3CMEI

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cmeI00
1VQMI 1QA6A 1VQ9I 3CCLI 2NXNB 1VQNI 3PIOF 1VQPI 5GADJ 1ACIA 2E34A 1VQOI 4IOAF 3I56I 3CMAI 1YIJI 3CCSI 2QEXI 5DM6F 2OTLI 1VQKI 1FOWA 3CCJI 5GAHJ 3G6EI 3PIPF 1FOXA 3G71I 1YJNI 3CCMI 1FOYA 1VQ7I 1VQ5I 3CJTB 3CD6I 3I55I 2JQ7A 2QA4I 3CCRI 4IOCF 4UY8I 2E36A 2ZJPF 1YI2I 2FOWA 2OTJI 5JVGF 3DLLF 3CC4I 1YJWI 1Y39A 2ZJQF 3J7YJ 3G4SI 5GAEJ 1VQ4I 2ZJRF 4IO9F 2H8WA 3CF5F 3J7ZI 5DM7F 1YITI 3CC7I 1HC8A 3CMEI 2K3FA 5GAGJ 1VQ8I 3CCUI 1VQLI 2E35A 3CCQI 1S72I 1MMSA 1YJ9I 4V19K 3CC2I 1VQ6I 3CCVI 1YHQI 3CCEI
chains in the Genus database with same CATH superfamily
2I8DA 4OIOF 3QPLA 3CUOA 4RLFA 1XC5A 1RR7A 3HM5A 4XKVA 4AVZA 2IS2A 1R58A 4L5EA 3K4MA 4B8XA 4QPQA 1ACIA 3HHHA 1PVEA 1QPIA 2E34A 1QPMA 3E1SA 3VYUB 1ZR4A 1I6XA 2VJJA 1LB2A 3GXOA 4EGYA 1W7PB 2VBWA 3TO7A 3QWLA 1HQCA 3CO6C 5D8KB 4O5VA 3S2DJ 2M7BA 5K5OA 4AIKA 1K4SA 5IT3A 2IGOA 3FIWA 2AXLA 4ESBA 3MWMA 2B0LA 4L9VA 4L9NA 2Q2EB 2M5WA 3GMEA 3WU2C 3O3KA 3S32A 1R00A 3S1NJ 3M1CA 4F92B 2VJIA 5IP9J 2GIVA 5EYRA 3WTUC 1POGA 2ZMEB 3BP8A 2VJ4A 3SFIA 5IOZA 4EJVA 2E1MC 1IV8A 5TGTA 1W0TA 4I6ZA 4LJZF 3N05A 4MO7A 5K7ZA 3CCRI 2FBIA 1XX5A 2F5FA 3A1YA 1MKMA 3DKYA 5FFXA 3MN2A 3A02A 4RGRA 2IGMA 6PAXA 1UHMA 3AG3H 4WXDA 1YW8A 4BQAA 1IO2A 1OJLA 2W00A 1S9HA 5CQEA 4B44A 3BZ6A 4CDGA 2VBXA 2ZSHB 3H92A 4A3LJ 4IKFA 5FLXZ 3PFIA 1YJWI 2M4GA 2ECBA 4PUSA 5HLHA 4PCQA 2RREA 4GXOA 3GZ6A 1OISA 3N4MA 3ERED 2DXIA 1TNSA 1LDKB 3K70D 2V7FA 1D8KA 3FHNA 5GAEJ 1ZKGA 3U9GA 1MBEA 2O9LA 3CUQA 1CQTA 3ZQQA 3GWZA 4G8XA 1SVMA 3M3YJ 1QZYA 2H8WA 2CW8A 2EZLA 2MYSA 3RKWA 3HOVJ 3I59B 1U5TB 3PFYA 2AO9A 4XLFA 3V7CA 4C2TA 4A2UA 2M2EA 2RNJA 1VQ8I 2EB7A 2P6TA 2HOAA 3CCUI 2E7WA 2UZKA 1XMAA 3DBRB 1ETOA 3OYLA 1IXCA 1XTAA 2M9HA 4QPOA 3RKYA 1AKHB 2F2EA 1MMSA 2E2IJ 2XB0X 2K3PA 2X9DA 4K2EA 1I50J 1CF7B 1YG2A 2V4JC 5HDNA 4M3FA 4C2UA 1TWAJ 4ZJZA 3CCEI 2LY1A 3MAJA 2KIMA 2JWTA 3I9V2 5CVIA 1VQMI 4HX8A 4G7HF 3BLYA 3KP3A 3TQNA 1BI1A 4BQOA 3CJNA 3CCLI 2FEZA 4BEHA 4BDYA 2PJRB 4E7KA 5ED4A 4BY7J 2E5NA 1ODDA 2W48A 3LAPA 3LMMA 1YTYA 1ORKA 4Z6YA 3J80Z 5FGMA 2MSYA 2JVHA 4IHTA 4JYKA 3HTSB 1BR1A 4CCJA 1SAXA 3DP7A 2PJPA 4HNUA 3IH2A 2W7NA 1VFCA 2CW0F 1Z6RA 2H6BA 1P2FA 1HKSA 4AC0A 3L2VA 1J9IA 4ZDLA 2M30A 5HDGA 4A3KJ 4YEJA 2EFOA 3K10A 2LFBA 3OS1A 3JRGA 2LDUA 4FX4A 3BQZA 4MFEA 3C7JA 3BG5A 5KK1A 2FQ4A 2E19A 3I0TA 1Y0NA 1AHDP 1LKXA 2M8EA 3IH4A 2IA0A 2DTZA 1X3UA 2VQGA 3KP5A 4KIGA 4P55A 4DYQA 1IXSB 2WV0A 4IHYA 4FISA 1ZG5A 5B3SH 5LGUA 1FY7A 1BC7C 4G7OF 4NQWA 1FYKA 3LQRA 2F48A 2V6CA 4UV8A 1YI2I 1SMYF 1LJ9A 2F4MB 2DFIA 3AG2H 4G7ZF 4EM0B 5F04A 1MNEA 2VQLA 4HF0A 5F27A 3M07A 5DCMA 5GP9A 4KN7X 4OMYA 2JK3A 5ICCA 2XSJC 4A5MA 2OAZA 1T95A 2STWA 2HQNA 2RV8A 2DK5A 1NK2P 2M4KA 1R1UA 2X51A 3V42A 1K61A 3OS0A 3CDHA 4A3FJ 4L0ZB 3H5RA 3LQQA 3BR3A 1U3EM 3LL7A 4A0ZA 3CF5F 2GXAA 3J7ZI 3CLQA 3HRMA 4Y13A 1SEUA 1BW5A 1EJ9A 4HRIA 2DJNA 3G3ZA 1W36D 3BZKA 1HF0A 3AL0C 1P7JA 3I71A 4P9FA 2ZO4A 4UVAA 4ZDPA 1YIOA 5JLXA 2CUEA 3D5RC 3P9IA 2LSOA 3BTJA 2QQAA 1JKRC 2IXSA 4BS9A 4IZZA 1YLFA 4KMUX 2DI3A 3BDDA 5D5XB 2EIJH 2EV6A 1OCTC 4ZZLA 4BHPA 1D5VA 2EFWA 4BBSJ 2VJ5A 3GLLA 4RDUA 1EH6A 3IV5A 3IL2A 3Q9VA 2W24A 1TP4A 3JW4A 1WH7A 3OYEA 4AIDA 1WKMA 5ILVA 4FTHA 1KQ0A 4M6XA 4M73A 1VQ9I 2DU9A 1R5ID 4RBOA 1LVKA 2KIFA 1SVOA 3F6VA 5D4RA 4UUSA 3HUGA 1U0JA 4ENJA 1W7PD 1TNTA 1TWGJ 1X1AA 1Y1VJ 2MGQA 4N0BA 3TO9A 1VQOI 4A3GJ 1DU6A 3GTKJ 2VUMJ 4QLCU 1WJEA 1RI7A 5HDKA 2RVCA 3CUQC 4XOTA 2PX9A 4FASD 1X3WB 2K85A 2CQ7A 2KFDA 3IUOA 2D5VA 3DEUA 2ZFUA 5KNLA 3FWEA 5B1AH 3S1QJ 4CYCB 1XGOA 2ZXWH 3H5AA 3ZQCA 1D8JA 2AS5F 1XN7A 3G6EI 1QVUA 3OL4A 3EETA 3TP3A 1HA8A 1OPCA 4I2OA 1FBQA 3FXUA 4W97A 4Z2YA 4ZYHA 3C18A 4A69C 3M8EA 3GUDA 2O8XA 3CZ6A 4D7NA 3L00A 1VQ7I 2ISYA 5EDNA 2Z16A 4LG0B 1A31A 1BI0A 3KP6A 3GW2A 2R7DA 1SD6A 5B5EC 2EQRA 2PI0A 2P8TA 2OF7A 3M9AA 5J8CA 1H0MA 2GOXB 5BOXA 1Y56A 3E97A 2XF5A 3GLXA 3WTYC 2L7KA 2JA5J 2HOEA 4L18B 2MW8A 2JRTA 1MJBA 1IRGA 3OIPA 1SFUA 3D5SC 4D9JA 3SFZA 4U0YA 2XKPA 3LSPA 3QP6A 2E2HJ 4KA4A 3KPHA 2E2JJ 1T0FA 1FMWA 3LFUA 2GWRA 1MIJA 1NTCA 2XAGA 5CLSA 4IHSA 2FBKA 1SFXA 3J7AY 3E5UA 1P4XA 2VT3A 3GFJA 4ZH4F 1RIOH 1UB9A 4MLOA 2OBPA 4P9UA 3FXMA 1YITI 3OYJA 1ZRDA 4DOZA 2BVLA 3HGYA 4MHGA 1MMGA 1B72A 3WGHA 1KU3A 3HOWJ 1E17A 2TCTA 3KYDB 4EMSA 3I4MJ 2LLKA 2QM3A 4EM2A 4J00A 4XN0A 3VWBA 3VSKA 1ZGAA 1J59A 3S2WA 2XPWA 4B09A 2P7CB 3CP8A 2NS7A 3PQKA 2CGPA 1MW7A 2A3SA 1HW2A 1HXDA 3IAM2 1FOKA 1G6NA 2HTJA 3LOCA 5L3CA 3GTLJ 3ZQGA 3JAMK 2HFHA 2IBDA 2EIMH 3PUBA 1PYVA 5LGNA 2DTRA 4BJ6C 4HF2A 2M8GX 3CJQB 2QYOA 4BE0A 4IHXA 2CQQA 2VQHA 2X1DA 2Y9YA 1FSHA 5GADJ 4CGZA 4ITVA 1W0UA 5DDGA 4NDLA 4M3EA 5EJCA 1TW3A 3I4PA 3Q5FA 2DA6A 5IYDJ 4R8HA 3EDPA 2IEKA 1AOYA 2FUG2 2HU9A 2Y0SN 1MMDA 1H9GA 2QBYA 5J1YA 1GXQA 3HDDA 2FA5A 3JREA 4G12A 2WBMA 4G94A 3SDGA 1HOMA 4MQVA 2AQEA 4ZYAA 3SYTA 2CUJA 2W57A 1EV7A 5ICGA 1O57A 5EG0A 1ZELA 3P5JA 2OV7A 2IA2A 5JHUA 3QYFA 3OIQA 4XN3A 4GDFA 5D8LB 3IKTA 1R36A 1IN6A 3H9GA 4HSTA 4S04A 5DTDA 3KEYA 2ZSIB 4RB2C 3W2VA 1Z1DA 5EEGA 2K4BA 2JQ7A 4CZZA 1WZ2A 3AG1H 4RGUA 3BR1A 3VFZA 1H9TA 1MBFA 2GA1A 5EEHA 3IP4B 2WY8Q 4JX4A 4YIFA 3QAHA 4BY1J 4CXFA 2K86A 2R4GA 2Z3YA 3L2UA 1XGSA 3FHZA 3GX4X 3P9CA 2FOWA 1B9MA 1WHUA 1D1BA 4WXHA 2VLAA 5ILUA 4KT5C 1I6HJ 1V5FA 2JUGA 2OA4A 3C1DA 1G4DA 3BT9A 5LBQA 5LFAA 4KNYA 3KCCA 3LWFA 4UXNA 5A2QZ 4XMYA 1O7FA 3SZPA 3HG9A 2HOSA 2R7TA 3OYFA 2LY9A 4YG2F 4GYGA 1OCPA 5JFRA 1Y6IA 3ABLH 3KP4A 2JTVA 5LGTA 1BL0A 2BOLA 3ABUA 4E7IA 4HBLA 1RNLA 4GRIA 1HKQA 1QZZA 2KL4A 1J7KA 1WQ2A 1IN4A 1MNDA 2KHMA 5GPCA 2IGNA 1ETKA 5FLMJ 3J7AO 5HODA 1SD5A 3ZP5A 1YJ9I 3QQAA 1RETA 4D5FA 3FZVA 4GO1A 4MQ9F 2QSFX 4B43A 3FXLA 1TTYA 5IT9Z 4PK4A 3TKYA 3K4CA 3HOTA 3CMYA 2CQXA 1MDMA 3FKIJ 3RZOJ 3ESWB 4NC8A 5JI6A 2QBYB 2O5RA 3AKZA 1E2XA 1GVDA 2XSDC 2V26A 4B3XA 2BXZA 2CU7A 1T0FC 1JKPC 3LSJA 2R7VA 4G6QA 3H3ZA 5E3LA 4CHUA 4RAGA 3N97A 3KEOA 5E3NA 4A12A 4ZYGA 1SAUA 4HQMA 2M0CA 1ZH5A 5D4SA 4MEYF 4EJOA 4XOPA 3F0CA 2HZTA 2IAIA 3VSLA 2CYYA 3TW6A 4HF1A 1ZR2A 4L5IA 4HSRA 2H09A 1XD7A 5GAHJ 3U2RA 2X0LA 3S17J 3G1LA 2WB1N 5DEQA 3JTHA 2L4AA 5E1XA 4BJ5C 2LD5A 2XPUA 2NVXJ 2EFPA 2LBFA 4EJTA 3JSOA 4RGSA 1OCCH 1TL8A 5FLXK 4ENNA 1GUUA 4CCKA 4BL0B 2A69F 2J5PA 2VPRA 4IOCF 4DIQA 3BR6A 2DA5A 2FNAA 2P0WA 1FWZA 3NWSA 2JA8J 4F55A 3OOPA 1F5TA 2R5YB 3DXJF 2EWNA 4D1QA 3PNVA 2RNGA 1X3ZB 3E6BA 2O61A 