3CMAV

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cmaV00
3CCLV 1KC8W 2QEXV 1VQKV 1Q81W 3CCQV 3CPWU 1K9MW 1M90W 1VQ5V 4WCEV 1VQ8V 3OW2U 3CC7V 1S72V 3CCVV 3G6EV 1Q82W 2D3OW 2OTJV 1YHQV 3I56V 1VQPV 3CCMV 1K8AW 1KQSU 1VQ9V 1VQ6V 1Q7YW 1VQNV 1Q86W 1K73W 1VQ4V 1YI2V 3CMAV 1M1KW 5DM6V 1N8RW 3CCJV 1W2BU 1JJ2U 1QVGU 4WFBV 1YJ9V 3CD6V 3CXCU 3CCEV 1YIJV 3CCSV 4WFAV 3G4SV 1VQLV 3CMEV 1VQOV 1VQ7V 3CCRV 2QA4V 1QVFU 1VQMV 2OTLV 1YJWV 1R73A 4WF9V 3CC2V 3G71V 3I55V 3CC4V 1NJIW 1KD1W 3CCUV 1YJNV 1YITV
chains in the Genus database with same CATH superfamily
1IXBA 2UXNA 2ATKC 4LC1A 3NR7A 5CB4B 2FTKA 5J2TB 2R9RB 2ZE8A 1W0KG 3FFQA 4OPHA 2CGOA 4CH5A 2JDIG 4LF5O 4AILC 4X89A 4WFBV 2HG5C 4DR1B 4GKKB 4LF5B 3JD2A 4MTXA 3CMEV 1J5EB 3N2GA 3OAAG 3C90A 5JJEB 3GVMA 2P06A 5GTIZ 1JMKC 4B3RB 1XOUA 4ZKIA 1VQ9V 3L71H 1BQZA 1WA8A 1S0VA 1W2BU 5IYZA 4DV1O 2QDOA 3HKEB 1XNQO 4E2LA 1RSOA 5B1AC 1YJNV 1DGSA 2W6JG 5J9PC 3ASNC 2UXCB 2PUSA 3G6BA 2FL4A 4LWSB 4JAUA 3ZEDA 4J42A 1HNXO 3FAVB 1EBOA 1SC5B 2EBOA 5ITZA 5BR8B 2Q8VA 2DWEC 1SZXA 1XNRO 1FXKA 1OCRC 2F43G 4JAAA 1ZL8A 3H1KH 3H01A 4RQEA 4B3TO 1SS3A 3ABKB 3CS5A 1XHXA 3RGBA 1QLEC 4K35A 4I50B 3WB1A 2D3OW 2GUZB 4BIZA 4U3JB 2LQTA 1V55C 3ZN1A 1IBMB 3K06A 5HFLA 3T1YO 3CX5F 4LFCO 4CZZA 3ETGA 3ZMTA 3LUTB 1JFFA 2QWPB 1KUQA 1GM9A 2VRZA 3SJQC 1HNWB 4DYLA 1BSMA 2BCCH 3K03A 2WAMA 4KUMA 3ZHQA 2PZSA 1PKXA 1NTZH 4R8CA 2A0LA 4HAMA 2CDYA 4DV0O 2UUBO 4YXWG 4JYCA 3CJHB 4LF8B 1ZSPA 2Y4TA 4DV2O 1R73A 3AG1B 2F93B 4FZ0A 2VQEB 5KHGA 1KP3A 1XI1A 5C8YA 4EFBA 2YXYA 2GV9A 1Q3EA 2JGUA 4BAYA 4WFGA 2IU0A 2KSDA 1ZLZA 1AR5A 5KX5B 3VQWA 4MVUA 1VF7A 3K04A 2CTQA 3SYCA 4DR2B 1QVGU 2PTMA 1FFTB 4UCTA 3R66A 4DXWA 5L3DA 5IY5B 3B8MA 4YY3O 3ZHTA 3AG7A 2M7WA 1IXMA 1KYOF 4IHJB 4YJ2A 4WFFA 3JAKA 2OTJV 3BY6A 4X62B 3EFFK 3QO5A 2VS0A 3ZN0A 1I94B 1YJWV 1NZ6A 1V9PA 2LO1A 1K33A 4UB6Z 1EZJA 4X8AA 3E86A 3OM3B 3ZRWA 1K3EA 2CTPA 4PA3A 4NKGB 1BHAA 4B3MO 2QM4A 1WA8B 3L70H 2RQ6A 3OUSA 1AJPA 2XT9A 5EIBD 4JI8O 3L74H 2Y0IA 5IYZB 2RDCA 1L1FA 1YHQV 1BE3H 1THZA 1RSOB 4JTAB 4TV9A 4L87A 1PL0A 5CN0A 3IGAC 4P2ZA 4DW0A 3P3NA 1VF6C 3N2KA 4OPAA 3CXCU 4KP4A 4PV1B 5ITZB 1SERA 1VQMV 3HB3B 1H2KA 3CCUV 5EYPA 4BR6A 1FXKB 1L8DA 1YVWA 4B7EA 4GZRB 1G6UA 3CEIA 1ZL8B 3LDEA 3TK1A 4MVRA 3A2FA 2E76B 1R6NA 1P49A 2XAQA 5KA6A 5BZBA 3W7WA 3S3WA 3K58A 3HPLC 1R1BA 4QPKA 2F66C 5L3BA 4PELA 1KKDA 4PA4A 4CS3A 2Q0AA 2GHYA 3F7VC 1EN6A 5FPRA 5FPOA 1V54B 2QR4A 1JFFB 2GBOA 5KHIA 1OCOB 5FLXN 1TA8A 2UXXA 1BQ0A 1VQNV 1DF4A 2EILC 2IBZH 2BTOA 3LSQA 2RNBA 4ICGA 1K34A 4DUYO 2Y4UA 1WP7A 5GONA 4LF4B 1HNZB 3SJCC 1N0NA 1RP3B 2GTAA 4RWUA 3X2QC 5IYDO 1R6TA 3E8GA 4IIJA 4MTFA 3OFNG 5C8YB 2CE4A 2Q9LA 2EIMC 3RYHA 1HWYA 2CUGA 3B09A 4D7TA 1FFXB 4J80A 1QBZA 5EK0A 3JD3A 1XHZA 2OT5A 5LMNB 1K9MW 3ZBHA 1W0JG 4LF9O 3E2EA 2DYRC 4J7ZA 1ZWIC 2ZE6A 4O2AA 4TQDA 4O4LB 4YJ2B 1P7GA 3JAKB 2W6IG 2EIKB 1XEQA 3D36C 3H1JH 4B08A 1QR9A 1DLBA 3LDCA 4YHHO 2UXDO 4X1YA 4H0LB 4K0KO 2BTQB 4YHHB 5IYBO 3JD4A 4MW3A 3CRMA 1K73W 4QGPA 1CXZB 1ROPA 2PGGA 3B77A 1SQXH 1YZBA 1NQTA 1WJZA 1TVKA 1AI4A 3AG4C 4KXRA 3ZMVA 5CA1A 3OTOB 1YIJV 1IBKO 4I9QA 3U0ZA 4PDMA 2WWWA 3G67A 3ZRWB 3DXRA 4JI5B 4DV4O 4LFBB 2ZDIA 1H38A 2R70A 4MS2A 4LF7B 3ZRSA 1XUQA 2P4VA 3ZCCA 1KQSU 4FFBB 3CRAA 2X6BA 3WB2A 2JJ1G 2E5LO 1XMOO 2L6LA 1TUEB 3ABMB 2N05A 4CH3A 1VQLV 2AZ0A 5CB4A 4TV9B 4HNAA 4X9QA 1BCCH 1RM1B 1Y74B 3K79A 5EZYA 4LNUA 3N2KB 1RPOA 3CRRA 2JS5A 4JPRA 4J9ZB 4DR7B 5EYPB 2ADQB 4YJ3B 3OT7A 1U96A 3IC9A 3ABTA 3JSLA 1LR1A 2Q7HA 1IBLB 1N36B 2JS3A 1QR8A 4W4LA 2ZKOA 1U97A 1KU9A 2AW9A 2DMXA 4K8XA 1GN4A 2DN9A 4OGQB 3CCVV 1Z5VA 4U7NA 3SGIA 3I56V 3SJBC 1AR1B 1O9HA 3TJTA 2R9AA 3VQYA 4JI0O 4JI7O 1NR7A 5LGTA 2M6YA 5JJJB 2RN9A 2P4KA 4LWSA 2FB5A 3A0RA 2OCCB 4EKWA 2IW5A 1KC8W 5B1OA 5L3CA 4FM1A 5GONB 1SQFA 1GRJA 3JALA 3ZX6A 1NR1A 3ASOC 5H6QA 4XDKA 3BABA 2UUAO 3BA8A 3OMAB 1M57B 1BS3A 2AHZA 2Y48A 3E8BA 5LOVB 1N33B 2DOSA 4IIJB 3P30A 4XDLA 1WB7A 3KCXA 2ITCC 3JSNA 4JZ2A 3ETDA 4DO2A 3LNMB 4CH4A 2GUZA 3RYHB 4DV6B 2EJ7A 3CCLV 2FYUH 1Q81W 2EIJC 3UO2A 1PD3A 1I0HA 1CP9A 4JI3O 4N23A 2B9ZA 5KHJA 4I7ZB 2YIDA 2Z3YA 4DR6O 1N4CA 1P84F 3ZMSA 1FJGO 4O2AB 4I5SA 2EZOA 2LFRA 3CSXA 3F7YC 3KZIZ 2X0LA 3E89A 1B04A 1M56C 5KA5A 4LFAB 3LDDA 1SZTA 1ZTEA 3HKCB 5LP6C 3AG3B 1GN3A 1Q8IA 4X1YB 3CYOA 3RYCA 4RO2A 2DW4A 2LW7A 2UXBO 4NXNB 5CA0B 2QA4V 4FMTA 3IFXA 1SETA 2BE3A 1TVKB 4B7KA 5KX5A 1H2MA 5CA1B 4JI4O 5TISZ 2ZE7A 3T1CA 5KAIZ 3BAAA 2CGNA 4BIUA 1GTOA 4CH6A 1JR9A 1F7YA 2DYSC 2GTSA 1ZUQA 4I0XA 3AG2B 4KL1A 3UKMA 5LHIA 4GLXA 4JI6O 4P9OA 4TOIA 4X65O 1E1QG 5IWAB 2MW2B 4HNAB 2WLIB 1MNGA 5IJ9A 4OX9O 1MZEA 5EZYB 3QVNA 4LNUB 1QQCA 3E35A 4AHCA 3D8CA 4EB6A 4O4JA 2OWOA 1QU7A 2X6CA 3SPGA 1NVPB 1K8AW 4O4HA 5KUKA 1Y67A 3STLC 2QJ1A 3ZIAG 2Q73A 3SPHA 4CC6A 3S3XA 4MVSA 3ML0A 2JVDA 1IZ3A 4HBNA 4LR3A 3ETQA 3RW0A 3DSQA 1BT8A 2LGQA 2YC0A 3HKDA 4DV1B 4F6EA 2MK3A 3ZHVA 1XNQB 3AK1A 2F4VO 3RYIB 3W7TA 4JV5O 4QE7A 2ZXWC 2EJRA 2ZIMA 4DV7O 1BMFG 2JGDA 1OCCC 1AI6A 3OUFA 2QKCA 1HNXB 5CA3A 1I5YA 2HKOA 3JALB 3G80A 1DK1A 1PNLA 2HJFC 1XNRB 3BEHA 3AEIA 3FX7A 3W7XA 5A2QN 1LNQA 4B3TB 1AJNA 4YIOA 1SRYA 1UFIA 2WLMA 5LYJA 3ABUA 1NVPD 5JCOA 5B1AB 4O2BA 3ASNB 4I9WA 1XL4A 3T1YB 4Z1MG 1VF6A 4LFCB 4J7KA 4B3SO 4QNHB 3TXQA 2Q5ZA 4UCUA 4UVAA 5GW7A 2CK3G 1OCRB 1VEWA 4H37A 1L0NH 4MTOA 1F51A 1GM8A 