3CMAH

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
160
Chain Sequence
b'KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3cmaH00
1VQ9H 3G71H 5GAHN 4WFAJ 4WFNJ 3CCVH 2ZJQJ 4WFBJ 3CXCH 3PIPJ 3CCJH 1KQSH 1VQOH 1Q7YJ 1YJ9H 3J7ZM 1KD1J 1M90J 4WCEJ 4UY8M 3I56H 1QVFH 3CCRH 3CCSH 1N8RJ 1YJWH 3CCQH 3CMAH 5MLCO 1Q81J 1VQLH 2OTJH 3CCUH 2QEXH 1JJ2H 3PIOJ 1K8AJ 1VQ8H 1QVGH 1WKIA 1VQNH 3G4SH 3CCLH 2ZJRJ 1YITH 3CD6H 1W2BH 1Q82J 2ZJPJ 1NJIJ 3CC7H 5HL7J 5GADN 1YI2H 1VQ6H 1Q86J 1M1KJ 1VQ4H 3CPWH 5DM7J 1YIJH 4IO9J 4WF9J 5GAEN 5JVHJ 3CCEH 5DM6J 3CCMH 1S72H 2OTLH 1VQKH 1VQPH 3CC2H 1Y69K 3G6EH 2QA4H 5JVGJ 1VQ7H 3CMEH 1YHQH 2PA2A 4U67J 3I55H 3DLLJ 5GAGN 3CC4H 4IOCJ 5H1SO 1K73J 5AN9F 1KC8J 3CF5J 1VQ5H 4IOAJ 1K9MJ 1VQMH 1YJNH 3OW2H
chains in the Genus database with same CATH superfamily
1VQ9H 3FAHA 3AMZA 1BRWA 3G71H 2B7QA 3EUB4 5GAHN 4WFAJ 4WFNJ 5AYYA 3CCVH 2ZJQJ 4EAFA 3B9JC 4WFBJ 2B7NA 3CXCH 2Q5WE 1N5XA 3PIPJ 3CCJH 1YTKA 3WO0A 1KQSH 2W3SB 1VQOH 3C2FA 1X1OA 4KWVA 1Q7YJ 1YJ9H 3J7ZM 3WNZA 1FO4A 1YTDA 4XR5A 3NVZC 1KD1J 2WK5A 1RM6A 1M90J 4GA6A 4WCEJ 1N61B 4US8A 1N63B 3I56H 4UY8M 1QVFH 1QPRA 5HUPA 3CCRH 3CCSH 3L0GA 1N8RJ 1QPOA 2TPTA 4X46A 1YJWH 4C7YA 1UOUA 2QIEA 3CCQH 4ZOHA 1O4UA 1ZXIB 4I9AA 3CMAH 3VMMA 1NVIE 5MLCO 3NS1C 1Q81J 1N60B 1VQLH 2OTJH 3CCUH 4LHMA 4GA5A 2QEXH 1JJ2H 3PIOJ 2DSJA 4US9A 1WYGA 1K8AJ 1VQ8H 1VDVA 4C7ZA 1QVGH 1WKIA 1VQNH 3RPFA 3G4SH 3CCLH 1JROB 2ZJRJ 2JBMA 2W3RB 3AN1A 1YITH 3CD6H 1W2BH 2I1OA 1Q82J 4GA4A 2ZJPJ 1NJIJ 3ETRC 5HUOA 3L4PA 3CC7H 1NVJA 3NRZC 5HL7J 5GADN 1YI2H 3H5QA 1N62B 1VQ6H 3TQVA 1Q86J 2B7PA 1M1KJ 1FIQC 1FFUB 2W55B 2I14A 5DM7J 1VQ4H 3CPWH 1YIJH 3C2RA 1SB3A 1JRPB 4IO9J 3PAJA 4WF9J 4KWWA 3NVVC 5GAEN 5JVHJ 5MPOC 3CCEH 1FFVB 1FM0E 5DM6J 3NVYC 3CCMH 1OTPA 1S72H 1VQKH 1SIJA 2OTLH 5EY3A 1VQPH 3NVWC 3CC2H 3FC4A 3C2EA 3G6EH 1Y69K 1FMAE 1DGJA 4YYYA 2QA4H 2W54B 1N5WB 2OMDA 3SR6C 5JVGJ 1VQ7H 5AYZA 3CMEH 5EP8A 4EADA 4AP8A 1YHQH 3C2VA 2PA2A 5AYXA 2E3TA 1YTEA 3C2OA 2J0FA 3WO1A 4U67J 3I55H 3DLLJ 1QAPA 3GNNA 5GAGN 1VLBA 3CC4H 1V97A 4IOCJ 5H1SO 1K73J 1QPNA 4YEKA 2WP4A 3AM9A 4USAA 5AN9F 1KC8J 3CF5J 4C80A 1VQ5H 1QPQA 4IOAJ 3BIIE 1K9MJ 1VQMH 2WK6A 1YJNH 5HULA 1AZYA 3OW2H
chains in the Genus database with same CATH topology