2FQ3A 4I0BA 2W82A 2DN0A 2GXGA 2XB5A 3G1MA 1MH3A 2LYCA 2OU2A 1KA8A 1R4MB 1GXPA 2HPMA 4BE2A 1QQIA 1W7PA 3G1OA 3EUKL 2ME0A 2OD5A 1P4AA 2ZJQF 1O3TA 2P5LC 2Y9ZA 1B8IA 4RLQA 4V2FA 3WGGA 2OUMA 2Q2EA 4BHBA 2QQ8A 1W5SA 4KT6A 1H8AC 1DU0A 3KFWX 1VI0A 3ZR8X 2JA6J 1LFBA 2P81A 5J8FA 1D0ZA 1J09A 1T38A 3AAFA 2YU9J 2VE9A 1XSDA 3F8FA 2MC4A 4MNUA 2ZMEA 2DLLA 1ZN2A 2OZ6A 1EKEA 3E5XA 4LGWA 3L9FA 2ICWG 4DBRA 5DV5A 1MDMB 3A0BC 1L3LA 3HKZN 3RJPA 3C2HA 3K4JA 1WI9A 2GQQA 2FU4A 1G2HA 3Q9SA 5DD4A 3F8NA 5H2FC 4KMFA 2NVYJ 2W84A 1IDZA 2VXDA 1U8RA 3FISA 1RRJA 1K83J 3SZGA 4S0HB 3AG4H 4U87A 3MVPA 3J80K 3DFGA 4DZJA 1GT0C 3BG7A 2NS8A 3OYKA 2V1DA 4AIJA 5CJ9A 5TRDA 4M6YA 5LRSA 4P1WA 2IS6A 3HEFA 3LFKA 5L3FA 1VQPI 4IVNA 3MCZA 2TRTA 1ZLKA 1SC7A 3KYCB 1SFEA 5H6QA 5CQGA 5HNFA 3I59A 3W6JB 1U5TA 2HQRA 2ESNA 2LBFB 1APLC 2X6YA 2X48A 1VF9A 5DM6F 3REOA 1HSTA 3RI4A 4RM3A 2DBBA 2EBIA 3F21A 3BR0A 3FF5A 3CCJI 3V7SA 5DS9A 4PJJA 1P7IA 4NB5A 4BNCA 4OIQF 5E1ZB 3LSHA 3ONQA 1AKHA 3E7LA 1P9QC 1FOYA 2KIQA 4M72A 5L3BA 1CF7A 1IGNA 5BPDA 4IPAA 3WU1B 3S3NA 4A93J 3TO6A 3GTOJ 4GFBA 4BE1A 1Y1WJ 4XQFA 5LHHA 5CVVA 1Z7LA 3QU6A 1IJWC 4AM3A 3LSGA 3CD6I 3W2AA 1JI8A 1UHWA 1TT0A 2AXTC 4N9IA 4LD5A 1J0RA 5F08A 3TP0A 3J81Z 1BA5A 2PJRA 4M3BA 1SANA 1B8IB 2M87A 2NNYA 2QUFA 2R7OA 2LNBA 2DOFA 3L2RA 2D2WA 3G2BA 4B3AA 3GZNB 2HVRA 2QWWA 2FNPA 2JSCA 5B1BH 3ZQ7A 5AIPA 3HRUA 3L7WA 5FRNA 3WHCA 5FD5A 3SQNA 3VDXA 4E7SA 1OYIA 2MABA 2VXZA 2R0QC 1ZLJA 2NS0A 5LEJA 3FKJA 3DBLB 2CV2A 3FK7A 2W1OA 4A6EA 2ZB9A 2V79A 3S15J 1W36C 1HDDC 1WWXA 3HIFA 2A5YB 3KZIC 1L0OC 3FXRA 2K3FA 3TDZC 4D7MA 4EGZA 4ESFA 5F0FA 4LLLA 2L4MA 2RKHA 1I1SA 4BXUA 2DYRH 2RQQA 4UVBA 2EA2A 5TJJA 4AD9A 3IWZA 1YW9A 4XONA 3F8CA 4XKCA 3RCOA 3TMOA 2QQBA 2XGDA 4CH7A 4R79A 3I54A 1JUMA 5BQTA 3HSFA 2H27A 2GAUA 2JRMA 1FMVA 4GGGA 1JHFA 3OMYA 4QWQA 5D5WB 1PP8F 2DYSH 3ZQFA 1XB4A 3OIOA 2DK8A 4WXCA 5DUIA 2MH2A 1U9NA 2VQCA 1YX5A 4BUPA 2GXBA 5GTIC 1JHHA 1SFKA 1ETWA 3QU3A 1MMNA 2K9MA 1U2WA 4XNFA 1ZG3A 1RZ4A 5HLGA 2V1NA 3F9KA 2PMHA 4OMZA 1X1DA 2DFEA 3CMAI 3DKXA 1FYMA 3HC7A 2ID3A 3PO2J 1S7AA 3S1MJ 4J19A 2QKMB 2COMA 4RB1A 2WAQA 2PG4A 1Z3YA 3H3VK 2JPCA 3HL2A 4YIRX 2CWEA 2HYFA 1JGGA 1V5GA 2ZMEC 1WI3A 3K4LA 1YJNI 1G59A 1IUFA 2L2OA 4QTRA 1V5EA 1OYYA 3VOEA 5M5WJ 4B47A 1OKRA 3FXOA 4WX9A 4OIPF 2X6OA 2DOEA 1E3PA 2ID6A 2H94A 3DPTA 1Z67A 2KJCA 3ABMH 1YFHA 5K1YA 1MNMC 2NVTJ 1ETYA 3OYMA 4UVCA 2HVQA 1IN7A 3DEEA 1WCMJ 3FK6A 3HJEA 3WE3A 1I3QJ 2XVCA 2MH9A 1BIAA 4KFCA 2E36A 3IKVA 2JZYA 3M8JA 3OR1C 2BY2A 3B02A 4HPQA 2QSHX 2OTJI 2KZVA 3WU0A 4F91B 3DLLF 1QO0D 1ERDA 2XDVA 3V7RA 4U88A 2PMZA 3K1NA 2ZC2A 4N9HA 2TDXA 1JTXA 1U5TC 5KVRA 3MKLA 1QHGA 2LREA 4CYCA 1E3OC 3JRDA 3FMQA 2ACJA 1FX7A 4LFUA 1FBUA 4NHJA 3OSGA 4I98B 2QKLB 3SDBA 2RDPA 2OPTA 2KISA 3ZCOA 5BPIA 1X4OA 3PJRA 4C9YA 3T0YA 1MMAA 1XMXA 2JPBA 2FMYA 4BGDA 2R92J 3QOEA 5K5RA 1TC3C 1HW5A 2H1KA 2P5KA 4U0VA 5E3OA 4LG0A 3VPRA 1B9NA 1YW7A 3I5UA 2ZNZA 4YELA 2PBIA 4F7ZA 2HDCA 1E3HA 2DFFA 4NC7A 2BYVE 1Z0XA 2V1UA 3WE2A 2KZGA 3HOYJ 3GFIA 5HVQC 2HKXA 1FLIA 3FM5A 4AVPA 1XCVA 2YSRA 2YUSA 3PNTA 3FMRA 3RPQA 1R6RA 4D5CA 2NNNA 3TL4X 1LNWA 3HYIA 1BOAA 3K0LA 4XLNF 3ERMA 3K2AA 2CFXA 1HSJA 4XR6A 5C4XJ 2WA0A 4DNCA 2LP0A 2EH3A 2XAJA 5ERIA 2R7UA 2DDAA 1RKWA 4TV7A 1B1BA 3A01B 3CCSI 2VI6A 4E7LA 2WAFA 2LK2A 5LHIA 1QBJA 3NWTA 2Z9OA 5LLQA 2BVMA 2K5CA 1Z6TA 3S93A 2BHZA 4YIIA 4C3JJ 4EJWA 1FOXA 3OL3A 3V4GA 2VKDA 4M3GA 3OS2A 2R3SA 3KIOA 2DODA 1R1TA 2JT1A 1UAAA 4M9XA 1MD0A 4ENKA 1IC8A 1R7JA 4EV0A 4C2MJ 1ZAOA 3ZOBA 4R1HA 3E6CC 3EUHA 4I0AA 4LOCA 4AIHA 4BBRJ 1MGTA 1TT5B 4PSWA 1BR4A 1DUXC 1HW1A 4BKXA 5HOOA 2DA3A 2CV1A 5A2QK 4BH9A 1BOBA 2K40A 3GTJJ 2L3DA 3H0GJ 5AONA 1USSA 2BGCA 4HDUA 1IRZA 3IH3A 1WJAA 5H6RA 4CCOA 2XAFA 5FLVA 2G7HA 1LPQA 1VTNC 1FPQA 1T08B 4RAFA 1Z7UA 1ZGJA 4A3IJ 3F72A 1JUSA 1YQAA 1VQ4I 1ZREA 5EF6A 4HX7A 3OYGA 2ZJRF 5BNGA 3CTAA 3ZPLA 2IPQX 3B6AA 3QRFF 2I10A 2RQPA 1EA3A 3BTLA 2BXYA 3LNQA 2H1LA 2EILH 2UUZA 2VKEA 1D1AA 4AYBN 4E4HA 5IOYA 2QSGX 2LMDA 4P5OA 5F6FA 2XGXA 1YYVA 2DT5A 2JA7J 3F8MA 3I3LA 3I58A 4XRFA 2ME6A 4IXAA 5F1JA 2BW3B 5J3LA 1S7OA 1XMKA 4MGRA 3GO5A 1PP7U 2NVUB 3SJMA 3DQVC 4PJNA 3CDLA 2DT6A 1ETXA 1OCOH 3F6OA 2CH0A 2D1VA 3PQJA 2WADA 2E60A 4ENMA 1S6LA 2M1BA 4V19K 2F5EA 1T33A 1LDJA 1JUPA 4RMNA 3RIRA 2D45A 2L54A 4OINF 4X6AJ 5F0CA 4A3CJ 3I53A 4Q47A 4UB8C 3BZCA 3U1KA 1IN8A 2EA4A 5EZHA 1AA7A 4HLYA 1KYWA 2HDDA 1WJDA 2R7QA 3K1PA 4IRGA 3HXLA 1IZ1A 3FM3A 4DZPA 1SVLA 1GV2A 5KAFC 1X19A 3RQIA 4LLNA 1OQYA 1O3QA 2HDWA 2XV4S 4XLCA 1R5GA 1ENHA 1WVRA 1RUNA 1ZARA 2Y0SA 4MIMA 4X0GA 2X6XA 1UJ8A 3OYDA 2KDZA 1TWHJ 1PDNC 2EZHA 4GYIA 4DJAA 2DJIA 3F8BA 3G71I 1X1CA 4L5JA 4Y3OA 4ON0A 3OOUA 2A07F 5D6EA 3CLOA 4FCYA 2LC2A 3S3OA 1XS9A 2QZ8A 1BJAA 4IQ4A 3OYBA 2OCCH 1W1WE 5J4VA 2XPVA 1I5ZA 2L01A 3WTTC 1NG7A 3JR9A 3R60A 1O7LA 1OMIA 1JE8A 2XAHA 2IP2A 3RSNA 2CRGA 2F5DA 2NOJB 3DPUA 3MZHA 2QVOA 1G3YA 1T98A 1XCBA 5GTHC 5JVTA 1JJ8C 2HVSA 2ZXIA 2LR8A 2LTPA 1Z05A 3BJAA 2K4JA 1MH4A 5IYBJ 2DCEA 3CP2A 4EJUA 3CC4I 5EZGA 1I27A 2M3AA 4RS8A 1WGXA 2X6WA 1O3SA 3MQ0A 3FXKA 4KN4X 3BC8A 1ZTRA 1X2NA 1YX3A 3IWFA 4JX5A 1D0YA 3K4BA 4C30A 4IO9F 5J47A 3K2ZA 5IYCJ 3O6BB 4ANJA 2X4HA 3BG6A 3CC7I 2VKVA 2JN6A 2I5UA 2L9RA 4BJTA 1YOVB 3PUFA 4Y4RA 5L3GA 3BPXA 1PUEE 4KICA 2E71A 3FBNB 4XKBA 2IS1A 3HPGA 2R7XA 1D3YA 3B73A 2V1XA 4Y15A 4BQNA 4EQQA 4I99C 3IC7A 5IPAA 1P92A 5FJ8J 2E35A 1K6YA 1N25A 2HS5A 4GCVA 1FZPB 2KP6A 3CCQI 2O6GE 1ETVA 2MG4A 3EUHC 1X2MA 2KRCA 4I76A 3M8FA 2EV5A 2R5YA 5J1RA 4MTDA 1STZA 4BQQA 4UUVA 2O03A 2XASA 4AUXA 2UV1A 4UHTA 1HDPA 3W2WA 3WTXC 4N4NB 2A6HF 2GA2A 2C6YA 1N78A 2W4SA 4KIFA 5IY5H 4B4CA 3GFMA 4A5NA 5CVJA 3Q0VA 3TDUC 3IAS2 2A5WA 3U1DA 5D6FA 5M3FJ 2F4IA 3OWTA 1GVJA 4PDKA 3H5NA 4JBAA 1ETQA 3F23A 1N75A 4M6VA 5ICFA 2XGCA 1QRYA 2E7XA 4CUGA 1ZGWA 4L9TA 4Q48A 2MBFA 3DLAA 2DT7B 2HGCA 2GLOA 4XSXF 2DMTA 1QNTA 2Y75A 1YRNB 3RDIA 3S2HJ 3KX2A 5EEAA 4A0XA 5C3EJ 3DTIA 4M74A 3J81K 4BYYA 1OCZH 5J40A 1RPWA 2BY1A 1ON1A 2A6TA 2L9NA 4JK1X 1ZQ3P 2O0YA 4RGXA 1ULYA 1RC9A 2KIUA 3PM1A 4KUMA 4E70A 1WJCA 4ZC3A 1U8BA 3HOXJ 1YO5C 5ICEA 1GLNA 4ZTFA 4IEJA 3H9JA 2VL8A 4D0PA 3HOUJ 3GTGJ 2KRHA 4IJAA 3L1PA 1MBGA 2VOOA 2VONA 2A61A 2XRLA 3BPVA 2L5QA 2XRNA 3S16J 1LVAA 2F6CA 1C0WA 1KU2A 1XGNA 1SFOJ 3BROA 1BBYA 2RAEA 2JMWA 5E8GA 1TW2A 2DDBA 5E3MA 3L09A 1WFXA 3LSMA 5E20A 1V4RA 4F93B 3A03A 3QYBA 4A3MJ 3C3WA 4O3MA 