3CMA3

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cma300
1N8R4 1K734 1VQ53 1Q7Y4 3CC73 1NJI4 1YJ93 1Q864 1VQ83 1KD14 3CPW2 1YIJ3 1K9M4 1YJW3 3CCS3 3CCV3 2QEX3 1M904 1VQ73 1VQ43 1VQN3 1Q824 2OTL3 1VQM3 3CMA3 1QVG2 1KC84 3G4S3 1KQS2 2OTJ3 1Q814 3CME3 3CCR3 1JJ22 3OW22 3CXC2 3CD63 3I553 1QVF2 3G6E3 2QA43 1YHQ3 3G713 1S723 1M1K4 3CCL3 1VQL3 1VQK3 3CCM3 1W2B2 3CCQ3 1VQ93 3CCJ3 1YJN3 3CCU3 1K8A4 1VQ63 1YI23 3CC43 1VQO3 3CC23 3I563 1YIT3 1VQP3 3CCE3
chains in the Genus database with same CATH superfamily
1BNIA 1T3BA 2H0IA 1OACA 3CPW2 2W9PA 1BRGA 1M9GA 3EX9A 1B2XA 4RNTA 1GY5A 1VQ73 5IG0A 2GEXA 1BSCA 1D6YA 3UJMA 4WYKA 1A67A 2LYXA 2C10A 4K1UA 3HK4A 3EBYA 3WA3A 5AIGA 5D81A 1UGIA 1UUVB 2HMMB 1JKGA 2W2CA 3ZFZA 4R1KA 3KIIA 2QA43 1WNHA 3EF8A 1BNJA 1YHQ3 2L1SA 1IVWA 3LMLA 5LC6A 4EV2A 7STDA 2IY2A 3X3XA 4EV5A 2C4BA 3G0KA 3URPA 3IMAB 1STFI 2E2UA 1N5HA 2KAAA 3SOAA 3B8LA 2RSXA 4FCJA 4N3VA 1GYBA 1HZ1A 2YFIB 1FGMA 5G2GA 1T2HA 1Q864 2F98A 1Q42A 4KFFA 8RNTA 1BNFA 4HM1B 2UUGC 2C11A 3DGOA 3MSOA 4OK0A 1F8NA 1Q824 3MG2A 1IVVA 4L8OA 4Q53A 2BO9B 6GSPA 3RNTA 2F86B 3UL5A 1ROVA 1RGFA 1FUWA 2BHMA 1RGEA 2FGTA 1AV4A 4XB5A 2IYJA 3DM8A 3T8UA 1FA3A 2P0XA 4HVNA 4O02B 2HMOB 3CNXA 3ZG5A 3SYUA 1JB4A 3GWRA 1QJGA 5CXOA 1JZOA 3ECFA 3EN8A 4FMDA 1FGRA 3OWYA 1CEWI 4LSOA 3UNLA 1DVCA 3HIGA 3LXUX 3UB1A 3NXJA 2W0QA 5IW9A 1GSPA 3CD63 3MKIA 4NREA 1Q7HA 1W2ZA 2BU4A 5EEOA 4K90B 3FH1A 3N8BA 4HM7B 5IG5A 4NHFA 7GSPA 2AAEA 2IMJA 1PU4A 3RGRA 1GMRA 4O3VA 5FW5A 1RSNA 4I5QA 3Q90A 4HM6B 3CCR3 4MMXB 1TJDA 1RGLA 1RTUA 1I3IA 3EQQB 1B20A 4AKYA 2IUJA 1OF5B 2OQEA 1TFOA 1G96A 1PY3A 3NBRA 1W2B2 1BSEA 1VQ93 1O7WB 1I8VA 2JDIH 2XSHB 3PYJA 1A90A 1O7GB 3BB9A 2V1LA 3GZRA 3K0ZA 1JRQA 4HOHA 4L7KA 3ZG0A 4N6MA 5CF1A 4J5GA 3ALAA 1FW7A 1OF5A 3BNDA 4TX4A 1QAKA 1BSDA 3FKAA 4KZ1A 3FG1A 1YJW3 3F7XA 2RBIA 4K1VA 4DKIA 1B3SA 1TP6A 2P38A 2P0MA 4FMCA 4X2HA 4XDVA 1JBTA 2Z6BA 4EW5A 3I553 2CKFB 3A5EA 3O8YA 4OUQA 1STDA 3G713 1FGQA 1Y4KA 2IA7A 4IPBA 3X40A 1IT7A 3LOYA 4CCVA 4BL3A 1FUSA 1W6CA 3DGNA 1GOVA 1MOLA 4GHOA 2KF3A 1SQWA 1SPUA 1AY7A 3LTCA 2IUKA 1ZS7A 1LRAA 1N5PA 4OVMA 3S28A 1IQ8A 1GD3A 1V57A 4HM8B 1Q7Y4 3HI7A 2SARA 4XBTA 4HM4B 3AGOA 4J8TA 4WFOA 1G0TA 3NHXA 2WGOA 1IV7A 1V58A 2B24B 3NM7A 2O3OA 4BL2A 2WOFA 1MWUA 5KP1A 2XGLA 2W6JH 3D79A 1MNLA 3AGNA 5AEWB 2RNTA 1SJWA 2CWTA 3KE7A 4R9KA 1HKXA 3CNMA 1BSAA 2CWUA 3EBTA 4I4KA 1OGXA 1N9JA 3F9SA 3HIIA 1VQL3 1O7NB 4XDWA 1IQXA 4QWTA 2F5WA 2LQVA 4PEJA 1IK3A 3NM2A 2CX1A 5JPPA 3F7SA 1NB3I 2ZA4A 1K734 5A0OB 3DZLA 4U13A 9RNTA 3J7Yd 3KSPA 3GZYB 2B1XB 4MJDA 2F4YA 5G1LA 1JKGB 3EJVA 4FCMA 2E2TA 1BRHA 1TRPA 5M18A 1I2GA 1PFPA 1W6GA 2YX9A 3Q1CA 3DGYA 3JUPA 4WHAA 1AVLA 1BANA 1MWTA 3EN1B 1BRNL 3WOEB 3E99A 2Y74A 4CPKA 1KWIA 1M1XB 1K28A 1RMSA 4KT3B 3G8ZA 4ZM8A 3SEDA 4ORLA 3F14A 2HMNB 1JB5A 1JB2A 1OHPA 1IVUA 1GMPA 1JZDA 2CFLA 2M7OA 3Q2PA 2OOVA 5EQLA 5BXQA 1AVKA 3OXAA 1EG9B 1AQZA 1BNEA 1B2SA 3FZWA 3PCRA 1A2KA 4GSPA 1RRHA 1JV2B 5EVHA 5AEUB 4HZ9B 1TFKA 2YFJB 3MWZA 3LTAA 2CFGA 1YVBI 1B2MA 1W5ZA 1EQKA 4GL6A 1GMQA 1HYFA 1TTOA 3N54B 1LOYA 3S5CA 1WMPA 2F5MA 1YIJ3 1D6ZA 2XH9A 4LGQA 3X42A 3CCS3 3K5TA 3DY5A 3NV0A 3FGYA 5JBSA 1I2FA 4L8PA 5I97A 2PNCA 1LVNA 3AMOB 1MGWA 1O7PB 2YFLB 4BTWA 1IYYA 2KXGA 3G4S3 1Q814 1RDSA 3GZXB 2CH9A 3HZPA 4HM2B 1FYSA 5G1KA 1NNVA 1RHLA 3AMOA 4HKVB 1K8A4 1BGSA 1RRLA 5M19A 1KSIA 4RNYA 1FGTA 2UX0A 1S723 1JJ22 1IU7A 1PYLA 3PS8A 1BNRA 1S5AA 1VQ83 4H61A 1VQQA 2CW9A 1KD14 4HYZA 1K41A 1AR0A 4RBNA 2XR8B 3K9MC 1B2UA 1W7CA 2CFDA 4FR9A 3X3YA 1E3RA 2RFRA 2Z7AA 1LNHA 3IJEB 1BU4A 5DREA 3V92A 3GRDA 1WMNA 5ELUA 3NX0A 4J9AA 3SOYA 3WOFB 1W6YA 4CJNA 1FGOA 3RGAA 3MG3A 3T0UA 1IVXA 1NDOB 1QVF2 2FXTA 3FSDA 1TUHA 4N6OB 3H51A 3WR2A 3CCQ3 