2EULA 1G4YB 3MHHC 4ASUG 2WLJA 3C3TA 1TUBA 4YIPA 1QLEB 4PA6A 2PI4A 4DV0B 1VQOV 2UUBB 3M8AA 1IURA 1V55B 3F5WC 1H2LA 3RYCB 4DV2B 4P9PA 2YUAA 3CC7V 3VQVA 1AROP 1Q6HA 3E22A 4PDVA 4GX5A 3A8TA 1GN6A 1FFXA 1Q90D 4KHPO 1XILA 4H44B 2XUMA 5CBHA 5J2UA 3RT3C 5EC2C 3P3PA 1QVFU 2WPDG 2V7QG 3L72H 3JD1A 4FLTA 4Q6GA 3BRCA 3GWKC 1IDSA 2X6AA 4I0XB 4O4LA 4YY3B 3QF7A 2IJHA 1XQ8A 1PNKA 2ZIOA 4WFEA 1AI5A 1M1KW 3T1HO 4JI2O 4IYHA 2XASA 2XTAA 3VBBA 5IJ9B 5B1BC 2BTQA 2WLKA 3G71V 4EB6B 4O4JB 1D5NA 1K97A 2QWRB 3K59A 2ZM6O 5EBMC 2Q67A 4O4HB 1M9NA 1JJOA 3DTUB 2Y69C 1AB3A 1YEWA 2N04A 5BMVA 4RQFA 1QNMA 1VIBA 5IYCO 1T5EA 3D36A 4B3MB 4FFBA 3FYEB 4X1KA 4GCZA 1D2DA 2YSUB 4JI8B 2QTSA 2OIEA 3HKDB 5CBFA 1XMQO 2UU9O 2CH7A 4ABMA 5KUMA 1BHBA 4LF6O 5HFMA 3P32A 2XAJA 4CC5A 1Y74A 4GX0A 3G4SV 1NTKH 2JGDB 4MVZA 1R3LC 1SQQH 1AR4A 5B3SC 1PPJH 2UUCO 3SYOA 2EZPA 5KHHA 4YJ3A 2KB1A 1YXBA 4D6TH 4MVOA 1FAFA 2DJVA 5IT9N 1Q86W 2EINC 4DK0A 4GYCB 5D5PA 4XBFA 3AK2A 3LSUA 4LCUC 2JK5C 4BW9A 5LYJB 1AP6A 4O2BB 2A79B 4A5UB 3CHXA 4EEQA 1HW7A 2QM7A 3G6EV 4DR3O 2L35A 4AI8A 1OCZC 3MD0A 3WFVA 1IVSA 3UCSC 3UO3A 2OIGA 3C3SA 1NBMG 4TV8B 4JGSA 2ZT9B 3T2MA 1L0LH 1F4MA 3ETEA 5L3GA 5IDJA 3B2EE 4DUYB 3JCZA 1MG1A 1LUVA 1TUBB 3KKYA 2HR3A 2QWNB 5LHGA 1GK9A 4DRXA 5LHHA 4R6ZA 4FLWA 5LOVA 4FLYA 4Z1VA 4X20A 1JOYA 5KAFZ 3E22B 4PDLA 1YJ9V 3JASB 3RN4A 1KP2A 2JEUA 2E3CA 3ZRXA 3ZMUA 2EILB 1WAZA 5J2UB 2A9HA 4JYAO 3WG7C 2YXLA 4X64O 2VWKA 4LF9B 2KQXA 2PYLA 1SQBH 3WU2Z 3X2QB 4ZOLB 3T4DA 2DWDC 4MT8A 4BW5A 3FKSG 1K4CC 1PL4A 4ZHQB 2VQFO 3HKCA 2EIMB 3CP1A 2VQFB 2QGNA 1MZFA 2ZCEA 2BOCC 2YI9A 3DGEA 2WLHA 5LL6Y 2UXDB 1FXVA 1SQGA 5CA0A 4JAVA 2VWJA 4K0KB 5DECA 4ZI7B 2G38A 2DYRB 3A0HZ 3JATA 4TQFA 3ZMZA 2OCHA 2DQ0A 1IBKB 4NVPA 1Q43A 4I55B 3K5MA 2AZ2A 1XL6A 5BXZA 4DV4B 4R7CA 5BMVB 2LJ2A 4BWAA 5JQGA 3VOUA 1YI2V 4X1KB 2NR5A 1XDCA 3FB5C 3RFRA 1HR0O 4AQYO 1TGOA 1KMIZ 2CH7B 3ABLC 1H8HG 2E5LB 1QHTA 1XMOB 4IYIA 3LSSA 1Z5WA 3ZHUA 1W59A 2WLIA 2XAHA 2ITDC 4NTWA 5KHKA 2HVKC 2RJZA 3AG4B 5IJ0A 1Q82W 1GO3F 4GX2A 3T4ZA 1Y66A 1P4RA 2B1GA 3CCJV 1O9GA 2A06H 5B1NA 2QWQB 1KKCA 1ENVA 2Q7GA 5EBWC 4JZGA 1N34O 1N32O 3B40A 1FS0G 4K8ZA 3ZRVA 3D3QA 2ZR3A 5AG2A 1SQVH 1KB9F 2BOBC 3RWRD 2CAZC 2YDEA 3RYIA 1AJQA 4UXNA 1GKFA 4JI0B 4JI7B 4Z2WA 1J95A 2B5UA 4DUZO 4LH7A 4U3FH 4X1IA 2AGAA 3FB8C 2ZQMA 3JYCA 3CMAV 1N8RW 3GWOA 4DRXB 4PI0A 2JRIA 2UUAB 3OMIB 3IC7A 3B4SA 3IAYA 1Q6UA 1N0JA 1NJIW 1KD1W 4X20B 4RUFA 4X66O 1YITV 1RPRA 5KLVH 4DR5O 3CWBH 2Q0OC 1VQ5V 1VF5B 1COWG 3OW2U 2LGWA 1F23A 3TCUA 4DR4O 5LMUO 4XDJA 4JI3B 2P67A 1AILA 1NKDA 3RYFA 4DV3O 3SYAA 4MTGA 1X4TA 4NB5A 2HJDA 4JTDB 4DR6B 3ASOB 1JX9A 1B06A 1EM1A 1FJGB 3E8HA 1VP7A 4P30A 2YXHA 2IH1C 2JEXA 1I5XA 2EIJB 2HVJC 2ADPA 4UUJC 4DV5O 3I5DA 3I55V 2UXBB 1HDJA 5KMGA 3JATB 2HHHO 3SPJA 1WB8A 2W0XA 2HHHB 4JI4B 3M7MX 4NXMO 4GUNA 1LUWA 3OEHG 1IX9A 4WBNB 3O65A 1M56B 4WFAV 4FK5C 5JQGB 2F95B 3MDSA 4JI1O 5LP6B 5CMUA 1WN7A 2DQ3A 4JI6B 1NS1A 4GT1A 4X65B 4GKJO 1KBHA 5EC1C 2N74A 3NXSA 2HEPA 1SESA 4RUEA 3MAQA 4GKJB 1Y76A 2R9IA 5JWPA 2P90A 3K57A 2JJ2G 3OD4A 4OX9B 5IJ0B 3CC2V 4UCVA 4Q20A 1VQKV 3K9SA 2WA4A 3APQA 1Y6XA 2DYSB 4D7SA 4CS2A 4NYKA 1S5HC 4DR1O 4GKKO 4TUYA 1FKAO 4E4EA 1J5EO 2A7WA 3QO8A 5L3FA 5DEDA 4PHZA 4B3RO 3JAWA 2QM8A 1VARA 3ZHSA 3EHBB 2F4VB 5CBGA 4JV5B 3A0BZ 3ABKC 4TSFG 4UCRA 4DV7B 4G2KA 4TT3G 2XAFA 3KCYA 4F4LA 2NLJC 4X1IB 1H2SB 5H9CA 4FM0A 2YIBA 2UXCO 1MABG 1YTFB 1OV9A 2QEXV 1K92A 4DW1A 2YI8A 5BR8O 1M4UA 2IJIA 4QE9A 4HZ3A 2C2AA 2JIZG 5JJNB 1URFA 1S3JA 3OMNB 1FPOA 5BY1A 3BCCH 4EFEA 4FPPA 2AHYA 4FZ1A 4F6RB 2ZXWB 2YIAA 5JVDB 1OCCB 3K9AA 3K5NA 3TGUH 3OR6C 3FYIB 3RYFB 1K4DC 2YICA 4B3SB 1IBMO 4TV8A 5JH7B 1JQ0A 3AG1C 1VQPV 1OHHG 4J10A 5LGNA 5DM6V 1AP5A 2WLLA 4KFMA 4I4TA 2Q6AA 2ODMA 1HNWO 2ETNA 1EN4A 2H3OA 1PM9A 5EIBC 5F2VO 3CRCA 1BZKA 5LXTA 1SKVA 3HR0A 4BIOA 5FNVB 1JCHA 1A32A 3Q4HA 4ZIBA 5B5EZ 4FLVA 3JASA 3JAMN 3W7UA 3OGIB 5IY5C 2RCVA 5KMGB 1YTFD 3BFRA 3B8NA 4LF8O 1K5QA 1RFYA 4NTXA 2VQEO 2WLNA 4KHPB 1Q6IA 1GM7A 3CCRV 5H5NA 3CC4V 1ORQC 3CB2A 1QCEA 1M93A 2WA3A 5E1AC 2NN4A 3SDLA 4ZOLA 4DR2O 3OTFA 3OE7G 2W0FC 2WSSG 3SYPA 4ZHQA 1M5IA 3RBZA 3H1LH 1S76D 3T1HB 1Y76B 4JI2B 1AI7A 4WF9V 3OR7C 4NR1A 2ZD9A 3HKBA 1KECA 2Q7EA 1NT2B 4ZI7A 3OEEG 4X62O 3CCMV 3K3WA 4W4KA 1H2NA 2ZM6B 1I94O 1TAEA 3ZHRA 1UJWB 4I55A 3CCEV 1MMMA 5L3EA 1SA0A 4TUYB 3MHSC 1UPGA 5E79Z 4UVBA 1NTMH 3N2GB 4J11A 2K9PA 1VMGA 2XAGA 5B1BB 3JAWB 4PA7A 1Q7YW 2QSAA 2ZINA 1VQ4V 1FXKC 2OYQA 1S5LZ 4QJFB 3DC6A 4U7OA 1XMQB 2UU9B 4FLZA 2KG7A 3QO7A 5A9GA 4LF6B 4UVCA 3ZJZA 2X7RB 1MSWD 1WPXA 2Z5UA 1CPYA 4UV9A 2UUCB 2Y69B 5LA6A 5JCOC 4N21A 3N27A 1R3IC 3W7SA 2PY5A 3ICXA 1V54C 2A3QA 1BGYH 2E74B 1OCOC 1R6KA 2OTLV 4MVQA 4CBCA 1HP8A 3K5OA 1CEZA 2IJKA 2Q69A 2ZNIA 1VQ8V 4UFZA 1GN2A 1JA8A 2GDSA 3D3IA 3WB0A 1VQ6V 3JARA 1YSCA 5DN6G 5B3SB 2E75B 1R3KC 4FIPC 4DR3B 2BSKA 3APOA 3K5LA 2YEVA 3IJ4A 1H8EG 2F1MA 2IM9A 2EINB 2WLLB 3L9DA 4FJCC 3CPWU 4I4TB 4DK1A 3UT5A 4H33A 4OXSA 4MW8A 3JCUZ 3BHPA 5LXTB 4LF4O 1PP9H 1HNZO 3Q4HB 1FXHA 1F4NA 1X59A 4O4IA 2FMLA 2YIBD 2IU3A 4G27B 1OCZB 5B66Z 1NH2B 2EIKC 4JYAB 5LGUA 4FM2A 2Q68A 3BVOA 4X64B 3J81N 3SR2C 4IGGA 4NTYA 3CD6V 2Q4PA 5LMNO 5D5QA 2O57A 2PF4E 2HFEC 2ZE5A 3H1IH 4LBEC 3R65A 1NI8A 3E8FA 3E83A 1YDXA 3PJSK 4UCOA 4FVMA 3J80N 1K7DA 1WP8A 5K1XA 4C7UA 4K3AA 2R72A 1SQPH 3HKBB 