1WJBA 2CSOA 1DGWY 1ZYRF 2RC4A 1HC8A 1JGSA 3ISPA 2CG4A 4BHCA 2Y2ZA 2LVSA 1CGPA 1T56A 2EV0A 2IJLA 4BACA 1LEBA 5DYMA 2W85A 4C3IJ 2DMNA 2ZKZA 2XF7A 1K7AA 1LQ1A 3K70C 4S05A 5F1RA 1I39A 2A6EF 3L2WA 3O8HA 3CCYA 2PLYA 3RQ4A 3LA7A 3C2GA 3KZYA 1UZCA 1IUYA 3TBIA 2EFQA 2CJJA 2YPRA 3I4NJ 2QLZA 4FX0A 1U78A 3K9TA 4U7BA 2IS4A 3WHBA 4IRHA 3M7GA 3MEXA 3OSFA 1ZHFA 3T1BA 1F9NA 4EATA 4IHVA 2NXNB 1LFUP 1VQNI 1NG6A 3CQZJ 2VIXA 3RPUD 4Y7NJ 3K4NA 4HX4A 3QODA 2OC6A 4XSZF 3VYTB 1LDDA 4JP0A 1VZ0A 5E79C 3WG7H 4KITB 2DMQA 3A2KA 3SEZA 2QQ9A 2M45A 2G9WA 3O2PE 1OR7A 3E5QA 2JJ7A 3R4KA 1BJZA 3ZMVA 3F3XA 2K27A 3GTQJ 1KQ8A 1XG1A 2MA3A 1R71A 1A35A 2H6CA 5HS7A 2AQFA 3MKYB 4FETA 3ECOA 1F36A 1T6SA 3BR2A 3H0DA 1UCRA 5D5UB 1SD4A 2FBHA 5EGOB 2V6EA 3D5LA 5CVRA 1G3TA 4HV6A 1JJ6C 2XIGA 4DGWB 4Y17A 2MFZA 5B66C 1EH7A 3JRFA 1RESA 2WV1A 2DA1A 3BG3A 2VE8A 2QA4I 1Z9CA 2GBYA 3HPHA 3P7NA 2ZXJA 3KP7A 3ULQB 2B9SA 1J5YA 3CJRB 1MSEC 5IP7J 1HCRA 4RM2A 3R6SA 4G6TB 2FE3A 1BN5A 1JKOC 1ON2A 5LD2C 1Y39A 2EZKA 4WK8F 1IV6A 3EUAA 2DMPA 2YX4A 2ZFWA 3J7YJ 3BWGA 3BG9A 1K6OA 2B7EA 2XHKA 2STTA 2H8RA 2X1EA 1FNNA 2E1CA 4BDZA 1WPKA 1P4WA 5GAGJ 4PZJA 1XSXA 3Q3SA 4OAZA 3W6KB 2ADUA 1G8XA 5M5YJ 2L02A 2CW7A 1E0EA 4RB0A 3QPSA 2LF7A 5HLTA 3I64A 3JRIA 2N8GA 1R49A 4FE4A 4DBQA 5M5XJ 2LKXA 3HGGA 1O3RA 2L9SA 4KDPA 2IRFG 2HI3A 1P6RA 2XKOA 1DGRM 3LSRA 1B6AA 2X1CA 2KDOA 4RAZA 1TWFJ 2NYXA 2YR2A 1Y8RB 4OU0A 4PGHA 5HNHA 4RA2A 3HRTA 2XC7A 2IA1A 4XL9A 1WRJA 3DPLC 1WSUA 1Q1HA 2EFNA 4J01A 2FJ1A 3PL8A 1B4AA 1FC3A 4AWXB 2DFHA 3CF2A 2JUCA 2CQKA 1UHSA 2Y30A 1D1CA 1D5YA 5JLWA 2A68F 3KETA 1T2KA 3IRQA 2NRAC 3LSTA 2BV6A 3PSFA 2K9NA 2LOOA 5F64A 1FYLA 2VODA 1J2XA 2WTEA 4CA0A 2K02A 2UXXA 1H89C 3DKWA 4CYDA 1H88C 3MD2A 4IHWA 4RAYA 1V3FA 1XGMA 2OJED 1IG7A 2EZIA 1RUOA 2R5ZA 4IL6C 4B48A 3GCMA 5FKKA 4ZZDA 3ZMZA 4HA8A 5CPRB 1LFPA 3T8TA 4YFNF 2EINH 3L2QA 2PQ8A 4A0YA 2PN6A 3WGIA 4PFOA 1WH5A 3VEPA 4I01A 4ASNA 2CMPA 3ZRGA 2BY3A 1S3JA 1JT0A 1FP1D 4LIUA 3GBGA 2EIKH 2V9KA 2JA2A 3DU5A 2RN7A 3KE2A 3FXQA 2GOMA 2KLOA 3VODA 5JVGF 5DCFA 3A01A 2IT0A 4LB5A 1FSEA 5M3MJ 4LK0F 1MSFC 2VBYA 2K9QA 4LLGF 3ELKA 3T8RA 3E6DA 1OR7C 2BY0A 2KMUA 1ONVA 4W1UA 4I09A 3IRRA 2LG4A 5DM7F 2VASA 3VYSB 3OYAA 1DQUA 3OYHA 5E18F 2K9SA 2HKOA 1OFCX 2HTSA 2O3FA 4XLHA 5JR3A 1KU9A 3F22A 1SD7A 2AHQA 1RKTA 4E7HA 3MZYA 2G7UA 2P4WA 1IAWA 5GPAA 2V9VA 3AL0B 3CDIA 3D0SA 2L0KA 1TWCJ 4E7ZA 4JQFA 2X85A 1Z77A 1NHAA 3NARA 4G6DA 2D1HA 2VN2A 5HLIA 2WAQN 3FX3A 2DO7A 4CCLA 3RKXA 3ZGKA 2UXNA 4Q5SF 2Q0OA 1FTZA 5KCMA 3B6CA 3BY6A 3FXJA 3HOSA 4XLEA 3PSIA 1OYWA 4M3DA 1M1EB 1T8IA 2ZNYA 1XDUA 2R5ZB 2R7ZJ 3A4CA 4HAMA 2OZUA 3I56I 1N77A 5K7FA 2ETHA 1R23A 3T5XA 2F5CA 1YIJI 2F4OB 2MD0A 2FX0A 2XGEA 2ISZA 2OTLI 2DQRA 3GVAA 1IF1A 1VQKI 1X1PA 2L7MP 3K6GA 3CUQB 3BTCA 3GZ5A 2BW3A 3E6MA 2Z2SB 3DCFA 1PJRA 4Q4ZF 3CCMI 1DP7P 2ZBKA 2FSWA 2Y48A 2Q1ZB 3MFKA 2PMZN 2Z99A 4G9YA 4KIBA 4MEXF 4HYEA 3V8KA 5BMZA 4PJ0C 3GTMJ 4P96A 4EEFG 4B1RA 2HEOA 3X2QH 5E17F 1A6IA 2KKOA 1DDNA 1NK3P 2GM4A 4HNVA 3BJ6A 2CO5A 3K4KA 1ZRCA 3K1MA 2DPDA 3BQYA 3TGNA 1QHHD 4EM1A 3RZDJ 3WTVC 1Q1VA 3DWLE 2ESHA 4OOIA 3QOPA 5C4JJ 2OQRA 4YRVA 3RPUA 1D0XA 5FKOA 2DA2A 1VQLI 3WTWC 1OLTA 2G0EA 2XAUA 4C3HJ 2LKSA 1QGPA 4BEHB 3OR2C 4XLAA 4A3BJ 2ELJA 3HTUA 1F4KA 3BCAA 1EF4A 3ZMTA 2XAQA 1ZG1A 1IW7F 1A36A 3DBHB 2XROA 1EH8A 2LRDA 4ZYEA 2YS9A 2XF6A 4AYBA 3CMEI 4XICA 4O6JA 3QYEA 2P5VA 4L9JA 4A3EJ 3ZMUA 3DTKA 1FIPA 2LY2A 3S1RJ 1UELB 2Q8KA 2BHYA 4XRSG 3NEUA 2DOAA 3FBIB 3QP5A 2KT0A 1JT6A 5FROA 4HZFA 4MFDA 4DQ2A 3CMMA 4II2A 2HOTA 1W5TA 3M4OJ 2FMLA 1MBKA 5IP6A 5KHDA 1QU3A 4KISA 2MLKA 3ASOH 2W25A 3A0HC 3JTGA 3RKQA 4BXXJ 1DPRA 2XUBA 1R4NB 5IT9K 5HS8A 3ZQLA 2DW4A 3ML6A 2WY7Q 1U6GA 2OCEA 4NQWB 5AIQA 3PIOF 4U7DA 2JVGA 4IRIA 2L7FP 1MBHA 2EPFA 3DF8A 4NNJA 2HYJA 3K69A 2CFOA 1U9OA 5HS9A 1R9TJ 4JOMA 2M7AA 5DCMB 1S7EA 1BW6A 3LSIA 3JSPA 5C44J 1DP3A 4JX6A 1TLHB 2VT2A 3NQOA 5J6XA 3MMYB 4M71A 3WTZA 3PIPF 1UG0A 3HRSA 3LAJA 2Z5UA 5LRRA 1LUJB 3ABTA 2F5VA 2PFBA 3H9QA 3OY9A 1S29A 4LG3A 3NAUA 1BI3A 4IX7A 2CV0A 1TQIA 3WODF 3ABKH 5FFZA 2V9PA 2BEOA 2L9VA 4OAYA 2GZWA 1AU7A 5H20A 1KQ9A 3CJTB 2WAEA 2VB6A 4V2GA 2OQGA 4HW0A 3MKWB 3O8GA 1USTA 3OYNA 4KJZA 5CVUA 1MJAA 2ZJ2A 4CICA 4PJLA 1FIAA 1GDTA 3GFLA 2WWYA 1S5LC 1JTYA 2K9LA 2ZJPF 1XPXA 5K5QA 5DUKA 5K7HA 3COAC 3TOAA 1K78A 5E8IA 2Y69H 2Z1DA 3OYCA 4PFPA 4BAYA 3ZN0A 2FXAA 5L3DA 1PUFA 1FT9A 3MZ8A 3SXYA 2YU3A 4FE7A 1X58A 4IF4A 2DA4A 4UUSB 2Y31A 3HUGB 4XKWA 1YRNA 3PNYA 4F52A 4II3A 5J1UA 3ZQHA 1T39A 1K79A 1FBSA 1I3AA 2JSPA 1HLVA 3GTPJ 1V54H 1QZEA 4HOBA 4KYWA 1R1VA 1MJ9A 2L7ZA 3V8JA 1O4XA 1LEAA 2BZTA 3JCUC 4I7HA 2QCOA 4XBFA 4ABZA 2EK5A 2J5OA 4WF2A 1Z3XA 1B59A 3Q0WA 1UG2A 1Z21A 1A6QA 2E5ZA 2DA7A 4CCMA 4YFKF 2HQ5A 2HNHA 1VQ6I 4YFXF 1KGSA 1R5HA 1X1BA 2FRHA 3CCVI 1YHQI 1NH3A 4XK4A 4UB6C 3D1NI 1BC8C 1BI2A 1QA6A 3DTEA 1UMQA 2HXIA 4HQEA 1BIBA 4L0YB 2QENA 4X1EA 4Y52J 3JRAA 2ELKA 3E0JB 1SMTA 3OYIA 3UNGC 4ZTJA 3EQLF 3S8PA 5J4YA 1LE8A 1J75A 2K7LA 3SHFA 2VC1A 2FOKA 5FKMA 2KJBA 3H1CA 3H3UA 3TW7A 4U0WA 3WG9A 4IOAF 2IGKA 1BM9A 4HG2A 2KPMA 1WJFA 3Q0UA 5FKLA 1HBXG 2P7VB 3UKGA 3BTIA 2HZDA 4LB6B 4NUBA 4A3JJ 4NBQA 1IN5A 5FKNA 4XRSA 4E6KG 1G3SA 5LEKA 3HHGA 4LMYA 3ZMDA 3JRHA 2CUFA 4HNTA 1Y0UA 2P6SA 1K4TA 4A6DA 2CQNA 2IW5A 1B72B 1WJ5A 1K78B 3ZMSA 4NC6A 1VQ5I 3FMSA 4I02A 4H0EA 5ILSA 2IVMA 4LITA 1X4PA 3KEQA 5E1WA 1ZRFA 1PUFB 4IQJA 4OWRB 1F1ZA 1GV5A 4CO8A 3LA2A 1Y8QB 4CSWA 4M9SA 5L3EA 1Z91A 4WCGA 2WB1A 4ZDOA 1KU7A 2HXOA 2PEXA 4HDVA 3GF2A 5KAIC 2BE5F 1I1GA 3DU6A 5FO5A 4BXFA 3L2CA 3ZQIA 2HR3A 1TZLA 4DYRA 2O7OA 3V8LA 4RB3C 4FHTA 4HLXA 3SEQA 3UR3C 5FD6A 1IDYA 1V55H 2R7RA 2R7WA 2ECCA 4XIDA 1KONA 5EGOA 3OV8A 2UWMA 3BCBA 2R93J 3WTSC 1ITYA 3AFHA 3U21A 5LHGA 3CO7C 1REPC 4DW6A 4CZCA 3E3VA 2QF7A 2EJRA 1S72I 3ZN1A 5EG0B 4OIRF 3ZXSA 1HKTA 2ZCWA 1LE8B 1IRFA 3K7AJ 4UNOA 2QGUA 3PO3J 4PSXA 3QPHA 4Y33A 5CKTA 3EPZA 3HSRA 2LF8A 4QSHA 9ANTA 1TQPA 2NVQJ 2YX7A 3QPTA 1GHCA 2PMUA 4UV9A 4HV5A 1QVTA 3R0AA 2VKHA 5FB2A 3TOBA 3W6VA 1YE9A 4F3QA 2WC2A 1MZBA 3R61A 2FF4A 1R22A 3HKZA 3KZZA 1RR8C 2HQAA 2ZXHA 4XORA 1TBXA 1A04A 1OCRH 2B63J 3S3MA 3LA3A 3JAMZ 2QEXI 2DQLA 3BR5A 3C2BA 2MD5A 2MC3A 1DPUA 1FEXA 2KRFA 3G73A 2DAOA 1IXRC 1FOWA 2MLGA 2R7FA 2KQRA 4HEA2 3JRBA 2R7SA 2VOPA 5FRMA 3HB9A 3HZJA 3LSKA 3EYYA 1FTTA 5D5VB 3DV8A 3S14J 1JKQC 1FJLA 5CYVA 3KP2A 4PGGA 1YS7A 1IRXA 2ELHA 2NAZA 2A05A 3CESA 3DEWA 3KLNA 5TISC 2CS3A 3SZTA 1G3WA 3TEDA 2DPUA 1ZK8A 4E7JA 5JHFA 4A3DJ 3I55I 1UFMA 4BU2A 2O8KA 1S8NA 4N4OB 2HYGD 3NRVA 4AU7A 2LH9A 4UY8I 4CCNA 4FQGA 2Z33A 2NOGA 4EVIA 2COBA 2VPLA 4LK1F 3GYHX 1MBJA 1KZHA 2E1OA 4WWCA 1KYZA 3ECHA 4H4KC 3GEZA 4XM3A 3KYLA 1AWCA 1W5CC 4QIWN 4FT8A 1BR2A 4PJMA 2HPIA 3H35A 3G4SI 1YS6A 4MTEA 4DYCA 4ZYDA 3IHUA 4ETSA 5BS6A 1XDSA 3BJOA 1A5JA 4UUTA 2BBYA 2LKPA 1XSVA 2E1MB 3ROUA 3RTRA 3VB2A 2FD5A 2RGVA 2VC0A 5DD8A 3HBLA 3R0JA 3EYIA 3HSEA 3RYPA 2E1NA 2M0MA 1TQMA 3P9KA 4LIVA 3H36A 5F0HA 4XLPF 2HWVA 3JRCA 3W3CA 1JXSA 3FDYA 4XRMA 3BOQA 4M9ZA 2CUZA 2M34A 1FP2A 3KLOA 2DMUA 2VBZA 3HOZJ 4ESJA 3CC2I 1F43A 2GIZA 1VNDA 1W4MA 3VYRB 3MKZA 3ASNH 3RYRA 3M1EA 2Y0MA
