3CMES

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cmeS00
1WEZA 2J76E 4FXVA 2MZRA 1YJWS 4WKRA 3SDEA 2N3OA 3CTRA 1VBZA 2CPHA 5CA5A 2RVJA 3G8SA 3P49B 2LCWA 2MQNA 4WCEQ 4OZ1A 1U1QA 1S79A 2MB0B 2N82B 1WHYA 2VONA 1UAWA 3CMES 2DO4A 2JRSA 2KM8B 3BO4A 2CPXA 2HVZA 4PRFA 2ERRA 1U1PA 1M5KC 2KU7A 1L3KA 2U1AA 2N7CA 3S7RA 2AYBA 1X4GA 5DDPC 1FJEB 3NS5A 2UP1A 3P6YC 2MJNA 3UD3P 3UCUP 2D9PA 1WHXA 1DHMA 4P6QA 2MGZA 2FC8A 1ZH5A 4IOAQ 1N8RT 2KXFA 2DGUA 1WEYA 4CQ1A 2MMYA 3PIOQ 5IM0B 1D8ZA 3CF5Q 2DHXA 2DHSA 1JMTA 2JX2A 1X0FA 2AYGA 1N88A 3CCVS 2OSQA 2YH1A 2DK2A 2CPFA 3B4MA 1FJ7A 1VQLS 2CPJA 2DHGA 3H2UB 4C7QA 2MHNA 2VOPA 1X5SA 3G71S 2MY7A 1QM9A 2YTCA 3EGZA 1VBXA 2LMIA 2MZTA 2DNLA 3EX7B 4YOEA 2MQMA 5JVHQ 1FJCA 3NNHA 4F25A 2KG0A 3VAIA 2V94A 2MKHA 4OZ0A 2RRBA 3TO8A 3U1LA 3MOJB 5GAHU 2M88A 2DGTA 2MKIA 5ITHA 2NLWA 2F9DA 5CYJA 1X5OA 1H2UX 1WF1A 2VODA 2Q79A 2GO9A 5IM0A 3SXLA 2KI2A 1HD0A 2E44A 2OIHA 2M9KA 1WF2A 1QVFR 5IFMA 1WG4A 3DLLQ 1X4DA 2MKKA 2KYXA 5H1SV 4A8XA 2RU3A 2XNRA 3JB9k 4QU6A 3L3CA 3VF0B 2KH9A 5DM7Q 5HL7Q 5CXTA 1FHTA 3I56S 2XS7A 3G4SS 1JJHA 1OIAA 3FEXB 1W2BR 5DDQC 2DNQA 3THTA 3CCES 1FO1A 1U6FA 4TU7A 3VAHA 2CPEA 1K9MT 1AUDA 2XB2D 5GMKa 1FXLA 3VAGA 2MJUA 2MPUA 5MLCV 1VC0A 3J7YU 2G0CA 2KN4A 1VC5A 4IOCQ 3CPWR 1P1TA 3CCUS 1JJ2R 2M52A 2RUGA 2ZJQQ 2LEBA 2DNMA 3UCGA 2CQGA 3R1LA 4YB1P 2M2BA 2EK6A 1P27B 3UD4P 2HGLA 2CJKA 2DHAA 2U2FA 5LXYA 3IRWP 1CVJA 2MZ1A 4QU7A 3G8TA 2F3JA 1X5PA 3DXBA 2DISA 2MZJA 4LIRA 5IQQA 3S6EA 3D2WA 1KOHA 2GHPA 3K0JA 2X1FA 2CQCA 1WWHA 3J7ZT 1X4AA 4ZKAA 2L41A 2J0SD 1JJ4A 2MKSA 2FHOB 2AYEA 2DIVA 1OPIA 1YTYA 2MQPA 2JWNA 3OW2R 2MQLA 2M8HA 3THPA 2DO0A 5DDOC 2XNQA 3CMAS 1O0PA 2DGXA 4CH1A 1VQKS 2AD9A 1SJQA 1VQ8S 4LMZA 2M8DB 1VBYA 2CQ0A 1DBDA 2LECA 1PO6A 1PGZA 4YUDA 1OO0B 3CULA 2JVRA 2KXHA 3NS6A 2JVOA 4CIOA 3UE2A 2ADCA 2CQIA 4PR6A 3P5TL 3UCZP 1YJ9S 1NO8A 2RS2A 4U67Q 1HL6A 2HGNA 1U1KA 2XS2A 1HA1A 3R1HA 3RW6A 2DNKA 3CUNA 1RKJA 1YIJS 4WFBQ 1OWXA 2LQ5A 2DGVA 2MZSA 1N52B 1S72S 2SXLA 3G6ES 2CQ3A 2CQHA 3FEYB 5FJ4A 3CCLS 2DNGA 1FT8A 3CC2S 2D3OR 4F02A 2MY8A 1K73T 4QQBA 5GADU 2E5GA 1A9NB 1RK8A 2DGQA 3MD1A 5BJRA 1QVGR 1VQNS 2BOPA 3NNCA 2KT5A 2MXYA 1WELA 2CPDA 4WFNQ 2CPZA 1M5OC 2CPIA 1VC6A 1M5PC 2HYIB 2MKCA 2OSRA 2RS8A 2M4MA 2CQ4A 2DH7A 2L9WA 2KM8C 2D9OA 1U1NA 1DZ5A 2OTLS 3ZZYA 1NU4A 2AYMA 2N3LA 3SMZA 1X5TA 2RNEA 4ERDA 1G2EA 2KFYA 3CCQS 1WEXA 3CC4S 2MSSA 1VQ5S 2CQPA 3UWTA 4LJMA 2J8AA 2DNNA 2VOOA 1XN9A 4QPTA 3N9UC 2DNZA 4C4WA 1X4CA 1BY9A 1M5VC 2RQCA 2CQDA 2M70A 2QA4S 4W92B 2XSFA 1M1KT 2HGMA 2DGWA 1ZZNA 1B7FA 3EGNA 1H2TZ 5LSLA 2QFJA 3CCRS 4CH0S 1WG5A 2I2YA 2LXIA 2LYVA 5DDRC 1YHQS 4BS2A 5LJ3Y 2DNYA 4FXWA 3ULHA 3TYTA 1SJRA 2FC9A 2ZJPQ 2G1DA 2KHCA 1D9AA 2HZCA 2MYFA 1X4HA 5LSOA 3HI9A 3LQVA 2MZQA 2OJ3A 1R8HA 4PKDB 1Q7YT 3PIPQ 4TLQA 2CQ2A 2MQQA 1KD1T 1X4BA 2YKAA 2KG1A 4WF9Q 3B4DA 2YH0A 2XS5A 4Y0FA 2DITA 3SDEB 4IUFA 3NNAA 3MUVP 2CQBA 1VQPS 2X1GA 2DGSA 1WTBA 4Y00A 3BO3A 1Q86T 3TP2A 1SJ4P 2G4BA 5D77A 2LEAA 1UFWA 2X1AA 2QEXS 5DM6Q 2NZ4A 2LXUA 1WG1A 3Q2TC 1X4FA 4TU8A 1UW4A 3MDFA 2I38A 5GAEU 2DNRA 2KVIA 3H2VE 2RQ4A 3VAFA 1U1LA 4Z2XA 2DNHA 1K8AT 4ED5A 1U6BA 3VALA 2KRRA 3MD3A 1U1MA 3G9CA 2CQ1A 3G96A 1ZZFA 2DH8A 3BS9A 2PE8A 3MUTP 3P3DA 3NMRA 5EN1A 5GVQA 3CCSS 4J5OA 3RW7A 3BO2A 2A3JA 1DRZA 5DETA 2MGZB 3MUMP 2CPYA 3MXHP 2L08A 1KQSR 3BEGB 4W90B 2OTJS 1KOOA 2ADBA 2J0QD 1VQ6S 1SJ3P 4C0OC 2LKZA 3MI7X 3CCMS 2FPHX 1N54B 2O3DA 3IWNC 4TU9A 4UQTA 1YWXA 2EK1A 3R27A 3V4MA 1URNA 1U1OA 1HD1A 1SXLA 3VAKA 2E5HA 2K8GA 1SJFA 3CC7S 3CCJS 1YJNS 4M5DB 1Q82T 2KXNB 1H2VZ 2K3KA 3CXCR 4EGLA 1M90T 2DH9A 1H6KX 3MURP 4F26A 5LXRA 2F9JA 2FY1A 3U1MA 1YI2S 2MSTA 2M7SA 2B0GA 1A7GE 1U2FA 2ZJRQ 1VQ9S 2LA4A 4UY8T 5HO4A 1IQTA 3LPYA 1UP1A 1WI8A 1NJIT 4WFAQ 3VAMA 2DNPA 2LA6A 4V19X 2EVZA 1R8PA 5GAGU 1WHVA 2DGOA 2BZ2A 2RT3A 2WBRA 1U1RA 2DIUA 2E5IA 2DNOA 5D78A 3S8SA 1KC8T 1VQ4S 3ZZZA 2M0GB 2X1BA 5JVGQ 1X4EA 1Q81T 1VQ7S 2PEHA 3Q2SC 1VQMS 3I55S 3US5A 2MQOA 1FNXH 2RRAA 3VAJA 2E5JA 1WI6A 5LJ5Y 4IO9Q 2KRBA 3HHNB 2DB1A 1WHWA 2MKJA 3S01A 1YITS 1WF0A 1F9FA 2YWKA 1VQOS 4WIIA 4RU2A 3CD6S
chains in the Genus database with same CATH superfamily
3OTOJ 1RACB 2J76E 3M8PA 2DYAA 4OZNA 2J9DA 2B9WA 4ILRA 5J2NB 1N56A 2A2CA 3A3OB 3NBPA 4DCOB 2HHXA 3SDEA 2N3OA 4ZPDA 2FD2A 2YXLA 3RRKA 3I82A 4DR7F 4O4GA 2CPHA 1DTQB 2OP5A 3IBCB 3LGNA 4O44A 1WOOA 2W8KA 3NP5A 3T1YF 3P49B 3W66A 4A8WA 4WCEQ 4JP8A 1HPZB 2F8MA 4AQYJ 3O3LA 5KFAA 3MAAB 3RYLA 5F8NA 1SBRA 4RW6A 1TP7A 2QLWA 1SKUB 1UEUA 2VKRA 3JTNA 4NEZA 4OJ1A 1S57A 1UAWA 3BGFA 3PW4A 3A8EA 2PGCA 3QATA 3R7BB 4ED3A 4C0HA 1H0HB 4I56A 5CCMA 1N5YB 2CVIA 3OR1B 4E8UA 1QE1A 2KU7A 3PR5B 2OEJA 4WU3A 1IWGA 2AYBA 2BKPA 2DXEA 2Z2YB 4ED5A 4ZVTB 2R4FA 3H59A 2OAUA 3NKYA 4WYWA 3UD3P 3BGLA 3BM7A 1WHXA 2BABA 1DHMA 2YNHB 1PJ5A 4TY8A 1XR5A 2IHR1 3SCKE 3M6XA 5K9FA 1LFWA 4A8KA 2FC8A 3PZPA 1KEKA 3QJPA 3QRRA 1ZAXA 3UN3A 2E7VA 1TFYA 1TMJA 3GONA 2DGUA 4CQ1A 2HHSA 3PIOQ 3FSYA 3Q89A 3TEHB 1W26A 2DHXA 2E1AA 3I0RA 3IG1A 4PG8A 4X4QA 4ELVA 1JMTA 3GE9A 1N5YA 2R7WA 4IO9Q 4FF1A 