4G28B 1JJ2U 2D2CB 1G1XB 3WG7B 1XREA 2IH3C 5H2FZ 1B3QA 4PDRA 4QIWF 4MVMA 2ZR2A 3L75H 3AK3A 2PYJA 2XNDG 4WCEV 2P6JA 3ABMC 2P5OA 1I7FA 1SA0B 4JF3A 4WFHA 4WBNA 3UM7A 4LP8A 2GSMB 3PN1A 3OTOO 4FFKA 1RM1C 3QNEA 5C93A 2Z0AA 1NH2D 2EX3A 5LP6A 3M99B 2V1DA 1EZVH 4JI5O 4H13B 1GH6A 2YS8A 1S77D 3L73H 1HR0B 4LFBO 4AQYB 3K0GA 4LF7O 2KG7B 1S5JA 1Z2GA 1S72V 4ZBMA 2XOKG 1AVMA 3EVKA 1US6A 3K0DA 5FL7G 4X88A 1EFRG 5IE9A 1WLEA 4RAIA 3VQXA 1ZX3A 5LA6B 2QTOA 4PJ0Z 1MOFA 5J2TA 1FYJA 4JYYA 1R3JC 3RVZA 2CTWA 2Y0PA 1EN5A 2RMKB 2H94A 4DR7O 1N34B 3ABLB 2OCCC 1N32B 1IBLO 1N36O 3K08A 4JTCB 2P7TC 2ARHA 1DF5A 4PA9A 2KKWA 2F23A 4CS4A 1BL8A 2QWOB 3JARB 1NU1H 1GAXA 3BA9A 2CTRA 1M57C 2BSKB 1YCIA 2AXTZ 1B6QA 2YEVB 2K1EA 4DUZB 1I08A 3HKEA 1QLNA 3F5TA 3GB7C 2ILMA 3UT5B 1Q5OA 4L8JA 3BPZA 1MSDA 1WPBA 3H9VA 4UV8A 2ZNJA 3TXSA 3FAVA 3QG5A 1OJHA 2LW1A 4FLUA 2HP8A 4O4IB 1M90W 4JYBA 1P7BA 3UQ8A 4X66B 1Y4MA 4DR5B 3QTCA 2FKXA 5H6RA 4F6RA 1JVMA 1ZAUA 2LP7A 3OGCC 4GX1A 1N33O 4DR4B 5JVDA 1K5SA 4TWKA 5K1PA 5LMUB 3JD0A 4DV6O 3H1HH 4UCSA 4I50A 3SPCA 3J7AU 3AG3C 5LBQA 4LH6A 5JH7A 4U3JA 4DV3B 3STZC 4FLXA 1MA1A 1DTOA 2PI5A 4UB8Z 3O9OA 2B1IA 4J41A 3KG2A 2LFSA 4IL6Z 5FNVA 1SF9A 3SPIA 3CE2A 5GTHZ 5EBLC 2ZDIC 3FB7C 4LFAO 3LNNA 3CXHF 3SYQA 4IT5A 4DV5B 2HLDG 1E1RG 2DE0X 3AG2C 1XBLA 3CJHA 3ZS8C 4J7JA 4PI2A 3U10A 3RVYA 1G8MA 4NXNO 1FD9A 3U11A 4J9YB 3SJAC 1PNMA 4NXMB 1H2GA 3TETA 1E79G 3DC5A 3CRQA 4JASA 4QPJA 4HYOA 1OZ0A 2NNUA 3CCQV 2H8PC 1WNSA 2V4DA 3THOA 4JI1B 2QKAA 3DXRB 3FD9A 4MSWC 3FB6C 2P22C 4PD4F 2QKSA 1GMGA 2QE7G 4R50A 1D5AA 3CCSV 4IHJA 1VQ7V 1PV0A 2XHBA 5IWAO 3EXAA 1JPXA 1YF2A 2IJJA
chains in the Genus database with same CATH topology
1QCEA 2HR3A 5E1AC 2UXNA 2ATKC 4LC1A 5LHGA 1GK9A 3CCVV 2FTKA 2R9RB 5LHHA 4U7NA 4R6ZA 3I56V 1W0KG 1AR1B 3OE7G 2W0FC 2WSSG 3SYPA 2JDIG 1JOYA 4X89A 4PDLA 4WFBV 2HG5C 3RBZA 1YJ9V 1NR7A 1KP2A 5LGTA 1S76D 3JD2A 4MTXA 3CMEV 1AI7A 2JEUA 3OAAG 4WF9V 3OR7C 3A0RA 2OCCB 3ZRXA 3ZMUA 4EKWA 2IW5A 2EILB 1KC8W 5B1OA 2A9HA 2ZD9A 5L3CA 3WG7C 1KECA 3OEEG 1NR1A 3ASOC 4ZKIA 3CCMV 1VQ9V 3K3WA 5H6QA 4XDKA 3OMAB 1M57B 3X2QB 2AHZA 1S0VA 2Y48A 1W2BU 3T4DA 2DWDC 3E8BA 4MT8A 1UJWB 4BW5A 3CCEV 3P30A 4XDLA 3FKSG 2ITCC 4DO2A 5L3EA 1K4CC 3ETDA 3LNMB 3MHSC 4E2LA 5B1AC 1YJNV 2EIMB 2W6JG 3CP1A 5J9PC 4UVBA 3CCLV 3ASNC 1Q81W 2EIJC 4JAUA 2BOCC 1PD3A 3DGEA 2XAGA 2WLHA 1CP9A 1EBOA 4N23A 5B1BB 4PA7A 1FXVA 2EBOA 1Q7YW 4JAVA 1VQ4V 1FXKC 2DWEC 4QJFB 4U7OA 3QO7A 1FXKA 1OCRC 2Z3YA 2F43G 3ZMSA 2DYRB 4UVCA 3ZJZA 2X7RB 3ZMZA 3H01A 4I5SA 4RQEA 2EZOA 1MSWD 2LFRA 3ABKB 2DQ0A 1WPXA 2Z5UA 3F7YC 1CPYA 1QLEC 2X0LA 3E89A 1M56C 1XL6A 5KA5A 4UV9A 4R7CA 3LDDA 1SZTA 2D3OW 2Y69B 4BIZA 4N21A 3VOUA 1V55C 3ZN1A 1R3IC 3AG3B 3W7SA 1YI2V 3K06A 5HFLA 1V54C 3FB5C 3CYOA 4CZZA 2DW4A 3ETGA 4RO2A 3ZMTA 1OCOC 3LUTB 1R6KA 3ABLC 1H8HG 2QA4V 1GM9A 3SJQC 4FMTA 3LSSA 4MVQA 2OTLV 4CBCA 3IFXA 1CEZA 2WLIA 1SETA 2XAHA 2ITDC 3K03A 2IJKA 2Q69A 2WAMA 2HVKC 4KUMA 1VQ8V 3AG4B 1PKXA 3T1CA 1Q82W 1GO3F 3D3IA 2A0LA 4GX2A 4R8CA 3T4ZA 1Y66A 1VQ6V 4BIUA 4HAMA 1GTOA 1YSCA 5B3SB 5DN6G 1P4RA 2B1GA 1R3KC 4FIPC 4YXWG 3CCJV 2DYSC 4JYCA 2YEVA 5B1NA 1H8EG 1ENVA 3AG2B 3UKMA 5LHIA 1R73A 3AG1B 4P9OA 1E1QG 1KP3A 5EBWC 2EINB 2WLLB 4FJCC 3CPWU 4BAYA 4WFGA 2IU0A 4H33A 4OXSA 4MW8A 2WLIB 1FS0G 4MVUA 3ZRVA 3K04A 2ZR3A 3SYCA 3E35A 1FXHA 1F4NA 2BOBC 1QVGU 1AJQA 1FFTB 4DXWA 4UXNA 1GKFA 2IU3A 5L3DA 1J95A 1OCZB 2X6CA 4G27B 3SPGA 5IY5B 2B5UA 1NVPB 1K8AW 3B8MA 5KUKA 3STLC 1NH2B 2M7WA 1IXMA 2EIKC 3ZIAG 4WFFA 3SPHA 3FB8C 2ZQMA 2OTJV 3BY6A 3JYCA 4MVSA 3ML0A 5LGUA 2Q68A 3RW0A 3CMAV 1N8RW 3EFFK 3GWOA 3QO5A 3CD6V 3OMIB 3IC7A 3ZN0A 1YJWV 2HFEC 4LBEC 2MK3A 3R65A 1NJIW 1KD1W 4RUFA 1YITV 1K33A 1RPRA 1VQ5V 3W7TA 3E8FA 1COWG 3E83A 4QE7A 3OW2U 2ZXWC 3PJSK 1F23A 1EZJA 1K7DA 2EJRA 3TCUA 1BMFG 1OCCC 4XDJA 4X8AA 3E86A 1AI6A 3OM3B 3OUFA 3ZRWA 5CA3A 1I5YA 1K3EA 2P67A 4G28B 2HKOA 4PA3A 1JJ2U 1NKDA 3WG7B 1BHAA 1PNLA 2IH3C 2HJFC 4MTGA 3SYAA 3BEHA 4JTDB 3ASOB 3OUSA 1AJPA 4PDRA 4QIWF 3AEIA 4MVMA 2ZR2A 1JX9A 3W7XA 3E8HA 2XNDG 4WCEV 1LNQA 2P6JA 3ABMC 1L1FA 1AJNA 4JF3A 4P30A 4WFHA 1SRYA 3UM7A 1YHQV 2WLMA 4LP8A 1THZA 2GSMB 2IH1C 4JTAB 1RM1C 3QNEA 2JEXA 3ABUA 1NVPD 4L87A 1PL0A 5C93A 5B1AB 5CN0A 1I5XA 3IGAC 1NH2D 3ASNB 3M99B 2V1DA 4P2ZA 4I9WA 2EIJB 2HVJC 1XL4A 3CXCU 4KP4A 4Z1MG 4UUJC 1SERA 1S77D 1VQMV 3HB3B 3K0GA 4QNHB 3I55V 3CCUV 1FXKB 4UVAA 5GW7A 2CK3G 3LDEA 3TK1A 1OCRB 1S72V 4ZBMA 2XOKG 4H37A 4MVRA 3SPJA 1R6NA 4MTOA 2XAQA 1F51A 1GM8A 5FL7G 3K0DA 1G4YB 3MHHC 1EFRG 4X88A 5BZBA 5KA6A 4ASUG 3W7WA 1WLEA 4RAIA 3HPLC 4QPKA 2WLJA 3OEHG 1QLEB 4PA6A 2PI4A 1M56B 4WFAV 1VQOV 4FK5C 5L3BA 2QTOA 4PELA 1MOFA 1KKDA 4PA4A 1R3JC 1V55B 3RVZA 2GHYA 3F5WC 2H94A 3F7VC 5CMUA 4P9PA 2DQ3A 1V54B 3CC7V 4GT1A 1AROP 4PDVA 5EC1C 1OCOB 4GX5A 3NXSA 4RUEA 1SESA 3ABLB 2OCCC 2UXXA 1VQNV 2R9IA 1DF4A 2P90A 2EILC 2JJ2G 3K08A 3LSQA 2P7TC 4JTCB 1DF5A 5CBHA 4PA9A 1K34A 5EC2C 1QVFU 1BL8A 2V7QG 2WPDG 3CC2V 4Q20A 1M57C 3JD1A 1B6QA 3X2QC 1VQKV 2YEVB 5IYDO 2K1EA 2DYSB 2X6AA 3E8GA 2IJHA 1PNKA 4MTFA 3OFNG 1S5HC 4WFEA 2EIMC 1QLNA 1AI5A 1M1KW 3GB7C 1HWYA 3QO8A 2XASA 5L3FA 3VBBA 5B1BC 4UV8A 1QBZA 5EK0A 3JD3A 3G71V 2WLKA 2OT5A 1K9MW 2QM8A 1M90W 1W0JG 3E2EA 2DYRC 4JYBA 1ZWIC 1P7BA 1K97A 3EHBB 1Y4MA 5CBGA 5EBMC 2Q67A 5H6RA 1JVMA 3ABKC 1M9NA 2LP7A 3OGCC 