5JPUA 5GSPA 2BIRA 1G02A 1A2PA 3LT8A 1UUWB 4MMZB 3OV4A 3DGLA 5AYSC 1O7MB 3OWSA 1JN5B 1OGZA 3K7CA 4O2HA 3OWUA 3FG4A 1BRSA 1ULIB 2XEPA 8CHOA 3NQZA 2GXFA 3NUVA 6RNTA 3WHOA 1W01A 1NU3A 3KSED 5HOHA 1YGEA 2W56B 1US1A 1JN5A 3GAXA 4HBRA 1BUQA 5IG3A 3K63A 1BOXA 5AIFA 3A76A 2BMQB 1CYUA 2GU1A 2L4VA 3STDA 1W4NA 4HM0B 1R4YA 1VZZA 7RNTA 1RGGA 3DMCA 1DYUA 3SXXA 3LYGA 2W56A 2KF4A 3CU3A 5HGRA 1OHOA 3EC9A 3Q3FA 4HAAA 4BIRA 4XM4A 1VQP3 1BRIA 1HU9A 1RCKA 3DUKA 2CHCA 3MPHA 1QMAA 2KCDA 1NJI4 5D83A 3BNBA 2HOHA 2MF7A 1N8QA 1B27A 1ZX2A 1K9M4 2ZL8A 4GB5A 1WTHA 4FMBA 1BNGA 5LC7A 2QEX3 5STDA 2CFKA 1A2VA 1GY7A 3KCHA 1EKMA 1JNQA 1BAOA 2BT3A 3MHEA 5KP3A 1ZO2A 1OPYA 3CXC2 2GBXB 3JUMA 2KF5A 2HMKB 1DMQA 5CK6A 1DVDA 4XBXA 3JUQA 1M1K4 1YNVX 1RN1A 2K3DA 2D42A 3F40A 5IERA 4H3UA 5AYRB 3BIRA 2ZHXB 3LZAA 2BMRB 4RZMA 3ER7A 1VQO3 2H0HA 3I563 3B4OA 2HMLB 2HMJB 3HOHA 5DRVA 1X1UA 4JF8A 1UW1A 2W04A 4EYCA 1LXEA 1JBSA 3WA2X 1RKYA 4R4KA 2MC8A 1YGWA 1V74A 1SIHA 5IEPA 1VQN3 2GEYA 1DE3A 3PXMA 3S27A 1BNSA 1C54A 2CG1A 1QVG2 1LOXA 3HX8A 2GU3A 4KFEA 2KRTA 3PCSA 6STDA 3OW22 2W03A 3LTBA 2F56A 3CCL3 1SARA 1YJN3 4R9LA 1R4CA 1Z1SA 1OCVA 1QALA 3H3HA 3KFQC 3NV0B 1UCIA 4WP5A 1I3FA 1RLSA 5TGNA 3CCE3 2CC3A 3M8CA 3MG1A 3CPOA 5IENA 1VQ43 1N9EA 5AI1A 1ASKA 1RJOA 3DH2A 2Z76A 3NBBA 2OTL3 1BVIA 2O9UX 2Q07A 3U97A 1OUNA 2RCDA 3F8HA 1KQS2 3G16A 3DGMA 4G1MB 3SX1A 3SVAA 2K54A 3AHWA 3U1WA 3FF0A 2ML5A 4HZBB 4N6NB 2P09A 1T2IA 2D1WA 2K0MA 3ROBA 3OX9A 4STDA 2QGUA 2H0GA 3X41A 4MMYB 2OCTA 2KF6A 4J5KA 3AHSA 3CCJ3 1GS3A 1VQ63 1YI23 1LNIA 1UDII 2CFWA 1X1WA 3CC23 1IQYA 1YVSA 3JUOA 4N6TA 5ELJA 1TRQA 1N8R4 2F99A 1OHSA 3CC73 3BU4A 2XGNA 1I2EA 3FCSB 2R4IA 1U8CB 4LZIA 2SBLA 3FG3A 3T8NA 4AKZA 1I70A 2XFTA 1RGKA 3GZBA 3L0RA 3QRDA 3CMA3 2JQ5A 1KC84 3QK9A 3WODG 1OH0A 4FMAA 3KN4A 1O7HB 1NO3A 1RGAA 2OQEC 3V99A 1IT8A 3D5IA 1VQK3 4IT7A 2E2VA 2UGIA 4BTYA 1SIIA 4FCZA 2GSPA 3GSPA 3CC43 1CQSA 3S67A 1JBRA 4EBGA 3WDGB 1QAFA 4LYLB 1VQ53 1UGHI 4MEIA 1DMNA 1ULJB 4XBYA 1Q40B 2Z77A 1I0VA 1E97A 1MWRA 2CK3H 4HM3B 3CCV3 3FLJA 4BU4A 5BIRA 4ILFA 5M1AA 1B2ZA 1MWSA 2Y73A 1E3VA 4O8SA 3X3ZA 1I0XA 4HJLB 4KVHA 1ROAA 1Q40A 1RNBA 1GY6A 1UCJA 3KZTA 3EHCA 5AIIA 3G6E3 1EA2A 2CIUA 2BNGA 1UCKA 5D82A 2WO0A 1T5YA 1UI8A 2AADA 3LT9A 2XSOB 1L5GB 1X1XA 3CCM3 1J2BA 5CF2A 5KP4A 1BRJA 3SLUA 1Q9EA 3LTDA 2XF3A 1RCLA 2XRXB 2OWPA 3EB8A 2I9WA 4K61A 5BVBA 2RGQA 4LMIA 1RGCA 1X1YA 1U5OA 3JVCA 1NWWA 1C7HA 1M904 1WQLB 3VGNA 2FNQA 2PZVA 4N6LA 1IV9A 1B21A 4X2OA 1LOWA 3RDEA 3VF1A 1DMMA 3MYTA 3JUNA 4N6V0 4EXRA 1CH0A 2CG0A 2WOHA 3B4PA 1CYVA 5FGOA 2XFSA 3PGBA 5RNTA 3CME3 2OTJ3 1BUJA 1W00A 1RN7A 3UL6A 4RNZA 1BSBA 1DETA 5CLKA 1ZGXA 2WGQA 3NQYA 1BIRA 1D6UA 3V98A 2R41A 5IEOA 5BU4A 4CDLA 3D3LA 1GOYA 3BLZA 4NPBA 1GOUA 1EUIC 1TIJA 3KKGA 5AIHA 4R80A 1IDPA 4LEHA 1YJ93 2J8XB 2CX0A 2ZDJA 3IPTA 3N9HA 1W02A 4AEQA 2P05A 1RNTA 1LQMB 1RGHA 3TDGA 1WMOA 2W9QA 2INXA 3DXOA 3WMDA 2CWVA 4JRFA 1RN4A 1TU5A 3BNEA 1VQM3 1LOVA 4BTXA 1UCLA 1EEJA 2BMOB 3B7CA 1MGRA 2ML6A 3LH4A 4KFDA 1FUTA 2OOVC 4WWUC 3PZWA 3VSYA 4EC6A 1UUGB 3F8XA 3NBJA 1ISKA 3EE1A 5IF6A 2A15A 4N6UA 3D5GA 3CCU3 1NB5I 1UI7A 1FZUA 1LQGC 2QIYA 3FF2A 3D9RA 1BRKA 2STDA 3D4AA 1GD4A 3BNCA 4HM5B 4IIAA 4WYKB 3S29A 5IG4A 1YIT3 3I0YA 2GBWB
chains in the Genus database with same CATH topology