2IM0A 1BQXA 1HQUA 2HFZA 3GPAA 4NYZA 3CD5A 2HAIA 4QIGA 2HHPA 3GZ7A 5T7LB 1X0FA 1JLAA 4QWEA 3KLFB 4JBCA 3R3TA 1B0PA 2YH1A 1HPZA 2CPFA 2ZWOA 3H0PA 5I3UA 3FMBA 5KG0A 3DM2B 1R89A 4QR0A 2VOPA 2YTCA 1MROA 3R8YA 5KOWA 4J9SA 4FF3A 3G6YA 4DQIA 4OZ3A 2IM1A 3K8WA 4OYPA 2VBYA 2LMIA 3A3PB 1T94A 1YX2A 2OFGX 3PJ9A 3EX7B 3K58A 4A8FA 5KFHA 1X7VA 2Y8WA 4E0DA 2OMLA 1U1RA 3ZO7A 2FJDB 4EYIB 1QE1B 1FJCA 1MW7A 3M32B 2UUBJ 3FZ2A 2H5EA 4USJC 4F25A 2QSFA 3V6KA 3RAXA 4WE1A 3VAIA 4LSLA 1EB0A 3HHLC 2I6WA 4LF9F 2LDIA 4K59A 5I42A 4OHXA 4RBVA 2M88A 3NG8A 1IBKF 3TA2A 3FSIA 4YY3J 4M5DA 4URSA 4X66J 2MTLA 2CNNB 2DPIA 5L39A 1MU2B 4NL5A 1RLCL 2MKYA 1B70B 3C3LA 2M9KA 4FNHA 3W2WB 3W63A 1WG4A 1B4SA 2HNYB 1HWUA 4IDKB 1UPMB 5K5MA 2UXDJ 4MKYA 2ZH2A 2KYXA 3KDNA 3NGUA 4WXOA 3CMQA 4A8XA 2Z58B 5EDWA 1S1WB 1CJVA 3IRXB 1VHIA 4XPCA 3CC4S 4GRSA 3OL8A 3JB9k 3TX8A 4W92B 5G0RB 2KH9A 4J91A 1O8BA 5HL7Q 4LSLB 2W25A 2B9XA 1FRKA 4L73A 4RNNA 3FBBA 2XS7A 2H48B 2GW8A 3R5CA 4MH8A 1LQ9A 2E9ZA 4NLTA 4IO1A 4L75A 1CC7A 1V3ZA 5E7OB 3HHKA 4NXNF 4PUOA 1KNZA 4EK2A 5A8KB 2CPEA 1NAQA 5GMKa 1KS2A 2AJ2A 1RCOB 2MJUA 2MGZB 3ISNC 3IS9B 2BJDA 4HDHA 2P9GA 4PPZA 5DM7Q 2OPSA 1MWQA 2D3ZA 3NAHA 1RA7A 3K59A 2G0CA 1YK9A 4RW7A 3QNWB 5D0HA 1KFSA 2KN4A 1R8BA 4K4XA 2KJWA 4R8UA 3IBFB 1HI0P 5A2QY 1S1UA 4AE5A 3FNNA 3H2LA 2ZJQQ 4CLKA 4CLTA 1JXEA 5BYQA 3GQCA 1IXKA 3BYPA 3DLHA 3MMBB 1Q0NA 3R1LA 2CQGA 1D8YA 4DXLA 4ED2A 1S0OA 4ILMA 3AODA 2DEIA 4HEA9 4AL6A 4WP8A 4DR4F 1CVJA 1VI7A 3QBCA 2HFVA 3MFHA 5FIIA 1LWFB 1VDHA 2H3EB 3H8YA 4Y28C 3G8TA 3H5XA 1GTEA 3P45B 1F2HA 1W25A 2DISA 2EEYA 2LP4A 3DXBA 3OFHA 4NZ0A 4P2SA 4DV6F 1N48A 2ZDOA 1LWEB 2RJZA 4Q7AA 4C8MA 4ECYA 1UWBA 3D68A 4DLEA 4DSIA 2K1RA 3OSPA 3K0JA 2J0SD 4DL3A 1JJ4A 2VA2A 1TL1A 3M1VA 3WDOA 2FHJA 4WZQA 1X31C 4YB6A 2FHOB 4XO0A 3PVXA 1EKRA 1CQMA 2MQPA 5I4MA 3OW2R 1MMLA 4NZ7A 3I4PA 1FE0A 5BR8F 2NUHA 2BDPA 1DFDA 4DPWA 3FCWA 4TLRA 4MFBA 4X64J 1XMQF 3THPA 1XMQJ 2GIFA 4NLXA 4TY8B 2XNQA 3WZ0A 4P74A 4HHUA 4OFZA 3CMAS 3T41A 1SJQA 3W5XA 1R27B 5IT4A 3W9IA 1L3UA 3M9OB 2G1HA 4LF6F 1AFJA 2M8DB 3OBIA 3TOQA 1VBYA 2XY7A 1U6ZA 3ISND 4FP9A 1DBDA 2CJAA 2R9LA 1VRQC 2LECA 3V81A 4UT4A 1QD1A 1PO6A 1PGZA 1RT1A 1OO0B 3Q83A 1YBAA 2KXHA 1I94F 1NK0A 2ZE2A 2C3MA 2WHOA 5HANA 1E6YB 3UE2A 2CQIA 4PR6A 5K8NA 4RU9A 2ZVSA 4M5JA 4DFMA 3A12A 3F44A 1MNEA 1HL6A 5CH7B 3QIDA 2QA2A 2HGNA 4F3MA 1U1KA 2PT0A 3WX4A 1ACMB 2VF3A 5B0EA 3VCDA 3CUNA 1IKXB 2P9EA 2C42A 3KHGA 4CDIA 4B9LA 2GIQA 3OR2A 2E1MC 4ZVGA 3LF0A 5CD4A 2BW2A 4N76A 1IN0A 4YB7A 4LFCJ 1B0TA 2WOMB 1HBOA 2Z56B 4C9DA 4DL0C 5CZVA 4EZ6A 3G6ES 2CQ3A 2CQHA 4WXWA 2I9SA 2J0XA 3CD0A 1TQLA 4RBUA 1FT8A 3BH6B 4Q2LA 3IM9A 3DYAA 2R8HA 3VVUA 2MY8A 3GTYX 4XTTA 4F02A 2XMVA 1K73T 1RTHB 4ZOSA 2K06A 1REVB 2E5GA 3A13A 1A9NB 2XG8A 3QYYA 2P6SA 2OPPA 1DAXA 2XYPB 5KFZA 3EMTA 4N56A 1BE4A 3HM9A 4DR2F 2JLEA 4DZDA 5L1LA 1TTHB 5HLFA 3HK2A 3FFIB 1NKCA 1QVGR 1QUPA 4X4RA 5D4OA 2WBMA 3HMJG 2KT5A 5F8GA 5BXIA 2JC1A 2IA6A 1RWXB 1CJUA 5CYMB 5K14A 2UXCF 1M5PC 2AJQA 4LRAA 4M94A 4ZVSB 3ILIA 1D09B 1QJHA 2APOA 3MPWA 4USKA 2RS8A 4EFAC 3JSMB 2DR7A 1I6JA 2DCLA 1QSSA 3CJ4A 4PXEA 1T9UA 1QAIA 4G1QB 1EETA 4DV0J 1FDDA 4P75A 2BRKA 4CNZA 4FS1A 4ERDA 1G2EA 3J7A1 2XM3A 2JFDA 4OYMA 5A76A 2VG5B 3D5MA 3DLEB 3SQOP 5KT7A 1GQEA 5IWAF 4JV2A 1PSDA 1TU0B 4C11B 1KQGB 3FCVA 1RLDA 1VJQA 2AWZA 3DRSA 3MFIA 2VOOA 4QPTA 5I42B 3N9UC 2Q1LA 3BGRB 2QLBB 4YHHF 2IDEA 3DFEA 2IMWP 3GIMA 3AD8C 5K14B 4DSKA 3PHEA 4JI5F 3LO3A 1WC6A 1OSDA 2RQCA 4DL6A 3VGVA 4ETXA 2GV1A 3IN5A 2NXEA 2XSJA 3M2UA 3MMCB 2JSXA 2R7TA 2QA4S 5KAKA 1N33J 2RILA 1QDUB 3M8YA 2AMCB 2X3DA 4FKYA 1XWLA 2EWHA 2XBPA 3PXGa 3TJ8A 1M1KT 4K8RA 3I96A 4OI1A 5C5JA 3HFKA 2W4PA 3J81U 2B56A 5HI7A 5G4DA 5KG5A 1SB6A 2VD3A 2QFJA 5DGAA 3CCRS 4A8QA 3DRYA 4P72A 3AD7C 3TAMB 4BCAA 5HVHA 3MPYA 2LXIA 3D0IE 3E01B 2PI5A 1LK5A 5AE3A 3Q86A 2V2KA 1PYOB 5LJ3Y 2DNYA 3GSDA 4NCAA 1SJRA 2IBKA 4AXJA 3MF5A 2ZJPQ 2FJXA 3BH7B 5KFSA 4LFBF 1IKXA 1N6QB 4ZJOA 3C46A 4PRFA 2P2CB 5C24B 1ELOA 1S1TA 3GR1A 1JLFA 2RSQA 3JSBA 5KFGA 2K2PA 4ZCIA 5A8WB 4I2PA 5F9LA 4F50A 1R8HA 2FJAB 4OI6A 4OJHA 7AT1B 2J6TA 1UW9A 3Q23A 3PIPQ 1Q7YT 4GMKA 1RWOB 4TLQA 3I0RB 3PX6A 3MM7A 5K8OA 2BX6A 1RT1B 2HEKA 2E1RA 3M1VB 5GMDA 4ER8A 3OUYA 2H1YA 3SQGB 4KKOB 4NPOA 4DX8H 3POTB 4PZVA 3MUVP 1ZTTA 3KLFA 1D1UA 2CQBA 2ROGA 4NLUA 1PG5B 2VQFJ 3MM5B 5CD4H 4Y00A 4N5SA 4DQQA 4RWXA 3LPEA 5JUMA 2VG7A 1VLYA 1UFWA 2LEAA 3W9HA 1R8AA 2X1AA 3A1YG 5AJ3J 1Q53A 3OFGA 2QEXS 3D9BA 2Z8QA 3KLHB 2LXUA 1WG1A 1HMVB 3UI3A 3Q8SB 4TU8A 3LANA 3T5LA 3EICA 2QMXA 3C15B 2VBXA 3MDFA 4PYAA 4LFAJ 4EUVA 2VIHA 3PX0A 1Y0HA 2RQ4A 1GXLA 3MCMA 2C2DA 2P5VA 3M9MB 4Q2MA 1UWBB 2AF6A 3TI0A 3QIPA 1XNQF 1GTHA 4X4VA 4MIAA 5ADZA 1HNXF 4PPDA 2I5JA 1EJ7L 1S6OA 2R7VA 1YKWA 2IJNA 1TL4A 2AV5A 2RF2A 3GV5B 5LMNJ 2PD1A 4RX6A 2HFOA 2VG6B 2BJ9A 3HT0A 4DI6A 2CJYB 3KUHA 2XY6A 2DRAA 1HWLA 3P3DA 3TZXA 2YWFA 3W2VA 3NL0A 2BKNA 3CO0P 3KLVA 3BO2A 4WIQA 2A3JA 1JWWA 4CT9A 3DRPA 3MMCA 4Y34A 2QMWA 3WBZA 2YWWA 1KSPA 1EHWA 2VC1A 4LT6A 3DOMA 1RHMB 3TX0A 1C1BB 2RQMA 4NXMJ 2CPYA 3G82A 3VTIA 