4GX1A 4TSFG 4G2KA 4TT3G 2XAFA 4F4LA 3DTUB 1K5SA 4TWKA 2NLJC 3JD0A 2W6IG 2EIKB 2Y69C 5H9CA 4RQFA 1MABG 3SPCA 3AG3C 5LBQA 1YTFB 1QR9A 1DLBA 3STZC 5IYCO 3LDCA 3D36A 2QEXV 1K92A 3FYEB 4GCZA 2YSUB 1DTOA 2IJIA 5CBFA 5IYBO 3JD4A 2PI5A 4MW3A 4QE9A 5KUMA 4HZ3A 1K73W 2C2AA 2JIZG 1BHBA 1ROPA 5HFMA 1S3JA 2B1IA 3OMNB 3B77A 3P32A 2XAJA 1NQTA 1AI4A 3AG4C 3ZMVA 3KG2A 2LFSA 4FPPA 2AHYA 4GX0A 1YIJV 2ZXWB 3G4SV 4MVZA 3SPIA 4PDMA 1R3LC 2WWWA 5B3SC 3ZRWB 1OCCB 3K9AA 5EBLC 2ZDIC 3FB7C 3OR6C 3FYIB 3SYQA 3SYOA 2EZPA 2ZDIA 1H38A 1K4DC 4MS2A 2KB1A 2HLDG 1E1RG 3ZRSA 4MVOA 3AG2C 3ZCCA 1JQ0A 3AG1C 1VQPV 1KQSU 1OHHG 1Q86W 2EINC 2X6BA 3RVYA 1G8MA 5LGNA 5DM6V 2JJ1G 2WLLA 4XBFA 4LCUC 4KFMA 1TUEB 3ABMB 2Q6AA 1MG1A 4J9YB 1VQLV 1PNMA 2JK5C 1H2GA 3TETA 1E79G 4JASA 4QPJA 4HYOA 1RM1B 3K79A 1OZ0A 2A79B 2NNUA 3CCQV 2H8PC 1RPOA 1JCHA 2QM7A 3G6EV 4JPRA 4J9ZB 3W7UA 4MSWC 1OCZC 3FB6C 3MD0A 5IY5C 3WFVA 1YTFD 3B8NA 2QKSA 1K5QA 1GMGA 1NBMG 2QE7G 3ABTA 4R50A 4JGSA 3T2MA 2WLNA 3CCSV 1GM7A 1VQ7V 3CCRV 1F4MA 3ETEA 1QR8A 5L3GA 5IDJA 3JCZA 3CC4V 1JPXA 2IJJA 1ORQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL V;  1KC8 W;  2QEX V;  1VQK V;  1Q81 W;  3CCQ V;  3CPW U;  1K9M W;  1M90 W;  1VQ5 V;  4WCE V;  1VQ8 V;  3OW2 U;  3CC7 V;  1S72 V;  3CCV V;  3G6E V;  1Q82 W;  2D3O W;  2OTJ V;  1YHQ V;  3I56 V;  1VQP V;  3CCM V;  1K8A W;  1KQS U;  1VQ9 V;  1VQ6 V;  1Q7Y W;  1VQN V;  1Q86 W;  1K73 W;  1VQ4 V;  1YI2 V;  3CMA V;  1M1K W;  5DM6 V;  1N8R W;  3CCJ V;  1W2B U;  1JJ2 U;  1QVG U;  4WFB V;  1YJ9 V;  3CD6 V;  3CXC U;  3CCE V;  1YIJ V;  3CCS V;  4WFA V;  3G4S V;  1VQL V;  3CME V;  1VQO V;  1VQ7 V;  3CCR V;  2QA4 V;  1QVF U;  1VQM V;  2OTL V;  1YJW V;  1R73 A;  4WF9 V;  3CC2 V;  3G71 V;  3I55 V;  3CC4 V;  1NJI W;  1KD1 W;  3CCU V;  1YJN V;  1YIT V; 
#chains in the Genus database with same CATH topology
 1IXB A;  2UXN A;  2ATK C;  4LC1 A;  3NR7 A;  5CB4 B;  2FTK A;  5J2T B;  2R9R B;  2ZE8 A;  1W0K G;  3FFQ A;  4OPH A;  2CGO A;  4CH5 A;  2JDI G;  4LF5 O;  4AIL C;  4X89 A;  4WFB V;  2HG5 C;  4DR1 B;  4GKK B;  4LF5 B;  3JD2 A;  4MTX A;  3CME V;  1J5E B;  3N2G A;  3OAA G;  3C90 A;  5JJE B;  3GVM A;  2P06 A;  5GTI Z;  1JMK C;  4B3R B;  1XOU A;  4ZKI A;  1VQ9 V;  3L71 H;  1BQZ A;  1WA8 A;  1S0V A;  1W2B U;  5IYZ A;  4DV1 O;  2QDO A;  3HKE B;  1XNQ O;  4E2L A;  1RSO A;  5B1A C;  1YJN V;  1DGS A;  2W6J G;  5J9P C;  3ASN C;  2UXC B;  2PUS A;  3G6B A;  2FL4 A;  4LWS B;  4JAU A;  3ZED A;  4J42 A;  1HNX O;  3FAV B;  1EBO A;  1SC5 B;  2EBO A;  5ITZ A;  5BR8 B;  2Q8V A;  2DWE C;  1SZX A;  1XNR O;  1FXK A;  1OCR C;  2F43 G;  4JAA A;  1ZL8 A;  3H1K H;  3H01 A;  4RQE A;  4B3T O;  1SS3 A;  3ABK B;  3CS5 A;  1XHX A;  3RGB A;  1QLE C;  4K35 A;  4I50 B;  3WB1 A;  2D3O W;  2GUZ B;  4BIZ A;  4U3J B;  2LQT A;  1V55 C;  3ZN1 A;  1IBM B;  3K06 A;  5HFL A;  3T1Y O;  3CX5 F;  4LFC O;  4CZZ A;  3ETG A;  3ZMT A;  3LUT B;  1JFF A;  2QWP B;  1KUQ A;  1GM9 A;  2VRZ A;  3SJQ C;  1HNW B;  4DYL A;  1BSM A;  2BCC H;  3K03 A;  2WAM A;  4KUM A;  3ZHQ A;  2PZS A;  1PKX A;  1NTZ H;  4R8C A;  2A0L A;  4HAM A;  2CDY A;  4DV0 O;  2UUB O;  4YXW G;  4JYC A;  3CJH B;  4LF8 B;  1ZSP A;  2Y4T A;  4DV2 O;  1R73 A;  3AG1 B;  2F93 B;  4FZ0 A;  2VQE B;  5KHG A;  1KP3 A;  1XI1 A;  5C8Y A;  4EFB A;  2YXY A;  2GV9 A;  1Q3E A;  2JGU A;  4BAY A;  4WFG A;  2IU0 A;  2KSD A;  1ZLZ A;  1AR5 A;  5KX5 B;  3VQW A;  4MVU A;  1VF7 A;  3K04 A;  2CTQ A;  3SYC A;  4DR2 B;  1QVG U;  2PTM A;  1FFT B;  4UCT A;  3R66 A;  4DXW A;  5L3D A;  5IY5 B;  3B8M A;  4YY3 O;  3ZHT A;  3AG7 A;  2M7W A;  1IXM A;  1KYO F;  4IHJ B;  4YJ2 A;  4WFF A;  3JAK A;  2OTJ V;  3BY6 A;  4X62 B;  3EFF K;  3QO5 A;  2VS0 A;  3ZN0 A;  1I94 B;  1YJW V;  1NZ6 A;  1V9P A;  2LO1 A;  1K33 A;  4UB6 Z;  1EZJ A;  4X8A A;  3E86 A;  3OM3 B;  3ZRW A;  1K3E A;  2CTP A;  4PA3 A;  4NKG B;  1BHA A;  4B3M O;  2QM4 A;  1WA8 B;  3L70 H;  2RQ6 A;  3OUS A;  1AJP A;  2XT9 A;  5EIB D;  4JI8 O;  3L74 H;  2Y0I A;  5IYZ B;  2RDC A;  1L1F A;  1YHQ V;  1BE3 H;  1THZ A;  1RSO B;  4JTA B;  4TV9 A;  4L87 A;  1PL0 A;  5CN0 A;  3IGA C;  4P2Z A;  4DW0 A;  3P3N A;  1VF6 C;  3N2K A;  4OPA A;  3CXC U;  4KP4 A;  4PV1 B;  5ITZ B;  1SER A;  1VQM V;  3HB3 B;  1H2K A;  3CCU V;  5EYP A;  4BR6 A;  1FXK B;  1L8D A;  1YVW A;  4B7E A;  4GZR B;  1G6U A;  3CEI A;  1ZL8 B;  3LDE A;  3TK1 A;  4MVR A;  3A2F A;  2E76 B;  1R6N A;  1P49 A;  2XAQ A;  5KA6 A;  5BZB A;  3W7W A;  3S3W A;  3K58 A;  3HPL C;  1R1B A;  4QPK A;  2F66 C;  5L3B A;  4PEL A;  1KKD A;  4PA4 A;  4CS3 A;  2Q0A A;  2GHY A;  3F7V C;  1EN6 A;  5FPR A;  5FPO A;  1V54 B;  2QR4 A;  1JFF B;  2GBO A;  5KHI A;  1OCO B;  5FLX N;  1TA8 A;  2UXX A;  1BQ0 A;  1VQN V;  1DF4 A;  2EIL C;  2IBZ H;  2BTO A;  3LSQ A;  2RNB A;  4ICG A;  1K34 A;  4DUY O;  2Y4U A;  1WP7 A;  5GON A;  4LF4 B;  1HNZ B;  3SJC C;  1N0N A;  1RP3 B;  2GTA A;  4RWU A;  3X2Q C;  5IYD O;  1R6T A;  3E8G A;  4IIJ A;  4MTF A;  3OFN G;  5C8Y B;  2CE4 A;  2Q9L A;  2EIM C;  3RYH A;  1HWY A;  2CUG A;  3B09 A;  4D7T A;  1FFX B;  4J80 A;  1QBZ A;  5EK0 A;  3JD3 A;  1XHZ A;  2OT5 A;  5LMN B;  1K9M W;  3ZBH A;  1W0J G;  4LF9 O;  3E2E A;  2DYR C;  4J7Z A;  1ZWI C;  2ZE6 A;  4O2A A;  4TQD A;  4O4L B;  4YJ2 B;  1P7G A;  3JAK B;  