3CLTD

Crystal structure of the r236e mutant of methylophilus methylotrophus etf
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
319
structure length
319
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSEPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein subunit beta
total genus 95
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3cltD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3cltD02
1XLTC 5HG0A 2B7LA 3RIYA 4DNXA 1PFWA 1EXDA 4PBSA 4ZT7A 1QU2A 2WVHA 3D4BA 4MW7A 1I6KA 3QE4A 1N2HA 4EFKA 1A8HA 2Z3VA 4HPWA 4UU7A 1PYDA 3FG9A 5IMSA 1OZHA 3IDFA 1YHZA 4RMIA 3F6EX 2ZUFA 4GU5A 4K0RA 3AG6A 2E18A 1Q17A 1O6BA 2CT8A 1MRZA 3RK0A 3LE8A 1QQTA 3N8HA 1N77A 2NXWA 3PKIA 1KP2A 4HD8A 2CV1A 1JEEA 3TNJA 2DJIA 1ZUNA 4NZPA 2JLCA 4V1CB 2HMAA 1T9DA 4QBTA 3SDBA 3IMGA 1MAUA 4OJMX 4UTRA 2FSVC 3E27A 3SEQA 2DLCX 4XFDA 3VU8A 5K6TA 1JIJA 1JHDA 1KAMA 2V3WA 2A88A 2Q5LA 3CVUA 4RPIA 3U3DA 1WXGA 3CLTC 4YMIA 1JECA 1EFVA 3D6UA 4I6EA 3ZGOA 1UPCA 4ZCSA 4J1TC 1O0CA 4U7JA 1TYCA 3K32A 2VXOA 1IRXA 1IQ0A 3JXEA 4A91A 1O97D 4MWBA 3CVXA 4J16C 1N75A 5FO1A 1JZSA 4JZYA 3VGJA 3X1MA 1U3DA 2BRUC 2VK4A 1YI1A 4MLPA 1O0BA 1NZJA 5TEVA 4MWDA 2OV4A 3ZIUA 3D81A 4FVTA 3FOCA 1X8XA 4V1CI 1F4LA 4GPEA 3F6BX 1XNJA 1PG2A 1ICIA 2PGOA 3C8ZA 5TS2A 1JILA 2PXHA 5LM3A 3IOBA 3IUBA 2RE8A 4HJRA 4I5IA 2QUKA 2UZ1A 4TWIA 2A86A 2WB2A 5K3SA 4BVGA 4JUAA 2H2HA 4J76A 4K9PA 2VBGA 2NZ2A 4RMHA 1N2OA 2HGZA 3QTTA 4C78A 1PT9A 1Y42X 3IVGA 2YY5A 3GLTA 2H4HA 3ZXSA 1YIAA 2AG1A 2Q28A 3P0IA 4YBRA 1YI0A 5KWVA 1EFPA 1FYDA 2EL7A 4MUHA 2H2FA 4V1CA 2YXNA 1N78A 2VBFA 4ZT6A 1GZUA 3IMCA 1KQPA 4G6ZA 2H29A 1MB2A 5K6RA 1QPBA 1O97C 3AG5A 4X3OA 1V5EA 3NV7A 4JXXA 1KH2A 4X3PA 2EZUA 2AG6A 3IVCA 2EZTA 3GLRA 1T6XA 1WQ4A 1M2JA 4ND7A 3CVVA 2CYAA 3HWX1 3N05A 1ULHA 3ILVA 3H05A 1OD6A 3P52A 1H3FA 1NUPA 4R2MA 1WQ3A 4ZCQA 3SP1A 4ZCTA 1HZZC 3IOEA 3KT3A 3A05A 4UTZA 1N2JA 4UU8A 5DASA 2NYRA 4RMGA 3MXTA 5EJ7A 4RUKA 4MW1A 1OWMA 3ZJUA 1YNOA 4MW2A 3UK2A 2VJYA 4PBRA 5FNZA 3ISJA 1Z8NA 1IQRA 2EJCA 2W93A 4GM1A 3AFHA 2H4FA 5D7NA 1EFPB 5DK4A 4JUDX 2GKSA 3H9CA 4HK4A 1DNPA 1YI8A 4CT0A 5LLTA 3D7KA 4BV2A 1EFVB 3U31A 4GRIA 1WOYA 5DGDA 1RQGA 1TEZA 4BVBA 3A2KA 1H1TA 3FNRA 5EKDA 4MVWA 4GG1A 3TQIA 1UFVA 5BWOA 2A7XA 3IH5A 4RJKA 1R6TA 1KP3A 3A04A 1UPAA 4K9QA 4EG3A 1BFDA 2D54A 4F56A 1IH8A 2X0KA 3COVA 3F3MA 4BN5A 1PNOA 4D5EA 1G8GA 1JZQA 1O95D 4D5GA 4MW6A 4XFJA 4U63A 1PI3A 4KGDA 5MGNA 1OWNA 1JSCA 2WVAA 3AIIA 3X1KA 2VTBB 4Y6LA 1M8KA 1COZA 3ZJTA 1NUUA 2J4DA 4EGAA 5KHAA 4DLPA 1Q15A 3DV2A 1V5GA 3P0HA 4JUBA 3M5WA 4RJJA 3UMVA 3OTWA 5IJXA 1J1UA 1R6UA 1VBKA 1WJGA 2JI8A 2PGNA 2JIBA 2E89A 2EZ4A 2FR8C 4MQ5A 2CV2A 4MW4A 4YP7A 3FHJA 3L93A 4CQNA 1YBHA 4JD5A 1N2EA 4MPPA 3IOCA 1M83A 4QREA 1WXEA 2J07A 1QRTA 4Y6QA 3A4IA 1OBCA 3CLSC 5K2OA 1O95C 2Z08A 2GM3A 3LQ1A 1N2IA 4GP9A 2GOYA 1TFUA 3INNA 3TZEA 4CDNA 5J59A 3HWWA 2D13A 5BWLA 1I6LA 2ZUEA 2QUJA 3ND7A 3CVWA 1N2GA 1G8HA 3GMIA 3HFJA 3PXUA 1I6MA 4K9OA 5FYQA 1MA3A 4JT8A 4G1CA 1M8PA 2A1UA 1YHYA 3RIGA 4K9NA 2AKEA 4UTNA 4MULA 2OD7A 2Q29A 1K4MA 1WXHA 2UZ1B 3LCJA 4I6JA 2VK8A 4ZP1A 2E21A 4GM4A 1PNQA 2H2IA 3UOWA 1SZDA 5MF6A 3ZJVA 2DXIA 2BTEA 1LW7A 1VLHA 4K9MA 1U7DA 1JGTA 2RD2A 1S5PA 1MJHA 3ZGVA 1T9CA 1KH3A 4ARCA 3OE1A 1P7PA 4F4HA 1T9BA 4MW9A 3FLMA 3COYA 5J58A 2JI6A 1EUYA 4BVEA 2J08A 4RMJA 1PFUA 2PZ8A 4EG7A 4MWCA 4OUDB 1K97A 4FEEA 4MQ6A 4AS1A 5FEMA 4EG1A 1D4OA 5EJ9A 2IJGX 1Q19A 4KPUA 4K9LA 1K92A 1MB9A 4NAHA 4R2LA 3FETA 1HYBA 1NUQA 1YIDA 4EG4A 5JBNA 1F7UA 3COWA 2OO5C 4I6GA 1J1ZA 1M1ZA 3PNBA 5TGTA 2NSYA 3FZNA 4IF6A 4O8ZA 3IAEA 3PDHA 1KAQA 2DPLA 1U2DC 5LFAA 1FFYA 4JSRA 5K0SA 3HMQA 4JU9A 4MVCA 1N1DA 1MOPA 2QTRA 2A4MA 2V0GA 3S3TA 1V8FA 1TQ8A 4UUBA 1EUQA 2PIDA 4FZJA 3RK1A 2JI7A 2QTNA 2Q5JA 3K35A 4DJAA 1J09A 1PFVA 3ZUGA 3MLBA 1YUNA 4ZZIA 3CLUC 1R6XA 3ELBA 5HUJA 1NYLA 4JYZA 1Y9DA 3IMEA 1CT9A 1J70A 1MC1A 1OZGA 1N3LA 4KR6A 4JUCA 4FZ3A 4GM0A 2FWNA 1PO7A 5FO0A 2WQ7A 4QELA 4QPZA 1ZPDA 4FEGA 1XNGA 4Q93A 1IVSA 1DJLA 1T9GS 3MUEA 3TS1A 1N0HA 5IHXA 1U0BB 4Q9DA 1JMVA 3BL5A 3NBKA 4K9KA 4F4UA 4JFAA 1U7XA 4MUGA 4QRDA 2VTBA 1WZ2A 1PTJC 3PKJA 4NAUA 4YP5A 2V0CA 4RJIA 3RJZA 2WQ6A 1Q11A 1YC5A 4WSOA 1WXIA 4EF6A 5H7XA 2H59A 2IELA 1E3TA 4MZXA 3COZA 4BVHA 2H2AA 4ZCRA 4S1OA 3CLUD 5K0TA 2IP1A 3H99A 2A1TS 4G5FA 1JIKA 4BWVA 3SZGA 3EYAA 3CLRC 5MFZA 3KT6A 3FIUA 2Q5OA 5EJ6A 4WNYA 1Q6ZA 4YP6A 1NM5C 4AQ7A 2PG3A 4PY2A 1QJCA 1SZCA 5TEWA 1T9AA 3K9WA 1I2DA 4DE5A 2WSIA 2VK1A 4UZEA 3SYTA 3G59A 2IHTA 4QQ8A 2O5RA 4HJXA 1O94D 4ZT4A 2J5BA 1K4KA 3H9BA 3TZLA 1N2BA 1GLNA 1EJ2A 3DO8A 2A1TR 3U1VA 1H3EA 1OVMA 4R8MA 2CFOA 2JANA 3HGMA 3ZGZA 1POXA 1NP7A 1S4MA 2J09A 1GTSA 4JU8A 1J20A 1O5TA 4NATA 2QQFA 3E9YA 1F9AA 1QNFA 2DR2A 2PANA 2WVGA 2QJFA 3L92A 3KT8A 1NURA 2HJHA 5EJMA 3FSJX 3KFLA 3IUEA 1UPBA 1T9GR 4MUEA 3CLTD 1M8GA 4MUFA 1M8FA 4MPJA 3ND5A 4NDAA 3SZ3A 2I1LA 3CA8A 4PBTA 2BYTA 1PG0A 1YTLA 5BNZA 2QJTA 4L2IB 3AKZA 2ZP1A 1U28C 5DGTA 2QUHA 2CYBA 4MWEA 2OQ2A 1TYAE 1S7GA 2OD9A 4JT9A 3G5AA 3FWKA 2H2DA 1LI5A 4C7BA 1V47A 3CLSD 4J75A 2X1LA 1TYDE 3N2YA 4DDMA 2H2GA 2QQGA 1WKBA 4ZT5A 