chains in the Genus database with same CATH topology
1VQMI 1QA6A 1VQ9I 3CCLI 2NXNB 1VQNI 3PIOF 1VQPI 5GADJ 1ACIA 2E34A 1VQOI 4IOAF 3I56I 3CMAI 1YIJI 3CCSI 2QEXI 5DM6F 2OTLI 1VQKI 1FOWA 3CCJI 5GAHJ 3G6EI 3PIPF 1FOXA 3G71I 1YJNI 3CCMI 1FOYA 1VQ7I 1VQ5I 3CJTB 3CD6I 3I55I 2JQ7A 2QA4I 3CCRI 4IOCF 4UY8I 2E36A 2ZJPF 1YI2I 2FOWA 2OTJI 5JVGF 3DLLF 3CC4I 1YJWI 1Y39A 2ZJQF 3J7YJ 3G4SI 5GAEJ 1VQ4I 2ZJRF 4IO9F 2H8WA 3CF5F 3J7ZI 5DM7F 1YITI 3CC7I 1HC8A 3CMEI 2K3FA 5GAGJ 1VQ8I 3CCUI 1VQLI 2E35A 3CCQI 1S72I 1MMSA 1YJ9I 4V19K 3CC2I 1VQ6I 3CCVI 1YHQI 3CCEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  1QA6 A;  1VQ9 I;  3CCL I;  2NXN B;  1VQN I;  3PIO F;  1VQP I;  5GAD J;  1ACI A;  2E34 A;  1VQO I;  4IOA F;  3I56 I;  3CMA I;  1YIJ I;  3CCS I;  2QEX I;  5DM6 F;  2OTL I;  1VQK I;  1FOW A;  3CCJ I;  5GAH J;  3G6E I;  3PIP F;  1FOX A;  3G71 I;  1YJN I;  3CCM I;  1FOY A;  1VQ7 I;  1VQ5 I;  3CJT B;  3CD6 I;  3I55 I;  2JQ7 A;  2QA4 I;  3CCR I;  4IOC F;  4UY8 I;  2E36 A;  2ZJP F;  1YI2 I;  2FOW A;  2OTJ I;  5JVG F;  3DLL F;  3CC4 I;  1YJW I;  1Y39 A;  2ZJQ F;  3J7Y J;  3G4S I;  5GAE J;  1VQ4 I;  2ZJR F;  4IO9 F;  2H8W A;  3CF5 F;  3J7Z I;  5DM7 F;  1YIT I;  3CC7 I;  1HC8 A;  3CME I;  2K3F A;  5GAG J;  1VQ8 I;  3CCU I;  1VQL I;  2E35 A;  3CCQ I;  1S72 I;  1MMS A;  1YJ9 I;  4V19 K;  3CC2 I;  1VQ6 I;  3CCV I;  1YHQ I;  3CCE I; 
#chains in the Genus database with same CATH topology
 2I8D A;  4OIO F;  3QPL A;  3CUO A;  4RLF A;  1XC5 A;  1RR7 A;  3HM5 A;  4XKV A;  4AVZ A;  2IS2 A;  1R58 A;  4L5E A;  3K4M A;  4B8X A;  4QPQ A;  1ACI A;  3HHH A;  1PVE A;  1QPI A;  2E34 A;  1QPM A;  3E1S A;  3VYU B;  1ZR4 A;  1I6X A;  2VJJ A;  1LB2 A;  3GXO A;  4EGY A;  1W7P B;  2VBW A;  3TO7 A;  3QWL A;  1HQC A;  3CO6 C;  5D8K B;  4O5V A;  3S2D J;  2M7B A;  5K5O A;  4AIK A;  1K4S A;  5IT3 A;  2IGO A;  3FIW A;  2AXL A;  4ESB A;  3MWM A;  2B0L A;  4L9V A;  4L9N A;  2Q2E B;  2M5W A;  3GME A;  3WU2 C;  3O3K A;  3S32 A;  1R00 A;  3S1N J;  3M1C A;  4F92 B;  2VJI A;  5IP9 J;  2GIV A;  5EYR A;  3WTU C;  1POG A;  2ZME B;  3BP8 A;  2VJ4 A;  3SFI A;  5IOZ A;  4EJV A;  2E1M C;  1IV8 A;  5TGT A;  1W0T A;  4I6Z A;  4LJZ F;  3N05 A;  4MO7 A;  5K7Z A;  3CCR I;  2FBI A;  1XX5 A;  2F5F A;  3A1Y A;  1MKM A;  3DKY A;  5FFX A;  3MN2 A;  3A02 A;  4RGR A;  2IGM A;  6PAX A;  1UHM A;  3AG3 H;  4WXD A;  1YW8 A;  4BQA A;  1IO2 A;  1OJL A;  2W00 A;  1S9H A;  5CQE A;  4B44 A;  3BZ6 A;  4CDG A;  2VBX A;  2ZSH B;  3H92 A;  4A3L J;  4IKF A;  5FLX Z;  3PFI A;  1YJW I;  2M4G A;  2ECB A;  4PUS A;  5HLH A;  4PCQ A;  2RRE A;  4GXO A;  3GZ6 A;  1OIS A;  3N4M A;  3ERE D;  2DXI A;  1TNS A;  1LDK B;  3K70 D;  2V7F A;  1D8K A;  3FHN A;  5GAE J;  1ZKG A;  3U9G A;  1MBE A;  2O9L A;  3CUQ A;  1CQT A;  3ZQQ A;  3GWZ A;  4G8X A;  1SVM A;  3M3Y J;  1QZY A;  2H8W A;  2CW8 A;  2EZL A;  2MYS A;  3RKW A;  3HOV J;  3I59 B;  1U5T B;  3PFY A;  2AO9 A;  4XLF A;  3V7C A;  4C2T A;  4A2U A;  2M2E A;  2RNJ A;  1VQ8 I;  2EB7 A;  2P6T A;  2HOA A;  3CCU I;  2E7W A;  2UZK A;  1XMA A;  3DBR B;  1ETO A;  3OYL A;  1IXC A;  1XTA A;  2M9H A;  4QPO A;  3RKY A;  1AKH B;  2F2E A;  1MMS A;  2E2I J;  2XB0 X;  2K3P A;  2X9D A;  4K2E A;  1I50 J;  1CF7 B;  1YG2 A;  2V4J C;  5HDN A;  4M3F A;  4C2U A;  1TWA J;  4ZJZ A;  3CCE I;  2LY1 A;  3MAJ A;  2KIM A;  2JWT A;  3I9V 2;  5CVI A;  1VQM I;  4HX8 A;  4G7H F;  3BLY A;  3KP3 A;  3TQN A;  1BI1 A;  4BQO A;  3CJN A;  3CCL I;  2FEZ A;  4BEH A;  4BDY A;  2PJR B;  4E7K A;  5ED4 A;  4BY7 J;  2E5N A;  1ODD A;  2W48 A;  3LAP A;  3LMM A;  1YTY A;  1ORK A;  4Z6Y A;  3J80 Z;  5FGM A;  2MSY A;  2JVH A;  4IHT A;  4JYK A;  3HTS B;  1BR1 A;  4CCJ A;  1SAX A;  3DP7 A;  2PJP A;  4HNU A;  3IH2 A;  2W7N A;  1VFC A;  2CW0 F;  1Z6R A;  2H6B A;  1P2F A;  1HKS A;  4AC0 A;  3L2V A;  1J9I A;  4ZDL A;  2M30 A;  5HDG A;  4A3K J;  4YEJ A;  2EFO A;  3K10 A;  2LFB A;  3OS1 A;  3JRG A;  2LDU A;  4FX4 A;  3BQZ A;  4MFE A;  3C7J A;  3BG5 A;  5KK1 A;  2FQ4 A;  2E19 A;  3I0T A;  1Y0N A;  1AHD P;  1LKX A;  2M8E A;  3IH4 A;  2IA0 A;  2DTZ A;  1X3U A;  2VQG A;  3KP5 A;  4KIG A;  4P55 A;  4DYQ A;  1IXS B;  2WV0 A;  4IHY A;  4FIS A;  1ZG5 A;  5B3S H;  5LGU A;  1FY7 A;  1BC7 C;  4G7O F;  4NQW A;  1FYK A;  3LQR A;  2F48 A;  2V6C A;  4UV8 A;  1YI2 I;  1SMY F;  1LJ9 A;  2F4M B;  2DFI A;  3AG2 H;  4G7Z F;  4EM0 B;  5F04 A;  1MNE A;  2VQL A;  4HF0 A;  5F27 A;  3M07 A;  5DCM A;  5GP9 A;  4KN7 X;  4OMY A;  2JK3 A;  5ICC A;  2XSJ C;  4A5M A;  2OAZ A;  1T95 A;  2STW A;  2HQN A;  2RV8 A;  2DK5 A;  1NK2 P;  2M4K A;  1R1U A;  2X51 A;  3V42 A;  1K61 A;  3OS0 A;  3CDH A;  4A3F J;  4L0Z B;  3H5R A;  3LQQ A;  3BR3 A;  1U3E M;  3LL7 A;  4A0Z A;  3CF5 F;  2GXA A;  3J7Z I;  3CLQ A;  3HRM A;  4Y13 A;  1SEU A;  1BW5 A;  1EJ9 A;  4HRI A;  2DJN A;  3G3Z A;  1W36 D;  3BZK A;  1HF0 A;  3AL0 C;  1P7J A;  3I71 A;  4P9F A;  2ZO4 A;  4UVA A;  4ZDP A;  1YIO A;  5JLX A;  2CUE A;  3D5R C;  3P9I A;  2LSO A;  3BTJ A;  2QQA A;  1JKR C;  2IXS A;  4BS9 A;  4IZZ A;  1YLF A;  4KMU X;  2DI3 A;  3BDD A;  5D5X B;  2EIJ H;  2EV6 A;  1OCT C;  4ZZL A;  4BHP A;  1D5V A;  2EFW A;  4BBS J;  2VJ5 A;  3GLL A;  4RDU A;  1EH6 A;  3IV5 A;  3IL2 A;  3Q9V A;  2W24 A;  1TP4 A;  3JW4 A;  1WH7 A;  3OYE A;  4AID A;  1WKM A;  5ILV A;  4FTH A;  1KQ0 A;  4M6X A;  4M73 A;  1VQ9 I;  2DU9 A;  1R5I D;  4RBO A;  1LVK A;  2KIF A;  1SVO A;  3F6V A;  5D4R A;  4UUS A;  3HUG A;  1U0J A;  4ENJ A;  1W7P D;  1TNT A;  1TWG J;  1X1A A;  1Y1V J;  2MGQ A;  4N0B A;  3TO9 A;  1VQO I;  4A3G J;  1DU6 A;  3GTK J;  2VUM