3E2EA 4B3OA 1KQSR 2WB1D 1WD6A 1UA0A 2MLYA 4WK3A 3OLBA 1S9EA 3BEGB 5C42B 5KFUA 3PW0A 2IVYA 3J80Y 3OR1A 4Q8EA 5D0EA 1KOOA 2J0QD 1GMWA 3BZQA 4DN9A 4ID5A 1SJ3P 2GS8A 1HARA 5KFRA 3MI7X 1H98A 4OI4A 1R31A 1GX6A 1KHVA 4CP5A 1TUWA 2O3DA 3H40A 2FVPA 2R42A 3HLUA 4MJKA 4JI4F 4LF8J 1APSA 3P8BB 2AQ4A 2DY9A 1NSKL 3H42A 5D15A 2E5HA 2K8GA 3B8HA 1S9FA 2DR5A 2V4JA 3QT5A 4ID8A 3CCJS 4P10A 1RDRA 3GFXA 3DDIA 4O3OA 2GAGC 1BHNA 3CDBA 4AD6A 2GVDB 3UCUP 1J27A 1L3TA 4EEYA 3HHEA 4C2MA 4TNOA 3C14A 2CVEA 1FNOA 4NRUA 2YKNB 2HVHA 2HHWA 2JEFA 4KBIA 4C48A 3MR3A 2EKNA 4JI8F 5KFWA 2XZTB 1NZAA 2AGPA 5H9EJ 1F3FA 2M7SA 2B0GA 5IWAJ 3LUYA 4RL1A 3KK3A 3AY0A 3X3UA 4WFZA 1Q16B 2WRMA 4CO2A 3GIJA 3UDVA 3R5BA 4K4YA 2R7XA 4HH1A 1U47A 3BGRA 4QJVA 4CLZA 1SUQA 3HHLA 4ENOA 1P9QC 2HQFA 1AW0A 4G6VB 4CLUA 4Z7YA 2DEJA 2GAHC 4ALZA 3TWZA 2XLIA 1N5VA 4V19X 3PW5A 1X9WA 1XBWA 3HSGA 2XWXA 3QT8A 2UV8A 3I4HX 3UR0A 2BE2B 4IKAA 4X4TA 2NPFA 4IQXA 2KFZA 3K5NA 4YR3A 2K7KA 3GMGA 2X1BA 2YKOA 2KVQE 1FVQA 4NA3A 1X4EA 4OZ5A 3T19A 3MEGB 5DQIA 5KG2A 2Q6CA 1TK5A 1W2IA 5CHCB 2W8LA 3Q2SC 3HCXA 1CQNA 2JFKA 5KFIA 2A6OA 3S1TA 1H73A 2KO1A 4K2JA 3DI6A 4I2QB 2MQOA 3M9NB 4FYXB 1M1HA 1KR4A 1RT3B 1N5SA 2FZCB 2E5JA 3CDEA 3OPKA 2W2MP 2KB2A 4I0WA 4CWBA 4EMDA 1D3WA 4ZVOB 4ZLLA 1R6YA 2OLWA 2MDAA 4QWDA 2KRBA 4WPAA 2ZH8A 5A2QU 2YKQA 4F4KA 1HWKA 2YNHA 1FRXA 1V9OA 1RB0A 2CADA 3FK4A 3L7UA 1LW2A 4ZVQB 4CLFA 2OUGA 5E2QA 4QPXA 5J2PB 3MR6A 3HXMA 2VPWB 3D6HB 1SH0A 1OQ3A 1WF0A 3GYGA 1WOPA 4CM2A 5KOXA 1HWJA 3M05A 3PW2A 1WG5A 1VK8A 1LXJA 3O6QA 1VQOS 1TFWA 3HO1A 4M5GA 2NXNA 2ZE2B 1MN7A 2BANB 3DMJB 1GXUA 1WEZA 2GMJA 3IG1B 4FXVA 1CLFA 1NHKL 2MZRA 3CDAA 3CJ2A 1YJWS 4I1TA 4WKRA 1GMVA 3OTEA 3SCLE 3CW2C 1Y9OA 4H4MA 4DU7A 3KJVA 3PEJA 1A0OB 4IG0A 2XZDB 2RVJA 5DZ6A 2MQNA 5C24A 1SV5A 1G4CA 3KDOA 2OEMA 1QTMA 1HBNB 1VCTA 4P2FA 4UOFA 3W65A 3RRGA 3MAAA 3C6TB 4CT8A 3Q22A 3C6TA 4YR2A 2N82B 2Z2MA 2YVSA 2K3IA 1NMEB 3FZBA 2J9CA 5IC4B 3G6VA 4B9NA 4I7FA 1IQZA 2FHKA 1JQGA 2H5JB 3NY0A 2Z30B 4V1Ak 5KFLA 2UVUA 2XMWA 3CO9A 1HQEB 3BO4A 2HVZA 1IBCB 1PKUA 4F0HA 1RT6A 2Q3PA 3KLIB 4UW2A 1M5KC 2HWHA 3KTQA 1NSPA 1Y5NB 4KT0C 1L3KA 1R43A 2YY3A 3DLKB 3OXGA 4L72B 2HAFA 1JLCB 2YNIA 1S12A 2F8HA 2H65B 2NCKL 3NWRA 2ZBCA 3PHTA 2IA0A 5BYRA 3ZZUA 3FSXA 4DUYF 3X1LB 3NS5A 2HS0A 3HSJA 2VG7B 2NXUA 4DV5J 1J5EJ 2UP1A 3P6YC 4K4ZA 2AJ1A 4LQ3A 2D9PA 4P6QA 1S5ZA 4HTJA 2MGZA 5HATA 1ZTWA 1Q8BA 3DU5A 1N8RT 3V6DB 2B4OA 1JXVA 4U9RA 2MMYA 4ATNA 2LEPA 2GVDA 2N4DA 4HACB 5IM0B 1D8ZA 5B0FA 3RB0A 4M5NA 4RBTA 2DHSA 4X65J 3FQKA 3OTDA 2BQ3A 4KE5A 2JEIA 1QY7A 2FLOA 5GAGI 3PM9A 3ZZTA 2HQDA 4F2RA 1SVDA 2ZH3A 5F8HA 2JX2A 1SL0A 3DI6B 4I2QA 4NLSA 4J9RA 1T3NA 2DBBA 3W3SA 4LFBJ 4GVBA 4DV4F 1H7XA 5D0RA 2BOAA 1RJJA 3VQTA 2E66A 4ZITA 1FJ7A 2F5GA 2COLA 1ZM3A 4C7QA 3H4BA 1X5SA 3KLGB 3EGZA 1QM9A 1CULB 4LF7F 4MKAA 3BPSP 1UVLA 3M2RA 1VBXA 1FRMA 3I32A 1S7IA 1RT2A 4DHVA 2B9EA 1JK9B 1M5HA 3MMAB 4GC7A 1TL3A 4HACA 2QYCA 2HQIA 1VMBA 3SBMA 4X65F 3CCMS 2E1CA 2IJFA 2HHVA 1G3OA 2EG1A 1TKZA 4MK8A 3NNHA 2GVZB 3DGPB 1GX5A 1OY9A 1RISA 3HSDA 3Q8UA 3Q0AA 4E98A 1U02A 5HQLA 3EGVA 1XMOF 1F5BA 5E33A 1S4FA 4P71A 4U7UK 4W4MA 4CYUB 2KG0A 1FJGF 2MKHA 5LT5A 3UPFA 4CCHA 4LF9J 2HQCA 1RBAA 1I5OB 3RU0A 3MOJB 2GZOA 1HHQA 1HI1A 2FHJD 1VS3A 3T9ZA 1NJXA 2MKIA 2XY5A 4LRDA 2F9DA 4LSZB 2J0WA 2UUBF 3DM2A 3V5RA 4X66F 3AD9C 3F73A 1HR0F 1RXOB 2L9NA 3R7NB 3HHLD 2V4RA 4WFXA 3W2WA 1HQEA 2OIHA 1GK8A 1WF2A 2CJBA 4DR1J 1X4DA 3K5PA 1B0VA 1YZ6A 5C2CA 2MKKA 1R8CA 1VYAA 4DR5J 3JSRA 3UDEA 1SKRA 3EM1A 1EQ0A 2PMHA 2GHWA 1JLEA 1NCLA 4KR0B 5F8LA 1CJTA 4C8ZA 1S77D 2XNRA 1Y5IB 3DKDA 3HKWA 2Y1JA 1NH7A 4QU6A 3L3CA 3VF0B 1S59A 3MM5A 2FUG9 4DWIA 3TVYA 2IAJA 5CXTA 2HIQA 2C2OB 1FHTA 1W7WA 4U8YA 3J7Z5 2R8KA 1JJHA 1OIAA 3FEXB 1M0SA 1N0UA 2YNFB 3G6XA 3THTA 1N0VC 1DY3A 3PTWA 4DL5A 4QWAA 3UD5A 2JNJA 2VL1A 4UTGA 3VAHA 3KHHA 4UOHA 1IJEB 2EC0A 2XB2D 4DR6J 5C25B 2ZUGA 1TMMA 1FXLA 5CCLA 1IKVB 3RAMA 1HNZJ 3N01A 1R0AB 2K1RB 4B9UA 3T6BA 5ETPA 4K0KF 4UQGA 4IOCQ 3V6JA 2A0FB 3MCSA 1JJ2R 3TUPA 2HMIB 1BD6A 2M52A 4IFVA 3CJ5A 1Y7PA 2ZHOA 4IH5A 3RRHA 2LEBA 3OLAA 1FWKA 1VIOA 3MEKA 3RBDA 3NLCA 1ZM9A 2ZOMA 3WHIA 1TZ0A 2DNMA 3UCGA 2BJ7A 3VGTA 3WQPA 2EI5A 2X3GA 4FPIA 2QC3A 2EK6A 2QA1A 3I5CA 3IAM9 2C3UA 2JH3A 3DDKA 4KPCA 4NLRA 4ZVHA 5KTQA 2CJKA 1NDPA 2U2FA 1RWPB 5KFDA 4I4BA 2G9OA 4KYZA 3UDCA 1MSWD 2E29A 2PC6A 4I6AA 1RWWB 1Q8IA 1ZAWA 2RHQB 2VU5A 3LTOA 3OQ2A 4QIVA 2WVCA 4ANCA 1JLBA 1TKXB 4A8SA 4JYAF 3N28A 3IBWA 1NBEB 4ZP7A 3HVWA 5IQQA 1QSYA 4N8NA 2YPZA 3KUEA 2HK3A 1KOHA 4MIWA 2BANA 1WSRA 5J1EB 4X2BA 2OD4A 1RWMB 2CQCA 3J7ZT 2L41A 1X4AA 2VFUA 1TL1B 2W9BA 4K4UA 1JLEB 1R7IA 2RRNA 1VRUB 3ELHA 5T14A 1RHRB 2I1RA 3NRBA 2DIVA 3A8KA 3D4JA 1OPIA 4LBIA 4CYUA 4O3SA 3OV7A 3MR2A 3POTA 1LOUA 2C2ZB 1GAOA 2V9KA 3CJ0A 6AT1B 2YX4A 3OXFA 3WC2A 4USTA 2NQPA 1Q1KA 2DO0A 2A1BA 2PSZA 1HBMB 2YNFA 3BN7A 3KK1B 3UR3C 3L09A 3RR8A 2RE1A 1O0PA 4I2PB 4CH1A 4JI1F 4KPYA 3K5LA 2QSWA 3EWGA 3N6NA 1HR0J 2NXCA 3QGHA 2EKYA 2CQ0A 4P73A 3PNIA 4TN2A 5IZHA 1RKIA 2BM0A 3CCZA 4G1QA 4LRFA 2CDRB 4YUDA 5KFJA 