3CMOH

Hiv neutralizing monoclonal antibody yz18
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
AVQLSQSGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCTRWPHYYGGSRYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV neutralizing monoclonal antibody YZ18
rcsb
molecule tags Immune system
molecule keywords Fab light chain
total genus 43
structure length 222
sequence length 222
chains with identical sequence Y
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoH02
2EDBA 2CPCA 4DW2L 4XNUH 4V1DD 1QP1A 1MFEH 2IPKB 4M1GH 4P2RE 1C08B 1RZKH 2J8OA 4XPGH 4NQCA 1HHIA 2VDKL 4AIZB 4NWUH 4YHLH 4YDLB 5FYKD 1OP5H 1G7IA 4PPTA 1T5XB 3VXMA 1W0VB 1FZMB 2BNQB 3DXAA 4AK1A 1FDLH 4YHPA 4NJAL 4IJ3B 2WAHA 3MJ8B 4GW5A 4MXVE 2JJTA 3U9PL 3MZGB 5I73C 4GMTL 4ZUUA 3FT3B 3TBWA 1CDCA 3QH3B 1PYWB 2HYMA 3FFCB 4N90E 3S98A 1EXUA 2JELL 2CDFB 5F7NC 1EPFA 5DJAA 1F4AA 2HVJB 3PXHA 4UQ3B 5AEAA 1AR1D 4XPBL 4XVTL 1RJZB 1M71B 3TVMC 2PXYC 2NZ9D 3EUUA 2XA8L 5IB5B 2HFEB 1F11B 3CFDA 1HSAB 1KPUA 1B3JA 3P4OA 1XGPA 1MCPH 2R69H 3OXSA 5DJZB 5C0ND 2NPLX 1TJHH 3HLAA 3GSVA 3G5VB 4JFEB 4F7MB 1ZT1B 4JFZL 5D4QA 2R2HB 1S7RB 3ZT6A 1M6OA 4M5YH 3MRNB 2FEDD 3R8BB 2ED7A 3U9PH 4X8XA 4H25A 1GH7A 5DQJA 5D2NB 4R4BB 1OGTA 5DFVC 1XGUB 2GYSA 4HG4K 3PWUA 4I18A 1EVUA 4CMHC 3L3DA 3MOAH 1ZS8A 4ZD3L 4P4RB 3FFCE 4RIRB 5IMOA 5IV2B 3DROB 4QO1A 5FECB 1KJ3H 3VG0L 5KVGL 4JKMA 1A4JA 1KPRA 1N4XH 3W0WA 2MHAB 2C3VA 4XVTH 1IC7H 3H7BB 2MCPL 1J7VR 3WS3B 1FFPB 5LAXB 4Z5RA 1JHKL 4U1NA 2K9UA 3WUWG 3OTTA 3N85L 4XZUA 4LPTA 4OI9A 4B53A 2M26A 2OR9L 5L9DH 2AQ1A 3S3JA 2CUIA 1TJHL 4NRXA 4JFZH 3GBMH 4ODWA 4QHKI 3RWGA 4LCCC 4M5YL 1CXEA 1NJ9A 4X7EC 3S96A 2MFNA 5FA3B 4AENA 3TV3H 1T83A 3QPQD 4HUWB 4YJZL 4FQXB 3FO2A 5IB1B 5JR1H 2BHUA 1CK0H 1YZZA 1AIFB 4JHAL 4UIKL 3MRIA 5J6GA 3P4NA 3LN9A 5K9OA 3JWOC 4HMEA 3VXSB 4WV1B 3WUWA 5IIEA 5DLMH 4Z76A 5IKCB 5BXFB 4MXQC 5F6IB 