3CLMA

Crystal structure of transaldolase (yp_208650.1) from neisseria gonorrhoeae fa 1090 at 1.14 a resolution
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
352
structure length
352
Chain Sequence
GMTILSDVKALGQQIWLDNLSRSLVQSGELAQMLKQGVCGVTSNPAIFQKAFAGDALYADEVAALKRQNLSPKQRYETMAVADVRAACDVCLAEHESTGGKTGFVSLEVSPELAKDAQGTVEEARRLHAAIARKNAMIKVPATDAGIDALETLVSDGISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFFISRVDSALDATLPDRLKGKTAIALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYPDTLYVDSLIGVHTVNTVPDATLKAFIDHGTAKATLTESADEARARLAEIAALGIDVETLAARLQEDGLKQFEEAFEKLLAPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transaldolase (YP_208650.1) from Neisseria gonorrhoeae FA 1090 at 1.14 A resolution
rcsb
source organism Neisseria gonorrhoeae
molecule tags Lyase
molecule keywords Transaldolase
total genus 150
structure length 352
sequence length 352
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2008-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3clmA00
2DZSA 1SZEA 3STFA 3C56A 1JVNA 3MP4A 5EY5A 5C2XA 1QAPA 6TIMA 3MP5A 4CQ8A 4LY8A 1SZFA 3L5AA 4O54A 4DO6A 4ZQRA 2A7PA 1HO4A 3PVFA 3DENA 3WK3A 3HGJA 2GOUA 1GVQA 1H61A 2CZEA 1QFEA 4HNNA 5L9FA 1F74A 2YFOA 3P8JA 2XN0A 2G95A 3GDLA 3PB2A 3OVRA 3BLIA 3DFPA 4CQAA 5K9CA 4RZ6A 4BWLA 3W74A 2CLIA 2VC6A 1GVRA 3GK0A 3C4UA 3I7SA 4RZ5A 3G1AA 1W3IA 5G1TA 4CCEA 5AHFA 5G4EA 1HFBA 1D9EA 3P81A 4O28A 3UPWA 2ZYFA 4JTHA 4O1BA 2V5BA 3UNDA 4ZQPA 1MEIA 1VS1A 1IXQA 4FNTA 1U5JA 2PRLA 3KOFA 4NXKA 2G96A 1YPFA 3NR0A 4LS0A 5LKYA 1WOBA 4AWUA 1SO6A 1LOLA 4K36A 3HJZA 1EPXA 1SFLA 2A4AA 4S2BA 3CTLA 1VJIA 3MYOA 1A5SA 3S5NA 4NZJA 4O50A 4JX4A 2BTMA 1QPRA 3SY5A 3DFOA 1BWKA 4KWVA 2E6FA 3NPXA 2WJZA 3B06A 2VFHA 3S9YA 5CPOA 1SZGA 1S3HA 2RH9A 4JX6A 3IIZA 1LRNA 4HT3A 4QSHA 5U4NA 4NJHA 1JUBA 2QCGA 1ZAJA 3BARA 3N3MA 3C6CA 2VFDA 3G24A 4IJBA 5DBUA 2OT1A 3EEGA 3R89A 4DBDA 3W7HA 4GUIA 3QPZA 4FX8A 5AYYA 3G8RA 2C18A 4KWWA 2GQAA 4K6AA 2DU2A 3DHFA 3DFSA 1KFCA 1P0NA 3HQ1A 3TH6A 1W8SA 1QCWA 5FI8A 3NQFA 3OHIA 2JK2A 3PC0A 2EPHA 5D30A 3SJ3A 2DZXA 1H50A 1G6CA 1NF7A 1J2WA 3NM3A 3NQGA 4UMAA 1FCBA 5H2ZA 4QNEA 2R94A 1I8JA 3LXAA 2ZRYA 3GXPA 4JYFA 1VYPX 4OT7A 5FF4A 3W1LA 3KVKA 1DQXA 1ZAIA 4FX6M 3NQ8A 3NGJA 1GJPA 5FEPA 3NQMA 3WFAA 2QCDA 2H3DA 3LGEA 3H55A 3S1WA 3JRKA 2NV2A 1TTQA 2Q8LA 1L9WA 3M7WA 5C55A 5AC8A 4K39A 1VR6A 1GTHA 4EWND 1GPWA 4OV4A 2QUUA 4B5NA 1GWJA 2VOMA 4Z1BA 2C1HA 1B3OA 1W0MA 5KZMA 2DORA 2E1DA 3C2VA 1YTKA 1TV5A 2JGQA 3MI3A 4RR4A 4XBSA 4Y96A 1XM3A 1W31A 4Z0SA 5HR6A 2Z0IA 1KFLA 3LCGA 1H60A 5CZTA 4DF1A 5CG7A 1OFDA 3UYCA 1MEHA 4X22A 2QEZA 4X9SA 1ICSA 3GVGA 3S42A 2ZA1A 4O15A 4EOUA 2C16A 1F7BA 1K8XA 3IGXA 1GQNA 3P8IA 1LDCA 3S1XA 1XUUA 3BW4A 4ZL1A 3P74A 1WX0A 5F1UA 3F4WA 5D2TA 1FCVA 2WOQA 1FDYA 3S8HA 1OX5A 1OABA 4JTGA 1IXOA 1JCLA 5D33A 3TMLA 4RLIA 4YCOA 2QF7A 5HMSA 4BK9A 3HGSA 4UTIA 3ZWSA 3DKJA 5HULA 1SSGA 2YYUA 3O16A 3STGA 1TO3A 2TPSA 3W1XA 3HG5A 1MSSA 4DPPA 5DY3A 5F4WA 5K4ZA 2JBMA 2ZTKA 2QAPA 5MHBA 1KTBA 5HUPA 3GLCA 1WXJA 2HMCA 4P61A 3C2OA 4BI7A 2C3ZA 3SGUA 2Z2UA 5D2XA 3CHVA 4JGDA 1KLZA 3IRDA 4E2BA 2ZZ5A 3S5ZA 1QNVA 1LYXA 3G1YA 4OU1A 2Y7EA 3QW4B 4R53A 1JR1A 4NVTA 3TCEA 1OX6A 1R2RA 3F4NA 1WAUA 3ZWTA 3MI6A 3W84A 4JTLA 1YDVA 1YLVA 3BG9A 2GJLA 3G0SA 1ZFJA 1YTEA 3W22A 4IPJA 3PUOA 1KV8A 4Q32A 1EA0A 2A7RA 2J9ZA 3FFSA 1G4SA 1G7UA 1PVNA 1YPIA 3B03A 1BEUA 3MJYA 4Z1DA 2DZPA 2X16A 1GVSA 5AB3A 2PRHA 4N2YA 3R8RA 2TYSA 3N14A 1KTNA 2RFGA 4OWGA 4E38A 2E6DA 3IVUA 2EHHA 2TSYA 3S5OA 3IGSA 4I7WA 4JEQA 1TPB1 3C3NA 1FDJA 3FS2A 3C2EA 3FJLA 3TQ0A 3M9YA 2ZFAA 1W3NA 3S1UA 5E93A 3UZ5A 3PF3A 2R91A 5I3IA 3GYEA 2V8ZA 2B7OA 3LHWA 3P62A 4AXKA 3GKFA 3W1RA 3KAOA 5E1QA 5F2IA 2XN1A 2NWSA 3GXTA 4IQLA 1XXXA 3VKJA 1OK4A 3W7CA 5K4XA 1RQEA 3TSBA 1LOQA 4JIPA 2V81A 2YDAA 3EKLA 1SU5A 3NQVA 1TPWA 3PG8A 2RKXA 3TSDA 3CEPA 3BVJA 1LLZA 2F7FA 4WXZA 2CZDA 4UTKA 1YXDA 3BLFA 2G97A 1N8FA 4BI6A 3TQKA 4HNTA 5J5DA 4N9BA 1OG0A 4M7TA 5I3GA 4O4WA 3TAKA 2VENA 3G0UA 2X30A 3L65A 4JYEA 1OYAA 2D73A 5HWJA 4FEZA 5D03A 2CZFA 1DV7A 1IF2A 4TMCA 4PTNA 4RCXA 3TW6A 1W37A 2WQPA 2GVLA 2YGYA 4H4IA 2A6NA 3T78A 5DCDA 1R2TA 2OX1A 3A5VA 4MLJA 3FKRA 3R2GA 3Q58A 5D32A 5FEZA 1FBAA 4GBUA 2ZCGA 1VRDA 1H7WA 4AF0B 1VLWA 3MI2A 1SUXA 3T7VA 4CQ9A 3KX6A 1XCFA 4ORMA 4O4VA 4IPIA 4LV4A 3TKFA 1SR9A 3TNOA 4LRTA 1WBHA 3DU0A 3I6RA 2YR1A 2ISWA 3PULA 5DXYA 3TFXA 2JKPA 3IVTA 5CGQA 3PSWA 3U8GA 3W7OA 1EP3A 3O05A 3NL2A 2FIQA 2I1OA 5FEXA 2AQWA 4OHQA 3UY7A 3BO9A 3NPWA 3TMQA 2H6RA 4JTKA 1YDNA 7TIMA 4NNCA 5DN1A 3TSMA 5BMXA 4JX5A 1KTCA 3DZ1A 3SECA 3KVLA 4K7VA 1IGSA 1FUYA 3NQEA 4O1DA 4CNNA 3NDOA 1JCYA 5D2WA 4AHOA 1L6WA 3G3DA 3TU9A 1LBLA 3NQAA 1RPXA 3JR2A 1ML1A 4JIQA 4AWTA 8TIMA 4P2VA 4DBEA 3MHGA 2CWNA 1LORA 3P80A 4GNJA 4FIQA 3QMSA 1WBJA 2WO5A 3FJ6A 3EWZA 3QRHA 4MZYA 4AMAA 4WX2A 1KFKA 4X3ZA 1OFAA 2FB2A 3A9IA 2ZRVA 2QJIA 3MHUA 1ONRA 3K30A 4MZ1A 1AMKA 3PUEA 3PUDA 1OF8A 3VFLA 4LOCA 4IWWA 1KBJA 1R30A 3QMRA 2C13A 1NF0A 2CLHA 4UFJA 4H3DA 4WUIA 3W1AA 2VFFA 4UTTA 1H7RA 1T8XA 2FJKA 2Y7FA 1K3UA 1TV8A 4I7UA 3UWQA 3W7MA 2PCQA 2J9YA 1JCXA 3W23A 1EUNA 2X1RA 4N6EA 1ZJIA 3L5LA 3UPBA 4WY0B 4CNPA 3LXCA 5AOUA 