3CMAE

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cmaE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cmaE01
4WFBE 3G71E 1KC8G 4U67E 4UY8G 1YHQE 2ZJQE 3PIPE 5DM6E 3I55E 1NJIG 2QA4E 3CCLE 2OTLE 4WFAE 1Q86G 3CC7E 3DLLE 1VQME 4WFNE 2OTJE 1M90G 3CC4E 4WCEE 4IO9E 5JVGE 5GAEG 1VQNE 3CCRE 1VQ4E 1K8AG 1VQ8E 3CXCE 2ZJPE 1RL6A 1JJ2E 3OW2E 3J7ZG 5H1SI 5DM7E 3CCUE 3CPWE 2ZJRE 1KQSE 5AN9B 4IOCE 4WF9E 1K73G 1YJWE 5GAHG 5GADG 1VQKE 3CD6E 1KD1G 1QVFE 1YIJE 5MLCH 1VQ7E 1W2BE 4IOAE 3I56E 3CCJE 5JVHE 1QVGE 5GAGG 3G6EE 3CCEE 3CCME 1YITE 3CMAE 1YJNE 1Q81G 1Q82G 1K9MG 3CC2E 3CF5E 2CQLA 1M1KG 3CCSE 3CMEE 1VQ5E 2QEXE 1VQOE 1VQLE 3G4SE 1YJ9E 5HL7E 1Q7YG 3CCVE 1N8RG 1VQ9E 3PIOE 3CCQE 1YI2E 1VQPE 1VQ6E 1S72E
chains in the Genus database with same CATH superfamily
5B10O 2G8CO 2AF5A 4WFBE 3G71E 1KC8G 2I5ZO 4U67E 1S72E 4UY8G 1YHQE 2ZJQE 2I5VO 2FKGA 2OL6O 3PIPE 5DM6E 3I55E 2QA4E 1NJIG 3CCLE 2OTLE 4WFAE 1Q86G 3CC7E 3DLLE 1VQME 4WFNE 3IGEA 2OTJE 1M90G 3EC5A 3CC4E 4IO9E 4WCEE 5JVGE 5GAEG 1VQNE 3CCRE 1VQ4E 1K8AG 1VQ8E 3CXCE 2ZJPE 1RL6A 1JJ2E 5B11O 3OW2E 3J7ZG 1OSPO 5H1SI 5DM7E 2OY1O 3CCUE 2OY7A 3CPWE 2ZJRE 1KQSE 5AN9B 4IOCE 4WF9E 1K73G 1YJWE 5GADG 3IG9A 1VQKE 3CD6E 1KD1G 1QVFE 1FJ1E 1YIJE 5MLCH 3CKGA 2PI3O 1VQ7E 1W2BE 4IOAE 2FKJA 3I56E 3CKFA 5B2AO 3AUMO 3CCJE 5JVHE 1QVGE 5GAGG 3G6EE 3CCEE 2HKDA 3CCME 1YITE 3CMAE 1YJNE 1Q81G 1Q82G 1K9MG 3CC2E 3CF5E 2CQLA 1M1KG 3CCSE 3CMEE 2OY8A 1VQ5E 1P4PA 2QEXE 1VQOE 2OYBO 1VQLE 3G4SE 1YJ9E 5B3MO 5HL7E 1Q7YG 2OY5O 2OL8O 3CCVE 1N8RG 1RJLC 2OL7A 1VQ9E 3PIOE 3CCQE 1YI2E 1VQPE 1VQ6E 5GAHG
chains in the Genus database with same CATH topology
4WFBE 3G71E 1KC8G 4U67E 4UY8G 1YHQE 2ZJQE 3PIPE 5DM6E 3I55E 1NJIG 2QA4E 3CCLE 2OTLE 4WFAE 1Q86G 3CC7E 3DLLE 1VQME 4WFNE 2OTJE 1M90G 3CC4E 4WCEE 4IO9E 5JVGE 5GAEG 1VQNE 3CCRE 1VQ4E 1K8AG 1VQ8E 3CXCE 2ZJPE 1RL6A 1JJ2E 3OW2E 3J7ZG 5H1SI 5DM7E 3CCUE 3CPWE 2ZJRE 1KQSE 5AN9B 4IOCE 4WF9E 1K73G 1YJWE 5GAHG 5GADG 1VQKE 3CD6E 1KD1G 1QVFE 1YIJE 5MLCH 1VQ7E 1W2BE 4IOAE 3I56E 3CCJE 5JVHE 1QVGE 5GAGG 3G6EE 3CCEE 3CCME 1YITE 3CMAE 1YJNE 1Q81G 1Q82G 1K9MG 3CC2E 3CF5E 2CQLA 1M1KG 3CCSE 3CMEE 1VQ5E 2QEXE 1VQOE 1VQLE 3G4SE 1YJ9E 5HL7E 1Q7YG 3CCVE 1N8RG 1VQ9E 3PIOE 3CCQE 1YI2E 1VQPE 1VQ6E 1S72E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB E;  3G71 E;  1KC8 G;  4U67 E;  4UY8 G;  1YHQ E;  2ZJQ E;  3PIP E;  5DM6 E;  3I55 E;  1NJI G;  2QA4 E;  3CCL E;  2OTL E;  4WFA E;  1Q86 G;  3CC7 E;  3DLL E;  1VQM E;  4WFN E;  2OTJ E;  1M90 G;  3CC4 E;  4WCE E;  4IO9 E;  5JVG E;  5GAE G;  1VQN E;  3CCR E;  1VQ4 E;  1K8A G;  1VQ8 E;  3CXC E;  2ZJP E;  1RL6 A;  1JJ2 E;  3OW2 E;  3J7Z G;  5H1S I;  5DM7 E;  3CCU E;  3CPW E;  2ZJR E;  1KQS E;  5AN9 B;  4IOC E;  4WF9 E;  