1OACA 3CPW2 2W9PA 1M9GA 3EX9A 1GY5A 1VQ73 5IG0A 2GEXA 1D6YA 3UJMA 4WYKA 1A67A 2LYXA 2C10A 4K1UA 3HK4A 3EBYA 3WA3A 5AIGA 5D81A 1UUVB 2W2CA 2HMMB 1JKGA 4R1KA 3KIIA 2QA43 1WNHA 3EF8A 1YHQ3 1IVWA 3LMLA 5LC6A 4EV2A 7STDA 3X3XA 4EV5A 3G0KA 3IMAB 1STFI 2E2UA 1N5HA 3SOAA 3B8LA 2RSXA 4FCJA 4N3VA 1GYBA 2YFIB 1FGMA 5G2GA 1Q864 2F98A 1Q42A 4KFFA 4HM1B 2C11A 3DGOA 3MSOA 4OK0A 1F8NA 1Q824 3MG2A 1IVVA 4L8OA 4Q53A 2BO9B 3UL5A 2F86B 1ROVA 1FUWA 2BHMA 2FGTA 1AV4A 4XB5A 3DM8A 3T8UA 1FA3A 2P0XA 4HVNA 4O02B 2HMOB 3CNXA 1JB4A 3GWRA 1QJGA 5CXOA 3ECFA 4FMDA 3EN8A 4LSOA 1FGRA 3OWYA 1CEWI 3UNLA 1DVCA 3HIGA 3LXUX 3UB1A 3NXJA 2W0QA 5IW9A 3CD63 3MKIA 4NREA 1W2ZA 5EEOA 4K90B 3FH1A 3N8BA 4HM7B 5IG5A 4NHFA 2IMJA 1PU4A 3RGRA 4O3VA 5FW5A 3Q90A 4HM6B 3CCR3 4MMXB 3EQQB 4AKYA 2IUJA 1OF5B 2OQEA 1TFOA 1G96A 3NBRA 1W2B2 1VQ93 1O7WB 2JDIH 2XSHB 3PYJA 1A90A 1O7GB 3BB9A 2V1LA 3GZRA 3K0ZA 1JRQA 4L7KA 4N6MA 5CF1A 3ALAA 1OF5A 3BNDA 4TX4A 1QAKA 3FKAA 4KZ1A 3FG1A 1YJW3 3F7XA 4K1VA 1TP6A 2P0MA 2P38A 4FMCA 4X2HA 4XDVA 2Z6BA 3I553 2CKFB 3O8YA 4OUQA 1STDA 3G713 1FGQA 1Y4KA 2IA7A 4IPBA 3X40A 1IT7A 3LOYA 4CCVA 1W6CA 3DGNA 1MOLA 1SQWA 1SPUA 3LTCA 2IUKA 1N5PA 4OVMA 3S28A 1IQ8A 1GD3A 4HM8B 1Q7Y4 3HI7A 4XBTA 4HM4B 4J8TA 4WFOA 3NHXA 2WGOA 1IV7A 2B24B 3NM7A 2O3OA 2WOFA 5KP1A 2XGLA 2W6JH 1MNLA 5AEWB 1SJWA 2CWTA 3KE7A 4R9KA 1HKXA 3CNMA 3EBTA 2CWUA 4I4KA 1OGXA 1N9JA 3F9SA 3HIIA 1VQL3 1O7NB 4XDWA 1IQXA 4QWTA 2LQVA 4PEJA 1IK3A 3NM2A 5JPPA 3F7SA 1NB3I 1K734 5A0OB 3DZLA 4U13A 3J7Yd 3KSPA 3GZYB 2B1XB 4MJDA 1JKGB 3EJVA 4FCMA 2E2TA 1PFPA 2YX9A 1W6GA 3Q1CA 4WHAA 3JUPA 1AVLA 3EN1B 3WOEB 3E99A 2Y74A 1KWIA 1M1XB 1K28A 3G8ZA 4ZM8A 3SEDA 4ORLA 3F14A 2HMNB 1JB5A 1JB2A 1OHPA 1IVUA 2CFLA 2M7OA 3Q2PA 2OOVA 5BXQA 5EQLA 1AVKA 3OXAA 1EG9B 3FZWA 3PCRA 1A2KA 1RRHA 1JV2B 5EVHA 5AEUB 4HZ9B 1TFKA 2YFJB 3MWZA 3LTAA 2CFGA 1YVBI 1W5ZA 1EQKA 4GL6A 3N54B 3S5CA 1WMPA 1YIJ3 1D6ZA 2XH9A 4LGQA 3X42A 3CCS3 3K5TA 3DY5A 3NV0A 3FGYA 5JBSA 4L8PA 5I97A 2PNCA 1LVNA 3AMOB 1O7PB 2YFLB 4BTWA 2KXGA 3G4S3 1Q814 3GZXB 2CH9A 3HZPA 4HM2B 3AMOA 1K8A4 4HKVB 1RRLA 1KSIA 4RNYA 1FGTA 2UX0A 1JJ22 1IU7A 3PS8A 1S5AA 1VQ83 4H61A 2CW9A 1KD14 4HYZA 1K41A 1AR0A 4RBNA 2XR8B 3K9MC 4FR9A 1W7CA 2CFDA 3X3YA 1E3RA 2RFRA 2Z7AA 1LNHA 3IJEB 5DREA 3V92A 3GRDA 1WMNA 5ELUA 3NX0A 4J9AA 3SOYA 3WOFB 1W6YA 1QVF2 1FGOA 3RGAA 3MG3A 3T0UA 1IVXA 1NDOB 2FXTA 3FSDA 1TUHA 4N6OB 3H51A 3CCQ3 5JPUA 3LT8A 1UUWB 4MMZB 3OV4A 3DGLA 5AYSC 1O7MB 3OWSA 1JN5B 1OGZA 3K7CA 4O2HA 3OWUA 3FG4A 1ULIB 2XEPA 8CHOA 3NQZA 2GXFA 3NUVA 1W01A 1NU3A 3KSED 1YGEA 2W56B 1US1A 1JN5A 3GAXA 4HBRA 1BUQA 5IG3A 3K63A 5AIFA 3A76A 2BMQB 1CYUA 2GU1A 2L4VA 3STDA 1W4NA 4HM0B 1VZZA 3DMCA 3SXXA 1DYUA 3LYGA 2W56A 3CU3A 5HGRA 1OHOA 3EC9A 4XM4A 1VQP3 1HU9A 3DUKA 2CHCA 3MPHA 1QMAA 2KCDA 1NJI4 5D83A 3BNBA 2MF7A 1N8QA 1ZX2A 1K9M4 2ZL8A 4GB5A 1WTHA 4FMBA 2QEX3 5LC7A 5STDA 2CFKA 1A2VA 1GY7A 1EKMA 1JNQA 2BT3A 3MHEA 5KP3A 1ZO2A 1OPYA 3CXC2 2GBXB 3JUMA 2HMKB 1DMQA 5CK6A 1DVDA 4XBXA 3JUQA 1M1K4 2D42A 3F40A 5IERA 4H3UA 5AYRB 3LZAA 2BMRB 4RZMA 3ER7A 1VQO3 3I563 3B4OA 2HMLB 2HMJB 5DRVA 4JF8A 1UW1A 2W04A 4EYCA 1LXEA 3WA2X 1RKYA 4R4KA 2MC8A 1V74A 1SIHA 5IEPA 1VQN3 2GEYA 3PXMA 3S27A 2CG1A 1QVG2 1LOXA 3HX8A 2GU3A 4KFEA 2KRTA 3PCSA 6STDA 3OW22 2W03A 3LTBA 3CCL3 1YJN3 4R9LA 1R4CA 1Z1SA 1OCVA 1QALA 3H3HA 3KFQC 3NV0B 4WP5A 5TGNA 3CCE3 2CC3A 3M8CA 3MG1A 3CPOA 5IENA 1VQ43 1N9EA 5AI1A 1ASKA 1RJOA 2OTL3 2Z76A 3NBBA 2O9UX 2Q07A 3U97A 1OUNA 2RCDA 3F8HA 1KQS2 3G16A 3DGMA 4G1MB 3SX1A 3SVAA 2K54A 3U1WA 3FF0A 2ML5A 4HZBB 4N6NB 2P09A 2K0MA 2D1WA 3ROBA 1S723 3OX9A 4STDA 2QGUA 3X41A 4MMYB 2OCTA 3CCJ3 1GS3A 1VQ63 1YI23 2CFWA 3CC23 1IQYA 3JUOA 4N6TA 5ELJA 1N8R4 2F99A 1OHSA 3CC73 2XGNA 3FCSB 2R4IA 1U8CB 4LZIA 2SBLA 3FG3A 3T8NA 4AKZA 2XFTA 3GZBA 3L0RA 3QRDA 3CMA3 2JQ5A 1KC84 3QK9A 1OH0A 4FMAA 3KN4A 1O7HB 1NO3A 2OQEC 3V99A 1IT8A 1VQK3 4IT7A 2E2VA 4BTYA 1SIIA 4FCZA 3CC43 1CQSA 3S67A 4EBGA 3WDGB 1QAFA 1VQ53 4MEIA 1DMNA 1ULJB 4XBYA 1Q40B 2Z77A 1E97A 2CK3H 4HM3B 3CCV3 3FLJA 2Y73A 1E3VA 4O8SA 3X3ZA 4HJLB 4KVHA 1ROAA 1Q40A 1GY6A 3KZTA 3EHCA 5AIIA 3G6E3 1EA2A 2CIUA 2BNGA 5D82A 2WO0A 