2ATMA 4E0CA 3TK7A 1VPXA 5IM51 3G0XA 1A5BA 3LTPA 1TYGA 3MBFA 3MWAA 4QQ3A 1EIXA 1LP6A 1OYCA 4JDYA 4XQ6A 3GNNA 3R12A 5C6MA 3NQ7A 4FF7A 3SSJA 4YWIA 5SWUA 1TPEA 1GT8A 1G7VA 2LLEA 1LTDA 4MIMA 3BW2A 4EF9A 3BGJA 1TPFA 1GVOA 1I2QA 3QC3A 1XBZA 3GDTA 2WKJA 3DKLA 4XTDA 3KVMA 4BF9A 1VC4A 4PODA 1Q45A 3HG4A 1GOXA 2VFGA 5FF7A 4ZQMA 3C8FA 1PCWA 4YL2A 4RV8A 4K8HA 3T40A 4OGZA 2X1TA 4Y90A 2C0AA 1IXPA 3UXAA 3E49A 2NUXA 1YDOA 1RVGA 2BXVA 3TV8A 2CFFA 1Q6LA 4ZQNA 2Y63A 1SW7A 3MW7A 2ZQ0A 3M5VA 2E09A 4R34A 1MXSA 5DCEA 3HG2A 3M0ZA 1VYSX 1VCGA 4DEFA 3SZ8A 3EWXA 2O7SA 1AL8A 2TRSA 4FIRA 3QYQA 1XDLA 2B4GA 3ABSA 1B4EA 2Z1BA 3YPIA 3W85A 3TE9A 1G4PA 5HJLA 4BWLC 3P7YA 5CPLA 3LHUA 5U7SA 3EWYA 4G1KA 4A29A 1ZNNA 4AEOA 3QMTA 3EX3A 5AHNA 3W7DA 4O13A 1LBMA 3LI1A 3AO0A 3NQDA 3NYZA 4UFHA 2BX7A 5F2GA 2PC4A 2V0TA 2JKEA 4JTIA 5IBXC 1UUMA 3THAA 1V5XA 2DP3A 4WD0A 1H1ZA 2CLEA 3TJXA 2C19A 3O06A 1G4TA 2B7PA 2Y89A 4CNOA 3OG3A 1V7YA 3E9AA 1PHWA 3LI0A 3QJAA 3QM3A 2QUVA 4JS3A 4XUGA 1D3GA 1JRBA 1TJPA 2ABBA 3B8DA 1W1ZA 5AC7A 2ZRZA 3EX4A 3T55A 3M16A 1BKSA 3C0JA 4O0KA 3KHJA 4A2SA 4FNSA 1TV7A 4KFOA 3ZR4A 5HNRA 5K2ZA 4MZ8A 1WYIA 4QISA 1QWGA 1RD5A 1SW0A 2V5LA 3EXTA 1F73A 1WDWA 1B4KA 1AK5A 3P5ZA 3LBMA 1OF6A 1SO4A 4FX7A 2NX9A 3WJZA 3TIMA 3ZFHA 5CKSA 4ZQOA 3NPVA 3LRLA 4OV9A 3PAJA 5F4XA 4IMEA 1TRIA 3E0IA 1SO5A 4XZ9A 4PFMA 3UWWA 2QCHA 5K3VA 5BMWA 1TRDA 2WV8A 3QQ1A 1C9DA 2C14A 4QJ1A 1TPVA 4OE7A 4GUJA 1OJXA 3IIPA 2YXGA 3L68A 4RXFA 4I7VA 5CPMA 1F2JA 1QO2A 1JUKA 3BG3A 3CPRA 2V2DA 3C2FA 3NNTA 4GUFA 1Z41A 3QSTA 4QITA 1TPDA 5CZSA 4O57A 1K7FA 3NXFA 5I3HA 1F76A 3C61A 5HINA 5BW6A 2WPBA 3W7PA 1M5WA 4IMDA 3HF3A 5DLCA 3WJWA 2H90A 5A8GA 4MY9A 1I2OA 1QOPA 1I2RA 4XWUA 2DZTA 1DKWA 5H91A 4UTTC 2FPVA 1OFQA 2V2CA 1TCDA 1XUZA 4BR1A 3GR8A 3E02A 1GZGA 1LBFA 3ZS4A 4JTTA 3LCXA 1FY6A 4J9JA 4N4QA 5AC6A 4PH6A 4ZQCA 3SGZA 3F03K 4LWWA 3ABOA 4TU1A 2P10A 3CWNA 2W79A 3U6WA 2V9DA 1QPOA 1NVMA 4IX0A 2JGYA 1EP2A 3N19B 3LLDA 3W7NA 1Z44A 2H8XA 5D38A 1HG3A 5LGZA 4MFDA 1KV5A 3W7LA 3DI0A 1I2PA 3UWYA 3WJYA 4UXDA 1K7EA 3B4UA 3TXVA 2QJGA 4PL2A 4UFLA 1OFEA 3I65A 1X1OA 3B0VC 1SPQA 1QDSA 1K02A 4O11A 1B57A 3LCWA 3W7IA 1W5QA 2XN2A 4NUWA 5J5RA 1I2NA 4PA8A 4AWSA 5FF3A 1EP1A 1HTIA 4GC4A 1KW1A 5DXXA 2EF9A 3VE7A 1O95A 5ABTA 2HSAA 3CIWA 3AJXA 5LNUA 2ZZ3A 3NM1A 3PBWA 4N6FA 3G8EA 3P67A 3LRMA 1A53A 1JCNA 1HL2A 4UUIA 4LV9A 1A5CA 4MPQA 2Q3RA 3IIXA 4GWEA 3QSRA 1GG0A 3FEMA 1O4UA 3O6DA 5AHIA 2J24A 4EVZA 4NU7A 3WK2A 3W07A 4JN6A 5BNKA 4M7SA 4NXSA 2JKAA 1LRTA 1RR2A 3W7JA 3LHZA 1J4EA 3B0UX 3TJLA 2ZTJA 3T44A 2OT0A 2FDSA 3DXIA 1XBVA 3VNDA 3OVPA 1RV8A 3BLEA 2VKZG 4CLMA 1M6JA 4LW7A 2QCEA 1C29A 2B0MA 4LUIA 3G18A 1HUVA 2WNQA 4LU0A 1YXYA 2A85A 4GUHA 1J5TA 1BWLA 3NAVA 4DF2A 5TQLA 3W76A 4C1KA 1Q3NA 2X1UA 4O17A 5D02A 1KFBA 3W2UA 3OEXA 3W3OA 4LC8A 3D0CA 3FYOA 1ZAHA 2ZRWA 5CSRA 5EPDA 3STEA 2CU0A 4UFMA 3QEZA 1MEWA 4UNLA 4O8RA 2BLEA 2YPIA 1R46A 3W7QA 3FOKA 1PIIA 3W7EA 3PB0A 3M41A 1MO0A 3KVJA 4LRSA 5AHLA 4Z08A 2WNZA 1JCMP 1GVFA 3LOTA 3A24A 5KTLA 2Z6JA 2QDGA 2AAMA 4GRSA 5FF2A 3NA8A 4IMFA 3L67A 4IUOA 4JTUA 1ZCOA 4M5PA 3U2OA 4YXGA 2EKCA 1F6KA 2QUTA 2VEPA 4NT0A 4K37A 3HGRA 2J27A 3L0GA 3W7KA 1D3HA 5HWNA 3IVSA 2RDUA 3RFAA 3EXRA 4KFPA 4LVAA 1JJKA 2NX3A 4Q33A 3RLUA 3ANYA 1SQ7A 3W9ZA 5EMUA 1OK6A 3I7QA 3ABRA 2HS6A 1FQ0A 3EXSA 4L4LA 4MJZA 4O1CA 2G5WA 1OFBA 5G2IA 3WK0A 4PL1A 5C5YA 2GVGA 1EWEA 1Z42A 3CQ0A 2CLOA 1LCOA 2CLLA 4HN4A 3EX2A 2QDHA 4UFKA 4LT9A 3B04A 3RNDA 2YX0A 3P60A 1XBXA 2EGZA 2OCZA 2QCDB 3I7RA 5K7JA 3LHVA 3G1DA 3OA3A 2ZZ2A 1SFJA 3T4CA 4Q4KA 4AF0A 2QCFA 1DQWA 3LCIA 3NPUA 4O18A 2NWRA 5CZJA 1LOSA 1F5ZA 2A21A 3E12A 3NOEA 3L0KA 3A22A 1OHLA 2FFCA 4ADSA 4ONVA 3TUUA 2Y85A 4UTJA 5FESA 4TIMA 4JTFA 1OVDA 3EX1A 4NJJA 5A5WA 1TB3A 1AL7A 1DVJA 2QCLA 3NZRA 2QJHA 4NX5A 1UCWA 2W0UA 3USBA 1LLWA 4LVBA 4N9CA 3DH7A 2ZA2A 1JCJA 2J88A 4ORIA 1FDZA 3CC1A 1WA3A 4ZZ9A 1Q6QA 4NX0A 1KBIA 4LUJA 3DGRA 3G1VA 3SI9A 3G3MA 3M5YA 3G1FA 4DF0A 3N73A 1EB3A 3W7RA 2PE4A 3S1VA 4W9TA 3S5YA 5CZ0A 3F1QA 2Y62A 3W87A 3FIGA 3GR7A 2FLIA 4N9DA 4UMBA 4WOZA 1PCKA 3FYPA 3LCHA 2V82A 1O60A 1TMHA 3CLMA 3W88A 3GKAA 3V1PA 1OFRA 1TJRA 2GPTA 3DFQA 4RKAA 2DJLA 2O7QA 4DXVA 5K9DA 2VXNA 2Y70A 5EYWA 3RMJA 4IX2A 4HKPA 3GXNA 3L66A 1VCFA 3LHYA 1KM0A 2X2GA 4NQ1A 3L2IA 5G2HA 2Y7GA 4O19A 1IXNA 1L6YA 4XKYA 3IIVA 4O10A 4M19A 1TPH1 2A7NA 2A1YA 3N2MA 2Y7DA 3HO8A 3E96A 3QF0A 4MVAA 3S6DA 3UWUA 5F2MA 3DFNA 3PSVA 4PCFA 3HOJA 1AW2A 2YW3A 1P5BA 4QIUA 3W7GA 1A5AA 3STCA 1L6SA 5KINA 4UTLA 1ME7A 1DBTA 1ZHAA 2H8ZA 3TXZA 2KZHA 5LHEA 3NL3A 1TIMA 3UD6A 3HPSA 1ALDA 3VI2A 4BI5A 5TBOA 1FCUA 3DHDA 4K7YA 3P5YA 3VCRA 1KM1A 2I9EA 5D04C 3Q37A 4IMCA 1W54A 3NVTA 5LNRA 1KM4A 4MJMA 2ZZ4A 3I68A 2WSRA 2R14A 2NUYA 4IOTA 4JTEA 4HNVA 3MBDA 4POCA 1W5MA 3QH2A 2YSWA 4WY0F 4JXCA 3SFKA 1DOSA 1KA9F 3C2RA 2I14A 2J9XA 5L6UA 3PR2A 3TX9A 4CCCA 2Y6ZA 3HMJG 3W71A 2BWGA 4A21A 3WJSA 1H51A 3KRUA 3THQA 3G1SA 4IGHA 3Q94A 4GE8A 1S5TA 4NZFA 4IMGA 1PS9A 3NZ1A 2C6QA 3QZEA 3PBUA 2Q3OA 1TPC1 2E68A 4JY8A 3CT7A 1PV8A 2E5CA 3W1PA 1W3TA 3CIXA 4M6VA 3HBLA 3N34A 4MYAA 3MYPA 2E6AA 1GG1A 4RXGA 4WY0A 4O1AA 4FNUA 1L2UA 1OYBA 4UTWC 1VH7A 1QPNA 2GJNA 4DO4A 2DZVA 2NXHA 1CX9A 