA 3G22A 3BLIA 4O11A 1PSCA 1FDJA 4D71A 1LCOA 2VM8A 4WJEA 2FGZA 3G2GA 1E0WA 1UIPA 4YTQA 2WHKA 4NXSA 3NNTA 1LBFA 3RRXA 2WKJA 2FFIA 1FWBC 1QTWA 2V3DA 4XUGA 1LG2A 1OBAA 4FX8A 1OJXA 1MW0A 5LXEA 5KTLA 5FAJA 1KO0A 3R58A 3GHUA 4EPKA 5K4XA 3WNOA 1U5VA 4GJIA 3WF2A 3RF9A 1P6WA 2ZTKA 1HG3A 2VC7A 2Y7GA 5FJPA 1RLDA 2ODOA 4ZXLA 3BVJA 6A3HA 3IJIA 2DSUA 4EE9A 1F3EA 3CLWA 4J2MA 2IKIA 1A5UA 5A6SA 3QRHA 2BXZA 1SZFA 3OBKA 2FZ9A 3W1MA 3MPGA 1W8GA 4GGHA 3WQFA 1OABA 4D6DA 3BOLA 4LUJA 2W27A 3CQKA 4FX7A 2YJQA 2Z26A 4F3HA 2GSJA 5E5CA 5FL0A 1RP8A 2R1NA 1DXFA 1DWAM 3P0XA 2NQZA 1CEOA 1J2BA 2XM2A 1B3WA 2DVUA 3SSZA 4H4IA 3DU0A 5E0CA 5A6AA 2I57A 1GG1A 1XH0A 1DHKA 3I65A 5BNKA 4M3PA 3SADA 2OCZA 4AIBA 3I3DA 1EQCA 3XINA 2DU2A 5AOUA 1DIEA 2DDXA 1VEOA 2ISVA 2QCDA 4PMDA 1N82A 4AD2A 3TYEA 1UKQA 2CEQA 4UOJA 1SZRA 1TTPA 3ES8A 2G8ZA 2BHZA 1JDFA 1M68A 4LB4A 1LL4A 1YMYA 1BXBA 3LX9A 2PPGA 1PIIA 4IIFA 1UWQA 4FI4A 4ERGA 1CTNA 2I5GA 2QV5A 1OFQA 1RA0A 3MP4A 2W63A 4HU4A 2BSLA 2PDJA 3U7VA 3QEZA 3S4TA 2P1FA 2Z1KA 1UWSA 4WSHA 4X9SA 3HPSA 5A8QA 1PHQA 1XYLA 3UZZA 1RJRA 3FA3A 4MJMA 1Z6KA 3H2EA 3CV6A 1W32A 3AHTA 1XLEA 5IM51 3CTLA 4BCEA 1C3FA 1UR4A 1KTCA 3POCA 2NVAA 4IIDA 5F2MA 4Z1BA 3T4CA 1OGGA 4ZBCA 4DZ5A 3S83A 4J28A 4AZCB 3GH4A 2PBOA 4BA0A 1AMYA 1DIOA 5LSMA 1NSJA 1NEYA 1R38A 1YXYA 4QAIA 5C9UA 2DSVA 2AGKA 2WZIA 4KETA 3PANA 4UTLA 3PBYA 3JU2A 3LYEA 2VR5A 2ATMA 3IGUA 4HK6A 3DOPA 1NP2A 3QLDA 1KBJA 2P3EA 4JFSA 4JQ4A 2Z29A 5LGZA 4L65A 3UWZA 4AVNA 2PE4A 1K02A 3E0LA 3KRUA 2UY3A 3S9IA 2NQJA 2QCCA 4EKJA 1G0CA 4O13A 4UTTC 5DANA 3Q45A 1YTKA 4MSSA 1V08A 3EOUA 4AFYA 1QNOA 5FJRA 4B15A 2OB3A 1XC6A 1XD0A 5D8ZA 3NDZA 1QVBA 5I5RA 1HT6A 5HWJA 5F7UA 1OF8A 4IF2A 4C1KA 2GK1B 5HMDA 5HAOA 2B4GA 3RR4A 2P53A 3AMKA 4NNBA 1UYQA 4HHMA 1VFUA 2W9MA 3L5MA 1YEYA 2V0TA 2IMRA 2J13A 2OGJA 2QEZA 3FEQA 3H4WA 3E38A 4P8VA 3BW3A 3EXRA 4D6CA 4NY2A 4IQDA 3DC8A 3E5BA 4NNCA 5D9NA 2C16A 1IT8A 2Z28A 1KXHA 2TSYA 2Q8XA 4CCCA 1S5TA 1ZUAX 4O18A 3ATZA 1KWGA 4I90A 2ZRWA 1B30A 3W7KA 3U9IA 5G1TA 1I8JA 2YZ5A 3L4YA 3DI0A 1K4HA 4ZXOA 3MMDA 2RGLA 2FPVA 2C1GA 4AHOA 2VGGA 5HR6A 2WKLA 3MI2A 2WHLA 4HMEA 3L0KA 1EO5A 4FIRA 2Q6ZA 4GZ7A 4CNOA 3I4EA 1QPQA 5A6KA 1BSLA 4I7UA 4AEOA 1S5WA 3FKRA 1TPH1 1JZ5A 4C7FA 4V28A 3EOOA 4H9MA 4LYKA 1R9XA 2OKOA 2AL2A 4UQCA 5D2YA 4IJRA 3R0UA 4OWGA 1GYNA 3GY1A 2PDMA 1UD3A 2D0GA 5HA7A 4GRSA 4KEVA 1SFJA 1Q3NA 3SY5A 1J4EA 2V30A 1OYAA 3KFTA 2FZ8A 3EWXA 2E5CA 2WVSA 4DVOA 1XSKA 2V67A 3K4WA 3JZEA 2FGLA 1S2AA 1K8CA 3BARA 4B3KA 2WJFA 4M81A 5HNNA 4N4QA 4CNSA 3WLOA 9RUBA 4AD3A 1H7RA 4UFIA 3WDPP 1XRVA 1OX4A 3GUWA 3PF3A 3GX9A 1QFEA 3UZXA 4H6QA 5CGQA 1WQ5A 4B16A 4JN6A 4GVHA 3BAKA 3LNMA 2QDHA 2ZXBA 3ZT5A 3D3FA 5DY2A 1VLIA 3DGRA 4I5RA 3S5YA 1YXCA 4OHQA 3QGVA 4LVAA 1HZYA 1RVKA 3KLLA 5A6TC 1ZBWA 1T5AA 4YTRA 1U83A 2CLIA 3AS1A 2UBPC 1MQQA 2BS9A 1SZNA 2QJHA 4HKPA 4LCRA 2EG8A 4MZYA 2CBIA 4S3DA 4QDWA 5AYZA 1KM6A 2OFJA 5BWAA 1QI5A 4JYFA 3ARRA 4EPDC 1YLVA 1JNDA 1P1XA 1BHGA 1OGBA 4NI8A