4IG9A 4KPUB 2OORC 1J21A 1O94C 2CYCA 4JXZA 2C31A 1IFXA 4IAOA 1OWPA 1Q1AA 2A1UB 1NUTA 3CVYA 1U31A 4BUZA 2JI9A 3RHSA 2HZ7A 2CUZA 2QUIA 1G8FA 2X1MA 2G36A 1D2RA 1IHOA 1OWLA 2DEUA 1EE1A 4EG5A 2C5SA 3HZRA 1NUSA 4XSVA 1GTRA 1PFYA 1OBHA 3Q10A 1Q77A 4MUKA 4X0EA 1O96A 3ND6A 1XNHA 3FY4A 1F7VA 1U2GC 4F3RA 3OP1A 5H16A 5AHWA 2YWCA 1M2HA 4KKVA 3JR3A 2CV0A 1O96B 1ZH0A 2O8VA 2DUMA 5DEOA 2EZ8A 5J5AA 4KR7A 2AG0A 3FDXA 1XJQA 2AZXA 4MW0A 3FI0A 3PNVA 5KCMA 4MUNA 1G59A 4HDAA 3IODA 4H3SA 4UTVA 2D5BA 3EY9A 4MVXA 4JUFA 3MMXA 3G6KA 3KT0A 4ZT2A 5DEIA 4P2BA 1M2GA 5EJ4A 3IAFA 1H3NA 4BVFA 2QTMA 4EG8A 4ND6A 2DETA 2EZ9A 2B4YA 1KKUA 1SURA 1LI7A 3ZXIA 2IHUA 1NSYA 1B6TA 2QJOA 3VRHA 2A84A 1POWA 4UTXA 4MUIA 4ZT3A 1BS2A 3DLAA 3EA4A 1KH1A 3P0JA 4DDHA 3D6VA 2JA2A 1VBNA 3FH0A 1WY5A 1MBZA 4UZFA 2XRYA 2XRZA 2IHVA 1YULA 1T6YA 3Q4GA 2Q5QA 3TQOA 2PZAA 3SEZA 5BWNA 1GN8A 3UY4A 3GLUA 4L2IA 1M8JA 1U3CA 4MVYA 1QTQA 4CDMA 4BN4A 1IQUA 4R0NA 1X6VA 1WXFA 2R5WA 2E0IA 1ZJWA 3ZG6A 1KQNA 2X3FA 4Y6OA 1ZH6A 1JIIA 3HV0A 3MLAA 2X7JA 1PVDA 2JLAA 3AL0C 1YC2A 5F23A 4ZCPA 5EJ5A 3CF4G 3X1JA 4TS1A 4KXQA 3IVXA 4OUDA 4COKA 3QTBA 4G5YA 4TWJA 2PFSA 4DDKA 2FRDC 2JAXA 3NBAA 4E1AA 1NI5A 5HUHA 3JWPA 1KORA 2TS1A 1QRUA 3GLSA 4ARIA 2FN3A 2YWBA 1V5FA 1VBMA 4UUAA 1J8FA 1T6ZA 3N9IA 3Q12A 2OD2A 1MCZA 1TYBE 2Z09A 5AHKA 3RFFA 3GLVA 1ILEA 4BV3A 4L3OA 1QRSA 1M2NA 3I05A 1KQOA 4U8HA 3PNYA 3UC5A 1JEDA 5EJAA 4EG6A 1Q14A 2Q27A 1GAXA 4MAFA 2CSXA 5DB4A 3H97A 4MW5A 3LOQA 3PRHA 4K03A 1OZFA 5MFPA 4Q16A 1YUMA 4MPRA 3GUZA 4MUJA 2H4JA 1M2KA 5EJ8A 3HL4A 3CLRD 3CR8A 1GPMA 4NX2A 2DERA 1QU3A 2VBIA 1MAWA 1KR2A 2PZBA 1OWOA 1VL2A 4KR9A 3RBAA 3DPIA
chains in the Genus database with same CATH superfamily
4J8PA 2B7LA 1A8PA 1PFWA 2GN1A 2VDVE 1EAYA 1UPUA 4X91A 2Z8YA 4EFKA 3L7IA 5B1EA 1SUBA 1EI9A 1R12A 1ZM7A 1QX4A 4XWYA 4AJJA 3O8BA 1V26A 2HYDA 1X42A 3SGLA 1AUXA 2ZT5A 1NBWB 1SBIA 3VYTB 1M2OB 5JS7A 3RK0A 1ZW1A 5KNDD 1NI4B 2JH3A 4LWZA 2PKEA 1D6SA 3K5IA 3NCTA 3WGVA 3A4MA 1FFEA 1ZHHA 5DI9A 1VB5A 1XEXA 1ZNWA 3R3UA 4M1YA 4GX1A 2FSVC 1P80A 3GY0A 1EK2A 1OA0A 5AVOA 2WMYA 3IMKA 2RGRA 1COWD 3NH9A 4S1TA 2RHOA 4NS4A 1V2HE 3F9CA 3GJ5A 5I7FA 5CXSA 1QB8A 3NUGA 1L5RA 2FOIA 2REXB 3N07A 3RU7A 2QLTA 2PEYA 3D3EA 2WYUA 4ZDKA 3TECE 1C3XA 1HYHA 2GPAA 2VQ6A 4MZDA 1C7RA 2X23A 2ZRLA 3H7IA 4FR2A 5ADHA 1T4DA 1B43A 3EXFA 9ATCA 5IANA 2I2XB 1OLOA 1JW9B 5HVNA 2Y3IA 1YZYA 1KEWA 3A9UA 1ADGA 4MV6A 5TEVA 2ID9A 1VSUA 2OV4A 1KMHB 4KXMA 2RB5A 1H0KA 2BFBA 1V16B 2II6A 4KN9S 5DYTA 5FRDA 4GR5A 5DSZA 1V1JA 2FEOA 3V8EA 5LP6C 1JILA 4EF4A 3R5SA 4CL8A 2WSMA 4BEWA 1RM5A 1TUEA 2DT5A 2HSGA 3CRQA 3I0MA 3JASA 5G53C 4OBBA 4TWIA 1ZAKA 2EBFX 3KQSA 3NASA 2H2HA 2PZFA 4J76A 2IU6A 4GWGA 4X20A 4RJ2A 3OQ1A 3PDIB 4UVDA 2R1TB 3TQHA 1PS8A 2OM6A 2CCGA 3BAZA 3DEKA 4FDUA 4RSHA 1WABA 4WN3A 5IUJC 3PNPA 1IN4A 3JZAA 3HVRA 2Q28A 2CVPA 2MSNA 2I2BA 2XSZD 3AUXA 3MBKA 3OPYI 4M60A 8ADHA 2MYNA 2PPLA 5G0TA 1KQPA 1MB2A 3C3DA 3HU2A 3I6BA 2G77B 4OB6A 2OFOA 5TY0A 3WP1B 1P3JA 1XAIA 4G0UA 1V71A 2O8BB 1E63A 1P2FA 4RTPA 4IZIA 2H48A 1VL1A 3O73A 3GLRA 3IOMA 3AVOA 4MQFA 3B8HA 1Z37A 1U6JA 3CVVA 2WINI 4UCXA 1AXRA 1MW9X 2IE0A 3D5TA 3PEFA 3GLHA 1ZIPA 4BLVA 3P52A 2BZ0A 4FU0A 3QVVA 4F6LA 2XMQA 4QTXA 1GG8A 2W6IA 5B1YA 3KT3A 4UTZA 4XM1A 3RFXA 2AD5A 3SMQA 2VHUA 4CQMD 5AOBA 3U39A 4AIIA 3QBTA 1F8GA 3EZ7A 1XAHA 1FSFA 3ID6C 3O93A 5LDDC 5JXWA 1Z8NA 3FYHA 1NJ5A 3G7SA 2V7EA 1ZICA 3AF5A 4P3KA 1DG3A 4JUDX 4MX8A 1YI8A 3TI7A 4FE7A 3PD1A 3NKVA 4JLWA 3COJA 2YHIB 1D07A 4GRIA 1ODTC 3HCAA 2HLNA 1TUBA 3EUAA 5K2MA 3TEFA 4ISCA 3PEYA 4Z8XA 1FS5A 2JD0A 1PJQA 2JHGA 3FTQA 5DTEA 3LX6A 4C04A 1HQCA 2F64A 1ZCJA 2CDBA 3HBFA 3GJTA 4PRYA 2FMIA 5C53B 5TQ0B 3K70C 3K9HA 3OLWA 5ISMA 4MNTA 1INLA 4IWNA 2D1RA 1WU7A 2BIFA 3IEXA 4HNAA 4OAQA 4QAJA 1UQTA 1P61B 4WE3A 3A1DA 5EXSA 2W6OA 4J29A 3G9XA 2P9FA 3D0QA 1AKMA 1OH5A 1G291 4E3ZA 3QSYA 4QYXA 5LBIA 3WJ2A 2G72A 2CF5A 4QARA 4CGYA 4MVJD 1XLWA 1L5OA 1IZYA 3QP9A 1RXSA 4LQ4A 1GTJ1 3OOWA 1OFGA 4KZKA 4TLBA 5CFMA 2IYLD 3NNNA 2YYSA 3EG5A 1M6YA 4B74A 1UANA 1U1CA 4XSHA 2H1LA 2GZ1A 5LVAA 3MCUA 4LYGA 3WLTA 5HCIA 1W5TA 2XCRB 5L6LB 2EZ4A 2FR8C 4OGGA 3QFHA 2VP6A 3FHJA 1FU4A 1GLGA 1NYRA 1UK7A 2WSBA 1QK3A 1DEHA 3D6TB 3ZE2B 5ALZA 1KZ6A 3QVLA 5AQEA 4DUZB 4MTCA 3E05A 2QU7A 4XDZA 2CNWA 1FB5A 2WM9B 3AHFA 3BF7A 3CLVA 3EGEA 2ORWA 2GM3A 2Z5GA 3IBYA 3IPYA 2WAYA 3VR3D 3HVKA 4BU0A 1ESMA 1UIMA 1I3MA 2JF0A 4J9UE 4QGBA 3I9MA 4BNFA 2IU0A 3I01M 1SPBS 1HDGO 3WB9A 3F47A 4DIMA 2JIRA 4UE6A 4JLVA 4GBJA 1DO2A 4L15A 3MNFA 3EA5A 4QL3A 4YT2A 1M8PA 2XTAA 4CCYA 4K9NA 4NXNB 5FBZA 5A4MS 1QE5A 2JLBA 3GGOA 1Q16A 5JANA 2LUOA 4FHCA 1R4NB 1X94A 1Y6JA 2IRWA 2VYFA 1E1KA 3OZ7A 1HDXA 2QD5A 2C4HA 3WLFA 1IIRA 3DPUA 1FUYB 3R7WB 5A9SB 1C81A 2FUCA 2A0FA 4J4HA 3P94A 2H18A 2WU4A 1Y5NA 4TWBA 3TQFA 3D2BA 1A8SA 1S3IA 2R97A 3FR8A 3TTSA 4EJ0A 4BMVA 3F49S 3AK4A 3NI2A 2HSEA 1M2VA 1P7PA 3A6KA 3GRUA 1SEVA 4QE3A 3UK0A 4BO0A 3Q8KA 4DSNA 3I42A 3FVWA 1PX2A 1TU4A 2G1KA 4G2NA 3QIVA 4ZDJA 1MORA 4FEAA 1Y3IA 3FUCA 4BMZA 1ZLXA 2ZAOA 1UDWA 1F4PA 2XUQA 3TKAA 1CLEA 1WB4A 1TTHA 1TL7C 4NBKA 3S1AB 