1SQEA 2V34A 2JVRA 4OX9F 1ZBTA 3NS6A 4KC5A 2ZM6F 4DR1F 1RTDA 4USVA 1YRXA 3IGVA 4R8UB 1GT8A 2VPXB 4I64A 1JX4A 4DR4J 4AL5A 4EBEA 2I8EA 1T05A 1U0HB 2HK2A 4PG6A 5F3TA 2HBZB 4OMFG 4CO5A 1F0XA 5E0OA 5T41A 4G3IA 2HHTA 5EX3A 4K4WA 2LFVA 3R1HA 2J6UA 3RW6A 1FD8A 2XHWA 1RKJA 2NSCA 4F2SA 4WFBQ 2KT2A 1Y3KA 1MMDA 4YY3F 5HQ8A 2XC9A 2MZSA 1N52B 2V8VA 1Q5YA 5JMNA 1HNWJ 2CWXA 2MQ8A 3V6DA 3QZ8A 4HLBA 2YQ0A 4OL8A 1IR1A 3MM6A 4AXIA 4DX5A 1CEZA 2BW7A 2BE2A 2E5LJ 3F0NA 1FTRA 2DNGA 2B3TB 3HT3A 1WUUA 4J7CA 2CNLB 4JI0F 3J81j 2V2ZA 2YKNA 2W7OA 2QFIA 1ZA1B 2HQ3A 1SC1B 1DQ9A 1X9SA 4DG1B 2D3UA 4WU2A 4CO4A 3MD1A 1FDNA 1RWNB 2W7PA 1NPRA 4DV0F 1NK4A 1V3SA 3AOAA 5K8PA 2BOPA 2VDHA 1RWKB 3SCIE 3RBZA 5IS2A 1FKPA 3M8QB 2NSBA 3W5ZA 4FVCA 1CC8A 5DLGA 2MXYA 2CPZA 1AROP 1SH3A 3ENWA 4UY85 2OPQB 5DQGA 2YBVA 2FGCA 4OYIA 1Q8KA 3HX9A 4F0KA 3GLJA 4RW9B 4URGA 4ELUA 2MKCA 2OSRA 4CLLA 3THVA 1NK6A 5KG4A 2M4MA 4EZ9A 2DH7A 1HBOB 2CDQA 4ZPTR 1EETB 2GQQA 3M4XA 2ZBQA 1DZ5A 4O4RA 2N3LA 3CCWA 2HNYA 3M8SA 3BGOP 2J8SA 1U4BA 1KVJA 1X5TA 1OY6A 4ZHRB 5H9EK 1PC4A 1WC0A 5DS7A 2RNEA 1SL1A 1FESA 2A10A 3OTCA 5J1NA 3KJVB 1KTVA 3ZC4A 2C2EA 3UWTA 4DV3F 3V4IA 1U7LA 3FVYA 1XN9A 1ZETA 1MWZA 2EFOA 1GMUA 2DNZA 1IVZA 2GC8A 1FA0A 4OX9J 1S48A 1NEEA 4EYHB 2AX0A 1J5EF 1S49A 1FX4A 1XR6A 5FDLB 1S6UA 4OIXA 4ZJQA 3I0SB 3LOUA 3OJSA 4FBUA 3L9ZA 1FKOB 4K2XA 2ZFHA 3MCOA 4LF4J 2R7UA 1X8DA 5HP1A 3T5JA 1HNZF 3CJ8A 4PWUA 2KZZA 1UEKA 1UZDA 2QRRA 3GSIA 1KLMB 3CDWA 3T5HA 4FF4A 2R3VA 3QIPB 1RT6B 5L46A 4DUYJ 2VPZB 3DGVA 5B0DA 4IFVB 5HVFA 1YZ7A 2EG2A 4GKKF 2LYVA 5DDRC 2AGQA 2KYZA 3F56A 3GB0A 3FC9A 2ZKTA 3DLJA 3ENAA 4FXWA 4J90A 4KHMA 3ULHA 2HKEA 4U6PA 3NS7B 3HD2A 2KHCA 3SIPB 1IM6A 1HNIA 1C0UA 1FTCA 3LQVA 1G1XA 2MZQA 2E9TA 5HVGA 4USUA 4UZBA 2V63A 2FLPA 4ITSA 5KG3A 1NK5A 4JYAJ 5D0GA 3LGHA 4PKDB 4HHJA 2HNDA 3GP9A 4LFAF 2NXJA 4KHPF 1C0TA 1WC5A 5GAHI 2CQ2A 1S97A 1KD1T 4B3RF 3UQSA 2YKAA 2KG1A 1WOSA 3RG6A 5AJ3F 5HMXA 4DR3J 1WORA 3JYTA 5GMEA 2AHOB 2AP6A 4WTYA 4C0BA 2XS5A 4JV5F 4C3KA 4A47A 1TL7B 1P9YA 1NUEA 1Z2ZA 3IR6B 1N33F 1YDLA 1WDDA 4L74A 2X1GA 2PMWA 3DHXA 4EBDA 2IAJB 8AT1B 2RMLA 1WC3A 3LP1A 4GKJJ 3EDQB 1EAYC 2POKA 2ABYA 3E8OA 1NPPA 1OPZA 2ILYA 1LWXA 4F0MA 2RD5C 4R5PB 3T1HJ 2C28A 2NZ4A 1TVRB 2IJRA 2V9WA 4NLQA 2DNRA 2KVIA 3M2VA 1NKBA 4ES3A 2O01C 4RR5A 5CABA 4CZCA 1U1LA 3VGUA 5IT9Y 2AEFA 4B3TF 5ETNA 1FD2A 1H72C 4HDGA 1U26A 2W9CB 1HI8A 2ACYA 4MMOA 1S6QA 2B6AB 5IOLA 3BR9A 3V2UC 1SC3B 2KRRA 1H7WA 1YRTA 2VDIA 3DLGA 1UMJA 1CG2A 4J9PA 3R5AA 5KG6A 4KQZA 2XMMA 3H5SA 4L6V3 4F4XA 3BS9A 4DF8A 3MUTP 2ALYB 1RT3A 2QX0A 1B7YB 1FKPB 1VHFA 5EN1A 4IG3A 3NOGA 4O3PA 1FDAA 2VUGA 4J5OA 3RW7A 2HHQA 1ZM4A 1JLQA 1RA6A 1RTJB 4OYZA 5DETA 4ZPAA 5KFKA 2XULA 2XYGB 3UN2A 4AL7A 4LRCA 4LREA 4B3OB 1ITPA 2NYIA 5L9NA 1NKEA 2VFRA 3MXHP 2L08A 1KWMA 1NXIA 1QAXA 1FFWB 4USWA 2QLFB 3P5BP 4FS2A 3MEDA 3QRQA 4C3LA 1UVNA 1SIZA 4IOBA 2P6TA 2HLUA 2QZ8A 2W9CA 1MLAA 2AEMA 2RAQA 2W4CA 1SC4B 3FDSA 2E1PA 3FKBA 3TUIC 4QBUA 4PXDA 4IH6A 1YGYA 3FFIA 2BE7D 3ISZA 4LRBA 4ZPVR 3E3XA 3UFCX 2AZ3A 4DS4A 3IWNC 4FXDA 4TU9A 1YWXA 1SUQB 1T9WA 1XR7A 2F63A 2JLFA 3HHLB 3KJNB 3V4MA 3W9JA 4CO0A 2R8IA 2GMHA 2IFXA 4LF8F 3GYXB 2V4JB 5D4LA 4WJBA 3CVKA 2Y1RI 1LW0A 3W8PA 1UVKA 3HSZA 4U8VA 4YR0A 4M5DB 2UUCF 2NR0A 1NM2A 1RTJA 4X4OA 3MEDB 4HTIA 4M5HA 5DGBA 2G2OA 3CXCR 3RAQA 2C22A 1HW9A 1DLOA 3CE8A 3M2RB 3NXZA 2HFSA 4FKXA 4PXBA 1M90T 3GG0A 2ZUAA 4MK9A 3PJWA 3C14B 1RTHA 2JC0A 2EFNA 2AW0A 2LLZA 4OX8A 3U1MA 4PAAA 2WONB 3O2IA 1YI2S 1O51A 1V5VA 4U7CA 2DR8A 2HHUA 4F4ZA 2V5HG 4ZVUB 3DLGB 1KHWA 3D0GE 1A7GE 1U2FA 1UCNA 3EXCX 3OTBA 4LR9A 4PG4A 2OD6A 1K44A 4QW8A 1VQ9S 2J7WA 3TA1A 3NCPA 2ZH6A 4ELTA 2ZOFA 5A8RA 3D3CJ 4JI7F 4ECVA 1XNQJ 1HNVB 5HO4A 1WI8A 1WJ9A 4C8NA 4WFAQ 3BDEA 2DNPA 2LA6A 3TRGA 2O66A 3KNGA 1SJ1A 1MROB 5F3ZA 1E6VB 1RU2A 1WHVA 3DOMB 4FVMA 1RTIB 4N7TA 4TYBA 5LMNF 5D6GA 4IR9A 2WBRA 1F5AA 1Y11A 2G2YA 2CJ9A 2E5IA 5D78A 2HNDB 1PILA 5B0GA 4RW4B 2G2ZA 2V8GA 3S8SA 1XERA 3MM7B 1VGYA 2HVDA 3DOLA 1QSLA 1SIWB 1CS4A 4MYUA 1Q81T 3B82A 3SSQA 5IV3A 2X7IA 2ZOGA 1KQFB 1VQ7S 1VLOA 4B3MF 2BM1A 4NXNJ 1FK9B 2YNIB 2QL9B 1DTQA 4DCJB 4WKYA 2H5IB 4G65A 1HQ2A 1N32J 4F67A 3LH2S 1WI6A 5LJ5Y 2JLGA 3T6JA 1B3TA 1CJKA 1YQHA 4KB7A 4OHZA 5KG1A 5A8WA 3M30B 2Z2ZA 3EVMA 3HHNB 4UZCA 2A18A 1HW8A 4DFPA 3V81B 2Y8YA 4NLGA 2DB1A 1WHWA 2I0XA 2YKMB 4QYZJ 1ZA2B 1YITS 2W4DA 4K5RA 2GIRA 1N36F 2YWKA 1VC6A 3IS9A 3PCOB 3MAQA 1N32F 5A6PA 1HBUA 3NGSA 2X51A 3I9V9 4A46A 2ZITA 2QT7A 3T9NA 3TQEA 5IXUA 2XGQA 5J2NA 3HFZB 2BYCA 1T9YA 1FFSB 2XI2A 3KFWX 4BWMA 5EX0A 2QV6A 1NPKA 4LIWA 4FDFA 4KGKA 3VV2B 3DLEA 1VBZA 3BF4A 3NGTA 5AXMA 2UU9F 1MMNA 3O44A 5JXSA 3WIVA 1TAUA 3BKUA 2LCWA 1KRPA 2ROPA 3NCRA 4D3HA 4LR7A 4OZ1A 1U1QA 1Q5VA 1S79A 2QTWA 4KFBA 1F1BB 4IRDA 2B51A 4DX7A 1WHYA 3PYEA 5F8MA 4NOHA 4UF4A 3HULA 1RHKB 4O23A 4JI2J 4DR7J 4RLEA 3CMES 1U2RA 1S99A 2W01A 3ITHB 2KM8B 3IC1A 3EXYA 2HIYA 3C19A 1IBMJ 1H3DA 2ERRA 3EYZA 3CJRA 4ZMMA 1U1PA 3IR5B 2QJ3A 2ZZTA 3SEOA 4NI2B 2U1AA 4F4AA 4OX7A 3S7RA 3AB2B 4AFFA 2N7CA 1S10A 2GA7A 2DR6A 3B6BA 3QQCD 