2W6I G;  2EIK B;  1XEQ A;  3D36 C;  3H1J H;  4B08 A;  1QR9 A;  1DLB A;  3LDC A;  4YHH O;  2UXD O;  4X1Y A;  4H0L B;  4K0K O;  2BTQ B;  4YHH B;  5IYB O;  3JD4 A;  4MW3 A;  3CRM A;  1K73 W;  4QGP A;  1CXZ B;  1ROP A;  2PGG A;  3B77 A;  1SQX H;  1YZB A;  1NQT A;  1WJZ A;  1TVK A;  1AI4 A;  3AG4 C;  4KXR A;  3ZMV A;  5CA1 A;  3OTO B;  1YIJ V;  1IBK O;  4I9Q A;  3U0Z A;  4PDM A;  2WWW A;  3G67 A;  3ZRW B;  3DXR A;  4JI5 B;  4DV4 O;  4LFB B;  2ZDI A;  1H38 A;  2R70 A;  4MS2 A;  4LF7 B;  3ZRS A;  1XUQ A;  2P4V A;  3ZCC A;  1KQS U;  4FFB B;  3CRA A;  2X6B A;  3WB2 A;  2JJ1 G;  2E5L O;  1XMO O;  2L6L A;  1TUE B;  3ABM B;  2N05 A;  4CH3 A;  1VQL V;  2AZ0 A;  5CB4 A;  4TV9 B;  4HNA A;  4X9Q A;  1BCC H;  1RM1 B;  1Y74 B;  3K79 A;  5EZY A;  4LNU A;  3N2K B;  1RPO A;  3CRR A;  2JS5 A;  4JPR A;  4J9Z B;  4DR7 B;  5EYP B;  2ADQ B;  4YJ3 B;  3OT7 A;  1U96 A;  3IC9 A;  3ABT A;  3JSL A;  1LR1 A;  2Q7H A;  1IBL B;  1N36 B;  2JS3 A;  1QR8 A;  4W4L A;  2ZKO A;  1U97 A;  1KU9 A;  2AW9 A;  2DMX A;  4K8X A;  1GN4 A;  2DN9 A;  4OGQ B;  3CCV V;  1Z5V A;  4U7N A;  3SGI A;  3I56 V;  3SJB C;  1AR1 B;  1O9H A;  3TJT A;  2R9A A;  3VQY A;  4JI0 O;  4JI7 O;  1NR7 A;  5LGT A;  2M6Y A;  5JJJ B;  2RN9 A;  2P4K A;  4LWS A;  2FB5 A;  3A0R A;  2OCC B;  4EKW A;  2IW5 A;  1KC8 W;  5B1O A;  5L3C A;  4FM1 A;  5GON B;  1SQF A;  1GRJ A;  3JAL A;  3ZX6 A;  1NR1 A;  3ASO C;  5H6Q A;  4XDK A;  3BAB A;  2UUA O;  3BA8 A;  3OMA B;  1M57 B;  1BS3 A;  2AHZ A;  2Y48 A;  3E8B A;  5LOV B;  1N33 B;  2DOS A;  4IIJ B;  3P30 A;  4XDL A;  1WB7 A;  3KCX A;  2ITC C;  3JSN A;  4JZ2 A;  3ETD A;  4DO2 A;  3LNM B;  4CH4 A;  2GUZ A;  3RYH B;  4DV6 B;  2EJ7 A;  3CCL V;  2FYU H;  1Q81 W;  2EIJ C;  3UO2 A;  1PD3 A;  1I0H A;  1CP9 A;  4JI3 O;  4N23 A;  2B9Z A;  5KHJ A;  4I7Z B;  2YID A;  2Z3Y A;  4DR6 O;  1N4C A;  1P84 F;  3ZMS A;  1FJG O;  4O2A B;  4I5S A;  2EZO A;  2LFR A;  3CSX A;  3F7Y C;  3KZI Z;  2X0L A;  3E89 A;  1B04 A;  1M56 C;  5KA5 A;  4LFA B;  3LDD A;  1SZT A;  1ZTE A;  3HKC B;  5LP6 C;  3AG3 B;  1GN3 A;  1Q8I A;  4X1Y B;  3CYO A;  3RYC A;  4RO2 A;  2DW4 A;  2LW7 A;  2UXB O;  4NXN B;  5CA0 B;  2QA4 V;  4FMT A;  3IFX A;  1SET A;  2BE3 A;  1TVK B;  4B7K A;  5KX5 A;  1H2M A;  5CA1 B;  4JI4 O;  5TIS Z;  2ZE7 A;  3T1C A;  5KAI Z;  3BAA A;  2CGN A;  4BIU A;  1GTO A;  4CH6 A;  1JR9 A;  1F7Y A;  2DYS C;  2GTS A;  1ZUQ A;  4I0X A;  3AG2 B;  4KL1 A;  3UKM A;  5LHI A;  4GLX A;  4JI6 O;  4P9O A;  4TOI A;  4X65 O;  1E1Q G;  5IWA B;  2MW2 B;  4HNA B;  2WLI B;  1MNG A;  5IJ9 A;  4OX9 O;  1MZE A;  5EZY B;  3QVN A;  4LNU B;  1QQC A;  3E35 A;  4AHC A;  3D8C A;  4EB6 A;  4O4J A;  2OWO A;  1QU7 A;  2X6C A;  3SPG A;  1NVP B;  1K8A W;  4O4H A;  5KUK A;  1Y67 A;  3STL C;  2QJ1 A;  3ZIA G;  2Q73 A;  3SPH A;  4CC6 A;  3S3X A;  4MVS A;  3ML0 A;  2JVD A;  1IZ3 A;  4HBN A;  4LR3 A;  3ETQ A;  3RW0 A;  3DSQ A;  1BT8 A;  2LGQ A;  2YC0 A;  3HKD A;  4DV1 B;  4F6E A;  2MK3 A;  3ZHV A;  1XNQ B;  3AK1 A;  2F4V O;  3RYI B;  3W7T A;  4JV5 O;  4QE7 A;  2ZXW C;  2EJR A;  2ZIM A;  4DV7 O;  1BMF G;  2JGD A;  1OCC C;  1AI6 A;  3OUF A;  2QKC A;  1HNX B;  5CA3 A;  1I5Y A;  2HKO A;  3JAL B;  3G80 A;  1DK1 A;  1PNL A;  2HJF C;  1XNR B;  3BEH A;  3AEI A;  3FX7 A;  3W7X A;  5A2Q N;  1LNQ A;  4B3T B;  1AJN A;  4YIO A;  1SRY A;  1UFI A;  2WLM A;  5LYJ A;  3ABU A;  1NVP D;  5JCO A;  5B1A B;  4O2B A;  3ASN B;  4I9W A;  1XL4 A;  3T1Y B;  4Z1M G;  1VF6 A;  4LFC B;  4J7K A;  4B3S O;  4QNH B;  3TXQ A;  2Q5Z A;  4UCU A;  4UVA A;  5GW7 A;  2CK3 G;  1OCR B;  1VEW A;  4H37 A;  1L0N H;  4MTO A;  1F51 A;  1GM8 A;  2EUL A;  1G4Y B;  3MHH C;  4ASU G;  2WLJ A;  3C3T A;  1TUB A;  4YIP A;  1QLE B;  4PA6 A;  2PI4 A;  4DV0 B;  1VQO V;  2UUB B;  3M8A A;  1IUR A;  1V55 B;  3F5W C;  1H2L A;  3RYC B;  4DV2 B;  4P9P A;  2YUA A;  3CC7 V;  3VQV A;  1ARO P;  1Q6H A;  3E22 A;  4PDV A;  4GX5 A;  3A8T A;  1GN6 A;  1FFX A;  1Q90 D;  4KHP O;  1XIL A;  4H44 B;  2XUM A;  5CBH A;  5J2U A;  3RT3 C;  5EC2 C;  3P3P A;  1QVF U;  2WPD G;  2V7Q G;  3L72 H;  3JD1 A;  4FLT A;  4Q6G A;  3BRC A;  3GWK C;  1IDS A;  2X6A A;  4I0X B;  4O4L A;  4YY3 B;  3QF7 A;  2IJH A;  1XQ8 A;  1PNK A;  2ZIO A;  4WFE A;  1AI5 A;  1M1K W;  3T1H O;  4JI2 O;  4IYH A;  2XAS A;  2XTA A;  3VBB A;  5IJ9 B;  5B1B C;  2BTQ A;  2WLK A;  3G71 V;  4EB6 B;  4O4J B;  1D5N A;  1K97 A;  2QWR B;  3K59 A;  2ZM6 O;  5EBM C;  2Q67 A;  4O4H B;  1M9N A;  1JJO A;  3DTU B;  2Y69 C;  1AB3 A;  1YEW A;  2N04 A;  5BMV A;  4RQF A;  1QNM A;  1VIB A;  5IYC O;  1T5E A;  3D36 A;  4B3M B;  4FFB A;  3FYE B;  4X1K A;  4GCZ A;  1D2D A;  2YSU B;  4JI8 B;  2QTS A;  2OIE A;  3HKD B;  5CBF A;  1XMQ O;  2UU9 O;  2CH7 A;  4ABM A;  5KUM A;  1BHB A;  4LF6 O;  5HFM A;  3P32 A;  2XAJ A;  4CC5 A;  1Y74 A;  4GX0 A;  3G4S V;  1NTK H;  2JGD B;  4MVZ A;  1R3L C;  1SQQ H;  1AR4 A;  5B3S C;  1PPJ H;  2UUC O;  3SYO A;  2EZP A;  5KHH A;  4YJ3 A;  2KB1 A;  1YXB A;  4D6T H;  4MVO A;  1FAF A;  2DJV A;  5IT9 N;  1Q86 W;  2EIN C;  4DK0 A;  4GYC B;  5D5P A;  4XBF A;  3AK2 A;  3LSU A;  4LCU C;  2JK5 C;  4BW9 A;  5LYJ B;  1AP6 A;  4O2B B;  2A79 B;  4A5U B;  3CHX A;  4EEQ A;  1HW7 A;  2QM7 A;  3G6E V;  4DR3 O;  2L35 A;  4AI8 A;  1OCZ C;  3MD0 A;  3WFV A;  1IVS