4AP5A 3PC8A 5IZCA 4AS1A 3I2JA 1K7XB 4FI3F 5BP7A 3ED1A 1E7YA 3OETA 3GJ3A 3QV1A 4G0OA 1FL9A 2H11A 1C0KA 1C9YA 1ECLA 1FFSA 3CWCA 3H8WA 3LBNA 3TSCA 4EG4A 3W4KA 5DP1A 4A5OA 5HK9A 1J1ZA 4D4JA 4PO8A 2FZWA 5A9SA 4YN3A 1L4EA 2QN9A 3M1IA 3NHKA 4XYBA 3MZ0A 5G4LA 2RKWA 1RYHA 2CJWB 4YREA 5BXQC 1N1DA 3NW9A 5EZ6B 4UMFA 1IN6A 5DWVA 2YY6A 4IZHA 3H4MA 2D74A 1DAGA 1U2TA 3T9CA 2WWYA 3WQSB 1YQ9A 2PIDA 3W78A 4OATA 5K8VA 5CDGA 3LU1A 1EK5A 1Z0FA 4J1NA 4XR4A 1OFTA 1NNI1 3WZMA 4C4TA 2AS0A 2W2KB 3TF5A 3DE4X 2JFWA 3KSDO 1T34A 3WSTA 5A5GA 3IX7A 4NQRA 3WQQA 3C6ZA 3PQ3A 5CYGA 5HGJA 4Y2VA 1G7TA 3OC6A 5KQPA 2JAHA 1KQ3A 3MQFA 3I0ZA 1A5BB 1N0HA 2PXXA 1TRHA 2QTHA 3OJOA 3BL5A 1YZUA 2ZIUB 4DQUA 5LWHA 2QI9F 2Z83A 4C0KA 4R5MA 3BD9A 3O8LA 5LNK6 3K1ZA 1L5ZA 2OHIA 2L42A 2F48A 3X3HA 1GEGA 1S2NA 1XK7A 4D9GA 1V25A 4LNUB 3S2YA 1SQGA 2HC9A 5F2OA 4N7MA 3UMYA 1E4EA 3PZBA 3LUFA 4O2LA 4JJ8A 3QIAA 4RSGA 3RC2A 3Q8MA 1XPRA 2IEYA 4GSYA 3KT6A 2FUNB 2Q5OA 4H2DA 2YDXA 3K6RA 1NMSA 4TLMB 5EP4A 3QUTA 4H4DA 1C1YA 2E1PA 3VZPA 1YOVB 4OQMA 1SM4A 5EFOA 5J1SB 1XCMA 5G0VA 4MV7A 1ZR2A 2QM3A 5AW5A 5JAHA 3MQ4A 1RKXA 4BJ1A 1DU4A 2P9QA 3SYTA 4FC7A 1Z8FA 3GRRA 4F93B 5IKEA 3KJIA 5A6VA 1Y7LA 2C82A 1WZUA 3AI3A 2V7QD 1NXPA 3FD8A 2JGAA 3H9BA 3OKAA 3OX1A 4TRRA 3FB1A 5B12A 2A9KA 4P0TA 4UUQA 1ZGBA 5FPTA 4MV9A 3DL7A 2HI0A 3KM0A 1J06A 1H2RS 3H4TA 1JR6A 1FSPA 4S1WA 2GK4A 2CDAA 4HFMA 4NATA 3ZLTA 1JTFA 4Q37A 3E9YA 1VJTA 3OHSX 4W8GA 1EA7A 2GFHA 5DSXA 1KE1A 2G0NA 1XHEA 3AV3A 3GW8A 2WU1A 3I1YA 2FWJA 2CFIA 2JGNA 3FLEA 1BMTA 4CFSA 5LP6A 4EEXA 3ZQUA 3KFLA 2RGNC 3B1YA 3C1OA 1WM1A 3R4VA 4RZQA 1CS0A 3T5PA 3OEED 2M1ZA 2CNBA 5IEBA 3R9KA 4YEDA 4RQAA 5ULLA 4MPTA 5K0FA 3GPLA 1Q57A 2PV7A 5JPCA 2BRUA 3K73O 4RD6A 3TTUA 1U1EA 1P60A 3PC6A 1KAGA 5F1OA 4JI1B 4J0FA 1STOA 4X64B 5CLLA 1NW7A 1VKHA 1W25A 4DJTA 1UT5A 1NBMA 3U3JA 4DQ0A 3IBTA 1HDIA 1K86A 2JPDA 3FWKA 3MJCA 4M8IA 4PG4A 5JLAA 4CEIB 1R0YA 5K0BA 5KJFA 5EIHA 1ZZEA 4PGGA 3SOZA 4AZ0A 1OBFO 2QVYX 4NYIQ 4C7KA 4D9CA 4CT4B 1ZCAA 3GCGA 4LX0A 4G97A 4LXHA 1E77A 2OXEA 4YRAA 1B3BA 3L6EA 2YKGA 1OV6A 3V7YA 1HUQA 1O94C 4WFQA 4TTQA 4Y6SA 2OZPA 1A5SB 2PD4A 4AQDA 2W2XA 1DO0A 2LTAA 5F73A 1SRRA 1AK2A 1JJFA 2LDBA 4JLNA 4H7EA 3KVRA 4I3GA 4URYR 1WR8A 4TKMA 3RUAA 5CDFE 1UOPA 4H7DA 4IXTA 1CIJA 1U94A 4X6UA 3VH2A 5B7PA 4MI1A 2NXNA 4TL9A 1NQXA 3E9CA 5EEHA 3B1FA 3ONVA 5EP3A 3RRZA 2O8FB 1RE1A 1U2GC 1AKRA 3F6YA 3P8ZA 3KQNA 1U5AA 3BH6A 5CNJA 1M2HA 1CY1A 1TLFA 1VBFA 1KI3A 3A9SA 3LFUA 3OJEA 3T06B 3ZE8A 2UU9B 4Z9BA 5LQSA 5JI2E 4WESA 1GZDA 3CCFA 4II3A 1FYXA 3U48A 2XKJE 3AGPA 2AG0A 1ZJJA 2AF4C 3HJBA 3GYBA 4WLVA 4WK0B 1RIIA 1Y80A 2H92A 5I47A 4ZZIA 4DY4A 3UJHA 1W88A 1DCKA 4H3SA 2ZJ1A 5H82A 1FNCA 1SA0A 2EQ5A 2X5OA 4QD3A 2VSNA 3CE6A 4G8BA 3W5SA 4B87A 1JJAA 2PS3A 2EKLA 2GNAA 2HNBA 1YUBA 3COPA 3NTUA 2A9RA 3LW8A 3AILA 3LY8A 4DCMA 1GUBA 3DJYA 4FMDB 2RHGB 4WZBB 5KJ1A 3OTHA 1XEFA 3V4ZA 5ESDA 4PNEA 3QLVC 1JQ3A 2IEGA 1Q1GA 1M1YB 2OL4A 4OB8A 3VRHA 2R6R1 4B6QA 4QLBA 5F98A 1ZGJA 3HEMA 1HYEA 2R4UA 1TLTA 1A69A 3H83A 4G86A 3SJBA 2XRYA 1E3WA 1WNFA 3H5NA 3PL1A 4QM7A 1L4BA 2GN4A 4GF5A 1JN0A 3FTFA 2KSQA 3S5UA 4FX2A 4PFQA 3UY4A 1VFNA 4OO3A 4GYWA 4M8LA 2H4YA 3BHIA 2D8AA 2FFBA 1IQUA 2QR5A 1VIDA 1JDPA 5CEEA 4QRHA 1Z2PX 4QU8A 1P77A 5DU2A 4YCBA 3HKDB 4OA8A 1ZN2A 2V98A 3PHGA 1G4HA 1GSIA 2JGDB 4Y6OA 4N7JA 3UFBA 3T61A 1WZNA 3B51X 1EDEA 1Z2EA 4HL6A 4PZUA 2C8JA 1IOZA 3EHEA 4IIJB 5FOTA 5CA1A 3HA2A 1R9NA 4QYIA 2ZYVX 3PYXA 1M72A 3EAGA 5JV5A 1P1CA 4HEA6 3KBBA 1XLTA 1KIMA 3OCCA 3TCNA 3DDUA 4RVNA 3I9FA 5EJ2A 2ZETA 1PFKA 1IZ8A 1J2UA 3BSFA 3AI2A 3BGSA 4O25A 3PFCA 2G5TA 3ZCVA 3UGQA 2HJ9A 4G5RA 5TC4A 1AO0A 4IIUA 3ADBA 1XKTA 5CD9A 4BDTA 4NYJQ 1XZAA 2YWEA 4KLRA 3KLOA 4C2BA 1J8FA 5CHYA 2O0KA 5F77A 1D1QA 1H2WA 3B2QA 3A1VA 5I9IA 4QGFA 4ADSG 4DWOA 3AIKA 3I05A 4KMMA 2GPJA 2IPMA 2BLLA 2PL3A 2F3TA 3S68A 3V2HA 4BMNA 3HJRA 5FUBA 2P6PA 3RH0A 2NUPB 3G5LA 2WKPA 1W52X 3A7EA 4PC1A 5F1KA 3VR0A 1TM2A 1LW6E 2DPXA 1ZY2A 1YUMA 3B7GA 1KSFX 2C61A 1AV6A 2FNAA 3EXHB 3JZFA 4FGUA 1SUWA 3DBOB 3H5OA 2VBCA 3QKTA 5EJ8A 1GJRA 5J5VA 3H1EA 2XNCA 1G7CA 3VKHA 3VPSA 1OROA 2ADMA 3DVQX 4FMPA 2G88A 2Q49A 5IH3A 4GH5A 3WMGA 3GRZA 4LY9A 3NTRA 4KOEC 4X1YA 2J0VA 2VG8A 4KR6A 2OXIA 1KDRA 2WM8A 2QN2A 1IE3A 1BWSA 3LDUA 5FULA 1TX4B 4IOJA 5EWMA 3N58A 3D4BA 3I9KA 3MUFA 3N8NA 3O9VA 2F00A 4QICA 4R01A 4RVFA 4D42A 5JRZA 4F84A 1ZS9A 4KQJA 2P9HA 5JZ9A 4C0QC 2X5JO 2KX7A 3AI7A 4P08A 1Q17A 2JCSA 5FOWA 1MRZA 2P41A 1QQTA 2KBEA 1E5XA 3GL9A 3ND8A 4PVDA 1H8ED 1RQ7A 2OXFA 5DPMA 2WY2D 4A26A 1YDEA 4HLUA 2WHXA 4CKEB 4NE7A 4QUKA 4NEHB 1GR0A 1PDWA 4IH4A 5IC5A 4P54A 2QAJA 4R8VA 3UANA 4MKGA 1VDZA 2EFEB 4TT3D 3QPVA 2O0MA 5A0FA 1CNEA 2SKEA 5EPUA 4JLSA 3ETDA 2DLCX 3QENA 2Z6QA 5DLEA 1C29B 1I0IA 3BYZA 3HDVA 1QLHA 2BMWA 2ZDGA 2Z8XA 2PVCA 1D03A 3EA0A 4KIFA 4KK4A 3U3DA 2HBZA 2IF2A 3EDRA 1EUCB 3D6UA 5E8JA 4LFAB 3KE9A 1HOXA 4J1TC 1CY2A 3LCVB 4W9NA 4DIKA 3PF8A 2QRUA 1O97D 1ZONA 1X38A 1ZOOA 3DW3X 3BORA 4M1WA 3ZS8A 4BLOA 1AA9A 3PFWO 3X1MA 2BRUC 3G8DA 3OOHA 1B1CA 5BN4A 3E7XA 1CQJA 1NZJA 4AKIA 2V65A 5JRDS 3L0DA 2JLSA 3ST7A 4M8NE 