4AVFA 1IIHA 1N55A 2VEKA 1AW1A 4LS1A 4TR9A 4D2JA 5HR7A 4DELA 1I4NA 1KM5A 3UWZA 2A2IA 3TC6A 3HPZA 5CPNA 3NQ2A 4FNQA 2FPYA 3W1NA 1OFOA 3W2MA 4AAJA 1FXQA 3OBKA 4AHPA 1XDMA 1K03A 2YZRA 3L0NA 1UUOA 2NX1A 3LCFA 1G67A 4WJEA 1A50A 2FQIA 1DJNA 1P0KA 1X6UA 4E2DA 3LBCA 4JR5A 3QPYA 1H1YA 1PE1A 2ATSA 3G1XA 4LS2A 4QM1A 4UMCA 3H54A 1X1ZA 3TQVA 3NEVA 1P4CA 1X7FA 1XBYA 3RLVA 2CLFA 4NJIA 4X2RA 2IQTA 3W83A 1FXPA 4XKYB 5G5IA 2NZLA 3EKZA 3IGUA 3LV6A 3ELFA 4GJ1A 3G1HA 3C52A 4Y6GA 5FF0A 3SW6A 4JDBA 4UR8A 3L5MA 1EUAA 3HIJA 4UC5A 5AFDA 2NUWA 3GX9A 3P82A 5LNWA 2OZ0A 4HPXA 2WNNA 5I3FA 1EX5A 4A2RA 3WJXA 4L4MA 3W72A 2E6YA 4S1FA 1SZNA 2NLIA 1SSDA 4JY9A 1H7OA 1XKYA 3V75A 1G4EA 2ABAA 3WK1A 4Z1AA 1HO1A 4O52A 4TMBA 4WQ6A 1VHNA 4A22A 1VHCA 3HB9A 4MUZA 4M6QA 4UIOA 3FA5A 3PBYA 3W86A 5D09A 3A5FA 5AHMA 3W2JA 4WZHA 3W2NA 3A21A 3ABQA 1UJPA 3UWVA 1WOAA 1FWTA 3BW3A 3W2KA 1RQHA 2FPTA 1P1XA 3ATZA 3W1MA 1KLYA 5G2WA 5HUOA 4MKNA 3P61A 3DI1A 4NJKA 3EB2A 1OX4A 5D2VA 5EKYA 3B0PA 3W6YA 3EWWA 1Y0EA 4C1LA 2GVJA 2QAFA 3PY2A 2F84A 4FHAA 4R33A 2YFNA 4U4MA 4YLWA 5GVJA 2ZBTA 5KZEA 5KZDA 3TC7A 5D2YA 4XTIA 3FKKA 4R7JA 2QCCA 1QR7A 1W5PA 3O63A 3O8AA 4ADTA 1Z48A 2QR6A 4HIBA 5G4WA 4FO4A 1XI3A 1NSJA 3HPXA 4DPQA 3UQNA 5BRBA 1W5OA 4JTSA 4JD4A 3GZ3A 1DORA 2PURA 5LNVA 4LNYA 1FWWA 1YTDA 2EAWA 2R8WA 5D05A 4RZ4A 3TAOA 1QMLA 3B05A 1LRQA 3LX9A 4MYXA 1GTEA 4JNMA 2XFWA 3RU6A 3GAYA 5K9XA 5EL1A 2A6LA 2VEMA 3RF9A 3ATYA 3QQ0A 3SR7A 1K8YA 1T99A 3LLFA 4PC8A 1KM6A 4UCGA 4AHQA 4UR7A 1FWRA 3MUXA 3N2XA 2DJXA 2B7NA 1T96A 2CW6A 4H6KA 5TIMA 1LZOA 4UTWA 2CLKA 5D37A 3O15A 4LVDA 3PWAA 3LXBA 3O6CA 5F4SA 2ISSA 3KFTA 3Q2DA 1AW5A 4RJEA 1TQJA 1RQBA 1TTPA 4K8EA 1TTJA 5T26A 3LRKA 1H7XA 3GB6A 4IXHA 2ALDA 3CEUA 3LM7A 1QOQA 3LTYA 1VQTA 4HSNA 1KFEA 3GIYA 2P0OA 2WSYA 1W56A 2HS8A 3DAQA 2HTMA 3O6YX 2NXGA 3H53A 1SW3A 4IXXA 5I3KA 3W75A 5KSWA 3PM6A 1JQVA 2PRMA 4DO5A 1NAL1 2ZRUA 1WV2A 5LGXA 3N9SA 4UNKA 3LB0A 3BG5A 4JICA 4O14A 2BSLA 4OBTA 3M47A 1XFBA 1H7NA 4AB4A 3KRZA 3O07A 4O16A 4MOZA 1CI1A 3L9CA 4DQWA 3EWBX 2H3BA 1MZHA 2GUUA 2ZRXA 1OX4B 5DCBA 2C15A 3M5ZA 5DBTA 3LHTA 2X1SA 3W2LA 3LTSA 1X8FA 4TX9A 3PG9A 5HQEA 1IIGA 4O53A 5KMYA 2A0NA 3R13A 3INPA 5I3JA 3M44A 4HPJA 1I45A 1RZMA 2YCEA 2GQ8A 1U83A 2QCMA 1S5VA 5E0KA 4Y8FA 3P84A 2VELA 1ZALA 5DELA 5AYZA 4HNUA 2Y88A 4A3UA 3R5EA 4WXYA 1R47A 5C54A 4FNRA 1JUEA 1VYRA 3NL6A 1FWNA 1Q6RA 3M1ZA 3BGGA 1F05A 1AG1O 1YYAA 3L21A 1ZENA 3A23A 5EBUA 1BTMA 4LVFA 3FLUA 4S2CA 2UV8G 1TPUA 1UBSA 3NL5A 5DY2A 4GUGA 1N7KA 3GDRA 5KITA 3CWOX 1UB3A 3M6YA 2DZUA 4LTSA 2RDWA 1WQ5A 1ZY9A 3CM4A 3CB8A 4ADUA 2B7QA 3IV3A 1SO3A 3PBVA 1W5NA 4FXSA 2CZ5A 1YXCA 3MHFA 4MFEA 3HGOA 3EX6A 1CW2A 3TA6A 3EWUA 2FTPA 1F6PA 4Y9AA 1JRCA 4UFIA 2Y61A 3W1UA 3GAKA 4EIVA 5G1YA 3TR2A 1QPQA 4UTUA 4M6PA 4ML9A 1GYNA 4N4PA 2P1FA 4BFAA 2E5DA 2VEIA 1VZWA 1KFJA 1TREA 1TTIA 3RK8A 1ADOA 2OJPA 1O5KA 3M43A 5AYXA 3TFCA 3IIOA 4I9AA 1EWDA 4U28A 2AGKA 5LNSA 1VLIA 3G22A 1FX6A 2J6XA 1VCVA 1JULA 4XBKA 4HSOA 1ME9A 1TQXA 1ICQA 4FXRA 1H63A 5HWMA 4RX0A 5LSMA 3O1NA 4TO8A 1LROA 4O0ZA 4Z0JA 2TMDA 1TSIA 4WOQA 2ZZ6A 3JS3A 3IEBA 2V2HA 1YADA 1ME8A 3BK0A 3W1QA 2DZWA 4MY1A 1VGAA 3LV5A 1Q6OA 4OQVA 1THFD 1KM2A 1K7XA 1FWSA 1LM1A 3MO7A 4NNBA 5CSSA 3VE9A 2QKFA 3TDFA 3NQCA 1DHPA 3TROA 1DL3A 2VFIA 4AH7A 3GDMA 1C8VA 2VFEA 2QCNA 3KRSA 4KFNA 4MLRA 2Q8ZA 3BPWA 3W70A 4EF8A 2ZZ1A 2A5HA 2OMAA 1FCQA 3BV4A 4ZVJA 2ISVA 3UXDA 1EEPA 1PL9A 3NO5A 3MMTA 1PHQA 3KXQA 3SIZA 4KKXA 4FB7A 5FEWA 1KM3A 3DBPA 3W1TA 2NV1A 4N9EA 1H7PA 3LCLA 2GQ9A 2V30A 4N02A 3CU2A 3PS7A 1G69A 1JQXA 4ICNA 1OFPA 4JTJA 5IBXA 4K38A 1ICPA 4QNWA 3W73A 2NXIA 5LHFA 1UASA 1E51A 2Z6IA 2ZDRA 6ALDA 2E5BA 1QO5A 3TW7A 1NFBA 1O5XA 5F2LA 3QW3A 3OVQA 2RHGA 4QAIA 1S5WA 4NNAA 1GYLA 1K8ZA 1DJQA 1T0OA 4O12A 1M7OA 4MY8A 4LC6A 1NEYA 4UTHA 3LDVA 4Z1CA 2BZNA 2ZZ7A 3MP3A 4LVGA 2YW4A 4HHPA 4JYDA 2RDTA 1H5YA 4FNPA 5F1VA 3N9RA 5AN7A 3OIXA 1O94A 1M7PA 1B9BA 4GXMA 4PEKA 4GFSA 2W6RA 3QFEA 5AHEA 2E77A 3DFTA 2CLMA 3LERA 4YCPA 1XL9A 3UY8A 2ZA3A 4ALDA 4ZMGA 5LZLA 5BOOA 4RK8A 3M5XA 3NQ6A 4YMZA 4NJGA 1R2SA 3S0CA 3NG3A 5EA9A 4UTMA 3HG3A 1XC4A 1GEQA 2WSQA 2FB3A 2YYTA 3GDKA 1H62A 3UZJA 4CCDA 3GNDA
chains in the Genus database with same CATH superfamily
1MW0A 2HE8A 4AZ5A 3SCSA 4XD4A 5M03A 3STFA 1RAKA 5LIKX 1JVNA 3MP4A 5C2XA 3MP5A 4CQ8A 1SZFA 3IUDA 1KXHA 2A7PA 1HO4A 3PVFA 2E40A 4R85A 1NTHA 3WK3A 3HGJA 4AU0A 1CENA 3R11A 1H61A 1A4MA 4JQAA 4GVHA 3VNKA 2WJEA 3UYIA 3GDLA 3GNPA 4S3AA 2WJDA 3DFPA 2FHCA 2HK1A 3SM0A 4GJJA 2VC6A 3I7SA 3GUWA 3G1AA 2WM1A 4XVEA 4AD4A 1D9EA 2W61A 4JTHA 1A3WA 1JZ5A 5ABGA 5HANA 3CHCA 3QHOA 3CBWA 1IXQA 4GQRA 3WLPA 3UJSA 4MB4A 3KOFA 3XINA 1JL8A 3DESA 4AWUA 1HGYA 4HZ8A 3HJZA 1EPXA 4O50A 1IEIA 1XLFA 2CETA 3NPXA 2VZTA 4MWAE 5EMMA 4RDWA 3UESA 4IP7A 1PWLA 5CPOA 1XX1A 2RH9A 4V2XA 1FP9A 4JX6A 2OGJA 1VBGA 2VURA 1LRNA 4HT3A 4WSHA 2ZDSA 1P48A 1JUBA 4NAFA 3A64A 2AQOA 1ZAJA 3EEGA 4L6HA 4H6EA 3W7HA 2FMOA 3QPZA 3A4JA 3BL3A 3G8RA 3FN9A 2ZE3A 3KOXA 1KB3A 4K6AA 1WP6A 2DU2A 3AHZA 3TH6A 3S47A 3S9IA 5JXQA 3NQFA 3OHIA 3G1RA 2JK2A 4L7ZA 3POCA 3EEZA 3SJ3A 4QROA 3DIPA 3TOYA 1D2KA 3M64A 4QG8A 1BHGA 1DQXA 3NSXA 4ZOEA 2J6VA 5FEPA 5DMMA 3WFAA 