4GVBB 3PO4A 1X4GA 3ENVA 4DPYA 1FJEB 5CQGA 4GC6A 1KLNA 2CKWA 3I9ZA 1I51B 2MJNA 3TW0A 3OL9A 3C6UB 4MKVA 5D3GA 1S9GA 3TJAA 3KG1A 1LWCA 2UV8G 3PRDA 4CTAA 2XMAA 3ZTPA 1LWCB 3AJ1A 4CTAB 3OVAA 1WEYA 1T02A 3GFHA 2B7CB 4B9TA 1JNZB 1CBKA 2ROEA 2HQGA 3DYAB 3AA8A 3KK2A 2W7AA 4WFYA 1TL5A 1FEHA 4R0JA 3RZAA 3AOCA 3KG4A 4F36A 2VJUA 2V2QA 5EWFA 3MM9B 1KN6A 4DL2A 4J9LA 2CWKA 2VG6A 3C2PA 2Z2LA 2WZ1A 4TXSA 3O8WA 2E5LF 4A48A 3CCVS 1ULRA 1XNRF 4EO6A 2OSQA 1RE1B 3B4MA 1KP6A 1RUSA 4ECUA 3T3FA 1HHTP 3HKZD 4QOTA 3LW5C 2PMZD 3RB6A 2UXDF 3Q8YA 1S6PA 2ASYA 3G71S 4R5PA 4QIFA 1RT4A 4LF5J 3MEEA 3UN5A 3NOCA 1LFPA 4DR2J 3BPDA 3GWCA 1EZZB 4LSNA 2FZGB 1SQFA 5MAOA 3J81Y 3UO0A 1RT2B 1VFJA 1RHUB 1WC4A 1YVFA 2DNLA 4YS2A 1JB0C 3AHPA 3QPIA 4FZVA 4PEOA 4CI0B 2WAQD 5KFVA 4Y2CA 3W8GA 4DR3F 4JI4J 3C8YA 1K1SA 3ET6B 1JIHA 3MECB 1REVA 2WK4A 1CSJA 1E6YA 2BE9B 3EUNA 1CS4B 3ZNUA 2HVEA 2MHEA 2C2MB 1VK3A 5KFQA 3QO9A 5T7LA 4EI2A 4QYZK 2RRBA 1HNIB 1IJFB 1FE4A 1PIEA 2V6AA 3LP2B 3TO8A 3T1AA 1HBNA 4GO5X 3UW1A 3OR2B 2DGTA 4J37A 2HBRB 3EZ5A 3D1HA 1HYSB 4K0KJ 4DBQA 1E6VA 1FWLA 2VV5A 3DNCA 1ZYQA 1TV6A 2ZH4A 1L3VA 1X5OA 2RKIB 1H2UX 3C16B 1PJ7A 3T1HF 2RKIA 2HFNA 3C16A 5L1IA 2GO9A 1TK8A 2JEJA 2UU9J 1LWFA 2VODA 1N4LA 2D1CA 5IM0A 1TKXA 2KI2A 1HD0A 1T8EA 3HPOA 5IFMA 2YQ3A 3QGIA 4R0EA 2IC3B 1J2VA 5CYQB 5A0YB 3BBCA 4NA1A 5HQMA 4NASA 4B9VA 5H1SV 4OYXA 4KKOA 2LXFA 2GJIA 5HK4A 3V6HA 9ATCB 2IRUA 3N6LA 4ZS6A 3H5UA 4KIAA 5I3PA 3ZZRA 2RDDA 2IMOA 4BLGA 1N5TA 2H4WB 3TZYA 4ZJLA 4J9NA 4K7QA 4I67A 4AQYF 2MEWA 3CNQP 2ZC3A 4YB5A 1PBAA 4KO0A 2G0JA 5LSRA 1W2BR 1D9DA 1OQ6A 4LUBA 4DQRA 2XGPA 3MEEB 1R0BG 2GFFA 3I0SA 4XAKA 1LNQA 1U6FA 2RUSA 3K7RA 4RPFA 2R7QA 6FDRA 1SL2A 1Q7LB 1NRKA 1YJUA 4QIEA 4CM0A 4LF4F 3AA9A 2MPUA 3BSNA 3PX4A 2V67A 2WSEC 3OTOF 1OMSA 2GO8A 1VQSA 1PJ6A 2LU1A 3J7YU 2RU9A 2KHDA 4DOZA 2UUAF 1VC5A 4ILLA 3CPWR 2LQBA 4ZP8A 3W5YA 3CCUS 2HMIA 3I5AA 4HI1A 2Z57B 3TARA 4EO8A 4O4GB 4C97A 4Z7CA 2F4FA 3F41A 3LAMA 3OD2A 2V2VA 4QW9A 3OFEA 4CLSA 4ECQA 3H98A 4MFBB 1I1GA 2M2BA 3D3BJ 2HGLA 4A8YA 5FDLA 3NMAA 2IRYA 3GJQB 4O0NA 5LXYA 4ZVFA 3ZZOA 4RW9A 3NGDA 2CG4A 2V8HA 2QG9B 2F3JA 1X5PA 3KOAA 4DSFA 4X4SA 1FRIA 2VC0A 1LWEA 4MTPA 3S6EA 1L3SA 2V8PA 4MKBA 2BJEA 2GHPA 4KH0B 3FRYA 1RAEB 2LQJA 1VOMA 4ZKAA 2AIRB 2IM2A 3MM8A 4ZVPB 1JLGB 3A8IA 1IWAA 2ZC4A 4ICLB 2KFNA 1VISA 5E3AA 4DUZJ 4NLPA 3D66A 2AYEA 2BMBA 3QAUA 4QCLA 3K57A 4DSLA 1T9XA 2JWNA 4NWBA 2IIHA 4K50A 1EP4A 2MQLA 2HSEB 3AB4B 3CEDA 3EJMA 3HJFA 2NPIA 4X4UA 2PEBA 3HFVA 5KT5A 1S9GB 2R8GA 1ICEB 1NDLA 1X60A 2DGXA 2FY8A 4LMZA 2AD9A 1VQ8S 2QGFB 3UNGC 2ZEJA 4DUZF 2NS1B 1LEOA 3R2CJ 4USIA 4DU8A 3OVBA 2HPUA 4YHHJ 3CULA 5DZ7A 3G8QA 2ZH9A 3JTOA 2ZM6J 2XYHB 4Y2AA 5ETMA 2F4VF 2BKOA 2VKZG 3ZTOA 3U1NA 1JLAB 4U67Q 3PO5A 2UVVA 3JSYA 1RQ0A 1HA1A 2XI3A 1QTNB 2IYIA 1PYSB 1RU1A 3TA0A 1IBKJ 4Q0BB 2L48A 3BR8A 3LP1B 1UVJA 1YIJS 1IR2A 3GYNA 1KTQA 1OWXA 1Y10A 1Z1ZA 2LQ5A 2QMUB 3QWUA 4KY3A 3PKYA 1NK8A 2HNZA 1FERA 1RBLA 4WTOB 1NSAA 5AXNA 3OL7A 4DFKA 1BWVA 1Q78A 2WSFC 2HW3A 2PDAA 2ZBIA 4HHHA 3GIIA 3CCLS 1JNRB 3ILLA 4N47A 3H7HB 3AT1B 4NEYA 5EHHA 4PCQA 2J7KA 3M32A 5GADU 2IC3A 3VWSA 1HNXJ 2JL9A 3OFFA 1RK8A 3ETMA 2DGQA 4M8LA 3HZGA 2OGUA 5FLXY 3R7SB 2A2DA 3G86A 4JI6F 2XHCA 1F9HA 1XEZA 4WFNQ 2ALZA 8ATCB 1M5OC 2VPYB 1C0UB 2JZ5A 2XWYA 5I3UB 3OHAA 2IRXA 3BV8A 2F7VA 2CIMA 2QN6B 4N8OA 2LVWA 4CO3A 5B0AA 2HYIB 4DV1J 3CJQA 4B9MA 2V50A 4TVAB 2CQ4A 4K4TA 2YKMA 5RUBA 1RAAB 1RHJB 2L9WA 2D9OA 3LP0A 2KJVA 5SZTA 1U1NA 4EU0A 3ZZYA 4DV6J 2G13A 2AYMA 1IKWB 4KJIA 1BUXA 3SMZA 9RUBA 1M1GA 2ZH1A 3MECA 4RUCA 4HKQA 1BMQB 2FVSA 3DOLB 4X84A 3JYTB 4C8YA 3CCQS 3JTPA 1V5IB 2MSSA 4DCPB 1VQ5S 2YWGA 3CD7A 2CQPA 4IG0B 3BSOA 4OYWA 1XMOJ 1XJWB 2XTJP 2BJ8A 3MTJA 1JXLA 1XK8A 2BJ3A 5E3QA 1JKHB 3J7YI 4C4WA 1IR0A 1BY9A 2D3O1 1S1TB 2F40A 5EWEA 3GFZA 2JJ4D 3GCXP 1RP5A 1IM4A 1TV6B 2H4YB 2RIJA 1BQMB 3DU6A 3ZXWA 3VZHA 3D67A 4BC9A 3M30A 3ETOA 8RUCA 1UVIA 3R2DJ 5DG9A 2M70A 1AUSL 1FKOA 3CIZA 5F8JA 2C2KB 2VFSA 3D6FB 3M6UA 4G1IA 4XK8C 2HGMA 1IKVA 2DGWA 4B02A 4RNFA 3KHLA 3EGNA 2WVBA 4F7VA 1H2TZ 2R2RA 4ECRA 3RBEA 1TUGB 5CYQA 5IV4A 5LSLA 2AJFE 5HMYA 3RB3A 4JV0A 5KT2A 4UOGA 4Q44A 4TQRA 2FLNA 4K5SA 4KGMA 1CJTB 5E3CA 1ROFA 2I2YA 3QJJA 2RB7A 2YQ1A 1FXDA 4BS2A 2ZD1B 3M7VA 3PG9A 5K20B 4YP3A 2FJVA 4PQUB 4QR2A 3ILOA 1UJ4A 1RHQB 2CAJA 4HR2A 3RBXA 2ILZA 1XC9A 1NLKL 4JI0J 1D9AA 4L3NA 2HZCA 2MYFA 4LQ9A 1X4HA 3C6UA 3LP2A 4DPUA 4DR5F 2N4CA 5KT6A 2Z0GA 2OJ3A 7FD1A 1NB2A 1WTFA 5CAAA 1K0VA 3W7BA 1BQNA 1C1CA 2C3YA 5J2PA 1HNWF 1KVIA 3Q24A 3HF5A 3PACA 2J7UA 2OFHX 3EE3A 3EVWA 4H4KA 4UUXA 5U47A 1U48A 4EWTA 2EW9A 2CYYA 5AE2A 2H9ZA 2BBEA 4PG5A 2MQQA 3BQ2A 1X4BA 2EFGA 1AFIA 4ZN3A 2VASA 5HJXA 1PCAA 1KC8T 4LBHA 2YH0A 4DPOA 2PFFB 2YKPA 3IMQJ 1JLGA 2F4VJ 1S1XB 3TZWA 2CZ4A 4P9SA 2XCPA 3RGIA 1TR0A 2DITA 3SDEB 4J9UE 3NNAA 1FRHA 3GV7B 3D54A 4IFYA 4ED4A 1VJWA 3W1YC 2DGSA 1WTBA 1RT7A 4NLDA 4MT1A 4P2XA 3BO3A 3A3NB 2ZZNA 2G4BA 1OYEA 1GFWB 1Y00A 4NMLA 3TZZA 3GJTB 2XSJB 3M2UB 4O0IA 5J2QA 1CULA 5DM6Q 4MIBA 1TVRA 1LW0B 3Q2TC 1X0PA 1FRJA 3U02A 2XO6A 1H74A 