A;  3UCS C;  3UO3 A;  2OIG A;  3C3S A;  1NBM G;  4TV8 B;  4JGS A;  2ZT9 B;  3T2M A;  1L0L H;  1F4M A;  3ETE A;  5L3G A;  5IDJ A;  3B2E E;  4DUY B;  3JCZ A;  1MG1 A;  1LUV A;  1TUB B;  3KKY A;  2HR3 A;  2QWN B;  5LHG A;  1GK9 A;  4DRX A;  5LHH A;  4R6Z A;  4FLW A;  5LOV A;  4FLY A;  4Z1V A;  4X20 A;  1JOY A;  5KAF Z;  3E22 B;  4PDL A;  1YJ9 V;  3JAS B;  3RN4 A;  1KP2 A;  2JEU A;  2E3C A;  3ZRX A;  3ZMU A;  2EIL B;  1WAZ A;  5J2U B;  2A9H A;  4JYA O;  3WG7 C;  2YXL A;  4X64 O;  2VWK A;  4LF9 B;  2KQX A;  2PYL A;  1SQB H;  3WU2 Z;  3X2Q B;  4ZOL B;  3T4D A;  2DWD C;  4MT8 A;  4BW5 A;  3FKS G;  1K4C C;  1PL4 A;  4ZHQ B;  2VQF O;  3HKC A;  2EIM B;  3CP1 A;  2VQF B;  2QGN A;  1MZF A;  2ZCE A;  2BOC C;  2YI9 A;  3DGE A;  2WLH A;  5LL6 Y;  2UXD B;  1FXV A;  1SQG A;  5CA0 A;  4JAV A;  2VWJ A;  4K0K B;  5DEC A;  4ZI7 B;  2G38 A;  2DYR B;  3A0H Z;  3JAT A;  4TQF A;  3ZMZ A;  2OCH A;  2DQ0 A;  1IBK B;  4NVP A;  1Q43 A;  4I55 B;  3K5M A;  2AZ2 A;  1XL6 A;  5BXZ A;  4DV4 B;  4R7C A;  5BMV B;  2LJ2 A;  4BWA A;  5JQG A;  3VOU A;  1YI2 V;  4X1K B;  2NR5 A;  1XDC A;  3FB5 C;  3RFR A;  1HR0 O;  4AQY O;  1TGO A;  1KMI Z;  2CH7 B;  3ABL C;  1H8H G;  2E5L B;  1QHT A;  1XMO B;  4IYI A;  3LSS A;  1Z5W A;  3ZHU A;  1W59 A;  2WLI A;  2XAH A;  2ITD C;  4NTW A;  5KHK A;  2HVK C;  2RJZ A;  3AG4 B;  5IJ0 A;  1Q82 W;  1GO3 F;  4GX2 A;  3T4Z A;  1Y66 A;  1P4R A;  2B1G A;  3CCJ V;  1O9G A;  2A06 H;  5B1N A;  2QWQ B;  1KKC A;  1ENV A;  2Q7G A;  5EBW C;  4JZG A;  1N34 O;  1N32 O;  3B40 A;  1FS0 G;  4K8Z A;  3ZRV A;  3D3Q A;  2ZR3 A;  5AG2 A;  1SQV H;  1KB9 F;  2BOB C;  3RWR D;  2CAZ C;  2YDE A;  3RYI A;  1AJQ A;  4UXN A;  1GKF A;  4JI0 B;  4JI7 B;  4Z2W A;  1J95 A;  2B5U A;  4DUZ O;  4LH7 A;  4U3F H;  4X1I A;  2AGA A;  3FB8 C;  2ZQM A;  3JYC A;  3CMA V;  1N8R W;  3GWO A;  4DRX B;  4PI0 A;  2JRI A;  2UUA B;  3OMI B;  3IC7 A;  3B4S A;  3IAY A;  1Q6U A;  1N0J A;  1NJI W;  1KD1 W;  4X20 B;  4RUF A;  4X66 O;  1YIT V;  1RPR A;  5KLV H;  4DR5 O;  3CWB H;  2Q0O C;  1VQ5 V;  1VF5 B;  1COW G;  3OW2 U;  2LGW A;  1F23 A;  3TCU A;  4DR4 O;  5LMU O;  4XDJ A;  4JI3 B;  2P67 A;  1AIL A;  1NKD A;  3RYF A;  4DV3 O;  3SYA A;  4MTG A;  1X4T A;  4NB5 A;  2HJD A;  4JTD B;  4DR6 B;  3ASO B;  1JX9 A;  1B06 A;  1EM1 A;  1FJG B;  3E8H A;  1VP7 A;  4P30 A;  2YXH A;  2IH1 C;  2JEX A;  1I5X A;  2EIJ B;  2HVJ C;  2ADP A;  4UUJ C;  4DV5 O;  3I5D A;  3I55 V;  2UXB B;  1HDJ A;  5KMG A;  3JAT B;  2HHH O;  3SPJ A;  1WB8 A;  2W0X A;  2HHH B;  4JI4 B;  3M7M X;  4NXM O;  4GUN A;  1LUW A;  3OEH G;  1IX9 A;  4WBN B;  3O65 A;  1M56 B;  4WFA V;  4FK5 C;  5JQG B;  2F95 B;  3MDS A;  4JI1 O;  5LP6 B;  5CMU A;  1WN7 A;  2DQ3 A;  4JI6 B;  1NS1 A;  4GT1 A;  4X65 B;  4GKJ O;  1KBH A;  5EC1 C;  2N74 A;  3NXS A;  2HEP A;  1SES A;  4RUE A;  3MAQ A;  4GKJ B;  1Y76 A;  2R9I A;  5JWP A;  2P90 A;  3K57 A;  2JJ2 G;  3OD4 A;  4OX9 B;  5IJ0 B;  3CC2 V;  4UCV A;  4Q20 A;  1VQK V;  3K9S A;  2WA4 A;  3APQ A;  1Y6X A;  2DYS B;  4D7S A;  4CS2 A;  4NYK A;  1S5H C;  4DR1 O;  4GKK O;  4TUY A;  1FKA O;  4E4E A;  1J5E O;  2A7W A;  3QO8 A;  5L3F A;  5DED A;  4PHZ A;  4B3R O;  3JAW A;  2QM8 A;  1VAR A;  3ZHS A;  3EHB B;  2F4V B;  5CBG A;  4JV5 B;  3A0B Z;  3ABK C;  4TSF G;  4UCR A;  4DV7 B;  4G2K A;  4TT3 G;  2XAF A;  3KCY A;  4F4L A;  2NLJ C;  4X1I B;  1H2S B;  5H9C A;  4FM0 A;  2YIB A;  2UXC O;  1MAB G;  1YTF B;  1OV9 A;  2QEX V;  1K92 A;  4DW1 A;  2YI8 A;  5BR8 O;  1M4U A;  2IJI A;  4QE9 A;  4HZ3 A;  2C2A A;  2JIZ G;  5JJN B;  1URF A;  1S3J A;  3OMN B;  1FPO A;  5BY1 A;  3BCC H;  4EFE A;  4FPP A;  2AHY A;  4FZ1 A;  4F6R B;  2ZXW B;  2YIA A;  5JVD B;  1OCC B;  3K9A A;  3K5N A;  3TGU H;  3OR6 C;  3FYI B;  3RYF B;  1K4D C;  2YIC A;  4B3S B;  1IBM O;  4TV8 A;  5JH7 B;  1JQ0 A;  3AG1 C;  1VQP V;  1OHH G;  4J10 A;  5LGN A;  5DM6 V;  1AP5 A;  2WLL A;  4KFM A;  4I4T A;  2Q6A A;  2ODM A;  1HNW O;  2ETN A;  1EN4 A;  2H3O A;  1PM9 A;  5EIB C;  5F2V O;  3CRC A;  1BZK A;  5LXT A;  1SKV A;  3HR0 A;  4BIO A;  5FNV B;  1JCH A;  1A32 A;  3Q4H A;  4ZIB A;  5B5E Z;  4FLV A;  3JAS A;  3JAM N;  3W7U A;  3OGI B;  5IY5 C;  2RCV A;  5KMG B;  1YTF D;  3BFR A;  3B8N A;  4LF8 O;  1K5Q A;  1RFY A;  4NTX A;  2VQE O;  2WLN A;  4KHP B;  1Q6I A;  1GM7 A;  3CCR V;  5H5N A;  3CC4 V;  1ORQ C;  3CB2 A;  1QCE A;  1M93 A;  2WA3 A;  5E1A C;  2NN4 A;  3SDL A;  4ZOL A;  4DR2 O;  3OTF A;  3OE7 G;  2W0F C;  2WSS G;  3SYP A;  4ZHQ A;  1M5I A;  3RBZ A;  3H1L H;  1S76 D;  3T1H B;  1Y76 B;  4JI2 B;  1AI7 A;  4WF9 V;  3OR7 C;  4NR1 A;  2ZD9 A;  3HKB A;  1KEC A;  2Q7E A;  1NT2 B;  4ZI7 A;  3OEE G;  4X62 O;  3CCM V;  3K3W A;  4W4K A;  1H2N A;  2ZM6 B;  1I94 O;  1TAE A;  3ZHR A;  1UJW B;  4I55 A;  3CCE V;  1MMM A;  5L3E A;  1SA0 A;  4TUY B;  3MHS C;  1UPG A;  5E79 Z;  4UVB A;  1NTM H;  3N2G B;  4J11 A;  2K9P A;  1VMG A;  2XAG A;  5B1B B;  3JAW B;  4PA7 A;  1Q7Y W;  2QSA A;  2ZIN A;  1VQ4 V;  1FXK C;  2OYQ A;  1S5L Z;  4QJF B;  3DC6 A;  4U7O A;  1XMQ B;  2UU9 B;  4FLZ A;  2KG7 A;  3QO7 A;  5A9G A;  4LF6 B;  4UVC A;  3ZJZ A;  2X7R B;  1MSW D;  1WPX A;  2Z5U A;  1CPY A;  4UV9 A;  2UUC B;  2Y69 B;  5LA6 A;  5JCO C;  4N21 A;  3N27 A;  1R3I C;  3W7S A;  2PY5 A;  3ICX A;  1V54 C;  