1T5YA 1UI8A 3LT9A 3CCM3 2XSOB 1L5GB 1J2BA 5CF2A 5KP4A 3SLUA 3LTDA 2XF3A 2XRXB 3EB8A 2OWPA 4K61A 2I9WA 5BVBA 2RGQA 4LMIA 1U5OA 3JVCA 1NWWA 1C7HA 1M904 1WQLB 3VGNA 2FNQA 2PZVA 4N6LA 1IV9A 4X2OA 3VF1A 3RDEA 1DMMA 3MYTA 3JUNA 4N6V0 4EXRA 2CG0A 2WOHA 3B4PA 1CYVA 5FGOA 2XFSA 3PGBA 3CME3 2OTJ3 1W00A 1RN7A 3UL6A 4RNZA 5CLKA 2WGQA 3NQYA 1D6UA 3V98A 5IEOA 4CDLA 3D3LA 3BLZA 1TIJA 3KKGA 5AIHA 4R80A 1IDPA 4LEHA 1YJ93 2ZDJA 3IPTA 3N9HA 1W02A 4AEQA 2P05A 3TDGA 1WMOA 2W9QA 2INXA 3DXOA 3WMDA 2CWVA 4JRFA 1VQM3 1TU5A 3BNEA 4BTXA 2BMOB 3B7CA 2ML6A 3LH4A 4KFDA 2OOVC 4WWUC 3PZWA 3VSYA 4EC6A 3F8XA 3NBJA 1ISKA 3EE1A 5IF6A 2A15A 4N6UA 3CCU3 1NB5I 1UI7A 2QIYA 3FF2A 3WODG 3D9RA 2STDA 4HM5B 3S29A 1GD4A 3BNCA 4IIAA 4WYKB 5IG4A 1YIT3 3I0YA 2GBWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 4;  1K73 4;  1VQ5 3;  1Q7Y 4;  3CC7 3;  1NJI 4;  1YJ9 3;  1Q86 4;  1VQ8 3;  1KD1 4;  3CPW 2;  1YIJ 3;  1K9M 4;  1YJW 3;  3CCS 3;  3CCV 3;  2QEX 3;  1M90 4;  1VQ7 3;  1VQ4 3;  1VQN 3;  1Q82 4;  2OTL 3;  1VQM 3;  3CMA 3;  1QVG 2;  1KC8 4;  3G4S 3;  1KQS 2;  2OTJ 3;  1Q81 4;  3CME 3;  3CCR 3;  1JJ2 2;  3OW2 2;  3CXC 2;  3CD6 3;  3I55 3;  1QVF 2;  3G6E 3;  2QA4 3;  1YHQ 3;  3G71 3;  1S72 3;  1M1K 4;  3CCL 3;  1VQL 3;  1VQK 3;  3CCM 3;  1W2B 2;  3CCQ 3;  1VQ9 3;  3CCJ 3;  1YJN 3;  3CCU 3;  1K8A 4;  1VQ6 3;  1YI2 3;  3CC4 3;  1VQO 3;  3CC2 3;  3I56 3;  1YIT 3;  1VQP 3;  3CCE 3; 
#chains in the Genus database with same CATH topology
 1BNI A;  1T3B A;  2H0I A;  1OAC A;  3CPW 2;  2W9P A;  1BRG A;  1M9G A;  3EX9 A;  1B2X A;  4RNT A;  1GY5 A;  1VQ7 3;  5IG0 A;  2GEX A;  1BSC A;  1D6Y A;  3UJM A;  4WYK A;  1A67 A;  2LYX A;  2C10 A;  4K1U A;  3HK4 A;  3EBY A;  3WA3 A;  5AIG A;  5D81 A;  1UGI A;  1UUV B;  2HMM B;  1JKG A;  2W2C A;  3ZFZ A;  4R1K A;  3KII A;  2QA4 3;  1WNH A;  3EF8 A;  1BNJ A;  1YHQ 3;  2L1S A;  1IVW A;  3LML A;  5LC6 A;  4EV2 A;  7STD A;  2IY2 A;  3X3X A;  4EV5 A;  2C4B A;  3G0K A;  3URP A;  3IMA B;  1STF I;  2E2U A;  1N5H A;  2KAA A;  3SOA A;  3B8L A;  2RSX A;  4FCJ A;  4N3V A;  1GYB A;  1HZ1 A;  2YFI B;  1FGM A;  5G2G A;  1T2H A;  1Q86 4;  2F98 A;  1Q42 A;  4KFF A;  8RNT A;  1BNF A;  4HM1 B;  2UUG C;  2C11 A;  3DGO A;  3MSO A;  4OK0 A;  1F8N A;  1Q82 4;  3MG2 A;  1IVV A;  4L8O A;  4Q53 A;  2BO9 B;  6GSP A;  3RNT A;  2F86 B;  3UL5 A;  1ROV A;  1RGF A;  1FUW A;  2BHM A;  1RGE A;  2FGT A;  1AV4 A;  4XB5 A;  2IYJ A;  3DM8 A;  3T8U A;  1FA3 A;  2P0X A;  4HVN A;  4O02 B;  2HMO B;  3CNX A;  3ZG5 A;  3SYU A;  1JB4 A;  3GWR A;  1QJG A;  5CXO A;  1JZO A;  3ECF A;  3EN8 A;  4FMD A;  1FGR A;  3OWY A;  1CEW I;  4LSO A;  3UNL A;  1DVC A;  3HIG A;  3LXU X;  3UB1 A;  3NXJ A;  2W0Q A;  5IW9 A;  1GSP A;  3CD6 3;  3MKI A;  4NRE A;  1Q7H A;  1W2Z A;  2BU4 A;  5EEO A;  4K90 B;  3FH1 A;  3N8B A;  4HM7 B;  5IG5 A;  4NHF A;  7GSP A;  2AAE A;  2IMJ A;  1PU4 A;  3RGR A;  1GMR A;  4O3V A;  5FW5 A;  1RSN A;  4I5Q A;  3Q90 A;  4HM6 B;  3CCR 3;  4MMX B;  1TJD A;  1RGL A;  1RTU A;  1I3I A;  3EQQ B;  1B20 A;  4AKY A;  2IUJ A;  1OF5 B;  2OQE A;  1TFO A;  1G96 A;  1PY3 A;  3NBR A;  1W2B 2;  1BSE A;  1VQ9 3;  1O7W B;  1I8V A;  2JDI H;  2XSH B;  3PYJ A;  1A90 A;  1O7G B;  3BB9 A;  2V1L A;  3GZR A;  3K0Z A;  1JRQ A;  4HOH A;  4L7K A;  3ZG0 A;  4N6M A;  5CF1 A;  4J5G A;  3ALA A;  1FW7 A;  1OF5 A;  3BND A;  4TX4 A;  1QAK A;  1BSD A;  3FKA A;  4KZ1 A;  3FG1 A;  1YJW 3;  3F7X A;  2RBI A;  4K1V A;  4DKI A;  1B3S A;  1TP6 A;  2P38 A;  2P0M A;  4FMC A;  4X2H A;  4XDV A;  1JBT A;  2Z6B A;  4EW5 A;  3I55 3;  2CKF B;  3A5E A;  3O8Y A;  4OUQ A;  1STD A;  3G71 3;  1FGQ A;  1Y4K A;  2IA7 A;  4IPB A;  3X40 A;  1IT7 A;  3LOY A;  4CCV A;  