1EXBA 2QCDA 3S1WA 2NV2A 2FVLA 1L9WA 1MW1A 1VJZA 4XK2A 1C3FA 2V67A 1GPWA 2ZX9A 4OUIA 5KZMA 4WGXA 1YTKA 3BH4A 2Y8KA 2ZUUA 2VYOA 3MI3A 1W32A 1B1YA 4Q4MA 3BLKA 1E0UA 3LCGA 5CZTA 5CG7A 1P0EA 2EO7A 3CV6A 2Q02A 3UYCA 4X22A 2PWEA 5KZ6A 2VGBA 5IDZA 3TP4A 3DERA 1RJQA 1W9VA 1SJCA 1K8XA 3P8IA 3S1XA 4YS1A 2UY3A 7XIMA 3F4WA 2PP3A 3CXOA 1UZDA 4B3LA 3GHSA 4ZO9A 2DVXA 3QQWA 1IXOA 1JCLA 2PEVA 2PDQA 4YCOA 1S2UA 4PCTA 2QF7A 1GOQA 4GQBA 5FKYA 3DKJA 1IR1A 5HULA 3GG0A 2YYUA 4O1EA 4QDWA 3OBAA 2W5FA 3STGA 3AU2A 2VP8A 3OGSA 3HG5A 1MSSA 2JBMA 2ZTKA 2YA1A 4C7DA 5MHBA 1KTBA 1WXJA 2NQ5A 2INZA 4JGDA 3FXYA 1KLZA 3IRDA 1S46A 3V0UA 1TV4A 3NO1A 3GTFA 5C2CA 4R53A 3TCEA 8RUCA 3TONA 2AQVA 4FS9A 4XSLA 3WBAA 1F6YA 3HTWA 1FWHC 3W84A 1WKYA 2EKGA 1YTEA 1PBGA 4CUCA 1TZ7A 1EA0A 4HB7A 4LAMA 3H2MA 3ZJ7A 2D3LA 3H22A 2X16A 3AYSA 4I9JA 3WD3A 4W7UA 4N2YA 3WUEA 1XLBA 4JTDA 1E71M 1F8MA 2EHHA 4GIEA 1TPB1 5BU9A 2VWTA 3SBFA 1A80A 1HJXA 4DBUA 5EFFA 1JYVA 3AS0A 3BLPX 1LQ2A 4QFUA 4AYGA 3UZ5A 3BMVA 4LH8A 2R91A 4N0RA 4AWEA 2VCAA 3LHWA 4AXKA 3QV9A 1PJ9A 3BCJA 1BG9A 3KP0A 4IICA 4HU3A 2R1MA 4TVCA 1D3CA 2NWSA 7TAAA 4IQLA 1QK2A 2QLYA 3MV01 5A6KA 3WBYA 3SCPA 4HU4A 1LOQA 4JIPA 4IFKB 3LY0A 1X8CA 1TPWA 3TSDA 1UPPA 3CEPA 2X7VA 5FJIA 1WPCA 2XIJA 4UTKA 3JVAA 1J11A 3QBUA 1JPKA 5A6JA 1YXDA 3S46A 1J0JA 1OG0A 5I3GA 2JFEX 3TAKA 5AY7A 2VENA 3L65A 1OYAA 3B8WA 5HWJA 4BQ3A 3RLHA 3ZSTA 2VC7A 1U33A 2WQPA 4LGXA 4D6GA 3N6HA 1AJZA 1FHLA 1IWPA 2PGEA 4Q4RA 3UJEA 4XZHA 4R88A 3Q58A 1HVXA 4XAGA 1YBQB 2ZCGA 1H7WA 1VLWA 1FKWA 5DMNA 4CQ9A 3KX6A 5CC6A 2OQYA 3TKFA 3MSDA 1T8QA 3UR5A 1MUMA 4EP8C 2YR1A 2O4QA 2ISWA 4MGGA 3TFXA 2JF6A 4GGBA 3W7OA 4Z2GA 1MRAA 3OYZA 2AQWA 3UY7A 4A8IA 1UG6A 3TLQA 2IKHA 4ACZA 3STPA 7PTDA 4JTKA 7TIMA 4PRWA 3KL0A 2DEPA 3TSMA 4JPGA 1E72M 1KTCA 4K7VA 4EACA 3KE0A 3NDOA 2D20A 4AHOA 3TU9A 1VIWA 2XISA 4DWSB 2DPEA 3NQAA 3BOLA 2OODA 2VRQA 3FCPA 3P80A 2X0HA 3QMSA 1XLKA 1VD6A 3FJ6A 2BHUA 3AHYA 2CEQA 9CGTA 4NZ4A 3QKEA 2XDFA 2FB2A 2WVSA 3A9IA 2QJIA 3MHUA 1ONRA 5HQMA 3K30A 2KX9A 3D47A 5FSEC 2YOCA 3R8GA 3SIMA 3TYEA 2HWGA 4AISA 1DJZA 4H3DA 4WUIA 4PCNA 2PGWA 1JI1A 1TG7A 2Y7FA 3ARZA 3KZSA 2FHFA 1CBGA 3SRFA 3Q65A 4MJ2A 4Q8NA 4WY0B 4CNPA 4HU8A 5AOUA 1XIGA 4W93A 3TK7A 3WQVA 3Q67A 5IM51 3N25A 4Q22A 3G0XA 1W1PA 1AJ2A 4Z2LA 1A5BA 2AAAA 1D8CA 8A3HA 3O0KA 2VCCA 1RY8A 1FWAC 1LP6A 3WNMA 4F48A 4XQ6A 2HJPA 3R12A 1QATA 4FF7A 3WD0A 1FRBA 1VFMA 4GFIA 4F0MA 4IT1A 1G7VA 4XAFA 1WZLA 1O1ZA 4MIMA 1U22A 5AECA 3BGJA 1QBBA 3MUAA 1I2QA 4R7OA 1BYCA 1LQ0A 3DKLA 1FVPA 3KVMA 3WX7A 3XIMA 2HE5A 3VTRA 1VC4A 5FF7A 4GC3A 3BAKA 4K8HA 4JQ4A 4OGZA 3C0SA 1EA9C 1VFHA 2X1TA 2DVTA 3KBMA 3H7RA 1EYEA 1K6WA 2POZA 1DE5A 3E49A 1YDOA 1RVGA 3TV8A 4ERAA 3CUIA 4LCRA 1ECEA 4DJDD 1MXSA 2XWDA 9RUBA 3T05A 3VABA 3N2OA 3VIGA 2R24A 3F7JA 3M0ZA 2WQDA 2ZWYA 2Y1HA 1K9EA 4C90A 2XVGA 4FXJA 2TRSA 3V4BA 3PZIA 3VKKA 4GQQA 2B4GA 1B4EA 1RBLA 4BWLC 1OD8A 3AISA 3BJSA 1GQLA 4A29A 4UOJA 4C6FA 3EA2A 3EX3A 4IQJA 1CGUA 1VPYA 4S39A 3OLDA 4UBPC 4UFHA 1IT8A 3BLLA 2V0TA 4JTIA 2FTWA 1JEZA 4R9XA 2CLEA 3TJXA 2C19A 1BG4A 4KCUA 2VQUA 4E4UA 4F0KA 5RUBA 3L4ZA 3CO8A 1PHWA 3LI0A 4J3UA 1KRMA 4ZE5A 3RM4A 3QV8A 4JNYA 3B8DA 1XCWA 1IEXA 2NQLA 4DAIA 4HNLA 1QNRA 3VX1A 3DUGA 4FNSA 4TUFA 4FLOA 4QISA 2V5LA 2NQJA 5EMKA 2WKLA 2NX9A 3TIMA 1M53A 3P14A 5CKSA 2GVEA 1V08A 4ZQOA 4AZIA 4W7WA 2WMHA 2WXDM 4PR4A 3SN4A 1EOMA 2ZVIA 1UWIA 3EBVA 5BMWA 1TRDA 3MVTA 4JTQA 1TPVA 3DC8A 3M0MA 3GNXA 2YXGA 1HKWA 1W2PA 1I6NA 3F5KA 4I7VA 2CZVA 3EDKA 1TMQA 2H9AB 5A6BD 4UQEA 3BG3A 3CZLA 1OM0A 2PDWA 3ITXA 1OC7A 3LZ3A 3E0VA 4GUFA 3QSTA 4QITA 5FL1A 3C5QA 1K7FA 5I3HA 5C7HA 3SSZA 3C61A 4PTVA 5BW6A 1CWYA 1KXVA 3WJWA 5GNXA 2H90A 5A8GA 3FHQA 4JFVA 2DZTA 2EPOA 1HX0A 5IDIA 5CGTA 1W9PA 2NVDA 1XUZA 3AFBA 3E02A 3ZS4A 3KP1A 3THUA 5G1MA 4PH6A 3SGZA 3PJUA 2W79A 1QNOA 1QPOA 1NVMA 2EG8A 4Q8OA 3U0HA 3EOUA 2VR2A 3LLDA 3VA8A 1NFPA 3BJFA 2RJGA 1HG3A 5LGZA 2WAGA 3GW0A 5GQBA 3W7LA 3DI0A 1I2PA 2Z4GA 6ENLA 1BQGA 4LANA 5HPCA 4HNOA 3OLGA 4HU0A 3CPUA 2D2HA 4GJIA 1XG3A 4K2SA 4LSBA 2OSYA 4C5ZA 1MQPA 3GUGA 3UU0A 1UZHA 2QGHA 1JGMA 3BCFA 2E9BA 1R38A 1I2NA 3VM5A 3SCVA 1K9TA 2PDFA 4M82A 5DXXA 3VIPA 2EF9A 3CJPA 2YL5A 4IUGA 3CIWA 3MVIA 3AXIA 2ZZ3A 5JUVA 3P67A 4Y8EA 2PGFA 4D6DA 4GO8A 1B30A 4KCVA 2AKMA 1A5CA 5CCZA 2Q3RA 4AZ7A 4NAFB 3PBMA 2WSPA 4DJFD 3WK2A 3CAQA 3W00A 4PMNA 4GI6A 3NOYA 4LUTA 3LHZA 3BURA 1KGUA 1EIBA 2GDQA 3LYEA 2CHNA 2OT0A 2FDSA 3MTWA 3OVPA 5EBAA 2B0MA 2XFYA 4LUIA 2A3AA 4LU0A 2A85A 3SCRA 1BWLA 3VD5A 4PMJA 1BKHA 2OO6A 1Q3NA 3CUHA 4GPNA 4AIOA 4U2YA 3H24A 3FYOA 4LBUA 3UVIA 1HKKA 1XLMA 5CSRA 5EPDA 3T08A 1AQMA 2PD9A 1JDDA 3QEZA 1AVAA 4UNLA 3OB8A 3M41A 4MSSA 5AHLA 4ZO6A 2WNZA 1JCMP 1NOUA 5HPOA 1EQCA 3GDBA 4RDVA 2AAMA 4KEMA 3E5PA 3K1DA 2WCAA 4IMFA 1ZCOA 4DUOA 1UD3A 3OBEA 3ME3A 5MKGB 4E8CA 2QUTA 2VEPA 2Z2AA 4WSKA 4U10A 4W8AA 4V33A 3ZR6A 1ONEA 4KFPA 4Q33A 3BZGA 3GXDA 1OK6A 1KBBA 1OY0A 4D8AA 3ABRA 2VJXA 2DY3A 4P7NA 1FQ0A 2DIJA 4L4LA 3FX4A 4MJZA 4GO9A 2PGRA 1OFBA 2PTDA 3WK0A 4PL1A 5IRPA 3OLIA 2P8CA 1CXIA 4ZOAA 2CLOA 2JALA 1HJVA 2CLLA 3EX2A 3EGJA 3TN6A 1XBXA 2EGZA 2QCDB 3R58A 4PULA 3NUKA 1Y65A 1X38A 3G1DA 3OA3A 4Q8QA 4BEUA 3WNPA 