2CEAA 3CF0A 5IASA 3C1TA 1QP0A 1OYWA 1NWCA 2VKTA 3GVCA 1KFJB 3MSXA 4JBNA 5CFRA 1I8TA 2OV8A 2D5AA 4UEQA 4MRRA 3C8ZA 1P91A 3F7NA 3FRJA 4MS4B 3NO4A 1R8JA 4KQEA 2J87A 3A25A 3DMFA 4HEJA 4IIGA 2VP2A 1NW8A 1E96A 1K5HA 2VPIA 3L0SA 3M34A 4FWBA 3VDQA 4DMFA 2VQEB 2A9PA 4TKVB 4O02B 1KC3A 1W93A 2AW5A 1X80B 2GARA 5J4YA 3QOXA 3ZDBA 3JD3A 3BEDA 3EH1A 1GA1A 3UC9A 4GAEA 3IE1A 1PEKE 2I2DA 2GEVA 3OVMA 4M7PA 4MUHA 1GU7A 1M73E 1J5XA 4GQIA 2A9FA 2OOSA 4O2BF 4TSFA 3CZRA 3D64A 4Y2GA 4KITB 5DBGA 3FNGA 3CB2A 1Z28A 3L4BC 1GUFA 3CO0S 1TTTA 3D2LA 5J40A 1SRQA 2FY8A 4GP6A 4ZVMA 5GGYA 4JLBA 2IZOA 2PH5A 3QYPA 2RGGA 4FCVA 1R0CA 1KSGA 3VU3A 1HYGA 4BNUA 1GQYA 1VI2A 3WY9A 2V55B 2PBLA 4X95A 3BC1A 5BVHA 1AQYA 3LM8A 1AT1A 4G67A 4ZCTA 1NRWA 1XZHA 1RZ3A 2BN4A 5A03A 3TG2A 1JHOA 4FQ5A 2G70A 3GEBA 4C88A 5AJUA 2VAWA 1XMSA 4JLMA 1V8PA 1G21B 1AQUA 4RMGA 5DNCA 3ZJUA 1H93A 5G0WA 3NGXA 3GN2A 4IS2A 1OF1A 1G5TA 1Q1NA 5BQ3A 1T2VA 2DHEA 3BWBA 4BTVA 1A2BA 1NMEA 4YAJA 2PUAA 1XG5A 1ULUA 5DK4A 5J2TA 2ZE8A 5AK6A 3KKZA 1X7ZB 1L1EA 1DC4A 2B1GA 5E4TA 5LKRA 2VUHB 4CF5A 1W6RA 4NU5A 1R6BX 1V9SA 4RTJA 3RSOA 2DPYA 4X7MA 2HT1A 2AVDA 4HTAA 4JLJA 2VDQB 3CW2A 5EWLB 4NESA 4BZXA 2W6NA 2ZYGA 1XQYA 4LQCA 1E5QA 1OV4A 4MVWA 5AM3A 2A7XA 3OOJA 5B7GA 1IBKB 2XMBA 1W4RA 4K6GA 4PRKA 3I2IA 3PWTA 2Z9BA 3ENQA 4IGIA 4NKRA 4KGZA 4BAZA 1BN7A 1WCXA 1Y98A 3KC2A 3TNFA 2ZJ5A 4MRVA 2NVOA 2ZPTX 5LYJA 2PRKA 1SIOA 3NYIA 1Z5PA 1MPTA 2Y1GA 4KL8S 4NHEA 1TKBA 3ZWBA 5HM8A 2UUAB 1W94A 4Y9RA 1EDBA 2BM0A 1TTPB 2VF5X 4YAUA 4TN1A 1M8KA 3PQEA 1V7ZA 1E3WB 1SBZA 2IUEA 2PUDA 4NBVA 3O2QB 1QOPB 1KZ7B 3INTA 4C7OA 1FPMA 1E0DA 4P3OA 2C1EA 1NNSA 2Z56A 1KPGA 2VFAA 4YECA 5ALQA 3THSA 4D79A 5HNKA 5EQFA 3IL2A 2BEKA 3WV5A 3FHLA 1RBMA 3JYOA 4L5AA 1X15A 4KMRA 4A6DA 5JISA 1UCFA 3L93A 1J0BA 3FSGD 4MUBA 2FTKE 1PL8A 1ADCA 1NNLA 2VDOB 3DULA 4HWKA 4PZDA 4WV3A 3WK4A 4RDXA 2R7LA 4W5HA 2B78A 4HNQA 5E1OA 2P62A 3SF0A 5BUQA 3WWCA 4BX2A 1AUPA 1PZMA 1NI3A 3SVZA 3GD5A 1TMGE 4UM8B 1ZZGA 1LLUA 1ZVJA 4OHUA 2YQZA 4QXAA 5F9MA 4CV3A 2YWFA 1P17A 5FYQA 3T9DA 2EJTA 1GQ2A 2ZU0C 2VUTA 2I4IA 1UBRS 2DU8A 1QK5A 1Q5PA 2Z3ZA 3PPIA 3FUTA 1K4MA 2Z2JA 4FYHA 4IXMA 2P9JA 4F2GA 5IN4A 1H4QA 1EVIA 2QNIA 3IP9A 2QRVA 3UWDA 4BE4A 2I6QA 3QMWA 4IV8A 4EB6B 1USIA 3OO0A 5MF6A 1X7DA 1FMFA 1XAJA 1Z4NA 1A0OA 2NO1A 2AMFA 2P3LA 2VPZA 3PXXA 3QVSA 4YAOA 1U7DA 3SKVA 4EKGA 1N9GB 3ITKA 2R87A 2SBTA 4Q3OA 5DSTA 3LKBA 2NUPA 1O1YA 2W8BB 1BKYA 1P0MA 2QZJA 3PGJA 1N33B 4REMA 2IYVA 2C4TA 4IIDA 3UCEA 1L9XA 4AYXA 3LV8A 4ZJZA 4TSKA 5LJIA 4S35A 3F98A 3U44B 3BCSA 4O4HA 2FEKA 4K6KA 1KR5A 1BW9A 1L7OA 4PX9A 1D3AA 3O90A 5B36A 3MTGA 1TB4A 4CKBA 2HCJB 2ZYAA 3NMUF 4YI5A 1THMA 1W8DA 1CUXA 2DFTA 4I9NA 2H1VA 4Y9UA 2WHEA 4D4KA 4HVCA 4K9LA 1K92A 2QAIA 5IYZB 1M0TA 1OVGA 2UZAA 4RWEA 3PC3A 2Q3JA 3ESRA 4JI2B 5JJKA 1C9KA 4TVKA 2NSYA 4JASB 1JVNA 4O8ZA 1DJQA 3OF2A 3VU9B 1OMOA 2WM3A 2DPLA 4DV7B 5TT1A 5KO2A 4JU9A 1XT6A 5BMVA 1FDVA 3H16A 1G1MA 3PUHA 1B0UA 4MITA 4MVCA 5BPHA 1XYYA 3A6PC 1S02A 3B3FA 4Y2TA 1E66A 1JXQA 1S2GA 3KJQA 1QYRA 1SH7A 1KBZA 3E5MA 4C30A 1BOFA 2AR0A 1RLMA 1T8SA 4OPMA 3O8DA 1CR0A 1NE7A 3VO2A 3VH1A 1Z9BA 2HV8A 3PGA1 3AH8A 3IA7A 4ESOA 1HTWA 3OM8A 4EPTA 2V9CA 4JOSA 2GYVA 1FMTA 3EW7A 1N3LA 1OAKA 4CEIA 4YAIA 1X39A 1YBVA 3TM5A 5AW4A 4LXUA 2NX2A 3HXQA 4UAJA 2F9MA 1KFBB 1NKSA 2GHQA 2C7RA 3LX5A 2R8BA 3NBKA 5EXTA 2PMEA 5FPKA 4OYHA 5I9SA 3I09A 1DAMA 4Q4HA 2HLDA 1G63A 2D5LA 2FEWB 2QGNA 3A58B 2PRJA 3I2KA 3IS3A 2CZGA 2QORA 3S8EA 5EIBC 5FIUA 4GE3A 2C2KA 1ECGA 3BB1A 5BUCA 5CA0F 3CLKA 1AHIA 1AKTA 4R9VA 5AO9A 2QTVB 1CJMA 2C3UA 3HCEA 4XWWA 2A92A 2UVPA 2PX3A 1FTSA 2H1CA 4GEGA 3OZXA 4L6AA 3LDAA 4LPKA 3V8BA 2YMQA 3WMWA 3O26A 3EAFA 5JSUA 2OAQ1 4M9ZA 3KETA 1O4WA 1SOMA 1X87A 1N4DA 1Q6ZA 4WNYA 4NBWA 4RH0A 5GY7A 3HR8A 3U60B 2VHJA 1P0IA 3K0KA 4FFPA 1PG5A 1G55A 3PCRB 1RYDA 1P9RA 1MZPA 5FI0B 1PJ3A 1C9NA 3IV6A 1P6QA 4LXQA 2WF5A 2I2FA 2X86A 5TF4A 4UEJA 1UFRA 4JKIA 1P19A 3DOFA 2O3JA 3ZBTA 4D3DA 4ER7A 1ZAYA 1TCBA 1YJBA 2W9XA 5LB4A 3UWSA 1KAHA 3VR6D 3RK4A 2ZI6A 3WHKA 3MINB 4PYMA 2WIDA 3QU4A 1MVNA 4PLGA 2IHBA 3LHIA 5IBRA 4Z54A 1R15A 5ETJA 1OIWA 3QGMA 3VVLA 3NOOA 4IDGA 3OM0A 2HH9A 2QJFA 3W3AA 3PLNA 4JWKA 4BBJA 1E1CB 2FH5B 3FVQA 3K0CC 5IABA 3X1DA 3A1SA 3HA7A 4KFTA 3MJEA 4HWGA 3TE6A 4MPJA 1FSGA 3OY7A 3F73A 3UJ7A 1S2IA 2ZWMA 2ZP1A 1UC4B 3G88A 5FUXA 1EEXB 2G76A 3ZNQA 4HYEA 3ESYA 4BBAA 1CJBA 3K1AA 4R16A 2B7CA 2GB4A 2VLIA 5EKTA 3T3IA 1JSRA 1VECA 2A0XA 2Z3WA 3AHEA 1TK2A 3PRYA 3G2IA 3BS4A 1KDVA 2JEOA 5H3CA 8OHMA 1T4BA 3B2EA 3EFHA 1VI6A 3AEXA 3CLSD 3K0CA 3KTFA 4TOIA 3H9EO 5ESXA 1G38A 1IWBB 1C7IA 2QQGA 3BKXA 5JPDA 1DUVG 3L5KA 2YXLA 2XNJA 4L8WB 3OJ0A 4JWTA 3FCCA 4E31A 4IDNA 4D3SA 2BEUA 3T7DA 1NUTA 2IODA 4HUQA 5JZVA 1VSTA 2ZYUX 5KC9A 2D4AA 4IQFA 5L53A 5M34A 5A0VA 3K9NA 4IHKA 3AR9A 4JY7A 1IMJA 1HZZA 1KDOA 1VRVA 2WHRA 3R3VA 4KZPA 5T5QA 4Z4GA 2C5SA 5FPHA 1IXSB 3QBEA 1QQBA 2ZUEA 3GPCA 1W5SA 3EXHC 4HNGA 4IMPA 1IY1A 1JF8A 1Y6RA 5JNTA 5KNBD 5EZQA 4LVUA 2HBYA 2BAGA 5KS2A 1M2VB 4W7SA 1O96B 3ONWA 1Q3TA 1E20A 1DEXA 1YS4A 4O2RA 4WN9A 3VHQA 5L8VA 1QQAA 4PRLA 3EE6A 4LDPA 