4BL3 A;  1FUS A;  1W6C A;  3DGN A;  1GOV A;  1MOL A;  4GHO A;  2KF3 A;  1SQW A;  1SPU A;  1AY7 A;  3LTC A;  2IUK A;  1ZS7 A;  1LRA A;  1N5P A;  4OVM A;  3S28 A;  1IQ8 A;  1GD3 A;  1V57 A;  4HM8 B;  1Q7Y 4;  3HI7 A;  2SAR A;  4XBT A;  4HM4 B;  3AGO A;  4J8T A;  4WFO A;  1G0T A;  3NHX A;  2WGO A;  1IV7 A;  1V58 A;  2B24 B;  3NM7 A;  2O3O A;  4BL2 A;  2WOF A;  1MWU A;  5KP1 A;  2XGL A;  2W6J H;  3D79 A;  1MNL A;  3AGN A;  5AEW B;  2RNT A;  1SJW A;  2CWT A;  3KE7 A;  4R9K A;  1HKX A;  3CNM A;  1BSA A;  2CWU A;  3EBT A;  4I4K A;  1OGX A;  1N9J A;  3F9S A;  3HII A;  1VQL 3;  1O7N B;  4XDW A;  1IQX A;  4QWT A;  2F5W A;  2LQV A;  4PEJ A;  1IK3 A;  3NM2 A;  2CX1 A;  5JPP A;  3F7S A;  1NB3 I;  2ZA4 A;  1K73 4;  5A0O B;  3DZL A;  4U13 A;  9RNT A;  3J7Y d;  3KSP A;  3GZY B;  2B1X B;  4MJD A;  2F4Y A;  5G1L A;  1JKG B;  3EJV A;  4FCM A;  2E2T A;  1BRH A;  1TRP A;  5M18 A;  1I2G A;  1PFP A;  1W6G A;  2YX9 A;  3Q1C A;  3DGY A;  3JUP A;  4WHA A;  1AVL A;  1BAN A;  1MWT A;  3EN1 B;  1BRN L;  3WOE B;  3E99 A;  2Y74 A;  4CPK A;  1KWI A;  1M1X B;  1K28 A;  1RMS A;  4KT3 B;  3G8Z A;  4ZM8 A;  3SED A;  4ORL A;  3F14 A;  2HMN B;  1JB5 A;  1JB2 A;  1OHP A;  1IVU A;  1GMP A;  1JZD A;  2CFL A;  2M7O A;  3Q2P A;  2OOV A;  5EQL A;  5BXQ A;  1AVK A;  3OXA A;  1EG9 B;  1AQZ A;  1BNE A;  1B2S A;  3FZW A;  3PCR A;  1A2K A;  4GSP A;  1RRH A;  1JV2 B;  5EVH A;  5AEU B;  4HZ9 B;  1TFK A;  2YFJ B;  3MWZ A;  3LTA A;  2CFG A;  1YVB I;  1B2M A;  1W5Z A;  1EQK A;  4GL6 A;  1GMQ A;  1HYF A;  1TTO A;  3N54 B;  1LOY A;  3S5C A;  1WMP A;  2F5M A;  1YIJ 3;  1D6Z A;  2XH9 A;  4LGQ A;  3X42 A;  3CCS 3;  3K5T A;  3DY5 A;  3NV0 A;  3FGY A;  5JBS A;  1I2F A;  4L8P A;  5I97 A;  2PNC A;  1LVN A;  3AMO B;  1MGW A;  1O7P B;  2YFL B;  4BTW A;  1IYY A;  2KXG A;  3G4S 3;  1Q81 4;  1RDS A;  3GZX B;  2CH9 A;  3HZP A;  4HM2 B;  1FYS A;  5G1K A;  1NNV A;  1RHL A;  3AMO A;  4HKV B;  1K8A 4;  1BGS A;  1RRL A;  5M19 A;  1KSI A;  4RNY A;  1FGT A;  2UX0 A;  1S72 3;  1JJ2 2;  1IU7 A;  1PYL A;  3PS8 A;  1BNR A;  1S5A A;  1VQ8 3;  4H61 A;  1VQQ A;  2CW9 A;  1KD1 4;  4HYZ A;  1K41 A;  1AR0 A;  4RBN A;  2XR8 B;  3K9M C;  1B2U A;  1W7C A;  2CFD A;  4FR9 A;  3X3Y A;  1E3R A;  2RFR A;  2Z7A A;  1LNH A;  3IJE B;  1BU4 A;  5DRE A;  3V92 A;  3GRD A;  1WMN A;  5ELU A;  3NX0 A;  4J9A A;  3SOY A;  3WOF B;  1W6Y A;  4CJN A;  1FGO A;  3RGA A;  3MG3 A;  3T0U A;  1IVX A;  1NDO B;  1QVF 2;  2FXT A;  3FSD A;  1TUH A;  4N6O B;  3H51 A;  3WR2 A;  3CCQ 3;  5JPU A;  5GSP A;  2BIR A;  1G02 A;  1A2P A;  3LT8 A;  1UUW B;  4MMZ B;  3OV4 A;  3DGL A;  5AYS C;  1O7M B;  3OWS A;  1JN5 B;  1OGZ A;  3K7C A;  4O2H A;  3OWU A;  3FG4 A;  1BRS A;  1ULI B;  2XEP A;  8CHO A;  3NQZ A;  2GXF A;  3NUV A;  6RNT A;  3WHO A;  1W01 A;  1NU3 A;  3KSE D;  5HOH A;  1YGE A;  2W56 B;  1US1 A;  1JN5 A;  3GAX A;  4HBR A;  1BUQ A;  5IG3 A;  3K63 A;  1BOX A;  5AIF A;  3A76 A;  2BMQ B;  1CYU A;  2GU1 A;  2L4V A;  3STD A;  1W4N A;  4HM0 B;  1R4Y A;  1VZZ A;  7RNT A;  1RGG A;  3DMC A;  1DYU A;  3SXX A;  3LYG A;  2W56 A;  2KF4 A;  3CU3 A;  5HGR A;  1OHO A;  3EC9 A;  3Q3F A;  4HAA A;  4BIR A;  4XM4 A;  1VQP 3;  1BRI A;  1HU9 A;  1RCK A;  3DUK A;  2CHC A;  3MPH A;  1QMA A;  2KCD A;  1NJI 4;  5D83 A;  3BNB A;  2HOH A;  2MF7 A;  1N8Q A;  1B27 A;  1ZX2 A;  1K9M 4;  2ZL8 A;  4GB5 A;  1WTH A;  4FMB A;  1BNG A;  5LC7 A;  2QEX 3;  5STD A;  2CFK A;  1A2V A;  1GY7 A;  3KCH A;  1EKM A;  1JNQ A;  1BAO A;  2BT3 A;  3MHE A;  5KP3 A;  1ZO2 A;  1OPY A;  3CXC 2;  2GBX B;  3JUM A;  2KF5 A;  2HMK B;  1DMQ A;  5CK6 A;  1DVD A;  4XBX A;  3JUQ A;  1M1K 4;  1YNV X;  1RN1 A;  2K3D A;  2D42 A;  3F40 A;  5IER