4AF0A 4W86A 1VP5A 3FDKA 4ZBCA 3LCIA 3S2MA 2NWRA 3URQA 3A22A 1OHLA 4ONVA 4H04A 2FZMA 4W88A 4UTJA 1PX8A 4M1BA 1TB3A 4PMXA 1DWAM 1GKRA 3DYOA 2QCLA 1GJWA 3NZRA 4G7EA 4CEUC 4DBWA 4NX5A 1UCWA 3ZVIA 2FTYA 4HBKA 1Z32X 3WF0A 4E5TA 4ORIA 1FDZA 1J01A 3GTXA 5CQ1A 3CC1A 4K68A 1H11A 3MMUA 1Q6QA 4NX0A 3O2LA 2YXOA 1KBIA 5CGMA 1LQAA 5DF0A 1DE6A 1M7JA 3OHMB 5LIYX 2PLCA 3W7RA 2X05A 4IPLA 3WEOA 3N3TA 2FLIA 2VDGA 1LJYA 4WOZA 2V82A 3O0FA 2E8ZA 2P53A 1S5NA 3CLMA 3I6EA 3V1PA 3HV9A 5K9DA 2Y70A 3MJMA 1HN1A 4BF5A 4WKFA 1KM0A 5H8MA 3GR4A 4B15A 1TPH1 4X2PA 4B2DA 3N2MA 4GIAA 3T0AA 2BFGA 5F2MA 1CTNA 3E2RA 1AW2A 4G2DA 4JN7A 4LAUA 1S39A 3OPSA 1DBTA 3AQUA 1G0CA 5LHEA 1TIMA 4S3DA 3KDNA 4XAPA 5TBOA 3VCRA 1XPYA 2I9EA 5D04C 3Q37A 1HXJA 4XIAA 1KM4A 2ZZ4A 3MBDA 1KRCC 2CBUA 2GVYA 2YSWA 4WY0F 3RM8A 1E4IA 3USZA 1LUCA 1KFWA 3W0KA 1VF8A 1K1DA 2J9XA 3PR2A 2Y6ZA 3W71A 2O4MA 4KQNA 4A21A 4JHMA 3KRUA 2VCBA 7CGTA 1S5TA 4B91A 4WK9A 4DWSD 1E5NA 2QULA 1G9HA 3B3DA 1CDGA 4KWUA 2IS7A 1ONXA 3GXIA 4FI4A 3PZUA 2E5CA 1E6PA 3B4YA 3VIMA 3HBLA 4KMQA 4O1FA 1E6SM 1Q5MA 2E6AA 4RXGA 1RUSA 3PZTA 4CGTA 4UTWC 2NXHA 1CX9A 3ARUA 2F2HA 2WVTA 4J5NA 3RDKA 4TR9A 3EDFA 5HR7A 1DJHA 2QJJA 4PEEA 3UWZA 1V6TA 4TV6A 2ZXDA 5CPNA 3IS4A 3NQ2A 3WMLA 1JYNA 1OFOA 1QVBA 3OBKA 1E6ZA 1R87A 4MNLA 4S3KA 2NX1A 4IJRA 4U3CA 1NP0A 2D0HA 2NLYA 3VDHA 2FQIA 1DJNA 1X6UA 3LBCA 1UKOA 3WQWA 2ALRA 5A95A 1P4CA 1X7FA 2CC0A 4Q4QA 1YIXA 1XBYA 1YRRA 2E4TA 3MZ2A 2IQTA 1FXPA 5E09A 3EKZA 3WQ8A 1REQB 3ELFA 2J7FA 3M6DA 3SW6A 1IE7C 4TVUA 5FJTA 1EUAA 4P8XA 2WMGA 5AFDA 1UOKA 1QJWA 5LNWA 1VEPA 4JFTA 4HPXA 4NAEB 1EF3A 4J4KA 4V28A 1SGJA 1MFVA 2E6YA 5LIUX 3UPMA 3CNYA 3WF2A 4ZR8A 4GIYA 4JY9A 1H7OA 3GYCA 5M17A 3VKAA 3V16A 5FD0A 4Z1AA 2JIWA 4O52A 4TMBA 4A22A 3HB9A 4MDOA 4MUZA 2V3FA 3W86A 5D09A 1RJRA 4EPDC 3VIJA 1HL9A 3B9EA 1JFHA 2QPUA 4V15A 3M0YA 3T07A 1PKYA 2C0HA 5HNTA 1CB7B 1WOAA 5E0CA 3LQGA 1E0XA 1NOWA 1GHRA 3AS1A 1P1XA 2OR2A 3GRIA 3ZT5A 3TEVA 2FFIA 4MKNA 1OEPA 1Q7MA 1OX4A 4NJKA 2D2JA 4CVUA 1BF2A 1Y0EA 1HKMA 1D8WA 3PY2A 2F84A 3ONBA 4U4MA 4YLWA 4FXFA 5GVJA 1P7TB 1E4MM 4H8NA 1OZQA 1N82A 4HMDA 3FKKA 2BVWA 1QR7A 3H26A 4AC1X 1F61A 1EPVA 4ADTA 1Z48A 4J3SA 1XI3A 2R9RA 3AMDA 1J18A 4IGMA 4EANA 1GKQA 4Z2JA 1TIWA 4WR3A 3GZ3A 5EFDA 4QXIA 4C1NB 5LNVA 3AIRA 3WCZA 3HFYA 2RGLA 4DXKA 3B05A 1LRQA 4HA1A 1S2WA 4MYXA 1GTEA 2VRKA 5BROA 2G3JA 5K9XA 3S2CA 1ZP3A 2A6LA 1DXFA 4MTVA 4L5ZA 3SR7A 3PNZA 2OZTA 1FWRA 4ZXLA 2B7NA 2CW6A 3NURA 3SAZA 2CLKA 4JEJA 5CH9A 3AU6A 3O6CA 1XH0A 2QUNA 3HQPA 1XG4A 4RJEA 3VNJA 3VNYA 1TQJA 1RQBA 1UA3A 1TTPA 3GB6A 4IXHA 2ALDA 3VIFA 3LM7A 1QOQA 1UQYA 2XZ9A 3LTYA 1IV8A 2HQAA 1EDGA 2DT1A 1BWVA 3PM6A 1JQVA 4DO5A 1WV2A 3MSRA 3N2CA 4F9JA 4O14A 4JICA 2BSLA 4OBTA 3P0WA 3M47A 3O07A 1FKXA 3RG6A 3KBWA 2YCKX 1CEOA 1BQCA 3EWBX 2C15A 5DBTA 2VZVA 4DUWA 1HIZA 3PG9A 4O53A 1OBAA 4QLKA 1WUFA 1SVDA 5I3JA 1ZB5A 3CUFA 2AMGA 1M04A 5C9UA 2QS8A 4JIIX 2Z28A 4Y8FA 5CC7A 4DYJA 1TJ0A 1NDVA 4F9DA 3UZWA 3R5EA 1LLOA 2XIIA 4QG6A 1FWNA 3TTQA 2XFRA 2A3EA 1MRQA 4CN6A 4PCSA 1R7OA 4LVFA 3E2SA 3ZMRA 1HJWA 2DSWA 2Z1VA 3M7SA 1BRLA 3WBXA 3ZLHA 3L7RA 4LTSA 2G4JA 1W2VA 4TTGA 2UY2A 4IIDA 3PBVA 1YXCA 3EX6A 4Z2KA 2OYLA 2ANUA 1ZCCA 3LUTA 5C70A 2FTPA 3CUJA 1F6PA 1JRCA 3WNKA 4UTUA 3W28A 4JCLA 3TWAA 3DG6A 3K13A 3T0DA 1TCMA 2HVMA 2Z25A 2XSXA 1E6NA 1KFJA 2OWWA 1TTIA 4PUKA 3IIOA 4HMNA 4HOZA 5LNSA 1VLIA 4Y2WA 3KTCA 2J6XA 1WKFA 2YA2A 3KOZA 4YYCA 3QOKA 1TQXA 1ICQA 3UJ2A 2ZKMX 4FXRA 4WHBA 4FOUA 1E73M 1LROA 2TMDA 4A35A 8XIMA 3CZ8A 3IEBA 1EJWC 2FJUB 2XH0A 3CL7A 4NASA 1H09A 1PYMA 1BXNA 1FHDA 4CNUA 4EPEC 3EMQA 3LV5A 1KM2A 4NNBA 1EL3A 5A69A 1HP4A 3VE9A 4JOMA 4Q8PA 5EU9A 1ODUA 2A3BA 1DHPA 1UPMB 3WY1A 1C7SA 4HN8A 1F8IA 3GDMA 2XU2A 3UCDA 1QW9A 4QAWA 4S3FA 2IXUA 1CXLA 4A3QA 5T8GA 4CQCA 2ZZ1A 4XVDA 4PUWA 4CD4A 2WVVB 1XLCA 1R5YA 3GVWA 1H1NA 3FK4A 3GIQA 1TZZA 4KKXA 1KM3A 5GJNA 4G8TA 4N9EA 4AIEA 7ODCA 1H7PA 3N6QA 3F2BA 4N02A 2V30A 1EJVC 3GG1A 1JQXA 1YEYA 4G56A 4S3GA 4DJFA 1PZ2A 1ICPA 1HJUA 2NSOA 3EYPA 2GGGA 2NXIA 5LHFA 3AJ7A 3APYA 2DQXA 1QXLA 2ZDRA 1KD0A 3TYAA 1E0WA 1O5XA 4F66A 3VOCA 3QW3A 4ICCX 4GX9A 2ACUA 3WLIA 4KT2A 4QAIA 3GG7A 1I0DA 1T0OA 5JU6A 1UP2A 2PLKA 4O12A 3HPFA 3CMJA 4JIRA 4D6IA 1M7OA 1NEYA 1Z3NA 4UTHA 1DWFM 2BZNA 1M7XA 3RCMA 3V0SA 3OQ8A 4JYDA 3V7PA 2RDTA 1H5YA 4B16A 4FNPA 5AN7A 1OT1A 5CPQA 4L6DA 5AHEA 2E77A 3DFTA 2EPNA 2ZA3A 3COTA 3M5XA 3NQ6A 4YMZA 3AIQA 3O7UA 2GQ3A 3S0CA 1MNZA 4UTMA 4U3AA 1GEQA 2YYTA 1R9XA 3GNDA 4US5A 4AD5A 6TIMA 3PZVA 1MXDA 3QGKC 4LYKA 4WRHA 4DO6A 3LG3A 2GOUA 4GK8A 2GK1B 2PB1A 4HNNA 2O92A 2XN0A 1D7FA 4B3KA 3BDKA 3OVRA 1OGBA 3BLIA 3GHUA 1OB0A 1OC5A 4CNSA 4BWLA 4IFOA 4R5EA 2CLIA 2OQHA 1E1CB 4AD3A 1TWIA 3C4UA 2DIKA 1V0MA 1RP8A 5G1TA 4CCEA 5G4EA 1XC6A 1HFBA 4CD8A 3P81A 3UPWA 4UQDA 4QCEA 2UBPC 4ZQPA 1JPDX 1MEIA 1UP0A 1C8QA 3GTNA 5HK4A 1VFLA 5FAJA 4NXKA 5LKYA 1RPKA 2XHYA 3ITCA 4NF7A 3N13A 4J3TA 3UGRA 1CXEA 1LOLA 1SMDA 4HOWA 1VJIA 1XLIA 3NZQA 5D9PA 1QPRA 1UR0A 1TJ1A 3TN4A 3CAWA 2WJZA 3B06A 2VFHA 3S9YA 4FOKA 1SZGA 3IUIA 4GYJA 4OFCA 2OELA 4HHMA 3IIZA 3VKDA 5D9OA 3WKZA 4QQUA 5MKGA 3VGDA 3C6CA 3G24A 3GZAA 4IJBA 4J2PA 2OT1A 5DBUA 4YVXA 3R89A 1EJSC 3DYPA 5XIAA 