1K73 G;  1YJW E;  5GAH G;  5GAD G;  1VQK E;  3CD6 E;  1KD1 G;  1QVF E;  1YIJ E;  5MLC H;  1VQ7 E;  1W2B E;  4IOA E;  3I56 E;  3CCJ E;  5JVH E;  1QVG E;  5GAG G;  3G6E E;  3CCE E;  3CCM E;  1YIT E;  3CMA E;  1YJN E;  1Q81 G;  1Q82 G;  1K9M G;  3CC2 E;  3CF5 E;  2CQL A;  1M1K G;  3CCS E;  3CME E;  1VQ5 E;  2QEX E;  1VQO E;  1VQL E;  3G4S E;  1YJ9 E;  5HL7 E;  1Q7Y G;  3CCV E;  1N8R G;  1VQ9 E;  3PIO E;  3CCQ E;  1YI2 E;  1VQP E;  1VQ6 E;  1S72 E; 
#chains in the Genus database with same CATH topology
 5B10 O;  2G8C O;  2AF5 A;  4WFB E;  3G71 E;  1KC8 G;  2I5Z O;  4U67 E;  1S72 E;  4UY8 G;  1YHQ E;  2ZJQ E;  2I5V O;  2FKG A;  2OL6 O;  3PIP E;  5DM6 E;  3I55 E;  2QA4 E;  1NJI G;  3CCL E;  2OTL E;  4WFA E;  1Q86 G;  3CC7 E;  3DLL E;  1VQM E;  4WFN E;  3IGE A;  2OTJ E;  1M90 G;  3EC5 A;  3CC4 E;  4IO9 E;  4WCE E;  5JVG E;  5GAE G;  1VQN E;  3CCR E;  1VQ4 E;  1K8A G;  1VQ8 E;  3CXC E;  2ZJP E;  1RL6 A;  1JJ2 E;  5B11 O;  3OW2 E;  3J7Z G;  1OSP O;  5H1S I;  5DM7 E;  2OY1 O;  3CCU E;  2OY7 A;  3CPW E;  2ZJR E;  1KQS E;  5AN9 B;  4IOC E;  4WF9 E;  1K73 G;  1YJW E;  5GAD G;  3IG9 A;  1VQK E;  3CD6 E;  1KD1 G;  1QVF E;  1FJ1 E;  1YIJ E;  5MLC H;  3CKG A;  2PI3 O;  1VQ7 E;  1W2B E;  4IOA E;  2FKJ A;  3I56 E;  3CKF A;  5B2A O;  3AUM O;  3CCJ E;  5JVH E;  1QVG E;  5GAG G;  3G6E E;  3CCE E;  2HKD A;  3CCM E;  1YIT E;  3CMA E;  1YJN E;  1Q81 G;  1Q82 G;  1K9M G;  3CC2 E;  3CF5 E;  2CQL A;  1M1K G;  3CCS E;  3CME E;  2OY8 A;  1VQ5 E;  1P4P A;  2QEX E;  1VQO E;  2OYB O;  1VQL E;  3G4S E;  1YJ9 E;  5B3M O;  5HL7 E;  1Q7Y G;  2OY5 O;  2OL8 O;  3CCV E;  1N8R G;  1RJL C;  2OL7 A;  1VQ9 E;  3PIO E;  3CCQ E;  1YI2 E;  1VQP E;  1VQ6 E;  5GAH G; 
#chains in the Genus database with same CATH homology
 4WFB E;  3G71 E;  1KC8 G;  4U67 E;  4UY8 G;  1YHQ E;  2ZJQ E;  3PIP E;  5DM6 E;  3I55 E;  1NJI G;  2QA4 E;  3CCL E;  2OTL E;  4WFA E;  1Q86 G;  3CC7 E;  3DLL E;  1VQM E;  4WFN E;  2OTJ E;  1M90 G;  3CC4 E;  4WCE E;  4IO9 E;  5JVG E;  5GAE G;  1VQN E;  3CCR E;  1VQ4 E;  1K8A G;  1VQ8 E;  3CXC E;  2ZJP E;  1RL6 A;  1JJ2 E;  3OW2 E;  3J7Z G;  5H1S I;  5DM7 E;  3CCU E;  3CPW E;  2ZJR E;  1KQS E;  5AN9 B;  4IOC E;  4WF9 E;  1K73 G;  1YJW E;  5GAH G;  5GAD G;  1VQK E;  3CD6 E;  1KD1 G;  1QVF E;  1YIJ E;  5MLC H;  1VQ7 E;  1W2B E;  4IOA E;  3I56 E;  3CCJ E;  5JVH E;  1QVG E;  5GAG G;  3G6E E;  3CCE E;  3CCM E;  1YIT E;  3CMA E;  1YJN E;  1Q81 G;  1Q82 G;  1K9M G;  3CC2 E;  3CF5 E;  2CQL A;  1M1K G;  3CCS E;  3CME E;  1VQ5 E;  2QEX E;  1VQO E;  1VQL E;  3G4S E;  1YJ9 E;  5HL7 E;  1Q7Y G;  3CCV E;  1N8R G;  1VQ9 E;  3PIO E;  3CCQ E;  1YI2 E;  1VQP E;  1VQ6 E;  1S72 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...