4XDGA 3MGAA 1L8OA 2HUPA 4ZA2A 4AO7A 1X1SA 2JJ2D 2HBQA 4MW0A 4ZC1A 3LQQA 4XQCA 5KNBA 3U09A 1F5SA 1JXMA 3CKYA 2BVNA 2QTLA 1L5QA 4V2IA 1WMDA 2OAP1 4RVGA 4XIGS 1USKA 4X61A 5DJ5A 1JFFA 1M2GA 2G80A 1PJZA 4P2BA 3VX3A 4F04A 4FXPA 3AHJA 4N5NA 4EW3A 13PKA 5CXXA 4MEJA 4Z0PA 4NBLA 4B2YA 2B0CA 5GQSA 4UFPA 1CZUA 3BF8A 2X4LA 3NV9A 4MUIA 1I9CA 3LBHA 3B3GA 1MBZA 5BV7A 4ATNA 2OFFA 1SPXA 2QMQA 2N75A 2XRZA 3IUPA 2GPWA 3Q4GA 4Z7OB 2ZXEA 2ZJ6A 4TM7A 1CZOA 3PQ8A 2HDHA 2ATEA 1KJWA 1QH8B 4XB2A 5TV2A 1K3FA 1B8OA 1CS0B 1DX9A 3DMNA 3PT5A 1NRJB 3WK9A 5C1DA 2C2GA 1E7WA 3P4XA 1D8TA 3GJ7A 4FBGA 3UB4A 1DV2A 3DF9A 1JIIA 4JGGA 2FJUA 2XNHA 2I3DA 1FDUA 3TMAA 2BEJA 1N1EA 3D0KA 4G0QA 5IAAA 3E53A 2NXJA 4JI5B 1WLYA 3X1JA 3W4IA 3LFHA 3PC8C 1W4LA 4CDRA 2QT9A 5IZCC 1Z68A 1VP3A 2ZUBA 5FFMA 4CKBB 1VL5A 1H0HA 4LSGA 5DCUA 1WXQA 2XUFA 2DHCA 3TD2A 2ANCA 3EWIA 4M99A 3U0VA 2RHJA 1EG2A 3N0WA 1QFMA 3R0ZA 1NI5A 4E1AA 1H05A 2I8CA 3JWPA 1DHTA 5BN4B 1KWKA 2QE7D 1Q91A 4MQUA 2JHCA 2ZRKA 3HUDA 4HC4A 2VDLB 3M6MD 3HHPA 4I1IA 4OEHA 3AUYA 2ECOA 1ETHA 1ZJ6A 3UJBA 4DFDA 2CBXA 5IWAB 1ZVKA 1ZQ9A 16PKA 2H6EA 3LUHA 2GHRA 1T6ZA 4M0KA 2GPNA 3LO5A 3BMOA 4MV5A 3X1ZA 2X6TA 1KIFA 1OLSB 4ZVSA 3C5HA 1HETA 4UDYX 4QPNA 2AN5A 4R3NA 2WD8A 1DFHA 1QQ6A 3UMBA 4A73A 4ZAVA 3UN1A 5KC8A 5U9CA 1FNNA 1R0RE 1XKQA 3ZHBA 2H17A 4TTAA 1X7GA 1X92A 2X22A 5KSPA 3E5NA 1ISHA 4WXYB 3QLEA 9ABPA 4L72A 2MSLA 4L3VA 1GARA 2OKGA 1BYIA 2EKBA 2KQUA 4US2R 4IGKA 5MFPA 1Z7WA 3C3CA 3RUFA 1A96A 1VKNA 5FBHA 1EK0A 2PUTA 4G63A 2JLVA 1KR2A 3IQZA 1X77A 3D7LA 3TL6A 4Z2AA 4RD0A 1KQGA 5EQTA 2ACEA 5HYVA 4R31A 2I78A 3VBCA 2YUTA 4F60A 1Y8ZA 1E2IA 2HA7A 4H3KB 2BM1A 4XZ3A 3RIYA 5JALA 4ISBA 3WGYA 5I7AA 1XXHA 4W5OA 1CEQA 3HXKA 1N5LA 2X4DA 3OKFA 1GPAA 3FVVA 5IVDA 5IF3A 5FWAA 1H4VB 1FXWF 1JDUA 3SSOA 3ZDRA 1EX9A 3STYA 4DNQA 4UKDA 1WUIS 4CFZA 3GG2A 2CT8A 3K0FA 3A3PA 3PSAA 2ZUDA 2QSJA 3EZLA 2VKQA 2JFZA 3JQDA 2I87A 2E2WA 1KEEB 3AINA 3K3PA 3NGMA 3SIWA 5GIPE 4HQOA 3CSDA 3DW1X 4FJ1A 3I1JA 1Y6ZA 1G8SA 5BNFA 3SDBA 5C2JB 1CQIB 3EH2A 2XOKD 2WFLB 2WSSD 3OZAA 4GGOA 4HY3A 4K3UA 3H3XA 2Q1WA 3VMFA 4D46A 5JAZA 5AUNB 1NVUQ 5FKJA 4HDSA 3JD1A 1NP3A 821PA 1H4TA 1XL0A 1SVLA 1W0JD 2NWQA 3KEFA 4R4JA 3FROA 3IAS1 4IJKA 1MQ9A 5FI5A 5G4KB 4N48A 2ISQA 2ZJFA 1SAYA 3KQOA 5KU7A 1SVKA 1YB4A 3K1JA 3VYWA 1JZSA 4LFCB 2WAAA 2ZQZA 1VL8A 3K0AB 3MAGA 4H6VA 3UK6A 2JAOA 3LAWA 3MAAC 1TCAA 3F1KA 4HTFA 3W6OA 1EQ2A 3DV9A 4HNHA 1Q7EA 5CW1A 4GPEA 5FLYA 4W6ZA 5HIMA 5K45A 2DGDA 5D00A 4HJRA 3AJ8A 3ZCTA 4RENA 3IQHX 1KJ8A 3A2NA 2UZ1A 2PYIA 3EDQA 3DDHA 2O5VA 3OMLA 4K9SA 3BOSA 4I1PA 1UT8A 3G02A 3RUEA 4RGYA 3NIFB 3QTTA 4QPPA 4KR3A 4MTLA 3ZVLA 2GFIA 1J6UA 2CWDA 3PIDA 3C5WP 5A2QA 2V5VA 3NPMA 3QXHA 4Y9DA 2H4HA 2BMVA 4P53A 4ZIRA 4JR2A 1R7RA 4E2FA 5CD1A 4EY5A 5DISB 1I1OA 1DFGA 2YJNA 4ZC8A 3BXPA 3TIFA 1XTSA 1E4VA 3C8HA 5BMOA 3B12A 2GBFA 3DTYA 3LWNA 4Q1FA 4XVUA 2W6ID 4XLZA 5HE9A 1P2UA 4YRZA 4ZK2A 2ZBEA 2FN4A 3FZGA 3NV7A 4ENTA 2LDXA 3B9BA 2PYDA 2BBSA 3B60A 1U0SY 5T8KA 1KBOA 4IV0A 1W0KD 5FUVA 1T6XA 5F78A 1TQ6A 1LPPA 2W2MA 3W9SA 4BKMA 3SZOA 1GPLA 4D3XA 5ALIA 1YJ8A 4O4JF 3N6XA 5BRAA 3NP7A 2Z4RA 4GC9A 1SHZA 4IHJA 1WQ3A 1RXCA 2WUFA 3CU5A 3UYKA 3B9QA 1DDOA 1OLUB 3F97A 2JAQA 4OV6B 2NUBA 5DV9A 4ZHQF 2O2IA 1VL0A 3LYHA 1UMCA 1KI1A 1VFPA 1HK7A 2W00A 2ORVA 2WSLA 3FRIA 5EXEA 1E18A 1LVHA 3SSAA 4F4CA 3UM9A 4OMFG 1DGQA 1YT5A 1ZD5A 2ZI3A 5I7OA 1LGYA 1XU7A 2PU5A 2WIBA 1CR4A 4BX0A 1ES9A 1NW5A 4TT8A 4BNDA 5AJHA 1XQWA 4PLTA 4EDFA 3GP3A 3QYFA 3TPFA 3JASB 3SYMA 1SUAA 4RK5A 1E6EA 2GKSA 4XOIA 1XCBA 4B83A 3UTDA 2H7XA 2Y1DA 5HX7A 2WA1A 3Q2KA 2SKCA 3PHCA 3TQQA 1E7QA 2O2ZA 2N47A 2ZVJA 1W5FA 1XR3A 1O95A 2VHZA 4LMPA 3QUSA 1P74A 2CSUA 4QATA 1DWPA 3EVZA 4K87A 4TGLA 1UFVA 2H8GA 2VH1A 1JV2B 3GMSA 2Q4DA 3HSYA 3H1GA 2BEVA 2PH1A 2E4AA 3EWSA 1H6BA 4BZQA 1O89A 5L40A 2JGLA 1PZXA 4KVAA 1P7VA 3GB9A 1FYWA 3EQ7A 3MWEA 3N7TA 3NJ8A 1JS1X 2X0KA 2XBLA 1Z0JA 2GCPA 4M55A 5K05A 2XQKA 3HVHA 1MB3A 1G8GA 1KFCB 4QEDA 2F3QA 4XFJA 4EO7A 2EV9A 2XVAA 2WVAA 2Z04A 5TPWA 1EJ0A 1WSWA 3R7WA 4PHGA 1QFYA 3RYFA 2VDJA 1CQJB 2BGGA 2WE7A 1X1DA 3ZJTA 3DFFA 2JBHA 5G2OA 3NEPX 4J6EA 2HX1A 1Q15A 4Y7DA 1J2TA 3KBOA 4CIAA 5L3QB 3CZMA 2OLJA 2H0AA 2X5KO 1YQXA 5K3DA 3GLIA 3CH6A 3IYLW 3OTWA 4CXMA 2GK7A 2CDNA 1GU1A 2ONJA 3OWOA 1R6UA 1J1UA 3KK0A 4MJLA 4G84A 4LW8A 1E2GA 1KU0A 4REQB 1X7HA 5KVQA 4F4DA 3IB6A 3ADOA 4ZYUA 1IBRA 3D3JA 3IQWA 4FKZA 3AZOA 1XZMA 1LBSA 4M2LA 3IAUA 1IVYA 2J07A 2NPOA 4NV3A 3A6FA 3KYDB 1IBSA 2DTXA 2C3MA 5CPFA 1SCUB 3TRDA 5IAOA 1BU8A 3JW8A 5KAPA 4WLEA 2RHHA 3P20A 4NENA 3G0CA 1RC8A 5TMEA 5FOUA 3ZWCA 1W87A 2MDTA 4EHHA 2VYND 1WO8A 2VJAA 2C99A 3QPBA 1EUDA 2OGUA 4FD3A 4PGFA 3RSQA 4N54A 2GM9A 2Y0EA 2V97A 4GE0A 4JT8A 4LZNA 4TTTS 5K1ZA 3U9SA 4QYSA 3DT6A 3LZDA 2KLBA 2CNWD 4TV8F 3C3XA 1GL3A 2F1OA 3O47A 3LS2A 2BOVA 3J80A 2ZJ8A 3FCOA 3OQMA 3QELA 1SNYA 5EZ5A 4CBVA 2W6MA 3A4LA 2ATIA 1RWWA 3ZJVA 3GRKA 4GGPA 4BPRA 4P5DA 1BX3A 4INOA 5DM70 1UBEA 2H08A 3PTAA 1FZQA 1HE8B 2ZTSA 2RD2A 1OI4A 3HYNA 4EATA 3EQ6A 3DZKA 3RTAA 1JVBA 3EAQA 4ZGGA 3EX7C 4IDPA 1P18A 2UXDB 3HE3A 3P2IA 3OWXA 4Y2RA 2HSZA 