5GAEU 2DRDA 4RJVA 4X4NA 3H2VE 4NLOA 4NXMF 4RO0A 1TL3B 4O3RA 3PYGA 3BREA 1N5QA 4K4VA 5AXKA 3IM8A 1RSCA 1PAUB 2DNHA 1DTTB 1QUVA 1TKZB 3B78A 3LALA 5M2RA 3CJKA 4CO1A 2ZH7A 2FVQA 2HHHF 1RBOB 1VRUA 2FQQB 1KQKA 2ZNZA 4KV8A 1RCXB 2FHMA 4C3MA 4HI2A 1D9FA 2RF2B 3VALA 1F60B 2GJ2A 3I6PA 5HN0A 4Y65A 3MD3A 1U1MA 3G9CA 1JLCA 3DRSB 3G96A 1VRTA 1YLXA 4FN5A 2PE8A 4ECSA 4ED0A 2PN6A 4OHWA 4TKTA 3BYRA 3VQSA 3RR7A 3CCSS 5LOQA 1DRZA 3DRPB 1XIQA 3W62A 4I6YA 2XQCA 1T7PA 3EPGA 1JLQB 1KONA 3IAS9 4RKUC 1HKAA 3G87A 1GXTA 3MR7A 4RUBA 4F3QA 4OZJA 4I7FB 4HT5A 2YNGB 4C8LA 3NGRA 4N41A 1T9VA 2E7WA 4N77A 1VBKA 4DF4A 2FDNA 4DV4J 3AOBA 2UUTA 4WZMA 2OTJS 3VVTA 2W9AA 1RTZA 1RAFB 4YEAA 4KGZB 2LDYA 1AB8A 1T95A 1UEVA 2LKZA 2MLZA 1IBLJ 1EIYB 5SUHA 5LMUJ 4OJGA 4DPXA 5DG8A 2FPHX 4FYVB 4EBCA 3TANA 4QWBA 3VHQA 3BB5A 3FGVA 2DXFA 3ONQA 4UQTA 2EK1A 2XZWA 2YX1A 3R27A 1YBTA 1U1OA 1TAQA 1BLUA 3QMQA 5D8HB 2F8EX 2VFVA 3MAHA 3VAKA 3RB4A 1SJFA 2JEGA 3CC7S 3GU0A 1YJNS 2QL5B 1HYSA 3L7OA 3PR4A 1SKSA 5K8MA 5F41A 1J5OA 1Q82T 2KXNB 4G1PA 1H2VZ 3KNAA 2K3KA 2RHSB 4PWWA 3I5BA 3PFEA 5HSPA 1RT5A 4ZA1A 2FTRA 3B54A 2EPIA 2DH9A 2W2QP 2OO4A 1WKJA 2VFTA 3AXMA 2JHEA 3KXDA 5CZXA 4F26A 1HWIA 2HG4A 4H4OA 3MURP 4NLYA 3UDLA 4ZIWA 4Y3CA 1U8WA 4A8OA 3PV8A 4PABA 4DEZA 3W60A 4WK1A 3OUYB 2EXUA 3IWXA 2R7SA 4DV1F 1U49A 2R2SA 4ZPCA 3JAMU 2ZJRQ 1TKDA 2IY5B 2PFDA 2O67A 5HMWA 3O5TB 4C8OA 2KZMA 4FYWB 3VAGA 4UY8T 1FFGB 1IQTA 2C3OA 3SV4A 3KK2B 2FJWA 4RW8A 1URRA 1H38A 5IT9U 1SV5B 1AYEA 2DHHA 4HH0A 1WDTA 4KO0B 2UUCJ 1JLFB 2HZAA 1LW2B 3N5FA 1SC6A 2EVZA 3ICLA 5IC6B 2EFVA 1SI9A 2H51B 5GAGU 2DR9A 2B4VA 4ZVEA 3SFGA 2ZWPA 2RT3A 3M8ZA 3DC2A 5HP1B 2GCFA 2DTJA 2HBQB 2PO4A 2UUAJ 1T0TV 3HVTB 1VQ4S 1U8SA 4ZDNA 5DRKA 1UL3A 2CG8A 3ZZZA 4RNMA 1BC6A 3QSIA 4USHA 5A0YA 1NDCA 2N7YA 3SFUA 2GQ2A 2PEHA 4LVNP 3U27A 1SKWA 3BDPA 4NYPA 5IT0A 1R3NA 2BEFA 3MM9A 2XMJA 2FIUA 3BKFA 3UVJA 2C2RA 4YQWA 1O5JA 1ZM2A 1FVSA 2BRLA 4ZCKA 3RTVA 1S0NA 2CNOB 4B9SA 5EGYA 3GFYA 5ETKA 2IBOA 4D3GA 3NGKA 2BQUA 2HZVA 3A8JA 2O5DA 4J9VA 1DARA 3OSNA 5D3GB 2ASLA 5F0UA 4ZLJA 1S6PB 2DRBA 2LQ9A 3JSMA 2MKJA 2FB0A 5FD1A 5ETTA 1NB7A 1F3VA 1GNKA 1U2CA 3TNVA 2G0IA 4RU2A 4PWDA 2HBYB 2OPSB 1RAGB 5ETRA 2AZ1A 1RGVA 3QFWA 3ET6A 2H54B 3K17A 2FLLA 2WB4A 3E01A 4NZ6A 4ICLA 4J9OA 1T05B 5H9FK 4CNYA 3CTRA 3MCNA 4QZVB 2YWHA 4LF5F 4YMEA 3BQ0A 5CA5A 3UVJB 3G8SA 1LK7A 2HWTA 4KGXB 4WP9A 3QZ7A 2GNKA 3JAMY 4X62F 1BGXT 4FBTA 4JI8J 4J9QA 3D28A 4KGVB 2MB0B 4PXCA 1MN9A 4Y6IA 4QWCA 2VHGA 3H4DA 3MM6B 2GJFA 2WVFA 2VONA 1FJGJ 2BACA 1IBLF 3TEGA 2KT3A 2QIFA 2DO4A 2JRSA 3AFGA 1DTTA 2CPXA 1ZPVA 2MLXA 1V6HA 2VH7A 2C2NA 3JXOA 3MMJA 4LVOP 4OZ2A 3U7JA 2OELA 4ZCMA 4XPEA 4A8MP 2ZZMA 4K4SA 1S6QB 2B6AA 2DD8S 1VIXA 4NI2A 4DV2F 3I31A 1EKSA 3DRRB 4M5MA 1YG0A 4Z37A 1U0HA 2B9YA 3Q8QB 4R25A 5DDPC 3OL6A 3W2VB 1EP4B 3HHDA 4X4PA 5EWGA 5F9NA 2J9DE 4IG3B 5KFNA 4C8KA 1MG7A 4NX9A 4OLOA 2K7JA 1HBMA 2VZ9A 4FYYB 2P9CA 2V8DA 3K5MA 3NCQA 3MR5A 4ZP6A 4YFUA 3QLHA 2W2PP 3MPUB 4BC7A 1ZH5A 5D4PA 4IOAQ 5AE1A 2KXFA 2PIIA 3MPVA 2KDOA 3E51A 3IWLA 3VZIA 1YJ7A 1RT5B 1Y3JA 3CF5Q 1C0TB 5ETLA 2LQ8A 3TUZC 3J80U 1GEHA 1HLWA 2ATLA 1UTAA 2W24A 4Q43A 1P1LA 3QT6A 4M5LA 3TAPA 1UFLA 1YRUA 3KJFB 4PWDB 2CFXA 3BSCA 3NEKA 4ZP9A 3MGJA 2RH3A 4CLYA 2VQEJ 1FK9A 4PG7A 2ASJA 3OT9A 5KFYA 2JDJA 3R9LA 1N36J 1JKHA 2IYGA 2AYGA 1N88A 4M95A 2GMLA 4NYOA 4ZLPA 1OSCA 1OY8A 3EGWB 3GILA 2DK2A 4ZK7M 2CPJA 4JUZA 4DS5A 1VQLS 2DXDA 4GVLA 2DHGA 3H2UB 4MYTA 2MHNA 4ZCLA 5DQHA 4IRKA 5GAEI 2MY7A 3AQPA 3KLHA 1NJWA 1ZS6A 4OV6A 1C1BA 2EFQA 1S1VB 2DKOB 3DOKB 2AKWB 2VQEF 3QJLA 2MZTA 3ADAC 4F3OA 4DSEA 1QAYA 4YOEA 2ACMA 4GO7X 2DJWA 2D69A 1A6LA 3DMJA 3N0VA 4CLPA 2BXJA 3H5YA 2MQMA 5KFEA 5JVHQ 2ZNYA 2R2TA 3KLIA 4B3MJ 4TYAA 1NNDA 3MEGA 1C2PA 1WKKA 2HRYA 4H4MB 2BVZA 1S1UB 4JOUA 4CRJA 2CNKB 1TKTB 2HS4A 2PA3A 5KFCA 3KJQB 2V94A 3QO9B 4OZ0A 4O44B 2ZH5A 4DL7A 1PBUA 3HDSA 1PAEX 5F0WA 5KFTA 1NK9A 4JV1A 4RWWA 3U1LA 3CSKA 3D6MB 3N5BA 4M5KA 5GAHU 3SI8A 1Z4UA 1K47A 1PC5A 3IP0A 5ITHA 2NLWA 4OJ3A 3R6GB 4C98A 2Q43A 4ZVRB 2FZKB 5CYJA 1RTIA 5ETVA 1FRLA 1WF1A 5A8KA 1FNMA 2Q79A 2BR0A 2YWEA 3EPIA 3N4WA 2WVEA 3FBCA 3G2XA 4LSNB 1NH8A 3SXLA 2VA3A 3TR5A 5BR8J 1SPBP 2E44A 2QE5A 2AJ4A 1QVFR 2ZHAA 4F4WA 3VGSA 1IKWA 4LR8A 5HJYA 3T5KA 3TAQA 3DLLQ 1Q79A 1T3OA 3TVZA 4OLPA 3DLBA 3DDNA 2FVRA 5M2UA 3GV8B 1B64A 2RU3A 3TAMA 1F2GA 2NUUG 1Q95G 1CJVB 4RNHA 2XMUA 3CWJA 4XIUA 1FWPA 1O6XA 1TK0A 3T1YJ 5J1PA 3V4IB 4M63A 3JQJA 4BDPA 4JI6J 2YPYA 2CUYA 2WTFA 3I56S 4ECXA 2WVDA 4X62J 3G4SS 1F9EB 1G7CB 3IFEA 2HWIA 2C3PA 4NLVA 5DDQC 3CB4A 4L76A 2DNQA 3L4BC 3SV3A 2UVRA 3SCJE 3QRPA 1PYTA 5F8IA 3CCES 3NAIA 1FO1A 2HS3A 4C6AA 4TU7A 3MTKA 1K9MT 2AEJA 1AUDA 2Y3YA 1LKZA 3MMAA 5I3QA 4F04B 1NJZA 1XNRJ 5MLCV 3KLEA 1VC0A 4NCGA 2A6MA 4OHVA 2GVZA 3DGPA 2XO7A 4LF6J 3CCTA 4ZPWR 3MHYA 1P1TA 3ENQA 5L9XA 3KMQA 3JQKA 1XTZA 3QWPA 1MWYA 2BA9A 5B09A 2RUGA 3UNYA 2R8JA 4S0MA 2OMOA 3DCAA 2PI4A 2Z4PA 4YB1P 2UZAA 1BWEA 1P27B 5DO2A 1NSQA 2EBEA 2W1BA 3HP6A 3UD4P 2DHAA 3KK1A 2D74B 1RI7A 3M8WA 4V19J 4OI3A 4Q0BA 3D1QA 5HBMA 1N34F 