A;  4H3U A;  5AYR B;  3BIR A;  2ZHX B;  3LZA A;  2BMR B;  4RZM A;  3ER7 A;  1VQO 3;  2H0H A;  3I56 3;  3B4O A;  2HML B;  2HMJ B;  3HOH A;  5DRV A;  1X1U A;  4JF8 A;  1UW1 A;  2W04 A;  4EYC A;  1LXE A;  1JBS A;  3WA2 X;  1RKY A;  4R4K A;  2MC8 A;  1YGW A;  1V74 A;  1SIH A;  5IEP A;  1VQN 3;  2GEY A;  1DE3 A;  3PXM A;  3S27 A;  1BNS A;  1C54 A;  2CG1 A;  1QVG 2;  1LOX A;  3HX8 A;  2GU3 A;  4KFE A;  2KRT A;  3PCS A;  6STD A;  3OW2 2;  2W03 A;  3LTB A;  2F56 A;  3CCL 3;  1SAR A;  1YJN 3;  4R9L A;  1R4C A;  1Z1S A;  1OCV A;  1QAL A;  3H3H A;  3KFQ C;  3NV0 B;  1UCI A;  4WP5 A;  1I3F A;  1RLS A;  5TGN A;  3CCE 3;  2CC3 A;  3M8C A;  3MG1 A;  3CPO A;  5IEN A;  1VQ4 3;  1N9E A;  5AI1 A;  1ASK A;  1RJO A;  3DH2 A;  2Z76 A;  3NBB A;  2OTL 3;  1BVI A;  2O9U X;  2Q07 A;  3U97 A;  1OUN A;  2RCD A;  3F8H A;  1KQS 2;  3G16 A;  3DGM A;  4G1M B;  3SX1 A;  3SVA A;  2K54 A;  3AHW A;  3U1W A;  3FF0 A;  2ML5 A;  4HZB B;  4N6N B;  2P09 A;  1T2I A;  2D1W A;  2K0M A;  3ROB A;  3OX9 A;  4STD A;  2QGU A;  2H0G A;  3X41 A;  4MMY B;  2OCT A;  2KF6 A;  4J5K A;  3AHS A;  3CCJ 3;  1GS3 A;  1VQ6 3;  1YI2 3;  1LNI A;  1UDI I;  2CFW A;  1X1W A;  3CC2 3;  1IQY A;  1YVS A;  3JUO A;  4N6T A;  5ELJ A;  1TRQ A;  1N8R 4;  2F99 A;  1OHS A;  3CC7 3;  3BU4 A;  2XGN A;  1I2E A;  3FCS B;  2R4I A;  1U8C B;  4LZI A;  2SBL A;  3FG3 A;  3T8N A;  4AKZ A;  1I70 A;  2XFT A;  1RGK A;  3GZB A;  3L0R A;  3QRD A;  3CMA 3;  2JQ5 A;  1KC8 4;  3QK9 A;  3WOD G;  1OH0 A;  4FMA A;  3KN4 A;  1O7H B;  1NO3 A;  1RGA A;  2OQE C;  3V99 A;  1IT8 A;  3D5I A;  1VQK 3;  4IT7 A;  2E2V A;  2UGI A;  4BTY A;  1SII A;  4FCZ A;  2GSP A;  3GSP A;  3CC4 3;  1CQS A;  3S67 A;  1JBR A;  4EBG A;  3WDG B;  1QAF A;  4LYL B;  1VQ5 3;  1UGH I;  4MEI A;  1DMN A;  1ULJ B;  4XBY A;  1Q40 B;  2Z77 A;  1I0V A;  1E97 A;  1MWR A;  2CK3 H;  4HM3 B;  3CCV 3;  3FLJ A;  4BU4 A;  5BIR A;  4ILF A;  5M1A A;  1B2Z A;  1MWS A;  2Y73 A;  1E3V A;  4O8S A;  3X3Z A;  1I0X A;  4HJL B;  4KVH A;  1ROA A;  1Q40 A;  1RNB A;  1GY6 A;  1UCJ A;  3KZT A;  3EHC A;  5AII A;  3G6E 3;  1EA2 A;  2CIU A;  2BNG A;  1UCK A;  5D82 A;  2WO0 A;  1T5Y A;  1UI8 A;  2AAD A;  3LT9 A;  2XSO B;  1L5G B;  1X1X A;  3CCM 3;  1J2B A;  5CF2 A;  5KP4 A;  1BRJ A;  3SLU A;  1Q9E A;  3LTD A;  2XF3 A;  1RCL A;  2XRX B;  2OWP A;  3EB8 A;  2I9W A;  4K61 A;  5BVB A;  2RGQ A;  4LMI A;  1RGC A;  1X1Y A;  1U5O A;  3JVC A;  1NWW A;  1C7H A;  1M90 4;  1WQL B;  3VGN A;  2FNQ A;  2PZV A;  4N6L A;  1IV9 A;  1B21 A;  4X2O A;  1LOW A;  3RDE A;  3VF1 A;  1DMM A;  3MYT A;  3JUN A;  4N6V 0;  4EXR A;  1CH0 A;  2CG0 A;  2WOH A;  3B4P A;  1CYV A;  5FGO A;  2XFS A;  3PGB A;  5RNT A;  3CME 3;  2OTJ 3;  1BUJ A;  1W00 A;  1RN7 A;  3UL6 A;  4RNZ A;  1BSB A;  1DET A;  5CLK A;  1ZGX A;  2WGQ A;  3NQY A;  1BIR A;  1D6U A;  3V98 A;  2R41 A;  5IEO A;  5BU4 A;  4CDL A;  3D3L A;  1GOY A;  3BLZ A;  4NPB A;  1GOU A;  1EUI C;  1TIJ A;  3KKG A;  5AIH A;  4R80 A;  1IDP A;  4LEH A;  1YJ9 3;  2J8X B;  2CX0 A;  2ZDJ A;  3IPT A;  3N9H A;  1W02 A;  4AEQ A;  2P05 A;  1RNT A;  1LQM B;  1RGH A;  3TDG A;  1WMO A;  2W9Q A;  2INX A;  3DXO A;  3WMD A;  2CWV A;  4JRF A;  1RN4 A;  1TU5 A;  3BNE A;  1VQM 3;  1LOV A;  4BTX A;  1UCL A;  1EEJ A;  2BMO B;  3B7C A;  1MGR A;  2ML6 A;  3LH4 A;  4KFD A;  1FUT A;  2OOV C;  4WWU C;  3PZW A;  3VSY A;  4EC6 A;  1UUG B;  3F8X A;  3NBJ A;  1ISK A;  3EE1 A;  5IF6 A;  2A15 A;  4N6U A;  3D5G A;  3CCU 3;  1NB5 I;  1UI7 A;  1FZU A;  1LQG C;  2QIY A;  3FF2 A;  3D9R A;  1BRK A;  2STD A;  3D4A A;  1GD4 A;  3BNC A;  4HM5 B;  4IIA A;  4WYK B;  3S29 A;  5IG4 A;  1YIT 3;  3I0Y A;  2GBW B; 
#chains in the Genus database with same CATH homology