2A3Q A;  1BGY H;  2E74 B;  1OCO C;  1R6K A;  2OTL V;  4MVQ A;  4CBC A;  1HP8 A;  3K5O A;  1CEZ A;  2IJK A;  2Q69 A;  2ZNI A;  1VQ8 V;  4UFZ A;  1GN2 A;  1JA8 A;  2GDS A;  3D3I A;  3WB0 A;  1VQ6 V;  3JAR A;  1YSC A;  5DN6 G;  5B3S B;  2E75 B;  1R3K C;  4FIP C;  4DR3 B;  2BSK A;  3APO A;  3K5L A;  2YEV A;  3IJ4 A;  1H8E G;  2F1M A;  2IM9 A;  2EIN B;  2WLL B;  3L9D A;  4FJC C;  3CPW U;  4I4T B;  4DK1 A;  3UT5 A;  4H33 A;  4OXS A;  4MW8 A;  3JCU Z;  3BHP A;  5LXT B;  4LF4 O;  1PP9 H;  1HNZ O;  3Q4H B;  1FXH A;  1F4N A;  1X59 A;  4O4I A;  2FML A;  2YIB D;  2IU3 A;  4G27 B;  1OCZ B;  5B66 Z;  1NH2 B;  2EIK C;  4JYA B;  5LGU A;  4FM2 A;  2Q68 A;  3BVO A;  4X64 B;  3J81 N;  3SR2 C;  4IGG A;  4NTY A;  3CD6 V;  2Q4P A;  5LMN O;  5D5Q A;  2O57 A;  2PF4 E;  2HFE C;  2ZE5 A;  3H1I H;  4LBE C;  3R65 A;  1NI8 A;  3E8F A;  3E83 A;  1YDX A;  3PJS K;  4UCO A;  4FVM A;  3J80 N;  1K7D A;  1WP8 A;  5K1X A;  4C7U A;  4K3A A;  2R72 A;  1SQP H;  3HKB B;  4G28 B;  1JJ2 U;  2D2C B;  1G1X B;  3WG7 B;  1XRE A;  2IH3 C;  5H2F Z;  1B3Q A;  4PDR A;  4QIW F;  4MVM A;  2ZR2 A;  3L75 H;  3AK3 A;  2PYJ A;  2XND G;  4WCE V;  2P6J A;  3ABM C;  2P5O A;  1I7F A;  1SA0 B;  4JF3 A;  4WFH A;  4WBN A;  3UM7 A;  4LP8 A;  2GSM B;  3PN1 A;  3OTO O;  4FFK A;  1RM1 C;  3QNE A;  5C93 A;  2Z0A A;  1NH2 D;  2EX3 A;  5LP6 A;  3M99 B;  2V1D A;  1EZV H;  4JI5 O;  4H13 B;  1GH6 A;  2YS8 A;  1S77 D;  3L73 H;  1HR0 B;  4LFB O;  4AQY B;  3K0G A;  4LF7 O;  2KG7 B;  1S5J A;  1Z2G A;  1S72 V;  4ZBM A;  2XOK G;  1AVM A;  3EVK A;  1US6 A;  3K0D A;  5FL7 G;  4X88 A;  1EFR G;  5IE9 A;  1WLE A;  4RAI A;  3VQX A;  1ZX3 A;  5LA6 B;  2QTO A;  4PJ0 Z;  1MOF A;  5J2T A;  1FYJ A;  4JYY A;  1R3J C;  3RVZ A;  2CTW A;  2Y0P A;  1EN5 A;  2RMK B;  2H94 A;  4DR7 O;  1N34 B;  3ABL B;  2OCC C;  1N32 B;  1IBL O;  1N36 O;  3K08 A;  4JTC B;  2P7T C;  2ARH A;  1DF5 A;  4PA9 A;  2KKW A;  2F23 A;  4CS4 A;  1BL8 A;  2QWO B;  3JAR B;  1NU1 H;  1GAX A;  3BA9 A;  2CTR A;  1M57 C;  2BSK B;  1YCI A;  2AXT Z;  1B6Q A;  2YEV B;  2K1E A;  4DUZ B;  1I08 A;  3HKE A;  1QLN A;  3F5T A;  3GB7 C;  2ILM A;  3UT5 B;  1Q5O A;  4L8J A;  3BPZ A;  1MSD A;  1WPB A;  3H9V A;  4UV8 A;  2ZNJ A;  3TXS A;  3FAV A;  3QG5 A;  1OJH A;  2LW1 A;  4FLU A;  2HP8 A;  4O4I B;  1M90 W;  4JYB A;  1P7B A;  3UQ8 A;  4X66 B;  1Y4M A;  4DR5 B;  3QTC A;  2FKX A;  5H6R A;  4F6R A;  1JVM A;  1ZAU A;  2LP7 A;  3OGC C;  4GX1 A;  1N33 O;  4DR4 B;  5JVD A;  1K5S A;  4TWK A;  5K1P A;  5LMU B;  3JD0 A;  4DV6 O;  3H1H H;  4UCS A;  4I50 A;  3SPC A;  3J7A U;  3AG3 C;  5LBQ A;  4LH6 A;  5JH7 A;  4U3J A;  4DV3 B;  3STZ C;  4FLX A;  1MA1 A;  1DTO A;  2PI5 A;  4UB8 Z;  3O9O A;  2B1I A;  4J41 A;  3KG2 A;  2LFS A;  4IL6 Z;  5FNV A;  1SF9 A;  3SPI A;  3CE2 A;  5GTH Z;  5EBL C;  2ZDI C;  3FB7 C;  4LFA O;  3LNN A;  3CXH F;  3SYQ A;  4IT5 A;  4DV5 B;  2HLD G;  1E1R G;  2DE0 X;  3AG2 C;  1XBL A;  3CJH A;  3ZS8 C;  4J7J A;  4PI2 A;  3U10 A;  3RVY A;  1G8M A;  4NXN O;  1FD9 A;  3U11 A;  4J9Y B;  3SJA C;  1PNM A;  4NXM B;  1H2G A;  3TET A;  1E79 G;  3DC5 A;  3CRQ A;  4JAS A;  4QPJ A;  4HYO A;  1OZ0 A;  2NNU A;  3CCQ V;  2H8P C;  1WNS A;  2V4D A;  3THO A;  4JI1 B;  2QKA A;  3DXR B;  3FD9 A;  4MSW C;  3FB6 C;  2P22 C;  4PD4 F;  2QKS A;  1GMG A;  2QE7 G;  4R50 A;  1D5A A;  3CCS V;  4IHJ A;  1VQ7 V;  1PV0 A;  2XHB A;  5IWA O;  3EXA A;  1JPX A;  1YF2 A;  2IJJ A; 
#chains in the Genus database with same CATH homology
 1QCE A;  2HR3 A;  5E1A C;  2UXN A;  2ATK C;  4LC1 A;  5LHG A;  1GK9 A;  3CCV V;  2FTK A;  2R9R B;  5LHH A;  4U7N A;  4R6Z A;  3I56 V;  1W0K G;  1AR1 B;  3OE7 G;  2W0F C;  2WSS G;  3SYP A;  2JDI G;  1JOY A;  4X89 A;  4PDL A;  4WFB V;  2HG5 C;  3RBZ A;  1YJ9 V;  1NR7 A;  1KP2 A;  5LGT A;  1S76 D;  3JD2 A;  4MTX A;  3CME V;  1AI7 A;  2JEU A;  3OAA G;  4WF9 V;  3OR7 C;  3A0R A;  2OCC B;  3ZRX A;  3ZMU A;  4EKW A;  2IW5 A;  2EIL B;  1KC8 W;  5B1O A;  2A9H A;  2ZD9 A;  5L3C A;  3WG7 C;  1KEC A;  3OEE G;  1NR1 A;  3ASO C;  4ZKI A;  3CCM V;  1VQ9 V;  3K3W A;  5H6Q A;  4XDK A;  3OMA B;  1M57 B;  3X2Q B;  2AHZ A;  1S0V A;  2Y48 A;  1W2B U;  3T4D A;  2DWD C;  3E8B A;  4MT8 A;  1UJW B;  4BW5 A;  3CCE V;  3P30 A;  4XDL A;  3FKS G;  2ITC C;  4DO2 A;  5L3E A;  1K4C C;  3ETD A;  3LNM B;  3MHS C;  4E2L A;  5B1A C;  1YJN V;  2EIM B;  2W6J G;  3CP1 A;  5J9P C;  4UVB A;  3CCL V;  3ASN C;  1Q81 W;  2EIJ C;  4JAU A;  2BOC C;  1PD3 A;  3DGE A;  2XAG A;  2WLH A;  1CP9 A;  1EBO A;  4N23 A;  5B1B B;  4PA7 A;  1FXV A;  2EBO A;  1Q7Y W;  4JAV A;  1VQ4 V;  1FXK C;  2DWE C;  4QJF B;  4U7O A;  3QO7 A;  1FXK A;  1OCR C;  2Z3Y A;  2F43 G;  3ZMS A;  2DYR B;  4UVC A;  3ZJZ A;  2X7R B;  3ZMZ A;  3H01 A;  4I5S A;  4RQE A;  2EZO A;  1MSW D;  2LFR A;  3ABK B;  2DQ0 A;  1WPX A;  2Z5U A;  3F7Y C;  1CPY A;  1QLE C;  2X0L A;  3E89 A;  1M56 C;  1XL6 A;  5KA5 A;  4UV9 A;  4R7C A;  3LDD A;  1SZT A;  2D3O W;  2Y69 B;  4BIZ A;  4N21 A;  3VOU A;  1V55 C;  3ZN1 A;  1R3I C;  3AG3 B;  3W7S A;  1YI2 V;  3K06 A;  5HFL A;  1V54 C;  3FB5 C;  3CYO A;  4CZZ A;  2DW4 A;  3ETG A;  4RO2 A;  3ZMT A;  1OCO C;  3LUT B;  1R6K A;  3ABL C;  1H8H G;  2QA4 V;  1GM9 A;  3SJQ C;  4FMT A;  3LSS A;  4MVQ A;  2OTL V;  4CBC A;  3IFX A;  