3AJDA 3IRWP 5LM7E 1DJ0A 2MZ1A 4LF7J 4QU7A 3K89A 1BQNB 1C1CB 3GG1A 1MU2A 5BYSA 4F4YA 3IR7B 2MZJA 4LIRA 1AXQA 1IKYA 2EFPA 5B08A 4I69A 3D2WA 1IKYB 3BSAA 3PRBA 2QA4G 2X1FA 3ZZ0A 1UWAA 1WWHA 2L9DA 2BUNA 2IPOB 4BBYA 4IQMA 1Y5LB 2CRLA 2D7SA 3BBBA 3MM8B 4IYQA 4H54A 1GMWD 3DLKA 2MKSA 2OPPB 3DRXA 4O3NA 3TVKA 3R6LB 4J9KA 1TKTA 3GIKA 4W98A 1YTYA 4QIWD 3KWMA 4QYRA 2JOQA 3KKFA 2M8HA 4OV1A 2FJEB 3EDRB 1JJCB 3R5JB 4OYAA 4TY9A 4ANDA 2XEXA 3AAWB 1REGX 3AH6A 3EZUA 3BJYA 4LBPA 2R7RA 5DDOC 2ZHBA 4FF2A 3D6TB 2WOMA 4HVZA 1VQKS 5FLXU 4JB8B 5L8RC 2V4QA 1HFEL 3PJXA 4Y2KA 5ETQA 4NCBA 3DOKA 2Y0SD 4UOCA 3BGUA 3JQMA 3TJ9A 2PA8D 3M6VA 2WW4A 4NCGB 3SSRA 4JI3J 4FPRA 1S9EB 4QR1A 2ZVIA 3SZ2A 3CIMA 1AA1B 1KBRA 1YJVA 3CT9A 1RWVB 2JVOA 4KSEB 5KFOA 4CIOA 1I94J 1HQUB 1RTDB 4B3TJ 2M3DA 4ID5B 1NHUA 2V0NA 5L38A 4JV5J 3Q8VA 2ADCA 1T9TA 3P5TL 3UCZP 5L1JA 1YJ9S 1NO8A 2RS2A 2J9EA 4FYDA 2XS2A 4URQU 4KHPJ 3N79A 4XDCA 4ECZA 1RWUA 4AYBD 3IXQA 4RW8B 2DNKA 2FJBB 3PDNA 2DGVA 5ETOA 2B8PA 1S72S 1IUJA 1FXRA 2IM3A 2SXLA 1BQMA 4LFCF 4YDDB 1F5CA 2BJ1A 3FEYB 5A6WA 3ZTRA 3PYFA 3LWMA 3GJSB 4BWJA 1SCJB 5FJ4A 1HIYA 4ES1A 1T03B 4JI3F 1U45A 3CC2S 1T03A 2D3OR 5DG7A 4RUAA 4PYDA 2B5JB 1R0CB 4QQBA 4OHYA 4KAIA 5EUHA 2I5JB 4CH7A 2OHDA 2DY1A 3KHRA 3K2YA 2Q66A 4DFJA 4DR6F 3NNCA 3PW7A 3A4TA 3CJSA 3SQGA 4A4JA 5BJRA 1YJTA 2VICA 1SH2A 4RNOA 1VQNS 1XMBA 5E3RA 2B8QA 2B4PA 2EBGA 1WELA 2CPDA 2CPIA 2KTQA 3PYDA 5M2PA 1UETA 3LA0A 4ZN1A 4U96A 1S1VA 1ZPWX 2B4UA 3BN4A 2QO3A 3CJTA 2ZBRA 2CZ9A 3FMWA 5HAOA 3AQOA 4DSJA 4GKKJ 2KM8C 4U7UD 1B99A 3LP0B 1DLOB 4KHRA 3WX8A 5C25A 5J2QB 4TQSA 5E41A 2HLTA 4DV7J 2OTLS 1NU4A 1WKLA 3C66A 4DQSA 1C4AA 2V69A 2F65A 2WCXA 2XMKA 2KFYA 1M5SA 2J6SA 3PEHA 1LXNA 1WEXA 5JJBA 3GR0A 2B43A 4DV2J 5G0RA 4E2FB 4LJMA 1U24A 7FDRA 2J8AA 2DNNA 1KFDA 2P8IA 2V68A 1XQIA 4P7VA 3MMBA 2C1EB 1KVKA 4DMZA 2WW8A 1RT7B 4DPTA 5A8RB 5KFMA 1X4CA 1N6QA 2NREA 3M8QA 2F1FA 5KT3A 1M5VC 4OYOA 2VJVA 4ANEA 1EX8A 1NDKA 2CQDA 4L3KA 2HNZB 3WIUA 4NRTA 3PFOA 4DZ6A 1WACA 1RAJA 2XSFA 1FX2A 2UXBF 4ECTA 1B7FA 3DN9A 3DXSX 1YJRA 5DLFA 3P96A 1QAJA 1K1QA 2UXCJ 1S4EA 3MWBA 4RW7B 4HT7A 3CJKB 4MAKA 4ED1A 2FYXA 1EQMA 4ZHRA 2L3MA 2DPJA 3CGIA 4CH0S 5KG7A 1FKAF 2EC2A 4IR1A 3DRRA 1BXNA 3NBPB 4KRWA 4LF1A 1YHQS 4IFYB 4CLWA 4P2MA 1FF2A 4WE1B 3TYTA 2W2OP 2DCUB 2FC9A 1VRTB 2UXBJ 3D0HE 3SYZA 1LV5A 2G1DA 1FCAA 3K5OA 2CJXB 4FNIA 1YSJA 4Y2MA 1G6BA 3HI9A 5LSOA 2HHHJ 4JI5J 2Y9HA 3PKMA 2KKHA 2GGPA 2NYHA 1UKUA 5KFXA 2Y0BB 4PQAA 4JI1J 3FQLA 1NHVA 1RAHB 2ATCB 1RYSA 1R0AA 2XLJA 2AT1B 4WP3A 4ED7A 2RDIA 5HROA 3BQ1A 3M2VB 2VB6A 5IQ6A 3KLEB 1UZHA 3PRVA 4AT1B 3ZZPA 3BKTA 3I87A 4WF9Q 1HBUB 3B4DA 4O3QA 4IDKA 4USMA 2BQRA 1QLNA 4DN0A 1Z2LA 2DT9A 4Y0FA 5KT4A 2YX7A 4AUKA 3KK3B 5HLFB 2R7OA 3QGGA 1U25A 1RYRA 4IUFA 4ED8A 3HVRA 4I68A 5D4NA 2ZD1A 3P4UB 4DV7F 5KFFA 4Q45A 1VQPS 1CJUB 5CYMA 5E3PA 3TP2A 4DDFA 1SJ4P 1Q86T 2W2NP 5D77A 2UUWA 2OI2A 1TELA 3L7PA 3QGPA 4KFBB 3IA0A 3MPDA 5B7WA 4HYKA 3TQ1A 1ZAVA 3RUBL 2XCAA 1X4FA 2Q6BA 1JLBB 1UW4A 2I38A 3G82B 1RADB 4U95A 4GKJF 1DURA 1OS5A 3VAFA 1X9MA 3DHWC 4Z2XA 3M8RA 4B08A 3KYLA 4IRCA 1KLMA 4JI2F 2Y1IA 2GQCA 3D1OA 4XDDA 4YDXA 5J1EA 4X64F 3ITHA 3KMSA 2R2UA 3KUGA 2AX1A 3IO1A 4P52A 3R97A 2HRTA 3FJ2A 4B17A 1AZSA 5AT1B 6FD1A 2ZDPA 4Q8FA 2E7XA 3HJVA 1U6BA 3OXLA 4ZLNA 3R5GA 4WYLA 1TL7A 1NJYA 3FUYA 2DVIA 3BBFA 3D7SB 1WSVA 3CJ3A 2CQ1A 1VQYA 1ZZFA 2DH8A 2M5YA 4Y2IA 1U09A 4YN3B 2FVCA 5GADI 1UFKA 3FBEA 3GIRA 1S0VA 3NMRA 3GCWP 4B3RJ 4HL9A 5B0CA 2LU2A 2VBZA 2WSCC 2B7BB 5AXLA 3GJRB 5GVQA 4ED6A 2AU0A 3VR1A 4DJBA 5B0BA 3QFHA 3O1LA 1CJKB 4DUTA 4Q5VA 3OJUA 3LWLA 1ZZNA 2ASDA 1J5OB 2HURA 2KL8A 2NZCA 3CDUA 1WNEA 4OX6A 2E9RX 2YNGA 3ZNJ1 3ZTQA 3MUMP 4DV3J 1UJ5A 1ZOTA 3C15A 3EZOA 2IVMA 3HZEA 4LF2A 4NLWA 4RW4A 2B5JA 3MZIA 3AJ2A 3HVTA 4NA2A 5THWA 1YBUA 4W90B 4ETZA 2ADBA 2HVIA 1P8GA 2VBWA 3OHBA 2UVWA 1VQ6S 4OYBA 3EVOA 1P6TA 4C0OC 2W9BB 1AZSB 1FEEA 2QL7B 5J2MB 3Q8PB 5J2MA 4RUHA 3FEZA 5C2GA 1N54B 5KFBA 1FDBA 1SQGA 2AJ0A 2XMTA 3HD1A 4KTQA 1URNA 1HD1A 2IDLA 4MK7A 4DQPA 2XLKA 1D0EA 1Q8LA 1RZMA 1SXLA 2CZVC 4J9MA 2QLXA 3FRZA 1K0TA 3R5DA 4RZRA 1KKHA 4P7TA 1HMVA 5DJBA 3PY8A 3QLHB 4ECWA 4RW6B 5HROB 1OYDA 1RT4B 1AT1B 3ZTSA 2BV3A 4EGLA 4ES2A 2VQFF 5L1KA 5LMUF 1F6TA 2HFUA 4F8RA 2GHVC 1H6KX 1RABB 3QAEA 4H4OB 3H25A 1Q4RA 5LXRA 2OH2A 2F9JA 5E5NA 3MOZA 2FY1A 5H9FJ 2QYGA 3HVAA 2CJQA 2MSTA 4KV8B 2WONA 5ETSA 3RJMB 1I3OB 2D41A 3TUJC 4DG1A 2VG5A 3JS9A 3QSYB 3LAKA 3QT7A 1KDNA 4DLGA 2LA4A 3LGMA 4WBFA 2ZKUA 3L95X 3H90A 4JI7J 3WC0A 4OI0A 1UP1A 1HNVA 3LPYA 2O1PA 2OPQA 3KG0A 4DX6A 3Q8RB 3VAMA 1NJIT 1DQ8A 4M5IA 1L5UA 4B3SF 3FCHA 3AXKA 2GGPB 4WWSA 4ZIVA 4NE9C 4OI2A 1R8PA 4ZPBA 2RQKA 1UJ6A 2CA9A 2DGOA 3IGNA 4KH1B 2BZ2A 4NMXA 2J5AA 1NK7A 4PUOB 2DIUA 2HRUA 2DNOA 2QLJB 1V3RA 4OZLA 5KFPA 1Y4ZB 2RDJA 1UA1A 5HMZA 4M1KA 3M8PB 2M0GB 2FGOA 3NWGA 3FBFA 3SSSA 5C7PA 3K8VA 5JVGQ 4OQJA 2ZBPA 4UUWA 1S1XA 3W61A 1N34J 1CPZA 4PQUA 1S1WA 3IRXA 4C11A 1VQMS 2AGOA 1S0MA 3J7AN 3I55S 3US5A 2OPRB 1FNXH 1EARA 1S7HA 2OKQA 2OPRA 2IVFB 2RRAA 3VAJA 1S76D 1UVMA 2GX8A 4IH7A 4B3SJ 1U0SA 3N6MA 3ILJA 1HHSA 1VR6A 1NZ8A 1DQAA 3ZFVA 1IBMF 1OJ4A 1R6VA 5HBMB 1C4CA 1TUVA 1RAIB 1UPPA 3KLGA 4H4KC 3W64A 1GH8A 4BHQA 3S01A 2Y1LB 4I6WA 1T11A 1F9FA 3M6WA 4DL4A 5C42A 2OEKA 5LL6d 1FI4A 4WIIA 4DV5F 1RAOA 1K8AT 2CXEA 3H20A 1WC1A 3CD6S 3OVSA