 1OAC A;  3CPW 2;  2W9P A;  1M9G A;  3EX9 A;  1GY5 A;  1VQ7 3;  5IG0 A;  2GEX A;  1D6Y A;  3UJM A;  4WYK A;  1A67 A;  2LYX A;  2C10 A;  4K1U A;  3HK4 A;  3EBY A;  3WA3 A;  5AIG A;  5D81 A;  1UUV B;  2W2C A;  2HMM B;  1JKG A;  4R1K A;  3KII A;  2QA4 3;  1WNH A;  3EF8 A;  1YHQ 3;  1IVW A;  3LML A;  5LC6 A;  4EV2 A;  7STD A;  3X3X A;  4EV5 A;  3G0K A;  3IMA B;  1STF I;  2E2U A;  1N5H A;  3SOA A;  3B8L A;  2RSX A;  4FCJ A;  4N3V A;  1GYB A;  2YFI B;  1FGM A;  5G2G A;  1Q86 4;  2F98 A;  1Q42 A;  4KFF A;  4HM1 B;  2C11 A;  3DGO A;  3MSO A;  4OK0 A;  1F8N A;  1Q82 4;  3MG2 A;  1IVV A;  4L8O A;  4Q53 A;  2BO9 B;  3UL5 A;  2F86 B;  1ROV A;  1FUW A;  2BHM A;  2FGT A;  1AV4 A;  4XB5 A;  3DM8 A;  3T8U A;  1FA3 A;  2P0X A;  4HVN A;  4O02 B;  2HMO B;  3CNX A;  1JB4 A;  3GWR A;  1QJG A;  5CXO A;  3ECF A;  4FMD A;  3EN8 A;  4LSO A;  1FGR A;  3OWY A;  1CEW I;  3UNL A;  1DVC A;  3HIG A;  3LXU X;  3UB1 A;  3NXJ A;  2W0Q A;  5IW9 A;  3CD6 3;  3MKI A;  4NRE A;  1W2Z A;  5EEO A;  4K90 B;  3FH1 A;  3N8B A;  4HM7 B;  5IG5 A;  4NHF A;  2IMJ A;  1PU4 A;  3RGR A;  4O3V A;  5FW5 A;  3Q90 A;  4HM6 B;  3CCR 3;  4MMX B;  3EQQ B;  4AKY A;  2IUJ A;  1OF5 B;  2OQE A;  1TFO A;  1G96 A;  3NBR A;  1W2B 2;  1VQ9 3;  1O7W B;  2JDI H;  2XSH B;  3PYJ A;  1A90 A;  1O7G B;  3BB9 A;  2V1L A;  3GZR A;  3K0Z A;  1JRQ A;  4L7K A;  4N6M A;  5CF1 A;  3ALA A;  1OF5 A;  3BND A;  4TX4 A;  1QAK A;  3FKA A;  4KZ1 A;  3FG1 A;  1YJW 3;  3F7X A;  4K1V A;  1TP6 A;  2P0M A;  2P38 A;  4FMC A;  4X2H A;  4XDV A;  2Z6B A;  3I55 3;  2CKF B;  3O8Y A;  4OUQ A;  1STD A;  3G71 3;  1FGQ A;  1Y4K A;  2IA7 A;  4IPB A;  3X40 A;  1IT7 A;  3LOY A;  4CCV A;  1W6C A;  3DGN A;  1MOL A;  1SQW A;  1SPU A;  3LTC A;  2IUK A;  1N5P A;  4OVM A;  3S28 A;  1IQ8 A;  1GD3 A;  4HM8 B;  1Q7Y 4;  3HI7 A;  4XBT A;  4HM4 B;  4J8T A;  4WFO A;  3NHX A;  2WGO A;  1IV7 A;  2B24 B;  3NM7 A;  2O3O A;  2WOF A;  5KP1 A;  2XGL A;  2W6J H;  1MNL A;  5AEW B;  1SJW A;  2CWT A;  3KE7 A;  4R9K A;  1HKX A;  3CNM A;  3EBT A;  2CWU A;  4I4K A;  1OGX A;  1N9J A;  3F9S A;  3HII A;  1VQL 3;  1O7N B;  4XDW A;  1IQX A;  4QWT A;  2LQV A;  4PEJ A;  1IK3 A;  3NM2 A;  5JPP A;  3F7S A;  1NB3 I;  1K73 4;  5A0O B;  3DZL A;  4U13 A;  3J7Y d;  3KSP A;  3GZY B;  2B1X B;  4MJD A;  1JKG B;  3EJV A;  4FCM A;  2E2T A;  1PFP A;  2YX9 A;  1W6G A;  3Q1C A;  4WHA A;  3JUP A;  1AVL A;  3EN1 B;  3WOE B;  3E99 A;  2Y74 A;  1KWI A;  1M1X B;  1K28 A;  3G8Z A;  4ZM8 A;  3SED A;  4ORL A;  3F14 A;  2HMN B;  1JB5 A;  1JB2 A;  1OHP A;  1IVU A;  2CFL A;  2M7O A;  3Q2P A;  2OOV A;  5BXQ A;  5EQL A;  1AVK A;  3OXA A;  1EG9 B;  3FZW A;  3PCR A;  1A2K A;  1RRH A;  1JV2 B;  5EVH A;  5AEU B;  4HZ9 B;  1TFK A;  2YFJ B;  3MWZ A;  3LTA A;  2CFG A;  1YVB I;  1W5Z A;  1EQK A;  4GL6 A;  3N54 B;  3S5C A;  1WMP A;  1YIJ 3;  1D6Z A;  2XH9 A;  4LGQ A;  3X42 A;  3CCS 3;  3K5T A;  3DY5 A;  3NV0 A;  3FGY A;  5JBS A;  4L8P A;  5I97 A;  2PNC A;  1LVN A;  3AMO B;  1O7P B;  2YFL B;  4BTW A;  2KXG A;  3G4S 3;  1Q81 4;  3GZX B;  2CH9 A;  3HZP A;  4HM2 B;  3AMO A;  1K8A 4;  4HKV B;  1RRL A;  1KSI A;  4RNY A;  1FGT A;  2UX0 A;  1JJ2 2;  1IU7 A;  3PS8 A;  1S5A A;  1VQ8 3;  4H61 A;  2CW9 A;  1KD1 4;  4HYZ A;  1K41 A;  1AR0 A;  4RBN A;  2XR8 B;  3K9M C;  4FR9 A;  1W7C A;  2CFD A;  3X3Y A;  1E3R A;  2RFR A;  2Z7A A;  1LNH A;  3IJE B;  5DRE A;  3V92 A;  3GRD A;  1WMN A;  5ELU A;  3NX0 A;  4J9A A;  3SOY A;  3WOF B;  1W6Y A;  1QVF 2;  1FGO A;  3RGA A;  3MG3 A;  3T0U A;  1IVX A;  1NDO B;  2FXT A;  3FSD A;  1TUH A;  4N6O B;  3H51 A;  3CCQ 3;  5JPU A;  3LT8 A;  1UUW B;  4MMZ B;  3OV4 A;  3DGL A;  5AYS C;  1O7M B;  3OWS