2VP0A 3PC7A 4PYQA 1XXLA 3UWOA 1QP8A 2VATA 3F5FA 3JQAA 4F1WA 2XB2A 5J58A 3U13A 2JI6A 8LDHA 1B41A 3PGLA 2CE2X 2YOHA 1PR4A 3Q8XB 4AKGA 3R3WA 2PCLA 2XY4A 3GRAA 3O4FA 2HJGA 2GCGA 2ZBVA 3T7AA 4JI7B 4MQ6A 4QM6A 3WB2A 1XVAA 5DM1A 4OHYA 2VAXA 1GCAA 1QAOA 5EJ9A 5FLXA 3LJKA 2QOEA 5GGXA 4OI2A 3ASYA 3HV2A 3KDSE 1WDMA 3WNDA 1HYBA 2B7BA 2BDEA 4EY7A 4UHEA 2VA9A 3LGSA 3PI7A 1NQWA 3K0HA 3LPLA 3FPBA 1Z6PA 4KO4S 4QVGA 4FYPA 1CRQA 1NTOA 1XMPA 2EG5A 3HG7A 4XWGA 2Y1FA 2IIBA 4EVSA 1CKEA 2XSZA 2V0GA 5JCPA 5TPZA 3DE3X 3ANNA 4QBIA 1R64A 5DCYA 4CQLA 3HXLA 4BO9A 4EHNA 5DCLA 2UYQA 3G8BA 2XZDA 4R2JA 3PHJA 3VSCA 5IFLA 2J5XA 1FYEA 1YD7A 2Q3CA 1DC3A 1T5TA 4N3CA 4IQ0A 4Q9AA 3A11A 5D1NA 3W77A 4RLFA 1Z8HA 3ELBA 5LNK1 4TS4A 3DE1X 2DRIA 3IHKA 1O6ZA 1CT9A 2J0UA 2IQIA 4UD6A 4YO8A 5DBOA 1MEEA 3WFZA 2VT3A 1NAIA 1ZIYA 3WNVA 2BGUA 4ENRA 1E5TA 1S6YA 1V2GA 1DBIA 2FWNA 5DMHA 5TQJA 1XPOA 1EDOA 1KMMA 3HCOA 3HWSA 1IVSA 3MK31 5AM4A 6LDHA 1JMVA 4TXJA 1IMOA 2JFYA 3QFTA 3F0TA 1G8YA 3S1AA 4QRDA 2WWFA 1EFCA 3DYBA 1PN3A 1Y8RA 4NV0A 2VSQA 1UOQA 2V0CA 3OX3A 4JMLA 3ZWOA 1EXVA 1RJ9A 3UTCA 1FXUA 1QHGA 2J8ZA 4B3IA 4CODB 4F6RA 4KN6A 1OKKD 4IWYA 4J2HA 5EUCA 1PBNA 3UMFA 3VNAA 1SJ9A 1JHUA 3IIKA 1F2TA 4X7PA 3IRUA 4B7UA 3ZX4A 1PIWA 3H99A 3HBLA 3MMNA 5LZ8A 4CLHA 1YFKA 5AKKA 3TR6A 4NCBA 5F2EA 3O3NB 2W98A 3KZMA 3WK6A 4YV2A 1PQUA 1R0ZA 1UZAA 4ANFA 4N7BA 5ALRA 1MR3F 3HN7A 1HRKA 2NT3A 4G81A 5ER9A 4ER0A 3PQDA 1KZ1A 3WKDA 1QG6A 3AETB 1XALA 3PFKA 3IKLA 4QQ8A 1RMYA 1RJGA 5B4UA 3VTAA 3U1VA 4JMPA 1IN1A 5KHLB 1G6OA 1SQ0A 3C0KA 4W9NC 1JPJA 5AI6A 3UBMA 1IL0A 2JANA 2QG6A 1E58A 2YFKA 2JHAA 2XVXA 1JX6A 1ULTA 3UVEA 1UJBA 2RBGA 2R44A 5TQ2B 4CIWA 2NG1A 4U6NA 3U3MA 5GZ1A 2IXBA 2IY7A 3RI3A 3BWCA 3GUCA 4Q47A 4OHZA 3HCFA 3TRFA 4EAQA 2DR2A 1H9BA 2KS6A 2GEKA 3M83A 3FPFA 4DBLE 3EJ6A 2AB0A 4LIPD 5EXPA 1YKGA 4DCSA 4UEKA 4UAUA 5CHEA 5KI6A 3GC6A 4JR1A 5DCWA 2LCIA 5K4GA 4N01A 2RI1A 1BOOA 2R5NA 1T8YA 5LP6F 1YDFA 4JITA 2EJBA 2D3TA 3IVAA 3E48A 4JJ4A 5BNZA 1LJUA 4YMHA 4JV5B 5REQB 1LTQA 3L8GA 2HDNB 3NORA 2OQ2A 1QUEA 1VHWA 4I0WB 1CZHA 1DRWA 4MARA 1LI4A 4XB6B 5ILQA 2P27A 1NP6A 3F2IA 5BN1A 3VPHA 1PR6A 2PKRA 4C4XA 3OM9A 2ZVPX 4LHZA 5TMDA 4PWZA 4AMYA 4ITRC 2WE8A 5HTOA 4OYRA 1Z0KA 2Z5VA 3DM9B 4IMJB 4KLAA 1G42A 5KJEA 5BVGB 5CIYA 3WAKA 2MU1A 4UBKA 3HU5A 3BHJA 1LRKA 3O7WA 3JRNA 4LKOA 2QIOA 5CT6A 5EUQB 4LVOA 2MIIA 1XVVA 3D7RA 4UMVA 2WNSA 3TLGA 4AKSA 3NBYC 1ZL0A 5AKXA 1N25A 4YUZA 4YUXA 4FDMA 1CR1A 5TDHA 5M7EA 4IUCS 1XQ1A 2N9UA 1JQJC 1N6HA 3FF1A 2HF2A 3JQCA 3LY7A 1H2EA 1U8ZA 3QA3E 4H27A 4OP3A 2RARA 3R3HA 1WOMA 4S0ZA 1FFWA 2WJIA 2UVDA 2ZIAA 3QKSA 4KFUA 3ICPA 4X85A 4WCVA 5EMLA 5MHTA 4FGWA 1J97A 2QS9A 3E61A 4BLRA 1NVKA 1AQJA 4EYKA 4F3RA 3I30X 3RIXA 4YQFA 3M49A 3WNZA 3R74A 3RRYA 4KKVA 3TZBA 3Q87B 4AU1A 2AKYA 1S4QA 1EP3B 2WWWA 3Q15C 4JNCA 2OV1A 1K63A 3DXXA 4C5BA 1B8NA 1RM4A 5TVKA 2HBRA 1PR1A 1WE2A 3WBBA 2YXEA 2WAXA 2WM2A 3FDXA 3U49A 4EY8A 2IUYA 4OU4A 2Y76A 2RC5A 3PNVA 2BR4A 4K0KB 3EIHA 4KO1S 4HX5A 5JAUA 1VE5A 1NC3A 3DLPX 4ZEXA 5L7YA 5I3CA 4GOJA 4LJLA 3T4UA 1H3NA 1A50B 4BVFA 5KYYB 2QMYA 4DR3B 1ESEA 2EZ9A 1SXHA 1J90A 1MO6A 1X8LA 2NSHA 4OYYA 1XCGB 4OQLA 2QKYA 1G98A 1C7FA 1FP4B 2RGAA 4L78A 4K05A 2JHPA 3DLAA 3LT0A 1XD2B 4JB2A 1XMOB 2IYNA 2IYEA 4HEHA 3KHSA 4JXKA 4U7PB 1X2EA 4NOLA 2ABWA 4Q12A 5DOZA 2JFQA 4A0GA 3GLUA 3TXAA 3EVGA 3NTOA 3V1MA 1BAPA 1IJEA 1Y81A 4U7TB 2JK0A 4HUTA 1EX7A 1Y89A 4PIMA 4YRBA 4YMTA 1HDEA 4TWAA 4UAGA 1VLMA 4I1UA 4EJFA 1KI6A 1WDLA 1TU3A 5EE3A 2W2NA 3N2GA 2HY7A 3WYNA 3HV0A 1T36B 3MLAA 2Q62A 1N1MA 2OR3A 4CE6A 3R7SA 5JWRA 3OZIA 1R5BA 2UZ3A 3WWZA 1JFTA 4A27A 2FZCA 4KXQA 3HU3A 4IGEA 3FWYA 1OASA 5C4MA 4AKHA 5DHUA 3T6KA 1ANKA 3D1JA 3G1UA 4J1QA 1T2EA 3ZD9A 2FRDC 1TCUA 3OQ6A 4YMGA 1VGQA 3EQ8A 2WPDD 1IHXA 3IDSA 3FUUA 1QOQB 1DC6A 1I2AA 4Y9SA 2H3EA 1A77A 2H52A 2ODAA 3DEJA 4KBFA 4ZVTA 3GGGA 4BXOB 2PLAA 3FFXA 5FLEX 4ALNA 1RXYA 1QIFA 2CMKA 2GN6A 1J0AA 2PGAA 3R0IA 3RT9A 2BFMA 3KR9A 5KYXB 3TNYA 4MQ4A 4EL5A 1TVKB 4TZKA 2Z09A 3TCKA 4DCOA 4IDFA 2AR7A 3RWOA 2HRZA 4H77A 1M6VB 1ILEA 2OLKA 1HLGA 1UT6A 2B6NA 4PZYA 2GXAA 1M33A 1DLJA 3ACBA 2DZDA 2FSGA 5SZIA 1JR3A 1Q7BA 1HNWB 1VJ1A 2ECPA 3A1WA 4EL0A 3E9QA 1TEHA 5CVEA 4ZOBA 2FVXA 2R7AA 1Z18A 1THGA 3H2HA 1TAUA 1QHFA 1SOAA 3BSWA 5IVPA 3SN6A 3JAMA 3L01A 1UXKA 2H4JA 4PCUA 1TVCA 1RWNA 4HAWA 5JFOA 1CQWA 4AXXA 4WPGA 4WNAA 3HL4A 5B1DA 1JDZA 4PQEA 4W1QA 4DABA 3RSCA 2PZBA 1U8AA 3O31A 3L0IB 2W6CX 3AKCA 1L7RA 2YMMA 1GAJA 1Z4LA 2ZSKA 4MYSA 1GSOA 1GT91 4WZAB 4UXHA 2ZUTA 2R1UA 4P82A 1QFSA 4OHOA 4QG7A 2NO4A 2HK9A 2P3OA 3L7OA 3EOBI 5KNBH 2XAUA 1A8HA 3RF7A 3SC4A 5DTRA 2XUPA 4PWYA 4YJGB 1MZVA 2V96A 3F6EX 1KETA 4KQFA 4L7VA 5D85A 1K7FB 3ADPA 1ZBDA 3SMVA 5BORA 2ZRNA 3QXCA 2GKOA 4BRSA 1VL6A 2RGYA 2YHIA 2IEDA 2CV1A 1PJSA 1BTOA 2ZR0A 2ZSEA 1K8XB 1Y1LA 1A9OA 2DJIA 1PQPA 3GH1A 2VZ0A 3OZGA 1K2VN 3AONB 4U6SA 3ZXXA 1SCNE 3F74A 5LXTB 1ONBA 1Z0UA 2V59A 4DNFA 3BJZA 1J23A 1X9IA 4EB3A 1ZGCA 2HKIA 3HU1A 2VPQA 3UH1A 1Y8QA 4HLQB 4R2HA 3VU0A 5I9NA 4M0FA 4EBBA 3GLFA 3GBSA 1QP4A 2UYOA 3HL0A 3E5RA 2EJWA 2E48A 3DL2A 3U16A 2NV2B 4GZMA 1SA0B 