5FSDC 4DBDA 1HP5A 5AYYA 2ISFA 4PFHA 5FA5A 4KWWA 2GQAA 3ZVHB 1Z89A 4US6A 1QT1A 4PRTA 3KCOA 1H50A 1NF7A 2PI6A 1J2WA 3NM3A 5H2ZA 4QNEA 5C0QA 3LXAA 1XLAA 2E1WA 2ZRYA 4JYFA 3W1LA 2XVNA 3WQ5A 4H2HA 4IZGA 4HA0A 3KVKA 3EB3A 4FX6M 2ICSA 1GJPA 4P7RA 1UWQA 2NV9A 3TR9A 3UW6A 3TCSA 3VGEA 1JPIA 4ZB2A 2C7FA 4HZ7A 4EWND 1FFRA 1GWJA 4MPKA 3A47A 1B3OA 4IFRA 1X1NA 5A8OA 1MDLA 4OJYA 1WNOA 4JQ2A 4AQLA 2FZNA 2PDBA 1NOFA 4AUBA 1OSEA 3SN1A 1W31A 2QJNA 3AXXA 4Z0SA 5HR6A 3SCQA 5A8MA 2RGMA 3T42A 1H60A 3D5HA 2QEZA 2YCJA 3D46A 1ICSA 4HJFA 3GVGA 3S42A 4HOXA 3OO2A 3GVQA 4LAKA 4JTRA 1LDCA 3MDWA 3BW4A 2WHMA 3P74A 5F1UA 5D2TA 1FDYA 3S8HA 3VD3A 1EGMA 3REQB 5HMSA 4UTIA 4F0HA 4JQ1A 2WCGA 3LENA 1ODZA 4GX8A 4A3YA 3PJTA 1TO3A 2Y4SA 3T6CA 1Z69A 2PBGA 5F4WA 4NZ5A 2UY5A 5K4ZA 4H83A 2QAPA 4Q8UA 3KL3A 5HUPA 1GUVA 3N2BA 4BI7A 3SGUA 1WKEA 2Z2UA 1ADDA 3WQEA 3ZSSA 4E2BA 3G1YA 3E1F1 1W9UA 4G1NA 1E3ZA 4NVTA 4B90A 4J3XA 4UOQA 1R2RA 1H5VA 2VM8A 2NT1A 3TN5A 1CXFA 1WAUA 3ZWTA 3MI6A 3VD4A 2GJLA 4XD5A 3G0SA 4AVOA 1KV8A 4Q32A 1DXIA 1DQUA 3N2TA 1JI2A 1D7KA 3FFSA 4JFSA 4Z1DA 1HZYA 1NWTA 3TNBA 3U5UA 1QNPA 1TMLA 2CHRA 4XZNX 1ISWA 3QY7A 3ES7A 3WQCA 2RFGA 2XIBA 4OWGA 4X61A 2VZSA 2E6DA 3IVUA 3KBVA 1ADSA 4QE1A 3LMZA 2DW7A 3SQMA 4JEQA 1MQQA 2XH7A 3ITYA 4P8VA 3K4WA 3FS2A 3TQ0A 5E93A 3FJ4A 5CSUA 3V5CA 1PDYA 5I3IA 3P62A 3L23A 3PPCA 1ISVA 4NRSA 3URBA 5F2IA 4NZ3A 2XN1A 3HURA 3RRAA 3OOQA 3VKJA 1DWIM 4UCFA 1QNQA 3CAVA 3W7CA 5K4XA 3F4DA 3KBJA 1A47A 2YDAA 4DY1A 2RKXA 1B5TA 4E3VA 4URIA 7ENLA 4OKDA 3BLFA 2G97A 3GNOA 4YHEA 4HNTA 4GYPA 4N9BA 3G0UA 2X30A 4JYEA 2P8BA 2AL2A 3FV9A 2CZFA 4U31A 2OZ3A 2PLMA 4P7OA 4RCXA 3TW6A 1W37A 4HHLA 5FJOA 3POHA 3R1ZA 1UH3A 4M56A 3C8NA 1R2TA 2OX1A 1QBAA 2J7GA 2PLJA 4LEQA 1NFGA 2QZRA 4Q6XA 1O12A 5D32A 1XYFA 1FBAA 2C1IA 1UR3M 4AF0B 3BSHA 3RX4A 5KEZA 1PIGA 3BOXA 3E5BA 4NAEA 3N17A 4K8GA 1XCFA 4ORMA 3PZNA 4LV4A 3BZJA 4TVDA 4W5UA 3DU0A 1O5RA 2O9RA 3LSCA 5BU6A 2BGQA 4DRSA 2VDHA 3E74A 3GW3A 5CGQA 3UR8A 1L8PA 1A3HA 3QR3A 1KR1A 3O05A 3KTXA 2PTZA 1PX4A 2FIQA 3L4UA 4OHQA 5LYRA 3AUOA 4AG0A 3MZNA 1VFUA 3OVGA 2R1PA 4YIWA 3TZFA 2XGIA 4JX5A 3I3DA 1HW6A 3SUWA 3DZ1A 3R7MA 3SECA 3DCPA 4L1XA 2CITA 1MZRA 3H2FA 1FUYA 4CNNA 2HROA 5D2WA 3PK7A 3G3DA 1UR4A 3ABZA 1RPXA 3JR2A 4C6DA 2CCRA 4P2VA 2WBKA 4DBEA 1ZS2A 1U1HA 2F6UA 1LORA 4FIQA 1WBJA 3EWZA 4MZYA 4AMAA 5M5DA 4WX2A 2DVUA 1A4LA 1OFAA 2QGYA 5AYIA 1DIDA 1XIDA 4O0QA 3PUDA 1OF8A 3MS8A 4LOCA 1KBJA 3QMRA 2C13A 2CLHA 4UFJA 4I90A 5T91A 1TVLA 1H7RA 2R1NA 4M8UA 1K3UA 3CQJA 1TV8A 4H9YA 2PCQA 1K4GA 2NQZA 2C8NA 2I5IA 2BY2A 4CN1A 3LXCA 1PO9A 1DIKA 4FP1A 3BTNA 4ZOBA 1F3TA 4LUSA 2HXTA 1KQZA 2AMXA 4OBRA 4LUTB 5I6SA 1E1EA 3EOSA 1L6GA 3LTPA 4PMQA 4YTSA 1R6WA 4KRUA 2HPMA 1V3JA 4PMDA 3S6TA 1OYCA 4JDYA 1QHZA 5I79A 3T8QA 2NQHA 5C6MA 1H41A 4XG1A 4PMOA 3NQBA 4DB7A 1UKPA 2ZC1A 3SRHA 2D22A 5H8PA 1GVOA 3QC3A 4LEFA 3P6LA 3GDTA 3M0KA 3N4FA 4L9ZA 1XLLA 3ICJA 1BRLB 4BF9A 3RMEA 5CEWA 1B0IA 1Q45A 3WF1A 4ZQMA 4QJ4B 4RV8A 3ITTA 1SYTA 3AMLA 1G1YA 2F2KA 4GBDA 3UXAA 1EOKA 2OPJA 1V3HA 1W1B1 2WANA 4RW3A 4ZQNA 3WMSA 1TFVA 3M5VA 1JAKA 3EAUA 1YE4A 3HG2A 3VIOA 1VCGA 1RXOB 5E6ZA 1FA2A 1R3TA 4DEFA 3SZ8A 5HXMA 1UOZA 3LS9A 3WELA 1CYGA 3GO2A 8CGTA 5FOOA 3AAMA 1UUQA 1E3XA 4S23A 1WDRA 4AZCB 3AXKA 3IAQA 4HHHA 3P7YA 3ORWA 5U7SA 4BA0A 1B54A 3AMKA 1NARA 2ZX6A 3I6TA 3QMTA 3PZMA 2QYGA 3W7DA 4ATDA 1Z6KA 5H1WA 3LI1A 3AO0A 2GWNA 3NYZA 1FWFC 4KEZA 3EPOA 2BX7A 2PC4A 4C6MA 1AMYA 2DP3A 2A3CA 4JHZA 5LA1A 1HF6A 2VVSA 4RW5A 2YBVA 4CNOA 3U2ZA 4FA3A 2PWUA 4HJWA 3QM3A 5E0FA 3P2VA 2ABBA 2PF8A 2XINA 1W1ZA 2IPJA 1QHOA 1XICA 2VZOA 3T55A 3L4WA 1PIFA 3AMGA 4PUDA 4H6RA 4UQCA 4DZAA 4KRTA 1TV7A 3IJ7A 4D9PA 3GBEA 5K2ZA 2NW0A 1SW0A 3VO0A 2Q09A 1F73A 1KGWA 1B4KA 3QTPA 4HZMA 3EPNA 3LBMA 2Z1XA 1GCYA 4K1GA 1IYXA 1JNEA 3ZFHA 3CTTA 2GSHA 1RA0A 3NPVA 1JDAA 4PN2A 4LAOA 3OGVA 4NL1A 1KKOA 4XKMA 1SO5A 3KW3A 1G5AA 2OOFA 3ZO9A 2QCHA 2WV8A 2C14A 2FH6A 2BY1A 5ENLA 3BUVA 4E2OA 1XQLA 2X42A 1V3LA 5CAKA 3IIPA 2HCVA 4IIGA 3GY1A 4RXFA 3ITGA 4GCXA 1QO2A 5DT7A 3CPRA 4F40A 2V2DA 3VDBA 2WMKA 3R8HA 4HP5A 3WD1A 2IPGA 1TPDA 1NQKA 5CZSA 3UXLA 4YTRA 1CECA 3W7PA 2OKOA 1M5WA 4HA4A 1V3IA 3WDPP 4QEHA 2C71A 1Y5XA 4XWUA 3AI0A 1DKWA 5BXSA 5H91A 4UTTC 2Y24A 2V2CA 3ISIX 1TCDA 4PB5A 4M29A 4Q8MA 3GR8A 2W92A 3MY9A 1FH7A 2NQ9A 1AFSA 4TU1A 3FVDA 3CWNA 3U6WA 2V9DA 1RCQA 4IPNB 2ZVRA 3PPFA 4IX0A 2JGYA 1UBPC 5D9MA 1BFNA 3GC4A 2YDRA 1R3RA 1Z44A 2H8XA 4BJHA 2VEGA 3VIKA 3EPMA 3TC3A 4XX6A 3UWYA 3WJYA 3VNIA 1REQA 3TXVA 5I7GA 2QJGA 4PL2A 1OFEA 4BEQA 3WQGA 1NJJA 2YBTA 3B0VC 2Y8UA 4NG3A 1POKA 1B57A 3MQTA 1EZWA 4DYKA 2XN2A 4NUWA 1E1FA 1O5QA 2I5GA 1ZUAX 2DGAA 1EP1A 5BWAA 4JTAA 3VE7A 1O95A 3WF4A 3AYVA 3EMCA 1KXQA 3LRMA 4L64A 4XV0A 1JCNA 3W26A 1HL2A 3GE7A 3QVQA 4LV9A 2EJAA 4PUEA 2CYGA 4GWEA 1GG0A 3FEMA 3SCTA 2J24A 4NU7A 4DO7A 3TLLA 3WDQA 2JKAA 1LG1A 1LRTA 5T9BG 4IG2A 2RAGA 4L80A 4FSAA 3DXIA 1XBVA 1RV8A 3WN6A 4LW7A 4LCSA 2QCEA 1C29A 4EPBC 3GM8A 4J27A 4GUHA 2VOTA 6REQA 4GISA 3VDAA 1Q13A 3VDCA 3AZTA 3VOJA 4X0VA 3D0CA 2D0FA 2ZRWA 4U2ZA 2VL4A 1MXGA 3STEA 3ARVA 3KS6A 3S2NA 1H49A 4I9TA 1WB0A 3ID7A 2VO5A 1QK0A 2QPSA 1H0IA 2J66A 3LGDA 5CBBA 4AD0A 1KCXA 2YPIA 