A;  1JN5 B;  1OGZ A;  3K7C A;  4O2H A;  3OWU A;  3FG4 A;  1ULI B;  2XEP A;  8CHO A;  3NQZ A;  2GXF A;  3NUV A;  1W01 A;  1NU3 A;  3KSE D;  1YGE A;  2W56 B;  1US1 A;  1JN5 A;  3GAX A;  4HBR A;  1BUQ A;  5IG3 A;  3K63 A;  5AIF A;  3A76 A;  2BMQ B;  1CYU A;  2GU1 A;  2L4V A;  3STD A;  1W4N A;  4HM0 B;  1VZZ A;  3DMC A;  3SXX A;  1DYU A;  3LYG A;  2W56 A;  3CU3 A;  5HGR A;  1OHO A;  3EC9 A;  4XM4 A;  1VQP 3;  1HU9 A;  3DUK A;  2CHC A;  3MPH A;  1QMA A;  2KCD A;  1NJI 4;  5D83 A;  3BNB A;  2MF7 A;  1N8Q A;  1ZX2 A;  1K9M 4;  2ZL8 A;  4GB5 A;  1WTH A;  4FMB A;  2QEX 3;  5LC7 A;  5STD A;  2CFK A;  1A2V A;  1GY7 A;  1EKM A;  1JNQ A;  2BT3 A;  3MHE A;  5KP3 A;  1ZO2 A;  1OPY A;  3CXC 2;  2GBX B;  3JUM A;  2HMK B;  1DMQ A;  5CK6 A;  1DVD A;  4XBX A;  3JUQ A;  1M1K 4;  2D42 A;  3F40 A;  5IER A;  4H3U A;  5AYR B;  3LZA A;  2BMR B;  4RZM A;  3ER7 A;  1VQO 3;  3I56 3;  3B4O A;  2HML B;  2HMJ B;  5DRV A;  4JF8 A;  1UW1 A;  2W04 A;  4EYC A;  1LXE A;  3WA2 X;  1RKY A;  4R4K A;  2MC8 A;  1V74 A;  1SIH A;  5IEP A;  1VQN 3;  2GEY A;  3PXM A;  3S27 A;  2CG1 A;  1QVG 2;  1LOX A;  3HX8 A;  2GU3 A;  4KFE A;  2KRT A;  3PCS A;  6STD A;  3OW2 2;  2W03 A;  3LTB A;  3CCL 3;  1YJN 3;  4R9L A;  1R4C A;  1Z1S A;  1OCV A;  1QAL A;  3H3H A;  3KFQ C;  3NV0 B;  4WP5 A;  5TGN A;  3CCE 3;  2CC3 A;  3M8C A;  3MG1 A;  3CPO A;  5IEN A;  1VQ4 3;  1N9E A;  5AI1 A;  1ASK A;  1RJO A;  2OTL 3;  2Z76 A;  3NBB A;  2O9U X;  2Q07 A;  3U97 A;  1OUN A;  2RCD A;  3F8H A;  1KQS 2;  3G16 A;  3DGM A;  4G1M B;  3SX1 A;  3SVA A;  2K54 A;  3U1W A;  3FF0 A;  2ML5 A;  4HZB B;  4N6N B;  2P09 A;  2K0M A;  2D1W A;  3ROB A;  1S72 3;  3OX9 A;  4STD A;  2QGU A;  3X41 A;  4MMY B;  2OCT A;  3CCJ 3;  1GS3 A;  1VQ6 3;  1YI2 3;  2CFW A;  3CC2 3;  1IQY A;  3JUO A;  4N6T A;  5ELJ A;  1N8R 4;  2F99 A;  1OHS A;  3CC7 3;  2XGN A;  3FCS B;  2R4I A;  1U8C B;  4LZI A;  2SBL A;  3FG3 A;  3T8N A;  4AKZ A;  2XFT A;  3GZB A;  3L0R A;  3QRD A;  3CMA 3;  2JQ5 A;  1KC8 4;  3QK9 A;  1OH0 A;  4FMA A;  3KN4 A;  1O7H B;  1NO3 A;  2OQE C;  3V99 A;  1IT8 A;  1VQK 3;  4IT7 A;  2E2V A;  4BTY A;  1SII A;  4FCZ A;  3CC4 3;  1CQS A;  3S67 A;  4EBG A;  3WDG B;  1QAF A;  1VQ5 3;  4MEI A;  1DMN A;  1ULJ B;  4XBY A;  1Q40 B;  2Z77 A;  1E97 A;  2CK3 H;  4HM3 B;  3CCV 3;  3FLJ A;  2Y73 A;  1E3V A;  4O8S A;  3X3Z A;  4HJL B;  4KVH A;  1ROA A;  1Q40 A;  1GY6 A;  3KZT A;  3EHC A;  5AII A;  3G6E 3;  1EA2 A;  2CIU A;  2BNG A;  5D82 A;  2WO0 A;  1T5Y A;  1UI8 A;  3LT9 A;  3CCM 3;  2XSO B;  1L5G B;  1J2B A;  5CF2 A;  5KP4 A;  3SLU A;  3LTD A;  2XF3 A;  2XRX B;  3EB8 A;  2OWP A;  4K61 A;  2I9W A;  5BVB A;  2RGQ A;  4LMI A;  1U5O A;  3JVC A;  1NWW A;  1C7H A;  1M90 4;  1WQL B;  3VGN A;  2FNQ A;  2PZV A;  4N6L A;  1IV9 A;  4X2O A;  3VF1 A;  3RDE A;  1DMM A;  3MYT A;  3JUN A;  4N6V 0;  4EXR A;  2CG0 A;  2WOH A;  3B4P A;  1CYV A;  5FGO A;  2XFS A;  3PGB A;  3CME 3;  2OTJ 3;  1W00 A;  1RN7 A;  3UL6 A;  4RNZ A;  5CLK A;  2WGQ A;  3NQY A;  1D6U A;  3V98 A;  5IEO A;  4CDL A;  3D3L A;  3BLZ A;  1TIJ A;  3KKG A;  5AIH A;  4R80 A;  1IDP A;  4LEH A;  1YJ9 3;  2ZDJ A;  3IPT A;  3N9H A;  1W02 A;  4AEQ A;  2P05 A;  3TDG A;  1WMO A;  2W9Q A;  2INX A;  3DXO A;  3WMD A;  2CWV A;  4JRF A;  1VQM 3;  1TU5 A;  3BNE A;  4BTX A;  2BMO B;  3B7C A;  2ML6 A;  3LH4 A;  4KFD A;  2OOV C;  4WWU C;  3PZW A;  3VSY A;  4EC6 A;  3F8X A;  3NBJ A;  1ISK A;  3EE1 A;  5IF6 A;  2A15 A;  4N6U A;  3CCU 3;  1NB5 I;  1UI7 A;  2QIY A;  3FF2 A;  3WOD G;  3D9R A;  2STD A;  4HM5 B;  3S29 A;  1GD4 A;  3BNC A;  4IIA A;  4WYK B;  5IG4 A;  1YIT 3;  3I0Y A;  2GBW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...