1CEZ A;  2WLI A;  1SET A;  2XAH A;  2ITD C;  3K03 A;  2IJK A;  2Q69 A;  2WAM A;  2HVK C;  4KUM A;  1VQ8 V;  3AG4 B;  1PKX A;  3T1C A;  1Q82 W;  1GO3 F;  3D3I A;  2A0L A;  4GX2 A;  4R8C A;  3T4Z A;  1Y66 A;  1VQ6 V;  4BIU A;  4HAM A;  1GTO A;  1YSC A;  5B3S B;  5DN6 G;  1P4R A;  2B1G A;  1R3K C;  4FIP C;  4YXW G;  3CCJ V;  2DYS C;  4JYC A;  2YEV A;  5B1N A;  1H8E G;  1ENV A;  3AG2 B;  3UKM A;  5LHI A;  1R73 A;  3AG1 B;  4P9O A;  1E1Q G;  1KP3 A;  5EBW C;  2EIN B;  2WLL B;  4FJC C;  3CPW U;  4BAY A;  4WFG A;  2IU0 A;  4H33 A;  4OXS A;  4MW8 A;  2WLI B;  1FS0 G;  4MVU A;  3ZRV A;  3K04 A;  2ZR3 A;  3SYC A;  3E35 A;  1FXH A;  1F4N A;  2BOB C;  1QVG U;  1AJQ A;  1FFT B;  4DXW A;  4UXN A;  1GKF A;  2IU3 A;  5L3D A;  1J95 A;  1OCZ B;  2X6C A;  4G27 B;  3SPG A;  5IY5 B;  2B5U A;  1NVP B;  1K8A W;  3B8M A;  5KUK A;  3STL C;  1NH2 B;  2M7W A;  1IXM A;  2EIK C;  3ZIA G;  4WFF A;  3SPH A;  3FB8 C;  2ZQM A;  2OTJ V;  3BY6 A;  3JYC A;  4MVS A;  3ML0 A;  5LGU A;  2Q68 A;  3RW0 A;  3CMA V;  1N8R W;  3EFF K;  3GWO A;  3QO5 A;  3CD6 V;  3OMI B;  3IC7 A;  3ZN0 A;  1YJW V;  2HFE C;  4LBE C;  2MK3 A;  3R65 A;  1NJI W;  1KD1 W;  4RUF A;  1YIT V;  1K33 A;  1RPR A;  1VQ5 V;  3W7T A;  3E8F A;  1COW G;  3E83 A;  4QE7 A;  3OW2 U;  2ZXW C;  3PJS K;  1F23 A;  1EZJ A;  1K7D A;  2EJR A;  3TCU A;  1BMF G;  1OCC C;  4XDJ A;  4X8A A;  3E86 A;  1AI6 A;  3OM3 B;  3OUF A;  3ZRW A;  5CA3 A;  1I5Y A;  1K3E A;  2P67 A;  4G28 B;  2HKO A;  4PA3 A;  1JJ2 U;  1NKD A;  3WG7 B;  1BHA A;  1PNL A;  2IH3 C;  2HJF C;  4MTG A;  3SYA A;  3BEH A;  4JTD B;  3ASO B;  3OUS A;  1AJP A;  4PDR A;  4QIW F;  3AEI A;  4MVM A;  2ZR2 A;  1JX9 A;  3W7X A;  3E8H A;  2XND G;  4WCE V;  1LNQ A;  2P6J A;  3ABM C;  1L1F A;  1AJN A;  4JF3 A;  4P30 A;  4WFH A;  1SRY A;  3UM7 A;  1YHQ V;  2WLM A;  4LP8 A;  1THZ A;  2GSM B;  2IH1 C;  4JTA B;  1RM1 C;  3QNE A;  2JEX A;  3ABU A;  1NVP D;  4L87 A;  1PL0 A;  5C93 A;  5B1A B;  5CN0 A;  1I5X A;  3IGA C;  1NH2 D;  3ASN B;  3M99 B;  2V1D A;  4P2Z A;  4I9W A;  2EIJ B;  2HVJ C;  1XL4 A;  3CXC U;  4KP4 A;  4Z1M G;  4UUJ C;  1SER A;  1S77 D;  1VQM V;  3HB3 B;  3K0G A;  4QNH B;  3I55 V;  3CCU V;  1FXK B;  4UVA A;  5GW7 A;  2CK3 G;  3LDE A;  3TK1 A;  1OCR B;  1S72 V;  4ZBM A;  2XOK G;  4H37 A;  4MVR A;  3SPJ A;  1R6N A;  4MTO A;  2XAQ A;  1F51 A;  1GM8 A;  5FL7 G;  3K0D A;  1G4Y B;  3MHH C;  1EFR G;  4X88 A;  5BZB A;  5KA6 A;  4ASU G;  3W7W A;  1WLE A;  4RAI A;  3HPL C;  4QPK A;  2WLJ A;  3OEH G;  1QLE B;  4PA6 A;  2PI4 A;  1M56 B;  4WFA V;  1VQO V;  4FK5 C;  5L3B A;  2QTO A;  4PEL A;  1MOF A;  1KKD A;  4PA4 A;  1R3J C;  1V55 B;  3RVZ A;  2GHY A;  3F5W C;  2H94 A;  3F7V C;  5CMU A;  4P9P A;  2DQ3 A;  1V54 B;  3CC7 V;  4GT1 A;  1ARO P;  4PDV A;  5EC1 C;  1OCO B;  4GX5 A;  3NXS A;  4RUE A;  1SES A;  3ABL B;  2OCC C;  2UXX A;  1VQN V;  2R9I A;  1DF4 A;  2P90 A;  2EIL C;  2JJ2 G;  3K08 A;  3LSQ A;  2P7T C;  4JTC B;  1DF5 A;  5CBH A;  4PA9 A;  1K34 A;  5EC2 C;  1QVF U;  1BL8 A;  2V7Q G;  2WPD G;  3CC2 V;  4Q20 A;  1M57 C;  3JD1 A;  1B6Q A;  3X2Q C;  1VQK V;  2YEV B;  5IYD O;  2K1E A;  2DYS B;  2X6A A;  3E8G A;  2IJH A;  1PNK A;  4MTF A;  3OFN G;  1S5H C;  4WFE A;  2EIM C;  1QLN A;  1AI5 A;  1M1K W;  3GB7 C;  1HWY A;  3QO8 A;  2XAS A;  5L3F A;  3VBB A;  5B1B C;  4UV8 A;  1QBZ A;  5EK0 A;  3JD3 A;  3G71 V;  2WLK A;  2OT5 A;  1K9M W;  2QM8 A;  1M90 W;  1W0J G;  3E2E A;  2DYR C;  4JYB A;  1ZWI C;  1P7B A;  1K97 A;  3EHB B;  1Y4M A;  5CBG A;  5EBM C;  2Q67 A;  5H6R A;  1JVM A;  3ABK C;  1M9N A;  2LP7 A;  3OGC C;  4GX1 A;  4TSF G;  4G2K A;  4TT3 G;  2XAF A;  4F4L A;  3DTU B;  1K5S A;  4TWK A;  2NLJ C;  3JD0 A;  2W6I G;  2EIK B;  2Y69 C;  5H9C A;  4RQF A;  1MAB G;  3SPC A;  3AG3 C;  5LBQ A;  1YTF B;  1QR9 A;  1DLB A;  3STZ C;  5IYC O;  3LDC A;  3D36 A;  2QEX V;  1K92 A;  3FYE B;  4GCZ A;  2YSU B;  1DTO A;  2IJI A;  5CBF A;  5IYB O;  3JD4 A;  2PI5 A;  4MW3 A;  4QE9 A;  5KUM A;  4HZ3 A;  1K73 W;  2C2A A;  2JIZ G;  1BHB A;  1ROP A;  5HFM A;  1S3J A;  2B1I A;  3OMN B;  3B77 A;  3P32 A;  2XAJ A;  1NQT A;  1AI4 A;  3AG4 C;  3ZMV A;  3KG2 A;  2LFS A;  4FPP A;  2AHY A;  4GX0 A;  1YIJ V;  2ZXW B;  3G4S V;  4MVZ A;  3SPI A;  4PDM A;  1R3L C;  2WWW A;  5B3S C;  3ZRW B;  1OCC B;  3K9A A;  5EBL C;  2ZDI C;  3FB7 C;  3OR6 C;  3FYI B;  3SYQ A;  3SYO A;  2EZP A;  2ZDI A;  1H38 A;  1K4D C;  4MS2 A;  2KB1 A;  2HLD G;  1E1R G;  3ZRS A;  4MVO A;  3AG2 C;  3ZCC A;  1JQ0 A;  3AG1 C;  1VQP V;  1KQS U;  1OHH G;  1Q86 W;  2EIN C;  2X6B A;  3RVY A;  1G8M A;  5LGN A;  5DM6 V;  2JJ1 G;  2WLL A;  4XBF A;  4LCU C;  4KFM A;  1TUE B;  3ABM B;  2Q6A A;  1MG1 A;  4J9Y B;  1VQL V;  1PNM A;  2JK5 C;  1H2G A;  3TET A;  1E79 G;  4JAS A;  4QPJ A;  4HYO A;  1RM1 B;  3K79 A;  1OZ0 A;  2A79 B;  2NNU A;  3CCQ V;  2H8P C;  1RPO A;  1JCH A;  2QM7 A;  3G6E V;  4JPR A;  4J9Z B;  3W7U A;  4MSW C;  1OCZ C;  3FB6 C;  3MD0 A;  5IY5 C;  3WFV A;  1YTF D;  3B8N A;  2QKS A;  1K5Q A;  1GMG A;  1NBM G;  2QE7 G;  3ABT A;  4R50 A;  4JGS A;  3T2M A;  2WLN A;  3CCS V;  1GM7 A;  1VQ7 V;  3CCR V;  1F4M A;  3ETE A;  1QR8 A;  5L3G A;  5IDJ A;  3JCZ A;  3CC4 V;  1JPX A;  2IJJ A;  1ORQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...