1VQ9H 3G71H 5GAHN 4WFAJ 4WFNJ 3CCVH 2ZJQJ 4WFBJ 3CXCH 3PIPJ 3CCJH 1KQSH 1VQOH 1Q7YJ 1YJ9H 3J7ZM 1KD1J 1M90J 4WCEJ 4UY8M 3I56H 1QVFH 3CCRH 3CCSH 1N8RJ 1YJWH 3CCQH 3CMAH 5MLCO 1Q81J 1VQLH 2OTJH 3CCUH 2QEXH 1JJ2H 3PIOJ 1K8AJ 1VQ8H 1QVGH 1WKIA 1VQNH 3G4SH 3CCLH 2ZJRJ 1YITH 3CD6H 1W2BH 1Q82J 2ZJPJ 1NJIJ 3CC7H 5HL7J 5GADN 1YI2H 1VQ6H 1Q86J 1M1KJ 1VQ4H 3CPWH 5DM7J 1YIJH 4IO9J 4WF9J 5GAEN 5JVHJ 3CCEH 5DM6J 3CCMH 1S72H 2OTLH 1VQKH 1VQPH 3CC2H 1Y69K 3G6EH 2QA4H 5JVGJ 1VQ7H 3CMEH 1YHQH 2PA2A 4U67J 3I55H 3DLLJ 5GAGN 3CC4H 4IOCJ 5H1SO 1K73J 5AN9F 1KC8J 3CF5J 1VQ5H 4IOAJ 1K9MJ 1VQMH 1YJNH 3OW2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 H;  3G71 H;  5GAH N;  4WFA J;  4WFN J;  3CCV H;  2ZJQ J;  4WFB J;  3CXC H;  3PIP J;  3CCJ H;  1KQS H;  1VQO H;  1Q7Y J;  1YJ9 H;  3J7Z M;  1KD1 J;  1M90 J;  4WCE J;  4UY8 M;  3I56 H;  1QVF H;  3CCR H;  3CCS H;  1N8R J;  1YJW H;  3CCQ H;  3CMA H;  5MLC O;  1Q81 J;  1VQL H;  2OTJ H;  3CCU H;  2QEX H;  1JJ2 H;  3PIO J;  1K8A J;  1VQ8 H;  1QVG H;  1WKI A;  1VQN H;  3G4S H;  3CCL H;  2ZJR J;  1YIT H;  3CD6 H;  1W2B H;  1Q82 J;  2ZJP J;  1NJI J;  3CC7 H;  5HL7 J;  5GAD N;  1YI2 H;  1VQ6 H;  1Q86 J;  1M1K J;  1VQ4 H;  3CPW H;  5DM7 J;  1YIJ H;  4IO9 J;  4WF9 J;  5GAE N;  5JVH J;  3CCE H;  5DM6 J;  3CCM H;  1S72 H;  2OTL H;  1VQK H;  1VQP H;  3CC2 H;  1Y69 K;  3G6E H;  2QA4 H;  5JVG J;  1VQ7 H;  3CME H;  1YHQ H;  2PA2 A;  4U67 J;  3I55 H;  3DLL J;  5GAG N;  3CC4 H;  4IOC J;  5H1S O;  1K73 J;  5AN9 F;  1KC8 J;  3CF5 J;  1VQ5 H;  4IOA J;  1K9M J;  1VQM H;  1YJN H;  3OW2 H; 
#chains in the Genus database with same CATH topology
 1VQ9 H;  3FAH A;  3AMZ A;  1BRW A;  3G71 H;  2B7Q A;  3EUB 4;  5GAH N;  4WFA J;  4WFN J;  5AYY A;  3CCV H;  2ZJQ J;  4EAF A;  3B9J C;  4WFB J;  2B7N A;  3CXC H;  2Q5W E;  1N5X A;  3PIP J;  3CCJ H;  1YTK A;  3WO0 A;  1KQS H;  2W3S B;  1VQO H;  3C2F A;  1X1O A;  4KWV A;  1Q7Y J;  1YJ9 H;  3J7Z M;  3WNZ A;  1FO4 A;  1YTD A;  4XR5 A;  3NVZ C;  1KD1 J;  2WK5 A;  1RM6 A;  1M90 J;  4GA6 A;  4WCE J;  1N61 B;  4US8 A;  1N63 B;  3I56 H;  4UY8 M;  1QVF H;  1QPR A;  5HUP A;  3CCR H;  3CCS H;  3L0G A;  1N8R J;  1QPO A;  2TPT A;  4X46 A;  1YJW H;  4C7Y A;  1UOU A;  2QIE A;  3CCQ H;  4ZOH A;  1O4U A;  1ZXI B;  4I9A A;  3CMA H;  3VMM A;  1NVI E;  5MLC O;  3NS1 C;  1Q81 J;  1N60 B;  1VQL H;  2OTJ H;  3CCU H;  4LHM A;  4GA5 A;  2QEX H;  