1R46A 4J35A 3VIIA 3FOKA 2V38A 3W7EA 2PFHA 4LRSA 3LOTA 3A24A 1B3YA 4GRSA 3L67A 1UD6A 4JTUA 1OC6A 2E9MA 1OZMA 5I00A 4I6KA 4K37A 1RA5A 3L0GA 5HWNA 4NKCA 2RDUA 3RFAA 4LVAA 5CJMA 3RAOA 1N8WA 5B7YA 1LL4A 3R6IA 2ZX7A 3NVDA 5GPRA 4O1CA 1TVPA 4LBRA 4HCLA 3JZEA 1CGWA 2GVGA 1EWEA 3AMCA 3TA9A 1I0BA 3DEQA 2Z1KA 4ML4A 4HN4A 2BGNE 1DTUA 4UFKA 2PDNA 3B04A 3L4YA 2YX0A 2ZUNA 4X60A 4PGLA 3I3BA 3LHVA 3A13A 1BXBA 1Y5VA 4XZIA 1BD0A 1AUSL 3IK4A 1EF2A 1U30A 1GK8A 1P1MA 4ZB0A 3T4CA 4Q4KA 2CWXA 1QI2A 2QCFA 1DQWA 1QTWA 5CZJA 1LOSA 1F5ZA 3NOEA 4ADSA 4BF7A 5LA0A 1J5SA 2PWGA 1WUEA 4AX7A 3EX1A 4IISA 2REQA 2XVPA 1DVJA 2CIPA 2DZAA 2J8GA 3USBA 4N9CA 2E7FA 1JCJA 4Q8VA 3WH9A 2J88A 4DJFC 1NY1A 3LSBA 1XRTA 4YHGA 1WA3A 3AUJA 2IPWA 3V3WA 4ZZ9A 2BMBA 4LUJA 4LUYA 3M5YA 3WLMA 3G1FA 4UQ9A 1EB3A 2PE4A 3N15A 3WLTA 3MCOA 3GXMA 2Y62A 3W87A 3NZPA 3VOFA 3GR7A 1VAHA 3G77A 3LCHA 3FW6A 5JH2A 2EPMX 1TR1A 1O60A 3THDA 3W88A 3WLNA 3GKAA 2OWXA 1TJRA 3M0XA 3SQSA 2TODA 3UG5A 3SDOA 1W1YA 2VXNA 5EYWA 3RMJA 4IFKA 1ZSXA 3FEQA 4NIRA 3LHYA 3KEHA 5G2HA 2J7EA 3B8TA 4YYFA 4WVXA 2VUNA 1L6YA 4XKYA 4M19A 3SJNA 3XISA 1H3GA 2A7NA 3EA1A 4GXWA 2XYLA 2XH4A 1E9LA 2A1YA 2Y7DA 3HO8A 3IGHX 4MVAA 2OSWA 3S6DA 2QQ6A 3PSVA 2BASA 4PCFA 3RM9A 3HOJA 1P5BA 4H9ZA 1E0VA 1Q66A 3AOFA 1ZLPA 4B5VA 4ASTA 1DYSA 1VBHA 3I4EA 3SUVA 7A3HA 1XISA 2DFAA 4MDPA 2VC9A 3DHDA 2GLKA 4K7YA 4P8UA 1KM1A 5DANA 1W54A 3NVTA 4JTCA 4MJMA 3BLOA 4JTEA 3FJNA 4POCA 1OINA 1P0DA 1KBKA 3SFKA 4UR9A 1KA9F 4V1XA 5L6UA 3HMJG 5A1AA 2BWGA 1PZ1A 2ZC8A 1IEWA 2FMNA 4IGHA 3RLGA 2QUMA 3KOWA 3WQFA 5FJPA 2C6QA 4NI3A 1I1XA 3QZEA 2WCSA 3KZPA 1TPC1 4Z42C 3CT7A 2X2YA 3FYYA 1W3TA 4IM4A 1GG1A 4Q6JA 4J7RA 4HPGA 4W85A 3AHTA 3MMDA 1L2UA 1Q2SA 3IV8A 4FLQA 5I3DA 4DO4A 3U5YA 1JPHA 3RR4A 1IIHA 3TYBA 4ZEPA 3TC6A 3HPZA 2FPYA 4FMVA 4AAJA 1FXQA 1XDMA 1K03A 3UVAA 3WENA 1GONA 3H6OA 3URAA 1XRFA 1C8YA 4WCJA 4WJEA 1A50A 1A5MC 1XLJA 3N18A 2E67A 4Z17A 2ATSA 4YVVA 3G1XA 4LS2A 4QM1A 3LU2A 4UMCA 3H54A 4NYYA 4XZMX 3NEVA 1QRQA 1KRAC 4FR6A 4E8GA 2HVNA 3S1GA 3S5SA 4DBSA 2CLFA 3AC0A 2VR5A 1WDPA 3UP8A 4XKYB 2W27A 5G5IA 1NU5A 2NZLA 4PUNA 2OLAA 3WH7A 3BICA 2V3DA 3OODA 4Y6GA 5FF0A 3K8MA 4UR8A 3L5MA 4KBXA 1IT0A 4UC5A 2VHLA 2NUWA 3KHDA 2OZ0A 3APGA 3ENLA 3TYCA 3EDDA 3WJXA 1I1WA 1AODA 2PDYA 3W72A 5I02A 4S1FA 4C6JA 5BCAA 2PDGA 4D1IA 3PHAA 1XYCA 3SCUA 5I78A 5I09A 2D24A 1OT2A 3V75A 1FWIC 5FACA 3S9ZA 3WK1A 3CASA 4Z1YA 1X39A 3WLJA 3E3HA 2YXXA 4MADA 4UIOA 1XYZA 1E15A 3A5FA 3D3FA 5A6MA 4WZHA 3CMFA 3ABQA 1GVEA 2ZUVA 3PFRA 4JNZA 1RQHA 1CXHA 3W1MA 1QUMA 5G2WA 5HUOA 3P61A 3EB2A 4RDZA 1RCOB 3W6YA 3EWWA 2DSVA 4QCFA 4A05A 2GVJA 1UWUA 2J7CA 2QAFA 2WYSA 3HV8A 4IQEA 3ZYZA 1BF6A 1YNQA 3TC7A 4XTIA 1V79A 4R7JA 4FPSA 4HIBA 3GS6A 3E0WA 1W91A 3UQNA 1XRVA 5BRBA 4CKQA 1W5OA 4TV5A 1B2YA 3CUXA 3LD5A 2AOSA 3M0JA 3PZ9A 1PKMA 1FWWA 3B9NA 4QDMA 4RZ4A 1QMLA 3WG6A 3LX9A 3VKCA 2V5JA 1J0IA 1W9DM 2EEXA 1UWRA 3RF9A 3QQ0A 1C93A 3UBPC 3HN3A 3AS3A 4UCGA 4UR7A 3N2XA 1K77A 5TIMA 1LZOA 3GHTA 4W8BA 3QZ6A 1KKRA 3DX5A 3O15A 4LVDA 4PZVA 2ISSA 1JF5A 1UIOA 3RCYA 3Q2DA 1AW5A 1LL7A 2WWCA 3UR7A 5T26A 1H7XA 3SUUA 5C9XA 4LF1A 3WDRA 4HSNA 1VQTA 1W3JA 1XS2A 3GIYA 3KM8A 3WNOA 1W56A 2HTMA 2NXGA 5KSWA 1A0CA 3D3AA 5BWFA 2UY4A 1UD5A 3N9SA 3BG5A 2Y2WA 3KRZA 1VFOA 2EXOA 3FHAA 5JH1A 3VGFA 4KWSA 3RRXA 3L4VA 4MOZA 3RR1A 1XGZA 4DQWA 5CLTA 2ZRXA 3P3BA 1OX4B 2PDLA 3M5ZA 3H4XA 3SCWA 4H7ZA 3GG8A 1X8FA 3R0DA 5HQEA 1IIGA 5KMYA 2A0NA 5TAOA 3R13A 3C86A 2OFJA 3KCLA 4NI8A 3DC0A 2OB3A 2EJ1A 4AVNA 1S3TC 1I45A 2YCEA 3U2CA 1S5VA 3BJTA 3E2VA 2V5DA 3R25A 1ZALA 5AYZA 2J47A 3PUGA 2Y88A 2BVTA 4A3UA 1V3KA 1R47A 4XUYA 3VZXA 1OD0A 5C54A 1JUEA 5JBDA 3L21A 1ZENA 2HBVA 1BTMA 1JCTA 3QPEA 4DN1A 2UV8G 3NL5A 3CIVA 1PZ3A 2QIWA 3UR2A 3AIUA 5CSYA 4J28A 4C7GA 1V4YA 3R0UA 2RDWA 5CAHA 1WQ5A 4F8XA 1OWQA 4U5KA 1TE6A 1W5NA 4JN8A 4FXSA 3MHFA 5HMFA 3WFLA 1ITUA 3CH0A 3OG2A 5B80A 1UR9A 4C65A 4DWSC 4DZHA 1P0BA 4Y9AA 4UFIA 3W1UA 4EIVA 5G1YA 3TR2A 1GZJA 4Q7NA 2FZ8A 4J1OA 4M6PA 4ML9A 4XZBA 3ZT6A 1GYNA 1UR8A 3PWIA 1UKTA 2VEIA 1GZ1A 1ADOA 1X97A 1O5KA 2Q6ZA 4I9AA 3VXGA 3VINA 3O9NA 1XIHA 1W1A1 2I57A 1WDDA 3WH8A 4ZA0A 1VCVA 1JULA 1ME9A 2YZ5A 1H63A 3G5EA 3O1NA 3NZGA 3WUGA 4Z0JA 2Q01A 1YADA 1KRBC 4ATLA 4MY1A 1VGAA 4J2MA 5ABFB 3ARTA 1C7TA 1LM1A 5CSSA 2L5HA 1RH9A 2QKFA 1ISXA 3TROA 1KQYA 4AH7A 3T9PA 1C8VA 2QCNA 3GIPA 4KFNA 5H6HA 2J78A 3LA4A 1BYAA 2A5HA 5HMDA 1F07A 3ZM8A 4ZVJA 4FB7A 3DBPA 3W1TA 2NV1A 4GI8A 1S1RA 1XCXA 5FL0A 4ROQA 3CU2A 1G69A 4L4OA 1OGSA 3RN6A 3ARPA 4K38A 3R43A 1QWKA 4U33A 1DWHM 2E5BA 1EDQA 1SFTA 5HAOA 1QO5A 3TW7A 3VGHA 3P0XA 3OVQA 5FCZA 4IIEA 4XD6A 2RHGA 3EDEA 1AH4A 1S5WA 4HCHA 3W01A 1OADA 1JDEA 1XIFA 1EJ7L 4LC6A 3MP3A 4LVGA 2YW4A 4HHPA 2W4XA 3N9RA 3S2JA 3OIXA 1B9BA 4F0SA 4GXMA 3EMZA 3QFEA 1NWRA 1YBQA 4AY7A 2PU0A 2CLMA 4YCPA 3EB4A 4WJXA 3WL0A 1PSCA 3C0LA 4NJGA 1R2SA 3PN8A 1Y5WA 5AC5A 1E55A 5EA9A 1AJ0A 3HG3A 4GYPC 3UZJA 4I8DA 1Z9AA 4CCDA 4W4QA 3C56A 5EY5A 1QAPA 3GFYA 3LPFA 5JBFA 4O54A 2WZMA 1DWJM 2CZEA 3UF9A 2YFOA 2G95A 1X6NA 3L4TA 1GVRA 3W38A 2CXGA 3QGVA 4AEFA 4YWSA 4F2TA 4O28A 4C60A 1W3KA 1PPIA 1JPMA 3U7BA 4O1BA 3WYZA 4BCEA 3UNDA 1VS1A 3FA3A 1N8IA 4G9PA 4FNTA 