chains in the Genus database with same CATH topology
2J76E 3M8PA 4OZNA 2J9DA 2B9WA 4ILRA 5J2NB 1N56A 2A2CA 3NBPA 2HHXA 3SDEA 2N3OA 4ZPDA 2FD2A 3RRKA 3I82A 4DR7F 4O4GA 2CPHA 1DTQB 2OP5A 3LGNA 4O44A 2W8KA 3T1YF 3NP5A 3P49B 4A8WA 4WCEQ 1HPZB 2F8MA 3O3LA 5KFAA 3RYLA 5F8NA 1SBRA 4RW6A 1TP7A 2QLWA 1UEUA 2VKRA 3JTNA 4OJ1A 1UAWA 3BGFA 3PW4A 3A8EA 2PGCA 4ED3A 4C0HA 1H0HB 4I56A 5CCMA 1N5YB 2CVIA 3OR1B 4E8UA 1QE1A 2KU7A 3PR5B 4WU3A 2AYBA 2R4FA 3H59A 2OAUA 3NKYA 4WYWA 3UD3P 3BGLA 3BM7A 1WHXA 2BABA 1DHMA 2YNHB 4TY8A 3UCUP 1XR5A 2IHR1 3SCKE 3M6XA 5K9FA 1LFWA 4A8KA 2FC8A 3PZPA 1KEKA 3QJPA 1ZAXA 1TFYA 2DGUA 4CQ1A 2HHSA 3PIOQ 3FSYA 2E1AA 2DHXA 3I0RA 3IG1A 4PG8A 4X4QA 4ELVA 1JMTA 3GE9A 1N5YA 2R7WA 4FF1A 2IM0A 1BQXA 1HQUA 2HFZA 4NYZA 3CD5A 2HAIA 4QIGA 2HHPA 3GZ7A 5T7LB 1X0FA 1JLAA 4QWEA 3KLFB 4JBCA 3R3TA 1B0PA 2YH1A 1HPZA 2CPFA 5I3UA 3FMBA 5KG0A 3DM2B 1R89A 4QR0A 2VOPA 2YTCA 1MROA 5KOWA 4J9SA 4FF3A 3G6YA 4DQIA 2IM1A 3K8WA 2VBYA 2LMIA 1T94A 2OFGX 3EX7B 3K58A 4A8FA 5KFHA 1X7VA 2OMLA 2FJDB 4EYIB 1QE1B 1FJCA 1MW7A 3M32B 3FZ2A 2H5EA 4USJC 4F25A 2QSFA 3V6KA 3RAXA 4WE1A 3VAIA 4LSLA 3HHLC 4LF9F 2LDIA 4K59A 5I42A 4OHXA 4RBVA 2M88A 3NG8A 1IBKF 3TA2A 3FSIA 4M5DA 4URSA 2DPIA 5L39A 1MU2B 4NL5A 3C3LA 2M9KA 4FNHA 3W2WB 1WG4A 2HNYB 4IDKB 1HWUA 5K5MA 4MKYA 2ZH2A 2KYXA 4WXOA 4A8XA 5EDWA 1S1WB 3IRXB 4XPCA 3OL8A 3JB9k 3TX8A 5G0RB 2KH9A 1O8BA 5HL7Q 4LSLB 2W25A 2B9XA 1FRKA 4RNNA 2XS7A 2GW8A 3R5CA 4MH8A 1LQ9A 2E9ZA 4NLTA 4IO1A 1CC7A 1V3ZA 5E7OB 3HHKA 4PUOA 1KNZA 5A8KB 2CPEA 1NAQA 5GMKa 1KS2A 3VAGA 2MJUA 3ISNC 3IS9B 2BJDA 4HDHA 2P9GA 4PPZA 2OPSA 2D3ZA 3NAHA 1RA7A 3K59A 2G0CA 4RW7A 1KFSA 2KN4A 1R8BA 4K4XA 2KJWA 4R8UA 1HI0P 5A2QY 1S1UA 4AE5A 3FNNA 3H2LA 2ZJQQ 1JXEA 5BYQA 3GQCA 1IXKA 3DLHA 3MMBB 3R1LA 2CQGA 1D8YA 4ED2A 1S0OA 4ILMA 4HEA9 4AL6A 4DR4F 1CVJA 1VI7A 4NXNF 3MFHA 5FIIA 1LWFB 3H8YA 3H5XA 4Y28C 3G8TA 1GTEA 1W25A 2DISA 3DXBA 3OFHA 4NZ0A 4P2SA 4DV6F 1N48A 2ZDOA 1LWEB 2RJZA 4Q7AA 4C8MA 4ECYA 1UWBA 4DLEA 4DSIA 3K0JA 2K1RA 3OSPA 2J0SD 4DL3A 1JJ4A 2VA2A 1TL1A 3M1VA 3WDOA 2FHJA 4WZQA 4YB6A 2FHOB 4XO0A 3PVXA 1CQMA 2MQPA 5I4MA 3OW2R 1MMLA 4NZ7A 3I4PA 1FE0A 5BR8F 2NUHA 2BDPA 1DFDA 4TLRA 4MFBA 1XMQF 3THPA 4NLXA 4TY8B 3WZ0A 2XNQA 3CMAS 4OFZA 1SJQA 1R27B 5IT4A 1L3UA 4LF6F 1AFJA 2M8DB 3OBIA 3TOQA 1VBYA 2XY7A 1U6ZA 3ISND 4FP9A 1DBDA 2CJAA 2R9LA 2LECA 1PO6A 1PGZA 1RT1A 1OO0B 1YBAA 2KXHA 1I94F 1NK0A 2ZE2A 2C3MA 2WHOA 1E6YB 3UE2A 2CQIA 4PR6A 5K8NA 4RU9A 2ZVSA 4DFMA 3F44A 1MNEA 1HL6A 5CH7B 3QIDA 2QA2A 2HGNA 4F3MA 1U1KA 2PT0A 3WX4A 5B0EA 3VCDA 3CUNA 1IKXB 2P9EA 2C42A 3KHGA 4B9LA 2GIQA 3OR2A 2E1MC 4ZVGA 3LF0A 4N76A 2BW2A 1IN0A 4YB7A 1B0TA 2WOMB 1HBOA 4C9DA 4DL0C 5CZVA 4EZ6A 3G6ES 2CQ3A 2CQHA 4WXWA 2I9SA 2J0XA 3CD0A 1TQLA 4RBUA 1FT8A 4Q2LA 3DYAA 2R8HA 4F02A 2MY8A 2XMVA 1K73T 1RTHB 4ZOSA 1REVB 2E5GA 1A9NB 2XG8A 3QYYA 2P6SA 2OPPA 1DAXA 5KFZA 4N56A 3HM9A 4DR2F 2JLEA 5L1LA 5HLFA 3HK2A 3FFIB 1NKCA 1QVGR 1QUPA 4X4RA 5D4OA 2WBMA 3HMJG 2KT5A 5F8GA 2IA6A 2JC1A 3NNCA 5K14A 5CYMB 2UXCF 1M5PC 2AJQA 4M94A 1QJHA 2APOA 3MPWA 2RS8A 4EFAC 3JSMB 2DR7A 1I6JA 2DCLA 1QSSA 3CJ4A 4PXEA 1QAIA 4G1QB 1EETA 1FDDA 2BRKA 4CNZA 4FS1A 4ERDA 1G2EA 3J7A1 3CC4S 2JFDA 5IWAF 2VG5B 3D5MA 3DLEB 4JV2A 5KT7A 1GQEA 1PSDA 4C11B 1KQGB 3MFIA 2AWZA 3DRSA 2VOOA 4QPTA 5I42B 3N9UC 2Q1LA 3BGRB 4YHHF 4PWDB 3DFEA 2IMWP 3GIMA 4DSKA 5K14B 3PHEA 4JI5F 3LO3A 1OSDA 2RQCA 4DL6A 4ETXA 3IN5A 2GV1A 2XSJA 3M2UA 3MMCB 2JSXA 2R7TA 2QA4S 5KAKA 2RILA 1M1KT 3PXGa 1XWLA 2EWHA 2XBPA 4OI1A 3I96A 5C5JA 3HFKA 2W4PA 2B56A 5HI7A 5G4DA 5KG5A 1SB6A 2VD3A 2QFJA 5DGAA 3CCRS 4A8QA 3DRYA 4BCAA 3TAMB 3MPYA 2LXIA 3D0IE 3E01B 2PI5A 1LK5A 5AE3A 2V2KA 5LJ3Y 2DNYA 3GSDA 4NCAA 1SJRA 2IBKA 4AXJA 3MF5A 2ZJPQ 2FJXA 5KFSA 4LFBF 1IKXA 1N6QB 3C46A 5C24B 1ELOA 1S1TA 3GR1A 1JLFA 2RSQA 3JSBA 5KFGA 2K2PA 4ZCIA 5A8WB 4I2PA 5F9LA 4F50A 1R8HA 2FJAB 4OI6A 4OJHA 2J6TA 3Q23A 3PIPQ 1Q7YT 4GMKA 4TLQA 3I0RB 3PX6A 3MM7A 5K8OA 1RT1B 2E1RA 3M1VB 3OUYA 3SQGB 4KKOB 4NPOA 4DX8H 3POTB 3MUVP 1ZTTA 3KLFA 1D1UA 2CQBA 2ROGA 4NLUA 2UVWA 3MM5B 5CD4H 4Y00A 4N5SA 4DQQA 4RWXA 5JUMA 2VG7A 1VLYA 1UFWA 2LEAA 2X1AA 1R8AA 3A1YG 1Q53A 3OFGA 2QEXS 2Z8QA 3KLHB 2LXUA 1WG1A 1HMVB 3UI3A 4TU8A 3LANA 3T5LA 2QMXA 3MDFA 2VBXA 4EUVA 3PX0A 1Y0HA 2RQ4A 1GXLA 2C2DA 2P5VA 3M9MB 4Q2MA 1UWBB 2AF6A 3TI0A 3QIPA 1XNQF 1GTHA 4X4VA 4MIAA 5ADZA 1HNXF 4PPDA 2I5JA 1S6OA 2R7VA 2IJNA 1TL4A 2AV5A 2RF2A 3GV5B 2PD1A 4RX6A 2HFOA 2VG6B 2XY6A 2DRAA 1HWLA 3P3DA 2YWFA 3W2VA 3KLVA 3BO2A 2A3JA 1JWWA 4CT9A 3DRPA 3MMCA 4Y34A 2QMWA 3WBZA 1KSPA 2VC1A 4LT6A 3DOMA 3E2EA 1C1BB 2RQMA 4B3OA 2CPYA 3VTIA 1KQSR 2WB1D 1WD6A 1UA0A 4WK3A 3OLBA 1S9EA 3BEGB 5C42B 5KFUA 3PW0A 2IVYA 3J80Y 3OR1A 4Q8EA 1KOOA 2J0QD 4DN9A 3BZQA 4ID5A 1SJ3P 1HARA 5KFRA 3MI7X 1H98A 4OI4A 1R31A 1GX6A <