1JJ2 H;  3PIO J;  2DSJ A;  4US9 A;  1WYG A;  1K8A J;  1VQ8 H;  1VDV A;  4C7Z A;  1QVG H;  1WKI A;  1VQN H;  3RPF A;  3G4S H;  3CCL H;  1JRO B;  2ZJR J;  2JBM A;  2W3R B;  3AN1 A;  1YIT H;  3CD6 H;  1W2B H;  2I1O A;  1Q82 J;  4GA4 A;  2ZJP J;  1NJI J;  3ETR C;  5HUO A;  3L4P A;  3CC7 H;  1NVJ A;  3NRZ C;  5HL7 J;  5GAD N;  1YI2 H;  3H5Q A;  1N62 B;  1VQ6 H;  3TQV A;  1Q86 J;  2B7P A;  1M1K J;  1FIQ C;  1FFU B;  2W55 B;  2I14 A;  5DM7 J;  1VQ4 H;  3CPW H;  1YIJ H;  3C2R A;  1SB3 A;  1JRP B;  4IO9 J;  3PAJ A;  4WF9 J;  4KWW A;  3NVV C;  5GAE N;  5JVH J;  5MPO C;  3CCE H;  1FFV B;  1FM0 E;  5DM6 J;  3NVY C;  3CCM H;  1OTP A;  1S72 H;  1VQK H;  1SIJ A;  2OTL H;  5EY3 A;  1VQP H;  3NVW C;  3CC2 H;  3FC4 A;  3C2E A;  3G6E H;  1Y69 K;  1FMA E;  1DGJ A;  4YYY A;  2QA4 H;  2W54 B;  1N5W B;  2OMD A;  3SR6 C;  5JVG J;  1VQ7 H;  5AYZ A;  3CME H;  5EP8 A;  4EAD A;  4AP8 A;  1YHQ H;  3C2V A;  2PA2 A;  5AYX A;  2E3T A;  1YTE A;  3C2O A;  2J0F A;  3WO1 A;  4U67 J;  3I55 H;  3DLL J;  1QAP A;  3GNN A;  5GAG N;  1VLB A;  3CC4 H;  1V97 A;  4IOC J;  5H1S O;  1K73 J;  1QPN A;  4YEK A;  2WP4 A;  3AM9 A;  4USA A;  5AN9 F;  1KC8 J;  3CF5 J;  4C80 A;  1VQ5 H;  1QPQ A;  4IOA J;  3BII E;  1K9M J;  1VQM H;  2WK6 A;  1YJN H;  5HUL A;  1AZY A;  3OW2 H; 
#chains in the Genus database with same CATH homology
 1VQ9 H;  3G71 H;  5GAH N;  4WFA J;  4WFN J;  3CCV H;  2ZJQ J;  4WFB J;  3CXC H;  3PIP J;  3CCJ H;  1KQS H;  1VQO H;  1Q7Y J;  1YJ9 H;  3J7Z M;  1KD1 J;  1M90 J;  4WCE J;  4UY8 M;  3I56 H;  1QVF H;  3CCR H;  3CCS H;  1N8R J;  1YJW H;  3CCQ H;  3CMA H;  5MLC O;  1Q81 J;  1VQL H;  2OTJ H;  3CCU H;  2QEX H;  1JJ2 H;  3PIO J;  1K8A J;  1VQ8 H;  1QVG H;  1WKI A;  1VQN H;  3G4S H;  3CCL H;  2ZJR J;  1YIT H;  3CD6 H;  1W2B H;  1Q82 J;  2ZJP J;  1NJI J;  3CC7 H;  5HL7 J;  5GAD N;  1YI2 H;  1VQ6 H;  1Q86 J;  1M1K J;  1VQ4 H;  3CPW H;  5DM7 J;  1YIJ H;  4IO9 J;  4WF9 J;  5GAE N;  5JVH J;  3CCE H;  5DM6 J;  3CCM H;  1S72 H;  2OTL H;  1VQK H;  1VQP H;  3CC2 H;  1Y69 K;  3G6E H;  2QA4 H;  5JVG J;  1VQ7 H;  3CME H;  1YHQ H;  2PA2 A;  4U67 J;  3I55 H;  3DLL J;  5GAG N;  3CC4 H;  4IOC J;  5H1S O;  1K73 J;  5AN9 F;  1KC8 J;  3CF5 J;  1VQ5 H;  4IOA J;  1K9M J;  1VQM H;  1YJN H;  3OW2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...