J;  4QLC U;  1WJE A;  1RI7 A;  5HDK A;  2RVC A;  3CUQ C;  4XOT A;  2PX9 A;  4FAS D;  1X3W B;  2K85 A;  2CQ7 A;  2KFD A;  3IUO A;  2D5V A;  3DEU A;  2ZFU A;  5KNL A;  3FWE A;  5B1A H;  3S1Q J;  4CYC B;  1XGO A;  2ZXW H;  3H5A A;  3ZQC A;  1D8J A;  2AS5 F;  1XN7 A;  3G6E I;  1QVU A;  3OL4 A;  3EET A;  3TP3 A;  1HA8 A;  1OPC A;  4I2O A;  1FBQ A;  3FXU A;  4W97 A;  4Z2Y A;  4ZYH A;  3C18 A;  4A69 C;  3M8E A;  3GUD A;  2O8X A;  3CZ6 A;  4D7N A;  3L00 A;  1VQ7 I;  2ISY A;  5EDN A;  2Z16 A;  4LG0 B;  1A31 A;  1BI0 A;  3KP6 A;  3GW2 A;  2R7D A;  1SD6 A;  5B5E C;  2EQR A;  2PI0 A;  2P8T A;  2OF7 A;  3M9A A;  5J8C A;  1H0M A;  2GOX B;  5BOX A;  1Y56 A;  3E97 A;  2XF5 A;  3GLX A;  3WTY C;  2L7K A;  2JA5 J;  2HOE A;  4L18 B;  2MW8 A;  2JRT A;  1MJB A;  1IRG A;  3OIP A;  1SFU A;  3D5S C;  4D9J A;  3SFZ A;  4U0Y A;  2XKP A;  3LSP A;  3QP6 A;  2E2H J;  4KA4 A;  3KPH A;  2E2J J;  1T0F A;  1FMW A;  3LFU A;  2GWR A;  1MIJ A;  1NTC A;  2XAG A;  5CLS A;  4IHS A;  2FBK A;  1SFX A;  3J7A Y;  3E5U A;  1P4X A;  2VT3 A;  3GFJ A;  4ZH4 F;  1RIO H;  1UB9 A;  4MLO A;  2OBP A;  4P9U A;  3FXM A;  1YIT I;  3OYJ A;  1ZRD A;  4DOZ A;  2BVL A;  3HGY A;  4MHG A;  1MMG A;  1B72 A;  3WGH A;  1KU3 A;  3HOW J;  1E17 A;  2TCT A;  3KYD B;  4EMS A;  3I4M J;  2LLK A;  2QM3 A;  4EM2 A;  4J00 A;  4XN0 A;  3VWB A;  3VSK A;  1ZGA A;  1J59 A;  3S2W A;  2XPW A;  4B09 A;  2P7C B;  3CP8 A;  2NS7 A;  3PQK A;  2CGP A;  1MW7 A;  2A3S A;  1HW2 A;  1HXD A;  3IAM 2;  1FOK A;  1G6N A;  2HTJ A;  3LOC A;  5L3C A;  3GTL J;  3ZQG A;  3JAM K;  2HFH A;  2IBD A;  2EIM H;  3PUB A;  1PYV A;  5LGN A;  2DTR A;  4BJ6 C;  4HF2 A;  2M8G X;  3CJQ B;  2QYO A;  4BE0 A;  4IHX A;  2CQQ A;  2VQH A;  2X1D A;  2Y9Y A;  1FSH A;  5GAD J;  4CGZ A;  4ITV A;  1W0U A;  5DDG A;  4NDL A;  4M3E A;  5EJC A;  1TW3 A;  3I4P A;  3Q5F A;  2DA6 A;  5IYD J;  4R8H A;  3EDP A;  2IEK A;  1AOY A;  2FUG 2;  2HU9 A;  2Y0S N;  1MMD A;  1H9G A;  2QBY A;  5J1Y A;  1GXQ A;  3HDD A;  2FA5 A;  3JRE A;  4G12 A;  2WBM A;  4G94 A;  3SDG A;  1HOM A;  4MQV A;  2AQE A;  4ZYA A;  3SYT A;  2CUJ A;  2W57 A;  1EV7 A;  5ICG A;  1O57 A;  5EG0 A;  1ZEL A;  3P5J A;  2OV7 A;  2IA2 A;  5JHU A;  3QYF A;  3OIQ A;  4XN3 A;  4GDF A;  5D8L B;  3IKT A;  1R36 A;  1IN6 A;  3H9G A;  4HST A;  4S04 A;  5DTD A;  3KEY A;  2ZSI B;  4RB2 C;  3W2V A;  1Z1D A;  5EEG A;  2K4B A;  2JQ7 A;  4CZZ A;  1WZ2 A;  3AG1 H;  4RGU A;  3BR1 A;  3VFZ A;  1H9T A;  1MBF A;  2GA1 A;  5EEH A;  3IP4 B;  2WY8 Q;  4JX4 A;  4YIF A;  3QAH A;  4BY1 J;  4CXF A;  2K86 A;  2R4G A;  2Z3Y A;  3L2U A;  1XGS A;  3FHZ A;  3GX4 X;  3P9C A;  2FOW A;  1B9M A;  1WHU A;  1D1B A;  4WXH A;  2VLA A;  5ILU A;  4KT5 C;  1I6H J;  1V5F A;  2JUG A;  2OA4 A;  3C1D A;  1G4D A;  3BT9 A;  5LBQ A;  5LFA A;  4KNY A;  3KCC A;  3LWF A;  4UXN A;  5A2Q Z;  4XMY A;  1O7F A;  3SZP A;  3HG9 A;  2HOS A;  2R7T A;  3OYF A;  2LY9 A;  4YG2 F;  4GYG A;  1OCP A;  5JFR A;  1Y6I A;  3ABL H;  3KP4 A;  2JTV A;  5LGT A;  1BL0 A;  2BOL A;  3ABU A;  4E7I A;  4HBL A;  1RNL A;  4GRI A;  1HKQ A;  1QZZ A;  2KL4 A;  1J7K A;  1WQ2 A;  1IN4 A;  1MND A;  2KHM A;  5GPC A;  2IGN A;  1ETK A;  5FLM J;  3J7A O;  5HOD A;  1SD5 A;  3ZP5 A;  1YJ9 I;  3QQA A;  1RET A;  4D5F A;  3FZV A;  4GO1 A;  4MQ9 F;  2QSF X;  4B43 A;  3FXL A;  1TTY A;  5IT9 Z;  4PK4 A;  3TKY A;  3K4C A;  3HOT A;  3CMY A;  2CQX A;  1MDM A;  3FKI J;  3RZO J;  3ESW B;  4NC8 A;  5JI6 A;  2QBY B;  2O5R A;  3AKZ A;  1E2X A;  1GVD A;  2XSD C;  2V26 A;  4B3X A;  2BXZ A;  2CU7 A;  1T0F C;  1JKP C;  3LSJ A;  2R7V A;  4G6Q A;  3H3Z A;  5E3L A;  4CHU A;  4RAG A;  3N97 A;  3KEO A;  5E3N A;  4A12 A;  4ZYG A;  1SAU A;  4HQM A;  2M0C A;  1ZH5 A;  5D4S A;  4MEY F;  4EJO A;  4XOP A;  3F0C A;  2HZT A;  2IAI A;  3VSL A;  2CYY A;  3TW6 A;  4HF1 A;  1ZR2 A;  4L5I A;  4HSR A;  2H09 A;  1XD7 A;  5GAH J;  3U2R A;  2X0L A;  3S17 J;  3G1L A;  2WB1 N;  5DEQ A;  3JTH A;  2L4A A;  5E1X A;  4BJ5 C;  2LD5 A;  2XPU A;  2NVX J;  2EFP A;  2LBF A;  4EJT A;  3JSO A;  4RGS A;  1OCC H;  1TL8 A;  5FLX K;  4ENN A;  1GUU A;  4CCK A;  4BL0 B;  2A69 F;  2J5P A;  2VPR A;  4IOC F;  4DIQ A;  3BR6 A;  2DA5 A;  2FNA A;  2P0W A;  1FWZ A;  3NWS A;  2JA8 J;  4F55 A;  3OOP A;  1F5T A;  2R5Y B;  3DXJ F;  2EWN A;  4D1Q A;  3PNV A;  2RNG A;  1X3Z B;  3E6B A;  2O61 A;  2FQ3 A;  4I0B A;  2W82 A;  2DN0 A;  2GXG A;  2XB5 A;  3G1M A;  1MH3 A;  2LYC A;  2OU2 A;  1KA8 A;  1R4M B;  1GXP A;  2HPM A;  4BE2 A;  1QQI A;  1W7P A;  3G1O A;  3EUK L;  2ME0 A;  2OD5 A;  1P4A A;  2ZJQ F;  1O3T A;  2P5L C;  2Y9Z A;  1B8I A;  4RLQ A;  4V2F A;  3WGG A;  2OUM A;  2Q2E A;  4BHB A;  2QQ8 A;  1W5S A;  4KT6 A;  1H8A C;  1DU0 A;  3KFW X;  1VI0 A;  3ZR8 X;  2JA6 J;  1LFB A;  2P81 A;  5J8F A;  1D0Z A;  1J09 A;  1T38 A;  3AAF A;  2YU9 J;  2VE9 A;  1XSD A;  3F8F A;  2MC4 A;  4MNU A;  2ZME A;  2DLL A;  1ZN2 A;  2OZ6 A;  1EKE A;  3E5X A;  4LGW A;  3L9F A;  2ICW G;  4DBR A;  5DV5 A;  1MDM B;  3A0B C;  1L3L A;  3HKZ N;  3RJP A;  3C2H A;  3K4J A;  1WI9 A;  2GQQ A;  2FU4 A;  1G2H A;  3Q9S A;  5DD4 A;  3F8N A;  5H2F C;  4KMF A;  2NVY J;  2W84 A;  1IDZ A;  2VXD A;  1U8R A;  3FIS A;  1RRJ A;  1K83 J;  3SZG A;  4S0H B;  3AG4 H;  4U87 A;  3MVP A;  3J80 K;  3DFG A;  4DZJ A;  1GT0 C;  3BG7 A;  2NS8 A;  3OYK A;  2V1D A;  4AIJ A;  5CJ9 A;  5TRD A;  4M6Y A;  5LRS A;  4P1W A;  2IS6 A;  3HEF A;  3LFK A;  5L3F A;  1VQP I;  4IVN A;  3MCZ A;  2TRT A;  1ZLK A;  1SC7 A;  3KYC B;  1SFE A;  5H6Q A;  5CQG A;  5HNF A;  3I59 A;  3W6J B;  1U5T A;  2HQR A;  2ESN A;  2LBF B;  1APL C;  2X6Y A;  2X48 A;  1VF9 A;  5DM6 F;  3REO A;  1HST A;  3RI4 A;  4RM3 A;  2DBB A;  2EBI A;  3F21 A;  3BR0 A;  3FF5 A;  3CCJ I;  3V7S A;  5DS9 A;  4PJJ A;  1P7I A;  4NB5 A;  4BNC A;  4OIQ F;  5E1Z B;  3LSH A;  3ONQ A;  1AKH A;  3E7L A;  1P9Q C;  1FOY A;  2KIQ A;  4M72 A;  5L3B A;  1CF7 A;  1IGN A;  5BPD A;  4IPA A;  3WU1 B;  3S3N A;  4A93 J;  3TO6 A;  3GTO J;  4GFB A;  4BE1 A;  1Y1W J;  4XQF A;  5LHH A;  5CVV A;  1Z7L A;  3QU6 A;  1IJW C;  4AM3 A;  3LSG A;  3CD6 I;  3W2A A;  1JI8 A;  1UHW A;  1TT0 A;  2AXT C;  4N9I A;  4LD5 A;  1J0R A;  5F08 A;  3TP0 A;  3J81 Z;  1BA5 A;  2PJR A;  4M3B A;  1SAN A;  1B8I B;  2M87 A;  2NNY A;  2QUF A;  2R7O A;  2LNB A;  2DOF A;  3L2R A;  2D2W