3T2QA 3OJGA 1RD6A 2PWFA 4P7LA 5I2UA 1YPFA 1Q6EA 1KWKA 3WEMA 4ATWA 4K36A 2PD5A 1YNPA 4C7FA 1CGYA 3CTLA 1K70A 2WZIA 4NZJA 3VK5A 2BTMA 3SY5A 3VVGA 3DFOA 1BWKA 1EFZA 4XAZA 1YNYA 1RLDA 1UWSA 3AYRA 2WMJA 2GJXB 4L61A 2V3GA 2I56A 4LPCA 2V68A 1S3HA 4GVFA 1VENA 3W4RA 3GQYA 4F4RA 4MJ4A 5U4NA 4NJHA 1W1IE 2WK2A 3CV1A 3BARA 3GH4A 3N3MA 1ZU8A 2BY3A 4DNHA 4LY4A 1ITXA 1P6WA 3H4GA 2AL1A 3DFSA 4AZGA 1KFCA 1P0NA 2D3NA 3HQ1A 1W8SA 1UROA 5FI8A 3ZIZA 4ZE4A 1R3SA 2EPHA 5D30A 2DZXA 1NWSA 1FCBA 4RZBA 4X63A 1I8JA 3OYXA 3SGGA 4OT7A 3GXPA 3MANA 5FF4A 1XR2A 1Q6FA 1SJBA 3HJEA 3NQ8A 1TWWA 2GJPA 1KC7A 4KIEA 3WLHA 2H3DA 3LGEA 4R27A 1OIMA 2ZX5A 4GLEA 1KR0A 3B9OA 2Q8LA 1V0KA 4MNMA 2W67A 5AC8A 3SRDA 2DQWA 1EX1A 4Z1BA 4ACYA 1V6WA 2C1HA 3BSMA 2DORA 2E1DA 2PTXA 1KNWA 1F3WA 1WKDA 4KWOA 4JHOA 1VB9A 4XBSA 5ABHA 3T81A 3QR0A 4RE4A 2Z0IA 1T7LA 1KFLA 1MEHA 4X9SA 4YPJA 5CG0A 4ZODA 2ZA1A 3VGGA 4O15A 3M0IA 3IGXA 1GQNA 3CS2A 5BRQA 1VPQA 1FCVA 2WOQA 4C6PA 1SJAA 4GCAA 2Z1WA 1X7IA 1MI3A 2DT0A 4BK9A 3HGSA 4IIFA 3ZWSA 4H1ZA 1SSGA 1LWJA 3O16A 4G7EB 1E9IA 2PDCA 1H2JA 3WQDA 2OO0A 3B8IA 4IPPA 2TPSA 4B9YA 4DPPA 5DY3A 4WDTA 2VTFA 2DW6A 3R10A 2G3IA 4TX8A 3PFMA 3H7VA 2ZZ5A 4H9MA 1LYXA 2DT2A 1UH2A 4KERA 4OU1A 2WMIB 3SQLA 3OA5A 3VC5A 1OX6A 3F4NA 4CNTA 1V0LA 1V77A 4MKVA 4P8WA 2PAJA 1KCKA 4I3GA 4KESA 1RBAA 2PODA 1RBOB 1L8NA 2VC5A 3TWBA 1IHIA 4JTLA 1YDVA 3FAWA 1BSIA 1YLVA 5HOSA 5JBEA 2BBFA 5BYWA 2YCIX 4Q4SA 1UA7A 5D9NA 4DNMA 2J9ZA 1JZ7A 1W1VA 1G7UA 1PVNA 4L4PA 3B03A 4YU1A 3LNMA 4JQ3A 3HPAA 2DZPA 1E4LA 1EHNA 5EMYA 4KS0A 5G4HC 1GVSA 2PRHA 4PMRA 4XIMA 4MMWA 3N14A 1DJWA 1RLCL 3VM7A 4GZ7A 4H00A 3F5LA 2QDDA 1PDZA 5GJMA 3QHMA 4RNFA 3S5OA 4I7WA 3C3NA 3VNLA 3C2EA 3OW1A 3BAXA 3WSUA 3LM3A 1NH6A 3M9YA 2ZFAA 3E0LA 4CU7A 1W3NA 2BOFX 3PF3A 1PKNA 4LX4A 3IWPA 4I6VA 2CKRA 1ZP4A 4RPPA 3W1RA 4NY2A 2W91A 3GXTA 4ZFCA 2R82A 1RQEA 3TSBA 1XDJA 3URNA 2V81A 3EKLA 2WNWA 3HFTA 1SU5A 3NQVA 3PG8A 1FTXA 4PCPA 3A3WA 4I5XA 3BVJA 1LLZA 1GQKA 3B40A 2CZDA 3A4XA 5I06A 5A8PA 4BI6A 3TQKA 1HKVA 5J5DA 2POTA 4M7TA 1Q6CA 2GSJA 3MPGA 4PUUA 2D73A 4DJDC 3QHNA 1IF2A 2D1ZA 1UHVA 1GJUA 3UERA 1V6UA 2CBJA 2YGYA 3WUBA 2A6NA 5DCDA 1QW8A 2JEPA 5AC4A 4MLJA 4H8UA 2XFFA 3FKRA 1TZ9A 4BQ2A 4QRNA 4GBUA 3GC5A 3MI2A 1SUXA 3T7VA 5AYBA 3CK5A 3C2YA 5HNUA 3W02A 4ILSA 2V5KA 3PNUA 3TNOA 2A79A 4AY1A 1WBHA 4M6UA 5DXYA 1J0KA 4AD2A 3U8GA 1HL8A 2HV5A 2GL5A 4Q8WA 1EP3A 3A12A 3UNTA 1M1BA 1YMYA 4P7QA 1TWZA 2JF7A 3BO9A 3M0LA 1UC5A 3NPWA 3TMQA 1YDNA 2INEA 1MW2A 1U1UA 5DN1A 5BRPA 4RE2A 1MNSA 3O3RA 5BMXA 1Q8JA 4QE4A 4GY1A 4M1RA 2F38A 3NQEA 4UTFA 5TD4A 3CUGA 5BOEA 1EJRC 3VMOA 4JIQA 8TIMA 2YCLB 1K6AA 3PZQA 2QXWA 3NDYA 3W29A 3UZXA 1KXTA 3VGBA 2WO5A 3QRHA 5GNZA 1VKFA 2HBXA 3QTGA 2Y5EA 4X3ZA 1GNXA 4H8HA 2ZRVA 2PWHA 4OOUA 4RDYA 1QW7A 4MZ1A 2Y5JA 2G37A 4J3VA 1PUDA 3EOEA 1J0HA 1V7AA 4BKNA 1LWHA 3VNZA 2G50A 3ZXWA 2H9AA 4Q7IA 1O7AA 3U3HA 1M9HA 2VGFA 3W7MA 1IQ8A 5MF5A 1J9YA 3TZNA 3BAIA 1JCXA 4XB3A 2GOKA 2X1RA 4GHRA 1ZJIA 2VD8A 3T2PA 3IACA 3FNDA 2REQB 1KCLA 1CPUA 5BXTA 3IUHA 3W82A 3PAOA 3S4TA 1VPXA 2IKIA 3L12A 1T40A 1PEZA 4AY8A 3MSYA 1TYGA 2ODOA 3ANVA 3MWAA 3VDGA 3U4FA 1U5HA 4RV3A 3DBNA 1GKPA 1NWUA 1EYWA 4XAYA 1HJQA 3GNNA 3NQ7A 5A6TC 2XGBA 4YNGA 1EZ2A 1GT8A 2LLEA 4IGNA 4JFWA 2MANA 1RSCA 4LCQA 1XH2A 4EF9A 2E28A 1TPFA 4LAZA 3IK2A 4U5IA 1UR2A 1XBZA 2WKJA 4XTDA 3CL8A 3N1AA 4NP7A 1W17A 2VFGA 4W87A 4JL1A 3C8FA 1DTNA 3T40A 3ARRA 1B3ZA 1EQPA 4Y9PA 3HQOA 1I60A 3RHGA 3TJIA 2NUXA 2Y0FA 2CFFA 2I9UA 1SW7A 3MW7A 4DLMA 3LPGA 4ROPA 2MUCA 2E09A 2XH2A 3UA4A 4ZOCA 4H8VA 4YTQA 1VYSX 4GXPA 4RE0A 2G41A 4CD6A 3KWXA 1V93A 2O7SA 3QYQA 4OVXA 4QX4A 2UWFA 3W37A 1XDLA 1UKSA 4S38A 1TA3B 2CBIA 2ZICA 4MWAC 4EE9A 4D6EA 3YPIA 3PPGA 1N2VA 3W85A 1I75A 3CV7A 3I3EA 1A5LC 1UQZA 2Z24A 1S2VA 2P3ZA 3GH7A 3CQIA 4G1KA 3WH6A 4LB4A 1ZNNA 3V36A 4AZCA 4AD1A 4EXQA 2A3LA 4IG2B 4WDUA 4GIRA 5IBXC 1UUMA 3THAA 1V5XA 4KGJA 3QOMA 3UJFA 2Y8VA 2CPUA 1GW1A 1G4TA 3L2MA 1A0EA 1M03A 3OG3A 2QUVA 6CGTA 4JS3A 4XUGA 1D3GA 2BVYA 1TJPA 2PZNA 4NSBA 1NM9A 2OSXA 4KCTA 2ZRZA 3EX4A 3WBEA 4H9TA 3REQA 3C0JA 5DEZA 2NSXA 3KHJA 4A2SA 4D71A 1XP3A 3ZR4A 4DJED 4QGCA 1GOOA 4B2DD 3ZJ6A 1C9WA 3CLWA 3F2CA 1OF6A 4GY0A 3AHXA 3WJZA 1DP0A 4OZOA 2QV5A 4L65A 3WMBA 3LRLA 2BXYA 3DYMA 1H0GA 4IMEA 1TRIA 3E0IA 4PFMA 1TX0A 4J40A 1EH9A 5K3VA 7REQB 3QV6A 3QQ1A 3SN0A 3BQ6A 2NT0A 1AQFA 4HMEA 3A9BA 4GVIA 4DZIA 4GUJA 3H8AA 2WC7A 3L68A 4DI9A 2FKPA 4Q4PA 5CPMA 1F2JA 1JUKA 2W3ZA 3UG3A 5HNNA 1MFUA 3WD2A 3C2FA 3NNTA 1YPXA 1Z41A 3NWRA 3NXFA 2B81A 2JEQA 1E0TA 2VZUA 4IMDA 3HF3A 8XIAA 3VFCA 1I2OA 3K1GA 1I2RA 2X0YA 1O66A 1OFQA 1JDCA 5CPSA 4BHYA 1SM9A 4JTTA 2PP0A 4J9JA 4N4QA 1J2BA 4V1YA 4CQBA 3F03K 4LWWA 3SEPA 2DUXA 3EWCA 1EP2A 5F7UA 3H4WA 4E4FA 3RCNA 3N19B 3OLEA 4PMZA 1XSKA 5D38A 2OWCA 2ZUSA 4MFDA 4AIUA 3VU2A 3JZUA 1HNYA 1QHPA 2YL9A 4ACZB 1W9BM 1NDYA 1JZ2A 6PTDA 3I65A 4LQ1A 1OCNA 3OTRA 3APTA 3GNRA 3RJXA 1FOBA 2VX5A 3B8SA 1QDSA 1JF6A 5EMLA 3IARA 3KS5A 2QT3A 4QS5A 3W7IA 1B3VA 1FWDC 4Y9NA 4PA8A 5JVLA 4AWSA 1HTIA 4GC4A 1KW1A 3AJXA 2OZ8A 5LNUA 4A3RA 4A4AA 3WQ6A 3NM1A 4JAWA 4QTGA 3N12A 2EQDA 1JXKA 4B5WA 3T0BA 2PC8A 1RJPA 3KLKA 4UUIA 4C6EA 3DOPA 1X6LA 3ONCA 3IIXA