5C3UA 3WTCA 1Q7RA 4Z1OA 1LB1B 4I5EA 4XIFA 5JSYA 3R77A 1JEAA 5ARBA 3BQNB 3UHOA 4RZUA 2B0JA 2VCHA 4QUHA 5LZ9A 4I19A 3AEUB 3TTYA 3R7FA 2BMJA 3IJEB 1DO8A 1N6RA 2Q7XA 3M6FA 5EAIA 4Q0MA 5FNVB 2SKDA 2H4WA 3MELA 3WRWA 2OCKA 5FDFA 1AKVA 4K1XA 3WGMA 4B4KA 1NV8A 4QAQA 5EP2A 3IOBA 4LK2A 4GOXA 3ZHOA 2ZDQA 4KBYA 4WOPA 4AMZA 4EY4A 3MRVA 4HFNA 1N32B 1ZCZA 4CM9A 2ZKIA 3FYTA 1DP4A 1YU9A 3KR1A 1JLMA 3OFSA 3ZYZA 3OP4A 4ONEA 2JRCA 4EGCB 4MRNA 7GPBA 3KB2A 4IKOA 1ZD1A 2FN9A 4I14A 5AVWA 2E4UA 3T41A 3E4DA 2A8YA 3FVTA 4PQYA 5B5SA 1EM8A 4X20B 4FNAA 1JHAA 2ZWIA 5REQA 3MWDA 1UC9A 1I3OA 3CEPB 1EFPA 2EL7A 2W4QA 4GXQA 2X8JB 4QOGA 5C18A 4JYCA 4GBMA 4MI3A 4CM9D 2V7BA 4FGSA 4PR3A 1QLJA 2G28A 4KX5A 3WV4A 3L07A 4E14A 3F67A 3EIUA 4GRDA 1I3KA 2G5GX 1Y1QA 1NHGA 3OOSA 4G4IA 4Q19A 2BGKA 1FDWA 2VRWA 2Y67A 3WGKA 1RWQA 4ZQGA 3V2UA 4F12A 5CFZA 1ISMA 1WQ4A 3JPWA 1G6Q1 2BY4A 1M2JA 1BEEA 4DW8A 4FBLA 1SC9A 1RWPA 4EA9A 2XCTB 2A57A 2W2QA 1OX5A 2PKCA 1OD6A 5ECDA 2PV0A 3Q1LA 4FW9A 3QE2A 1MUUA 4KWCA 1LPAB 1M6NA 3KQQA 2B94A 3Q7RA 4QTUB 3WIDA 5AW8A 5JU6A 2HWWA 2EP5A 3L7MA 1AQIA 4Z99A 1VPWA 4I4TB 3HNOA 3DZ8A 3OEHD 3UK2A 4IJMA 1BS1A 2EHJA 3HQ4O 2XW6A 3WSVA 4RKYA 3GNLA 1WSDA 3LQKA 1W2WB 3RSGA 2Z6UA 3LVQE 4X1KA 2A30A 4QO8A 5SZJA 1BVHA 1WB5A 1E0JA 2PRYA 3A1FA 3H9CA 3P26A 4N12A 1CG6A 3RFUA 4UVIA 5F2NA 1SVNA 3KFXA 3U31A 3HEAA 2NM0A 2R7NA 3DTVA 1WOYA 2Q3DA 4KXLA 3A9CA 5IBCA 5A9RA 3FNRA 4JB3A 1OTYA 3NT2A 1CZRA 4OSOA 3OIDA 1C9JA 3UJAA 3M4XA 3IH5A 1Q0HA 1KI2A 2Q4RA 1TEXA 2XX3A 3VR4D 3ERCA 1ZCBA 3EW9A 3L49A 4TXMA 3BREA 1Z5WA 4ABYA 3A27A 1AMUA 3CRZA 1SQ6A 4TYMA 3T3MB 3OD1A 2JBAB 4AK9A 1SBNE 2A58A 2VRNA 3D3WB 4GKJB 4J9VA 4LNAA 4B3RB 1P1JA 1Q7CA 4XQ0A 4HAZA 4A4DA 1G9SA 1N2XA 3A14A 4AY3A 1H5UA 4U2CA 2PMCA 4LY0A 4RVSA 4B5LA 3IR6A 2AFHB 4EGAA 1U9IC 4X1KB 1QVAA 1V5GA 2QYSA 2YZMA 4JQSA 3BFKA 3FMPB 5JG7A 3F9IA 5EGSA 4C0HA 1K6JA 1O03A 2IH4A 1GCIA 1GGKA 5IJXA 3A4VA 3LXUX 2NNWB 1N5KA 4HNRA 1D1PA 3EGVA 3QPAA 4MQ5A 4UJ5A 4GWKA 5FOQA 3T3OA 2Y77A 3IULA 1WKVA 5EZSA 3NIWA 2PXCA 1XTJA 4MKFA 5AESA 4UUNA 2IEZA 3AJ9A 3PCTA 2ZW9A 1LCIA 3AZQA 5EKUA 3U6BA 2EERA 2D13A 2YZ2A 4GP7A 4CPDA 3FIJA 4LZAA 3GUYA 2VSXA 3N2IA 5CBPA 2Q2VA 4WGFA 4XQGA 2EFDB 2Q3MA 5NULA 1YH3A 1XXHB 3UICA 4BQOA 5GONA 2KBFA 1KO1A 3DZGA 1W96A 1GZ5A 3O91A 1E1RD 2DUWA 2OBBA 2ZTHA 1DWOA 1JFLA 3NXKA 4XARA 2JAPA 5BSTA 3DDZX 3ENKA 2OD7A 2R96A 2WUWE 1LPSA 4Q05A 4RA6A 3ZNNA 4JYBA 4JJ7A 1I30A 1EFHA 3SS9X 2XXAB 5GJVC 2PUBA 3AR7A 2VCEA 3M6XA 1SVUA 2YNMC 1O8BA 1KNXA 4M76B 1V4VA 3D4PA 1P5HA 1KRWA 4ZO4A 6REQB 5JI3E 1VOTA 2EQBA 5IMBA 1IAQA 1C8VB 4DLVA 3VI4B 2PX6A 1V1MB 1VCIA 4KQMA 4JSTA 2SNIE 4N3NA 2J3KA 2GEDA 3MIZA 1HDCA 4J0GA 4W9MC 4AY2A 4BVEA 2BMFA 1T2FA 2I2AA 3CY6A 4PW0A 4ZVVA 4C01A 4LCJA 2PZ8A 2Z8YM 3QLVA 3ROTA 1U8UA 3H0EA 4G85A 2LZ0A 3K71B 4P92A 1W2HA 1XP5A 4X5OA 5LOVB 1Y1PA 5JTUA 5C51B 4BBPA 1E1MA 2E9SA 4BGDA 5IBQA 2CLKB 2X13A 1N6OA 4BRUA 1KJZA 1L5WA 2X9GA 3LUJA 1G20B 4YXWA 4DYVA 4KRFA 1G0OA 1JHZA 2OWDA 3FOFC 4ENUA 4CG2A 2CVOA 3JZIA 2ZBFA 2I29A 3SQNA 4NOMA 5LFAA 3DCYA 2PM8A 1RRGA 2C4KA 4DMHA 1D4FA 3DTNA 4ZYXA 1DZIA 4CGZA 1PKEA 4X6XA 4OQDA 1T5BA 3RODA 4Y9TA 2D00A 1NMYA 1O4VA 2BHNA 2P9ZA 3FLBA 4FZJA 3RK1A 1P1IA 3IT2A 4I5GA 4DVGA 4I1SA 5LKAA 5BURA 4ENWA 5CITA 4DGSA 5BW4A 2DOKA 2P5UA 5F7XA 3ZBPA 3F4KA 3A31A 3RB8A 5CLQA 3KYBA 1U2SA 1AHNA 2G6BA 3GGCA 4JUCA 4GM0A 4QYIB 3QFCA 4B3MB 3X2EA 2WQ7A 5L3SA 4HQKA 1QXSA 4BX9A 1MNQA 3MOSA 4LJ5A 4B71A 1N8KA 4Q3KA 1PNVA 3NHLA 1N5IA 2HSWA 3AOEA 1NMXA 4HNTA 3TXYA 1WZ2A 1II8A 5AW9A 4PG8A 1RXVA 1W73A 4FZVA 4ER6A 2J0QA 3FTEA 2C94A 2DFPA 2Q5EA 2H59A 1RHUA 3AYXB 3CMMA 1A7UA 2LWIA 1SG6A 2EVWX 1QBGA 1LBIA 2DFNA 3SEFA 4BWFB 4O0MA 4HV4A 4IEFB 3DCNA 3H3FA 1FDTA 3FAKA 4G5FA 4G9BA 3G7UA 4UMEA 3V33A 3ZE7A 4YQYA 4AW9A 1US8A 1SUIA 2HL6A 1U7HA 3ICCA 2NU8B 2YWHA 4PSAA 2VOEA 1CC1S 1DPGA 1NQOA 2B3TA 4UBJA 4F7DA 2QX8A 2W4MA 1OIXA 4FYVA 4A1OA 2WD7B 4M86A 4DQVA 4HMQA 1E1DA 1SVWA 2F2TA 4QOEA 3FZQA 4IV5A 4KUGA 4RACA 1ORRA 4IM7A 5T8KC 1E9SA 4LZWA 4R1LA 1JIUA 3AXTA 2QGZA 2F62A 1ZIXA 1E6WA 3VR2D 4DLRA 3FNHA 1I1NA 1AKUA 1JA1A 2PH3A 2ZQYA 4YAKA 5K09A 4AM8A 5HP4A 3S2GA 4F85A 2ZE6A 4X6YA 2ZTLA 4J6FA 3JCZA 3AI1A 1RXIA 1HXHA 1LQ2A 5HS6A 5FA6A 3IXMA 2JG3A 1YR9A 1F48A 1XSEA 2R3SA 3L0PA 1Z0IA 3OPMA 3DA8A 3OTGA 4O1IA 4F1JA 4TVSA 1ZW6A 2DHRA 4MWGA 4E2WA 4B45A 2YVKA 3I72A 4WZ6A 4OX9B 1NULA 3N2LA 4NYMQ 2C2OA 3ES9A 3NOXA 3TJMA 4UVGA 1JMYA 3VYRB 5KTRA 3SZ3A 2O06A 3C6YA 3E9EA 4PYJA 1UEIA 4PZLA 3T9BA 5KNDA 1S9HA 2DBQA 3DP9A 4RTOA 5DGTA 2A5LA 2ZT6A 2QUHA 2CYBA 1HRDA 1FX1A 4TWZA 3AC0A 3G9ZA 4PTZA 4PLYA 4YCAA 3TJRA 3N8IA 3G5AA 2CLIB 3D8NA 4KH0A 4QDUA 4DJEC 5IAJA 1QHHA 4AZ3A 5IT4A 3J81k 4F9EA 4M9XA 4Y98A 3E1KA 2AOUB 1XDGA 3ETJA 5C0OE 121PA 2OAEA 3T5AA 3C43A 1CDEA 1XV5A 3BG5A 4FILA 4UEOA 3R5JA 1RAGA 1MG5A 3HXTA 4G1EB 2PWYA 4GGMX 4MB0A 4NCJA 3U3KA 2J46A 4E5DA 5IS2A 2OGTA 5AVTA 2BP7B 1ZHOA 1KEPA 1Q1AA 1Y1TA 1I5RA 2HPZA 4QT0A 5ALYA 3SC2A 3NHJA 1OH7A 1PJ8A 4KYUA 1F0YA 1Y82A 1GZVA 5K3FA 3ONNA 2IPXA 5GM1A 1BVYF 1G8FA 3IR5A 3LVBA 1Z2NX 221PA 2QTWB 2DP4E 2ORIA 1SUEA 3A26A 