A;  3G2B A;  4B3A A;  3GZN B;  2HVR A;  2QWW A;  2FNP A;  2JSC A;  5B1B H;  3ZQ7 A;  5AIP A;  3HRU A;  3L7W A;  5FRN A;  3WHC A;  5FD5 A;  3SQN A;  3VDX A;  4E7S A;  1OYI A;  2MAB A;  2VXZ A;  2R0Q C;  1ZLJ A;  2NS0 A;  5LEJ A;  3FKJ A;  3DBL B;  2CV2 A;  3FK7 A;  2W1O A;  4A6E A;  2ZB9 A;  2V79 A;  3S15 J;  1W36 C;  1HDD C;  1WWX A;  3HIF A;  2A5Y B;  3KZI C;  1L0O C;  3FXR A;  2K3F A;  3TDZ C;  4D7M A;  4EGZ A;  4ESF A;  5F0F A;  4LLL A;  2L4M A;  2RKH A;  1I1S A;  4BXU A;  2DYR H;  2RQQ A;  4UVB A;  2EA2 A;  5TJJ A;  4AD9 A;  3IWZ A;  1YW9 A;  4XON A;  3F8C A;  4XKC A;  3RCO A;  3TMO A;  2QQB A;  2XGD A;  4CH7 A;  4R79 A;  3I54 A;  1JUM A;  5BQT A;  3HSF A;  2H27 A;  2GAU A;  2JRM A;  1FMV A;  4GGG A;  1JHF A;  3OMY A;  4QWQ A;  5D5W B;  1PP8 F;  2DYS H;  3ZQF A;  1XB4 A;  3OIO A;  2DK8 A;  4WXC A;  5DUI A;  2MH2 A;  1U9N A;  2VQC A;  1YX5 A;  4BUP A;  2GXB A;  5GTI C;  1JHH A;  1SFK A;  1ETW A;  3QU3 A;  1MMN A;  2K9M A;  1U2W A;  4XNF A;  1ZG3 A;  1RZ4 A;  5HLG A;  2V1N A;  3F9K A;  2PMH A;  4OMZ A;  1X1D A;  2DFE A;  3CMA I;  3DKX A;  1FYM A;  3HC7 A;  2ID3 A;  3PO2 J;  1S7A A;  3S1M J;  4J19 A;  2QKM B;  2COM A;  4RB1 A;  2WAQ A;  2PG4 A;  1Z3Y A;  3H3V K;  2JPC A;  3HL2 A;  4YIR X;  2CWE A;  2HYF A;  1JGG A;  1V5G A;  2ZME C;  1WI3 A;  3K4L A;  1YJN I;  1G59 A;  1IUF A;  2L2O A;  4QTR A;  1V5E A;  1OYY A;  3VOE A;  5M5W J;  4B47 A;  1OKR A;  3FXO A;  4WX9 A;  4OIP F;  2X6O A;  2DOE A;  1E3P A;  2ID6 A;  2H94 A;  3DPT A;  1Z67 A;  2KJC A;  3ABM H;  1YFH A;  5K1Y A;  1MNM C;  2NVT J;  1ETY A;  3OYM A;  4UVC A;  2HVQ A;  1IN7 A;  3DEE A;  1WCM J;  3FK6 A;  3HJE A;  3WE3 A;  1I3Q J;  2XVC A;  2MH9 A;  1BIA A;  4KFC A;  2E36 A;  3IKV A;  2JZY A;  3M8J A;  3OR1 C;  2BY2 A;  3B02 A;  4HPQ A;  2QSH X;  2OTJ I;  2KZV A;  3WU0 A;  4F91 B;  3DLL F;  1QO0 D;  1ERD A;  2XDV A;  3V7R A;  4U88 A;  2PMZ A;  3K1N A;  2ZC2 A;  4N9H A;  2TDX A;  1JTX A;  1U5T C;  5KVR A;  3MKL A;  1QHG A;  2LRE A;  4CYC A;  1E3O C;  3JRD A;  3FMQ A;  2ACJ A;  1FX7 A;  4LFU A;  1FBU A;  4NHJ A;  3OSG A;  4I98 B;  2QKL B;  3SDB A;  2RDP A;  2OPT A;  2KIS A;  3ZCO A;  5BPI A;  1X4O A;  3PJR A;  4C9Y A;  3T0Y A;  1MMA A;  1XMX A;  2JPB A;  2FMY A;  4BGD A;  2R92 J;  3QOE A;  5K5R A;  1TC3 C;  1HW5 A;  2H1K A;  2P5K A;  4U0V A;  5E3O A;  4LG0 A;  3VPR A;  1B9N A;  1YW7 A;  3I5U A;  2ZNZ A;  4YEL A;  2PBI A;  4F7Z A;  2HDC A;  1E3H A;  2DFF A;  4NC7 A;  2BYV E;  1Z0X A;  2V1U A;  3WE2 A;  2KZG A;  3HOY J;  3GFI A;  5HVQ C;  2HKX A;  1FLI A;  3FM5 A;  4AVP A;  1XCV A;  2YSR A;  2YUS A;  3PNT A;  3FMR A;  3RPQ A;  1R6R A;  4D5C A;  2NNN A;  3TL4 X;  1LNW A;  3HYI A;  1BOA A;  3K0L A;  4XLN F;  3ERM A;  3K2A A;  2CFX A;  1HSJ A;  4XR6 A;  5C4X J;  2WA0 A;  4DNC A;  2LP0 A;  2EH3 A;  2XAJ A;  5ERI A;  2R7U A;  2DDA A;  1RKW A;  4TV7 A;  1B1B A;  3A01 B;  3CCS I;  2VI6 A;  4E7L A;  2WAF A;  2LK2 A;  5LHI A;  1QBJ A;  3NWT A;  2Z9O A;  5LLQ A;  2BVM A;  2K5C A;  1Z6T A;  3S93 A;  2BHZ A;  4YII A;  4C3J J;  4EJW A;  1FOX A;  3OL3 A;  3V4G A;  2VKD A;  4M3G A;  3OS2 A;  2R3S A;  3KIO A;  2DOD A;  1R1T A;  2JT1 A;  1UAA A;  4M9X A;  1MD0 A;  4ENK A;  1IC8 A;  1R7J A;  4EV0 A;  4C2M J;  1ZAO A;  3ZOB A;  4R1H A;  3E6C C;  3EUH A;  4I0A A;  4LOC A;  4AIH A;  4BBR J;  1MGT A;  1TT5 B;  4PSW A;  1BR4 A;  1DUX C;  1HW1 A;  4BKX A;  5HOO A;  2DA3 A;  2CV1 A;  5A2Q K;  4BH9 A;  1BOB A;  2K40 A;  3GTJ J;  2L3D A;  3H0G J;  5AON A;  1USS A;  2BGC A;  4HDU A;  1IRZ A;  3IH3 A;  1WJA A;  5H6R A;  4CCO A;  2XAF A;  5FLV A;  2G7H A;  1LPQ A;  1VTN C;  1FPQ A;  1T08 B;  4RAF A;  1Z7U A;  1ZGJ A;  4A3I J;  3F72 A;  1JUS A;  1YQA A;  1VQ4 I;  1ZRE A;  5EF6 A;  4HX7 A;  3OYG A;  2ZJR F;  5BNG A;  3CTA A;  3ZPL A;  2IPQ X;  3B6A A;  3QRF F;  2I10 A;  2RQP A;  1EA3 A;  3BTL A;  2BXY A;  3LNQ A;  2H1L A;  2EIL H;  2UUZ A;  2VKE A;  1D1A A;  4AYB N;  4E4H A;  5IOY A;  2QSG X;  2LMD A;  4P5O A;  5F6F A;  2XGX A;  1YYV A;  2DT5 A;  2JA7 J;  3F8M A;  3I3L A;  3I58 A;  4XRF A;  2ME6 A;  4IXA A;  5F1J A;  2BW3 B;  5J3L A;  1S7O A;  1XMK A;  4MGR A;  3GO5 A;  1PP7 U;  2NVU B;  3SJM A;  3DQV C;  4PJN A;  3CDL A;  2DT6 A;  1ETX A;  1OCO H;  3F6O A;  2CH0 A;  2D1V A;  3PQJ A;  2WAD A;  2E60 A;  4ENM A;  1S6L A;  2M1B A;  4V19 K;  2F5E A;  1T33 A;  1LDJ A;  1JUP A;  4RMN A;  3RIR A;  2D45 A;  2L54 A;  4OIN F;  4X6A J;  5F0C A;  4A3C J;  3I53 A;  4Q47 A;  4UB8 C;  3BZC A;  3U1K A;  1IN8 A;  2EA4 A;  5EZH A;  1AA7 A;  4HLY A;  1KYW A;  2HDD A;  1WJD A;  2R7Q A;  3K1P A;  4IRG A;  3HXL A;  1IZ1 A;  3FM3 A;  4DZP A;  1SVL A;  1GV2 A;  5KAF C;  1X19 A;  3RQI A;  4LLN A;  1OQY A;  1O3Q A;  2HDW A;  2XV4 S;  4XLC A;  1R5G A;  1ENH A;  1WVR A;  1RUN A;  1ZAR A;  2Y0S A;  4MIM A;  4X0G A;  2X6X A;  1UJ8 A;  3OYD A;  2KDZ A;  1TWH J;  1PDN C;  2EZH A;  4GYI A;  4DJA A;  2DJI A;  3F8B A;  3G71 I;  1X1C A;  4L5J A;  4Y3O A;  4ON0 A;  3OOU A;  2A07 F;  5D6E A;  3CLO A;  4FCY A;  2LC2 A;  3S3O A;  1XS9 A;  2QZ8 A;  1BJA A;  4IQ4 A;  3OYB A;  2OCC H;  1W1W E;  5J4V A;  2XPV A;  1I5Z A;  2L01 A;  3WTT C;  1NG7 A;  3JR9 A;  3R60 A;  1O7L A;  1OMI A;  1JE8 A;  2XAH A;  2IP2 A;  3RSN A;  2CRG A;  2F5D A;  2NOJ B;  3DPU A;  3MZH A;  2QVO A;  1G3Y A;  1T98 A;  1XCB A;  5GTH C;  5JVT A;  1JJ8 C;  2HVS A;  2ZXI A;  2LR8 A;  2LTP A;  1Z05 A;  3BJA A;  2K4J A;  1MH4 A;  5IYB J;  2DCE A;  3CP2 A;  4EJU A;  3CC4 I;  5EZG A;  1I27 A;  2M3A A;  4RS8 A;  1WGX A;  2X6W A;  1O3S A;  3MQ0 A;  3FXK A;  4KN4 X;  3BC8 A;  1ZTR A;  1X2N A;  1YX3 A;  3IWF A;  4JX5 A;  1D0Y A;  3K4B A;  4C30 A;  4IO9 F;  5J47 A;  3K2Z A;  5IYC J;  3O6B B;  4ANJ A;  2X4H A;  3BG6 A;  3CC7 I;  2VKV A;  2JN6 A;  2I5U A;  2L9R A;  4BJT A;  1YOV B;  3PUF A;  4Y4R A;  5L3G A;  3BPX A;  1PUE E;  4KIC A;  2E71 A;  3FBN B;  4XKB A;  2IS1 A;  3HPG A;  2R7X A;  1D3Y A;  3B73 A;  2V1X A;  4Y15 A;  4BQN A;  4EQQ A;  4I99 C;  3IC7 A;  5IPA A;  1P92 A;  5FJ8 J;  2E35 A;  1K6Y A;  1N25 A;  2HS5 A;  4GCV A;  1FZP B;  2KP6 A;  3CCQ I;  2O6G E;  1ETV A;  2MG4 A;  3EUH C;  1X2M A;  2KRC A;  4I76 A;  3M8F A;  2EV5 A;  2R5Y A;  5J1R A;  4MTD A;  1STZ A;  4BQQ A;  4UUV A;  2O03 A;  2XAS A;  4AUX A;  2UV1 A;  4UHT A;  1HDP A;  3W2W A;  