3CMNA

Crystal structure of a putative hydrolase with a novel fold from chloroflexus aurantiacus
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
298
Chain Sequence
LIDWEQARQAALRLSQWEQAPVDNRAFRREQYARMVALSEPLIADYLGVRLPEPVSRIFVFDRREWLEANIVSFSQLFRPIEEMYEKSSKLLGVQIGGLLGYLAQRVLGQYDLSLLSAGGSLYFVEPNIARVQQQLGLSDEDFRLWITLHEMTHAFEFEAYPWVRTYFRELLEQNFALTPEQRAVFDRIQALMSLIEGYGNHVMNAVGRRLLPSFNQIEQQIAQRQRQRTMLDQMVFRLTGLDLKLAQYQQGEAFVNAVVAARGIQFASRVWERPENLPSMDEIRNPGQWIVRMDREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative hydrolase with a novel fold from Chloroflexus aurantiacus.
rcsb
source organism Chloroflexus aurantiacus j-10-fl
molecule tags Hydrolase
molecule keywords Putative hydrolase
total genus 115
structure length 298
sequence length 350
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10103 Zincin_2 Zincin-like metallopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.150.30 Mainly Alpha Up-down Bundle Lysin Lysin 3cmnA01
3CMNA
chains in the Genus database with same CATH superfamily
2XNDA 1H8EA 1E79A 2HLDA 1MABA 3OE7A 1LISA 1W0JA 4TT3A 4XD7A 2LYNA 1NBMA 2QE7A 2W6IA 4YXWA 1COWA 2R9VA 1E1RA 5CDFA 4ASUA 1KMHA 1W0KA 2WSSA 5DN6A 2JIZA 3LYNA 2F43A 2WPDA 1OHHA 1E1QA 1EFRA 1LYNA 1FX0A 1SKYB 3OFNA 1BMFA 2JDIA 1H8HA 2JJ2A 2LISA 1GAKA 3ZIAA 5FL7A 2JJ1A 2CK3A 3OEHA 4Z1MA 4TSFA 2XOKA 3OEEA 3OAAA 2V7QA 2W6JA 3CMNA 3FKSA
chains in the Genus database with same CATH topology
2XNDA 1H8EA 1E79A 2HLDA 1MABA 3OE7A 1W0JA 4TT3A 4XD7A 1NBMA 2QE7A 2W6IA 4YXWA 1COWA 2R9VA 1E1RA 5CDFA 4ASUA 1KMHA 1W0KA 2WSSA 5DN6A 2JIZA 2F43A 2WPDA 1OHHA 1E1QA 1EFRA 1FX0A 1SKYB 3OFNA 1BMFA 2JDIA 1H8HA 2JJ2A 3ZIAA 5FL7A 2JJ1A 2CK3A 3OEHA 4Z1MA 4TSFA 2XOKA 3OEEA 3OAAA 2V7QA 2W6JA 3CMNA 3FKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMN A; 
#chains in the Genus database with same CATH topology
 2XND A;  1H8E A;  1E79 A;  2HLD A;  1MAB A;  3OE7 A;  1LIS A;  1W0J A;  4TT3 A;  4XD7 A;  2LYN A;  1NBM A;  2QE7 A;  2W6I A;  4YXW A;  1COW A;  2R9V A;  1E1R A;  5CDF A;  4ASU A;  1KMH A;  1W0K A;  2WSS A;  5DN6 A;  2JIZ A;  3LYN A;  2F43 A;  2WPD A;  1OHH A;  1E1Q A;  1EFR A;  1LYN A;  1FX0 A;  1SKY B;  3OFN A;  1BMF A;  2JDI A;  1H8H A;  2JJ2 A;  2LIS A;  1GAK A;  3ZIA A;  5FL7 A;  2JJ1 A;  2CK3 A;  3OEH A;  4Z1M A;  4TSF A;  2XOK A;  3OEE A;  3OAA A;  2V7Q A;  2W6J A;  3CMN A;  3FKS A; 
#chains in the Genus database with same CATH homology
 2XND A;  1H8E A;  1E79 A;  2HLD A;  1MAB A;  3OE7 A;  1W0J A;  4TT3 A;  4XD7 A;  1NBM A;  2QE7 A;  2W6I A;  4YXW A;  1COW A;  2R9V A;  1E1R A;  5CDF A;  4ASU A;  1KMH A;  1W0K A;  2WSS A;  5DN6 A;  2JIZ A;  2F43 A;  2WPD A;  1OHH A;  1E1Q A;  1EFR A;  1FX0 A;  1SKY B;  3OFN A;  1BMF A;  2JDI A;  1H8H A;  2JJ2 A;  3ZIA A;  5FL7 A;  2JJ1 A;  2CK3 A;  3OEH A;  4Z1M A;  4TSF A;  2XOK A;  3OEE A;  3OAA A;  2V7Q A;  2W6J A;  3CMN A;  3FKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...