3QBDA 5DE3A 2DEUA 3ZBQA 2BKLA 4LDZA 1N5JA 1PJ2A 1TQ2A 2ZSHA 5ALUA 4D92A 5C81A 3OPXA 2IWRA 2GN2A 2NMVA 3PF9A 3OIGA 3OQOA 4H1UA 3WGZA 3BB3A 2EBHX 1JNXX 2Z4TA 3VISA 1OB5A 1QS0A 5JE8A 3P45A 2VHEA 2W6ZA 2JGRA 1G8AA 2G1JA 3QHQA 4BYMA 2H1FA 4QUBA 2BGRA 1XHLA 2X4IA 4L16A 2DUMA 4H6PA 1DCFA 1TNDA 3QY9A 4DMGA 1DQSA 4LZPA 5MFZA 2BI4A 3ZY2A 1GNRA 4O2AB 4KR7A 1XYVA 3L1IA 3RIEA 4FTWA 2N3ZA 3KKEA 2R8XA 2WZDA 4E88A 1YMVA 2D5BA 2GCNA 4YJFB 2ZI5A 3LPNA 5KQGA 4XXHA 3RVOA 4AQYB 5IU6A 1A88A 2MJLA 1Z83A 1MDBA 5AKEA 5AIAA 2XYPA 3EZ6A 2XYRA 1JU3A 1Q83A 1UOEA 4OHCA 1YZKA 5FBWB 2IHUA 4NFSA 3S99A 4NQZA 2J45A 2LGJA 2AFRA 2PT5A 4R81A 3V32A 3OG9A 1WMFA 3M9WA 4IP0A 4KWHA 1NNUA 1ZM9A 3P0JA 5EESA 3ZGLA 3NKLA 3ZVNA 3OE4A 1ISSA 2BEUB 1V95A 3M2PA 3OO1A 3L6UA 2BHRA 2XEDA 3KVYA 2IHVA 4MYRA 1A27A 4UPEA 3ZC3A 4DRZA 3UUWA 4U5QA 4LTDA 2V6FA 1HY3A 1U3CA 2ASVA 2I2CA 2R1VB 3H2GA 5HMMA 1OIVA 3MTAA 4ALIA 1YWGO 4B9EA 4D56A 1WXFA 5ED4A 1QOZA 2AJ8A 1QHNA 2BCJQ 4P31A 1GDTA 4MUAA 2CUKA 2HGSA 5SY6A 2VHWA 1NXWA 4WBNB 1BSVA 2JB9A 1NONA 3QFSA 3ECCA 3H5RA 3IVRA 3W5JA 4YFVA 4YCNA 3JQPA 3IHLA 2JLAA 1YC2A 5IJ0B 1Y3HA 1GA6A 3A4TA 2R8RA 3SEAA 1XA4A 5D84A 4DG8A 5CEFA 5DNVA 4M87A 3EN0A 3QTBA 4ETWA 3HJCA 4G5YA 5E0KB 2PFSA 1TJNA 1ZIOA 3NHBA 4PAMA 4PZ9A 5T4HA 4NFHA 4AS2A 5AFSA 1PQWA 1RJEA 1GUZA 2AMJA 3NWEA 4P4TA 3I1FA 4GMHA 1KORA 4IVNA 5KWEA 4XWOA 2BT4A 1J0EA 2WI8A 4RHYA 5DZSA 4E09A 3OTQA 2C9MA 1E32A 1GVHA 1DL5A 4O2BA 1EG7A 1M2WA 4FQ8A 1BEZA 2GH1A 3NVMB 1XAGA 1F3LA 3ZWAA 3DB2A 2OBXA 2DX7A 3O9ZA 1SN7A 5HKKD 1BXZA 2B1JA 1W49A 3K1AB 2ZT8A 4IFEA 3NOVA 1X9GA 4Y1RB 1T0BA 3GCDA 2G5PA 5JVDB 3HSSA 3UQYS 2ERYA 4IDEA 3KKOA 4CM4A 4LF8B 1JE1A 1JAXA 1G8JA 1KNQA 1M2KA 5FTLA 5B3JC 3SBEA 1HLDA 2IEAA 1TC1A 1ADBA 1MAWA 3OQIA 1L8QA 2A3RA 4W9RA 3S40A 4CM6A 1E9DA 1F0NA 1KOFA 3KQPA 4DPLA 3WGIA 4NSNA 2FPKA 3DCIA 4WK4B 2AKAB 2BFAA 1RHKA 3H2YA 3L4EA 5ALMA 1BHSA 2XTZA 3P4UA 2WR8A 3BSSA 3PFGA 2ZAMA 4MW7A 1TKCA 2Z3VA 3JZDA 3FDIA 3O4JA 4HPWA 4UU7A 5KQRA 4KFSA 3F5SA 4DMUB 4BO3A 2GPBA 4EHIA 4R41A 2A5YB 4YP0A 1BWRA 3KHUA 5EWMB 1O57A 3W9UA 1G18A 2B4QA 5KYYA 3MJSA 3TMKA 3B6JA 1N77A 4EGJA 1RHJA 5DHSA 5CNMA 4L28A 3SHQA 4QQRA 4FOLA 2I34A 4YC7A 1P0CA 1ZUNA 2FP4B 2ZIVB 3HR7A 1EWVA 2BM8A 2WWXA 3B70A 2CLEB 3KZOA 3PEVA 4CCSA 1QH0A 4MV3A 3VHXB 4ZYYA 1EGHA 1QMPA 2ZVDA 3CEHA 3DVSX 3E27A 4M3NA 4PG5A 1JL3A 5CFQA 1XZDA 4O3MA 2J0EA 2V3WA 3OAAD 3IIIA 1CYEA 4RD4A 1PR9A 1QSGA 3HCWA 3S28A 1SU4A 5KX5A 1IY8A 4CLRB 1KEUA 4BX3A 3JQGB 1KMIY 4X93A 3SHOA 1XA0A 4R40A 2DG2A 1O0CA 4A91A 1JWAB 2XZOA 1DC7A 2IL1A 3LBFA 1CNMA 4L4SA 1JSXA 4UQOA 5CR9A 1HNNA 1S96A 1USUA 1MABB 2UV8A 3ISVA 4FOSA 1X7XB 4MWDA 2G4VA 4P5PA 3REGA 1HPLA 1HLFA 1Y9ZA 2GF9A 4HFJA 4DLLA 2VEDA 4M1QA 3NBFA 5DBFA 4DLYA 2AFIA 2ODWA 1NQAO 4HI0E 4CTNA 4QGSA 3GLHB 3JWJA 1V96A 3B20A 3MJ4A 4M1KA 1MEJA 2BELA 3ZGNA 1WBBA 5BR8B 1Z34A 4GX0A 4R1MA 2VIIA 1E99A 3DMGA 3E2MA 3K2EA 4DDVA 4EY6A 3HFRA 1Q1QA 2F3SA 4C78A 3DL4A 1DPFA 3O03A 5GJBA 4R7GA 4HO1X 4L57A 1K06A 2PY6A 4ZRNA 1IBLB 4YUYA 1PSWA 2V58A 1ORTA 1F0PA 1YI0A 2R8OA 1I5OA 4E15A 5TPZD 8ATCA 1UBTS 2JFNA 1R18A 4QFMA 4EMUA 4FONA 5TGZA 2JGEA 3LC0A 1DX4A 4NAVA 2B37A 1J7JA 4RVCA 1YQGA 1C1HA 3R0VA 1MG0A 2MMGA 2C7BA 2FZKA 3AR3A 4B47A 2Q0SA 4M6WB 4L22A 2EZUA 3ZJYA 2CMHA 4EKYA 1Y4AE 1J0XO 3ACCA 4TMVA 4E11A 2WWGA 3QMMA 4R8SA 5A05A 3R8CA 4GQAA 1EBFA 3ILVA 4B76A 2Q0XA 4QDJA 2TSYB 4M37A 1TPZA 3R40A 4IH1A 3D6NB 1K5PA 4MV8A 3ZI4A 1VCNA 4M88A 4J0EA 1JSZA 2QVCA 1PL0A 3PDIA 3OPYB 5KYVA 2YCLA 4AJEA 1VDMA 4F9GA 1VKOA 2GAOA 5ALDA 3IQGX 5DNUA 4PC2A 2R4TA 1C3OB 1U98A 2B1IA 4UPDA 4GOKA 5FPPA 4YAFA 3R5FA 4N5IX 5D7NA 4CZ2A 1NE2A 1WMSA 3OLYA 1DNPA 4PCAA 1JYSA 2QYHA 1HE2A 1OPXA 1BWQA 2CXPA 2NU7A 2D1YA 2R62A 3U4IA 5BSVA 5BUSA 1JDBB 1D0IA 4BATA 4KIUA 4EARA 3AUUA 1TD1A 4IJVA 4GKBA 1A9RA 3KHTA 2PT9A 2E1RA 4DVJA 3EODA 3M1YA 4MB6A 3L06A 5J63A 3A28A 3HGQA 1BFDA 2GAAA 1JHXA 1WBJB 3B5IA 4MLZA 4KSBA 4Z0HO 3ZK7A 4MW6A 3ZIAD 2NAFA 1SCIA 2I6UA 4U2GA 1JKJB 3DUFB 3LQ4A 4TTRA 1XP8A 1EJ6A 1ZOIA 3Q40A 1C9MA 1ZKMA 2Q6VA 4OH7A 1N0WA 4EF5A 1MO5A 1XRRA 2PLNA 5LR6A 1Z2AA 3QJGA 3IDAA 4IHJB 2Z2XA 1Q0SA 3E2PA 4UULA 4A23A 4F6RB 2OT3B 2G9VA 2NVWA 4UATA 4DR2B 4HATA 4PLPA 4V0NA 4GYKA 5EHNA 4EY3A 4F4JA 3V4OA 1I7DA 5KTMA 3RJMA 1MAAA 4HDSB 2DBRA 3A4NA 5SV2A 2Q4BA 2WKQA 2JJ8A 4Q4AB 2E89A 5H5JA 4JR0A 2AYXA 2GJ8A 4X92A 4EHLA 2F59A 2RCYA 5E6UA 3NHRA 2L17A 4I3FA 3THOA 3FNBA 5I4BA 2WIAA 2QX4A 3P32A 2QPAA 1EIWA 3DZJA 3Q7PA 4OQNA 3Q1KA 3LQ1A 1TA9A 3H42B 2QN3A 3V42A 5FOVA 4GMDA 3QRWA 4CDNA 1ABFA 3CKMA 4N6NA 5DLYA 1DT5A 2AQHA 3LWBA 4R9SA 3GQVA 4D9IA 3WLNA 1QGUB 3HUFA 4J91A 3SF8B 1O3YA 4FCCA 1CB7A 1YRBA 4GWLA 2XCLA 3M6LA 2RB4A 3Q6IA 4EI2A 2Q3FA 1NQUA 3HA5A 3I5UA 3T52A 2GYUA 2K87A 4BE7B 3Q9LA 4U2KA 1N1GA 1N3IA 4C6HA 1Q50A 4OQ4A 2WFZA 3PUZA 4LF9B 3MSCA 3W4JA 5E6SA 4Y7CA 2K7FA 3VUEA 1EBUA 4K46A 4GS5A 1W7AA 3BDAA 1BN6A 1FNDA 2GA9A 3N86A 4RFLA 2FLKA 2P2ZA 4H31A 4FFDA 5BWMA 3WI7A 2IOFK 3H8VA 2VJPA 2CHVA 3K0EA 3ZGVA 3YASA 3QLUC 3RU3A 4DJFC 1P3Y1 4ENPA 2GCIA 2X19A 1PK9A 3UGKA 5B6IA 3MMZA 2OY0A 4QODA 1I1QB 1TAQA 2JLUA