3WTX C;  4N4N B;  2A6H F;  2GA2 A;  2C6Y A;  1N78 A;  2W4S A;  4KIF A;  5IY5 H;  4B4C A;  3GFM A;  4A5N A;  5CVJ A;  3Q0V A;  3TDU C;  3IAS 2;  2A5W A;  3U1D A;  5D6F A;  5M3F J;  2F4I A;  3OWT A;  1GVJ A;  4PDK A;  3H5N A;  4JBA A;  1ETQ A;  3F23 A;  1N75 A;  4M6V A;  5ICF A;  2XGC A;  1QRY A;  2E7X A;  4CUG A;  1ZGW A;  4L9T A;  4Q48 A;  2MBF A;  3DLA A;  2DT7 B;  2HGC A;  2GLO A;  4XSX F;  2DMT A;  1QNT A;  2Y75 A;  1YRN B;  3RDI A;  3S2H J;  3KX2 A;  5EEA A;  4A0X A;  5C3E J;  3DTI A;  4M74 A;  3J81 K;  4BYY A;  1OCZ H;  5J40 A;  1RPW A;  2BY1 A;  1ON1 A;  2A6T A;  2L9N A;  4JK1 X;  1ZQ3 P;  2O0Y A;  4RGX A;  1ULY A;  1RC9 A;  2KIU A;  3PM1 A;  4KUM A;  4E70 A;  1WJC A;  4ZC3 A;  1U8B A;  3HOX J;  1YO5 C;  5ICE A;  1GLN A;  4ZTF A;  4IEJ A;  3H9J A;  2VL8 A;  4D0P A;  3HOU J;  3GTG J;  2KRH A;  4IJA A;  3L1P A;  1MBG A;  2VOO A;  2VON A;  2A61 A;  2XRL A;  3BPV A;  2L5Q A;  2XRN A;  3S16 J;  1LVA A;  2F6C A;  1C0W A;  1KU2 A;  1XGN A;  1SFO J;  3BRO A;  1BBY A;  2RAE A;  2JMW A;  5E8G A;  1TW2 A;  2DDB A;  5E3M A;  3L09 A;  1WFX A;  3LSM A;  5E20 A;  1V4R A;  4F93 B;  3A03 A;  3QYB A;  4A3M J;  3C3W A;  4O3M A;  1WJB A;  2CSO A;  1DGW Y;  1ZYR F;  2RC4 A;  1HC8 A;  1JGS A;  3ISP A;  2CG4 A;  4BHC A;  2Y2Z A;  2LVS A;  1CGP A;  1T56 A;  2EV0 A;  2IJL A;  4BAC A;  1LEB A;  5DYM A;  2W85 A;  4C3I J;  2DMN A;  2ZKZ A;  2XF7 A;  1K7A A;  1LQ1 A;  3K70 C;  4S05 A;  5F1R A;  1I39 A;  2A6E F;  3L2W A;  3O8H A;  3CCY A;  2PLY A;  3RQ4 A;  3LA7 A;  3C2G A;  3KZY A;  1UZC A;  1IUY A;  3TBI A;  2EFQ A;  2CJJ A;  2YPR A;  3I4N J;  2QLZ A;  4FX0 A;  1U78 A;  3K9T A;  4U7B A;  2IS4 A;  3WHB A;  4IRH A;  3M7G A;  3MEX A;  3OSF A;  1ZHF A;  3T1B A;  1F9N A;  4EAT A;  4IHV A;  2NXN B;  1LFU P;  1VQN I;  1NG6 A;  3CQZ J;  2VIX A;  3RPU D;  4Y7N J;  3K4N A;  4HX4 A;  3QOD A;  2OC6 A;  4XSZ F;  3VYT B;  1LDD A;  4JP0 A;  1VZ0 A;  5E79 C;  3WG7 H;  4KIT B;  2DMQ A;  3A2K A;  3SEZ A;  2QQ9 A;  2M45 A;  2G9W A;  3O2P E;  1OR7 A;  3E5Q A;  2JJ7 A;  3R4K A;  1BJZ A;  3ZMV A;  3F3X A;  2K27 A;  3GTQ J;  1KQ8 A;  1XG1 A;  2MA3 A;  1R71 A;  1A35 A;  2H6C A;  5HS7 A;  2AQF A;  3MKY B;  4FET A;  3ECO A;  1F36 A;  1T6S A;  3BR2 A;  3H0D A;  1UCR A;  5D5U B;  1SD4 A;  2FBH A;  5EGO B;  2V6E A;  3D5L A;  5CVR A;  1G3T A;  4HV6 A;  1JJ6 C;  2XIG A;  4DGW B;  4Y17 A;  2MFZ A;  5B66 C;  1EH7 A;  3JRF A;  1RES A;  2WV1 A;  2DA1 A;  3BG3 A;  2VE8 A;  2QA4 I;  1Z9C A;  2GBY A;  3HPH A;  3P7N A;  2ZXJ A;  3KP7 A;  3ULQ B;  2B9S A;  1J5Y A;  3CJR B;  1MSE C;  5IP7 J;  1HCR A;  4RM2 A;  3R6S A;  4G6T B;  2FE3 A;  1BN5 A;  1JKO C;  1ON2 A;  5LD2 C;  1Y39 A;  2EZK A;  4WK8 F;  1IV6 A;  3EUA A;  2DMP A;  2YX4 A;  2ZFW A;  3J7Y J;  3BWG A;  3BG9 A;  1K6O A;  2B7E A;  2XHK A;  2STT A;  2H8R A;  2X1E A;  1FNN A;  2E1C A;  4BDZ A;  1WPK A;  1P4W A;  5GAG J;  4PZJ A;  1XSX A;  3Q3S A;  4OAZ A;  3W6K B;  2ADU A;  1G8X A;  5M5Y J;  2L02 A;  2CW7 A;  1E0E A;  4RB0 A;  3QPS A;  2LF7 A;  5HLT A;  3I64 A;  3JRI A;  2N8G A;  1R49 A;  4FE4 A;  4DBQ A;  5M5X J;  2LKX A;  3HGG A;  1O3R A;  2L9S A;  4KDP A;  2IRF G;  2HI3 A;  1P6R A;  2XKO A;  1DGR M;  3LSR A;  1B6A A;  2X1C A;  2KDO A;  4RAZ A;  1TWF J;  2NYX A;  2YR2 A;  1Y8R B;  4OU0 A;  4PGH A;  5HNH A;  4RA2 A;  3HRT A;  2XC7 A;  2IA1 A;  4XL9 A;  1WRJ A;  3DPL C;  1WSU A;  1Q1H A;  2EFN A;  4J01 A;  2FJ1 A;  3PL8 A;  1B4A A;  1FC3 A;  4AWX B;  2DFH A;  3CF2 A;  2JUC A;  2CQK A;  1UHS A;  2Y30 A;  1D1C A;  1D5Y A;  5JLW A;  2A68 F;  3KET A;  1T2K A;  3IRQ A;  2NRA C;  3LST A;  2BV6 A;  3PSF A;  2K9N A;  2LOO A;  5F64 A;  1FYL A;  2VOD A;  1J2X A;  2WTE A;  4CA0 A;  2K02 A;  2UXX A;  1H89 C;  3DKW A;  4CYD A;  1H88 C;  3MD2 A;  4IHW A;  4RAY A;  1V3F A;  1XGM A;  2OJE D;  1IG7 A;  2EZI A;  1RUO A;  2R5Z A;  4IL6 C;  4B48 A;  3GCM A;  5FKK A;  4ZZD A;  3ZMZ A;  4HA8 A;  5CPR B;  1LFP A;  3T8T A;  4YFN F;  2EIN H;  3L2Q A;  2PQ8 A;  4A0Y A;  2PN6 A;  3WGI A;  4PFO A;  1WH5 A;  3VEP A;  4I01 A;  4ASN A;  2CMP A;  3ZRG A;  2BY3 A;  1S3J A;  1JT0 A;  1FP1 D;  4LIU A;  3GBG A;  2EIK H;  2V9K A;  2JA2 A;  3DU5 A;  2RN7 A;  3KE2 A;  3FXQ A;  2GOM A;  2KLO A;  3VOD A;  5JVG F;  5DCF A;  3A01 A;  2IT0 A;  4LB5 A;  1FSE A;  5M3M J;  4LK0 F;  1MSF C;  2VBY A;  2K9Q A;  4LLG F;  3ELK A;  3T8R A;  3E6D A;  1OR7 C;  2BY0 A;  2KMU A;  1ONV A;  4W1U A;  4I09 A;  3IRR A;  2LG4 A;  5DM7 F;  2VAS A;  3VYS B;  3OYA A;  1DQU A;  3OYH A;  5E18 F;  2K9S A;  2HKO A;  1OFC X;  2HTS A;  2O3F A;  4XLH A;  5JR3 A;  1KU9 A;  3F22 A;  1SD7 A;  2AHQ A;  1RKT A;  4E7H A;  3MZY A;  2G7U A;  2P4W A;  1IAW A;  5GPA A;  2V9V A;  3AL0 B;  3CDI A;  3D0S A;  2L0K A;  1TWC J;  4E7Z A;  4JQF A;  2X85 A;  1Z77 A;  1NHA A;  3NAR A;  4G6D A;  2D1H A;  2VN2 A;  5HLI A;  2WAQ N;  3FX3 A;  2DO7 A;  4CCL A;  3RKX A;  3ZGK A;  2UXN A;  4Q5S F;  2Q0O A;  1FTZ A;  5KCM A;  3B6C A;  3BY6 A;  3FXJ A;  3HOS A;  4XLE A;  3PSI A;  1OYW A;  4M3D A;  1M1E B;  1T8I A;  2ZNY A;  1XDU A;  2R5Z B;  2R7Z J;  3A4C A;  4HAM A;  2OZU A;  3I56 I;  1N77 A;  5K7F A;  2ETH A;  1R23 A;  3T5X A;  2F5C A;  1YIJ I;  2F4O B;  2MD0 A;  2FX0 A;  2XGE A;  2ISZ A;  2OTL I;  2DQR A;  3GVA A;  1IF1 A;  1VQK I;  1X1P A;  2L7M P;  3K6G A;  3CUQ B;  3BTC A;  3GZ5 A;  2BW3 A;  3E6M A;  2Z2S B;  3DCF A;  1PJR A;  4Q4Z F;  3CCM I;  1DP7 P;  2ZBK A;  2FSW A;  2Y48 A;  2Q1Z B;  3MFK A;  2PMZ N;  2Z99 A;  4G9Y A;  4KIB A;  4MEX F;  4HYE A;  3V8K A;  5BMZ A;  4PJ0 C;  3GTM J;  4P96 A;  4EEF G;  4B1R A;  2HEO A;  3X2Q H;  5E17 F;  1A6I A;  2KKO A;  1DDN A;  1NK3 P;  2GM4 A;  4HNV A;  3BJ6 A;  2CO5 A;  3K4K A;  1ZRC A;  3K1M A;  2DPD A;  3BQY A;  3TGN A;  1QHH D;  4EM1 A;  3RZD J;  3WTV C;  1Q1V A;  3DWL E;  2ESH A;  4OOI A;  3QOP A;  5C4J J;  2OQR A;  4YRV A;  3RPU A;  1D0X A;  5FKO A;  2DA2 A;  1VQL I;  3WTW C;  1OLT A;  2G0E A;  2XAU A;  4C3H J;  2LKS A;  1QGP A;  4BEH B;  3OR2 C;  4XLA A;  4A3B J;  2ELJ A;  3HTU A;  1F4K A;  3BCA A;  1EF4 A;  3ZMT A;  2XAQ A;  1ZG1 A;  1IW7 F;  1A36 A;  3DBH B;  2XRO A;  1EH8 A;  2LRD A;  4ZYE A;  2YS9 A;  2XF6 A;  4AYB A;  3CME I;  4XIC A;  4O6J A;  3QYE A;  2P5V A;  4L9J A;  4A3E J;  3ZMU A;  3DTK A;  1FIP A;  2LY2 A;  3S1R J;  1UEL B;  2Q8K A;  2BHY A;  4XRS G;  3NEU A;  2DOA A;  3FBI B;  3QP5 A;  2KT0 A;  1JT6 A;  5FRO A;  4HZF A;  4MFD A;  4DQ2 A;  3CMM A;  4II2 A;  2HOT A;  1W5T A;  3M4O J;  2FML A;  1MBK A;  5IP6 A;  5KHD A;  1QU3 A;  4KIS A;  2MLK A;  3ASO H;  2W25 A;  3A0H C;  3JTG A;  3RKQ A;  4BXX J;  1DPR A;  2XUB A;  1R4N B;  5IT9 K;  5HS8 A;  3ZQL A;  2DW4 A;  3ML6 A;  2WY7 Q;  1U6G A;  2OCE A;  4NQW B;  5AIQ A;  3PIO F;  4U7D A;  2JVG A;  4IRI A;  2L7F P;  1MBH A;  2EPF A;  3DF8 A;  4NNJ A;  2HYJ A;  3K69 A;  2CFO A;  1U9O A;  5HS9 A;  1R9T J;  4JOM A;  2M7A A;  5DCM B;  1S7E A;  1BW6 A;  3LSI A;  3JSP A;  5C44 J;  1DP3 A;  4JX6 A;  1TLH B;  2VT2 A;  3NQO A;  5J6X A;  3MMY B;  4M71 A;  3WTZ A;  3PIP F;  1UG0 A;  3HRS A;  3LAJ A;  2Z5U A;  5LRR A;  1LUJ B;  3ABT A;  2F5V A;  2PFB A;  3H9Q A;  3OY9 A;  1S29 A;  4LG3 A;  3NAU A;  1BI3 A;  4IX7 A;  2CV0 A;  1TQI A;  3WOD F;  3ABK H;  5FFZ A;  2V9P A;  2BEO A;  2L9V A;  4OAY A;  2GZW A;  1AU7 A;  5H20 A;  1KQ9 A;  3CJT B;  2WAE A;  2VB6 A;  4V2G A;  2OQG A;  4HW0 A;  3MKW B;  3O8G A;  1UST A;  3OYN A;  4KJZ A;  5CVU A;  1MJA A;  2ZJ2 A;  4CIC A;  4PJL A;  1FIA A;  1GDT A;  3GFL A;  2WWY A;  1S5L C;  1JTY A;  2K9L A;  2ZJP F;  1XPX A;  5K5Q A;  5DUK A;  5K7H A;  3COA C;  3TOA A;  1K78 A;  5E8I A;  2Y69 H;  2Z1D A;  3OYC A;  4PFP A;  4BAY A;  3ZN0 A;  2FXA A;  5L3D A;  1PUF A;  1FT9 A;  3MZ8 A;  3SXY A;  2YU3 A;  4FE7 A;  1X58 A;  4IF4 A;  2DA4 A;  4UUS B;  2Y31 A;  3HUG B;  4XKW A;  1YRN A;  3PNY A;  4F52 A;  4II3 A;  5J1U A;  3ZQH A;  1T39 A;  1K79 A;  1FBS A;  1I3A A;  2JSP A;  1HLV A;  3GTP J;  1V54 H;  1QZE A;  4HOB A;  4KYW A;  1R1V A;  1MJ9 A;  2L7Z A;  3V8J A;  1O4X A;  1LEA A;  2BZT A;  3JCU C;  4I7H A;  2QCO A;  4XBF A;  4ABZ A;  2EK5 A;  2J5O A;  4WF2 A;  1Z3X A;  1B59 A;  3Q0W A;  1UG2 A;  1Z21 A;  1A6Q A;  2E5Z A;  2DA7 A;  4CCM A;  4YFK F;  2HQ5 A;  2HNH A;  1VQ6 I;  4YFX F;  1KGS A;  1R5H A;  1X1B A;  2FRH A;  3CCV I;  1YHQ I;  1NH3 A;  4XK4 A;  4UB6 C;  3D1N I;  1BC8 C;  1BI2 A;  1QA6 A;  3DTE A;  1UMQ A;  2HXI A;  4HQE A;  1BIB A;  4L0Y B;  2QEN A;  4X1E A;  4Y52 J;  3JRA A;  2ELK A;  3E0J B;  1SMT A;  3OYI A;  3UNG C;  4ZTJ A;  3EQL F;  3S8P A;  5J4Y A;  1LE8 A;  1J75 A;  2K7L A;  3SHF A;  2VC1 A;  2FOK A;  5FKM A;  2KJB A;  3H1C A;  3H3U A;  3TW7 A;  4U0W A;  3WG9 A;  4IOA F;  2IGK A;  1BM9 A;  4HG2 A;  2KPM A;  1WJF A;  3Q0U A;  5FKL A;  1HBX G;  2P7V B;  3UKG A;  3BTI A;  2HZD A;  4LB6 B;  4NUB A;  4A3J J;  4NBQ A;  1IN5 A;  5FKN A;  4XRS A;  4E6K G;  1G3S A;  5LEK A;  3HHG A;  4LMY A;  3ZMD A;  3JRH A;  2CUF A;  4HNT A;  1Y0U A;  2P6S A;  1K4T A;  4A6D A;  2CQN A;  2IW5 A;  1B72 B;  1WJ5 A;  1K78 B;  3ZMS A;  4NC6 A;  1VQ5 I;  3FMS A;  4I02 A;  4H0E A;  5ILS A;  2IVM A;  4LIT A;  1X4P A;  3KEQ A;  5E1W A;  1ZRF A;  1PUF B;  4IQJ A;  4OWR B;  1F1Z A;  1GV5 A;  4CO8 A;  3LA2 A;  1Y8Q B;  4CSW A;  4M9S A;  5L3E A;  1Z91 A;  4WCG A;  2WB1 A;  4ZDO A;  1KU7 A;  2HXO A;  2PEX A;  4HDV A;  3GF2 A;  5KAI C;  2BE5 F;  1I1G A;  3DU6 A;  5FO5 A;  4BXF A;  3L2C A;  3ZQI A;  2HR3 A;  1TZL A;  4DYR A;  2O7O A;  3V8L A;  4RB3 C;  4FHT A;  4HLX A;  3SEQ A;  3UR3 C;  5FD6 A;  1IDY A;  1V55 H;  2R7R A;  2R7W A;  2ECC A;  4XID A;  1KON A;  5EGO A;  3OV8 A;  2UWM A;  3BCB A;  2R93 J;  3WTS C;  1ITY A;  3AFH A;  3U21 A;  5LHG A;  3CO7 C;  1REP C;  4DW6 A;  4CZC A;  3E3V A;  2QF7 A;  2EJR A;  1S72 I;  3ZN1 A;  5EG0 B;  4OIR F;  3ZXS A;  1HKT A;  2ZCW A;  1LE8 B;  1IRF A;  3K7A J;  4UNO A;  2QGU A;  3PO3 J;  4PSX A;  3QPH A;  4Y33 A;  5CKT A;  3EPZ A;  3HSR A;  2LF8 A;  4QSH A;  9ANT A;  1TQP A;  2NVQ J;  2YX7 A;  3QPT A;  1GHC A;  2PMU A;  4UV9 A;  4HV5 A;  1QVT A;  3R0A A;  2VKH A;  5FB2 A;  3TOB A;  3W6V A;  1YE9 A;  4F3Q A;  2WC2 A;  1MZB A;  3R61 A;  2FF4 A;  1R22 A;  3HKZ A;  3KZZ A;  1RR8 C;  2HQA A;  2ZXH A;  4XOR A;  1TBX A;  1A04 A;  1OCR H;  2B63 J;  3S3M A;  3LA3 A;  3JAM Z;  2QEX I;  2DQL A;  3BR5 A;  3C2B A;  2MD5 A;  2MC3 A;  1DPU A;  1FEX A;  2KRF A;  3G73 A;  2DAO A;  1IXR C;  1FOW A;  2MLG A;  2R7F A;  2KQR A;  4HEA 2;  3JRB A;  2R7S A;  2VOP A;  5FRM A;  3HB9 A;  3HZJ A;  3LSK A;  3EYY A;  1FTT A;  5D5V B;  3DV8 A;  3S14 J;  1JKQ C;  1FJL A;  5CYV A;  3KP2 A;  4PGG A;  1YS7 A;  1IRX A;  2ELH A;  2NAZ A;  2A05 A;  3CES A;  3DEW A;  3KLN A;  5TIS C;  2CS3 A;  3SZT A;  1G3W A;  3TED A;  2DPU A;  1ZK8 A;  4E7J A;  5JHF A;  4A3D J;  3I55 I;  1UFM A;  4BU2 A;  2O8K A;  1S8N A;  4N4O B;  2HYG D;  3NRV A;  4AU7 A;  2LH9 A;  4UY8 I;  4CCN A;  4FQG A;  2Z33 A;  2NOG A;  4EVI A;  2COB A;  2VPL A;  4LK1 F;  3GYH X;  1MBJ A;  1KZH A;  2E1O A;  4WWC A;  1KYZ A;  3ECH A;  4H4K C;  3GEZ A;  4XM3 A;  3KYL A;  1AWC A;  1W5C C;  4QIW N;  4FT8 A;  1BR2 A;  4PJM A;  2HPI A;  3H35 A;  3G4S I;  1YS6 A;  4MTE A;  4DYC A;  4ZYD A;  3IHU A;  4ETS A;  5BS6 A;  1XDS A;  3BJO A;  1A5J A;  4UUT A;  2BBY A;  2LKP A;  1XSV A;  2E1M B;  3ROU A;  3RTR A;  3VB2 A;  2FD5 A;  2RGV A;  2VC0 A;  5DD8 A;  3HBL A;  3R0J A;  3EYI A;  3HSE A;  3RYP A;  2E1N A;  2M0M A;  1TQM A;  3P9K A;  4LIV A;  3H36 A;  5F0H A;  4XLP F;  2HWV A;  3JRC A;  3W3C A;  1JXS A;  3FDY A;  4XRM A;  3BOQ A;  4M9Z A;  2CUZ A;  2M34 A;  1FP2 A;  3KLO A;  2DMU A;  2VBZ A;  3HOZ J;  4ESJ A;  3CC2 I;  1F43 A;  2GIZ A;  1VND A;  1W4M A;  3VYR B;  3MKZ A;  3ASN H;  3RYR A;  3M1E A;  2Y0M A; 
#chains in the Genus database with same CATH homology
 1VQM I;  1QA6 A;  1VQ9 I;  3CCL I;  2NXN B;  1VQN I;  3PIO F;  1VQP I;  5GAD J;  1ACI A;  2E34 A;  1VQO I;  4IOA F;  3I56 I;  3CMA I;  1YIJ I;  3CCS I;  2QEX I;  5DM6 F;  2OTL I;  1VQK I;  1FOW A;  3CCJ I;  5GAH J;  3G6E I;  3PIP F;  1FOX A;  3G71 I;  1YJN I;  3CCM I;  1FOY A;  1VQ7 I;  1VQ5 I;  3CJT B;  3CD6 I;  3I55 I;  2JQ7 A;  2QA4 I;  3CCR I;  4IOC F;  4UY8 I;  2E36 A;  2ZJP F;  1YI2 I;  2FOW A;  2OTJ I;  5JVG F;  3DLL F;  3CC4 I;  1YJW I;  1Y39 A;  2ZJQ F;  3J7Y J;  3G4S I;  5GAE J;  1VQ4 I;  2ZJR F;  4IO9 F;  2H8W A;  3CF5 F;  3J7Z I;  5DM7 F;  1YIT I;  3CC7 I;  1HC8 A;  3CME I;  2K3F A;  5GAG J;  1VQ8 I;  3CCU I;  1VQL I;  2E35 A;  3CCQ I;  1S72 I;  1MMS A;  1YJ9 I;  4V19 K;  3CC2 I;  1VQ6 I;  3CCV I;  1YHQ I;  3CCE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...