5I17A 4YK4C 1XGRB 1N4XL 3CUPA 4NYLB 1OGAB 2Q20A 3DLQR 5D2LF 3RIAF 4YGVA 1JJUA 4WFHD 1UVQA 5D8JH 2HT2D 2D0FA 2B0SH 1CG9A 3BKMH 2QTEA 1YECH 3ZKSD 2DWEA 2H26A 3MBEA 4Y2DD 3JTTA 3WL9B 2YD4A 5J9PB 5DRNA 5EG6C 3LN4A 1TVDA 3L9RA 2F58H 4Y2DB 2X42A 4NO3B 5GGSB 3WNOA 2IMMA 4ETQA 3VI4E 5FA4A 4QF1A 1M6OB 2L7JA 4MDIA 1NFDF 5JDSB 4DVRL 3SO3C 2HFGH 3QUXD 5CGYD 3AS2A 1GC1L 4I5BA 2VC2L 3WLBA 5I2IA 4LU5H 4DTGL 1RIUL 4H0GA 4HKXA 3CPLB 1KSRA 3G6JB 4LPVA 3P77B 1XT5A 3QDJD 5CBAA 1V05A 4YK4B 3FCTB 5E8PB 2XNAB 2BRRH 1IM3B 3T4YA 4Z7NE 2CDFA 2O5ZH 3LKNA 4CMMB 3C09C 3O6FA 3SBWA 4LHQB 5JLZB 4PS4L 4X4XB 3L6FA 1D6EA 1FC1A 4ODSH 4OFIA 2CK0H 3H42L 4S1SH 43C9B 5KVMC 3PL6A 3PQYB 1RAMA 5H94B 4U3HA 2O5XL 1KENH 2EC9T 5ICZB 2AEQL 5C07A 3HMXA 4WHCA 3BH9A 3MUHL 3O4LA 2VLRD 2HFGL 3ARWA 3ZE1E 4LSDA 1JYXA 1GC1H 1QRKA 3SCMB 5GHWH 3ULSA 5BOPA 1Q9LB 5ANMA 3ZHKA 2WANA 2FHCA 2CMRH 1ZGLM 4OQTL 2ZUSA 2J5LB 2OMNA 3BW9B 5SX5H 1B6DA 2YRPA 4PJ5E 4EUPG 1KN2L 3E3QC 1JWSA 3TJEH 1DN0B 1O7SA 1FGNH 2OSLB 32C2A 4I18B 3C09B 4AIZA 1TETL 1UM4H 1ETZA 2OXGA 4NQCB 5I1JH 3NIDE 4QXGL 3TPUB 4Q9QH 4F58L 5IG7B 3OZ9L 4HDIA 3QWOB 4FQ2L 1T0MB 3OGCB 4LVNC 2EKSA 3M07A 4X6FA 4RZCA 1L0QA 3PP4H 1Q1JL 4CU6A 4IRSD 4NRYA 4DKEL 3OB0H 3T77B 2X1OA 4XC3L 3MRQA 2ZSVA 4LLYA 2VE6B 2C3XA 2WSKA 3RZCB 4IMKC 5D5MB 1F11A 2WP3T 1NBVL 2ICEB 3PWJB 3DI2B 1RQ5A 4AQOA 2FO4B 3IF1B 3REWA 1KN4L 4I4WA 1RZJC 1L0YA 1YEHH 4EI5A 3EYSH 1TMCB 2X4QA 1J1PL 5FHAL 3CLFL 5DI8A 3ET9F 4QHLB 1U93B 2VKXA 2VO5A 5TGBA 4PJFE 4KTEL 3X14B 1RURL 5DFWH 3BWAA 1I9JL 3WJJC 3MLRH 5LG1A 1BZ9B 2PW1B 3FFDA 4RISL 4XCCH 4OZIB 2E7HA 2JJUA 4XC3H 1QR1B 4M6NH 1JGLH 5F9DC 4ZS6D 2I5YH 2J8UE 4G6FB 1EHNA 1UM6H 1XR9B 1CDIA 4NSKA 4JM2C 4NO5B 2DICA 5FGCB 5C9KA 3LH2H 1I4FB 5MENA 4JY6A 2JF1A 5I1CH 2XPGA 1XGYH 3VFVB 2C1PB 1LP9E 3MRCB 1WC7A 2E5EA 3D6GA 2NY7L 4JFDE 1EERB 4JM2B 4Z0BL 3DHMA 4EQ2A 3VFUA 2VSDA 2BHYA 5D5MF 3HZVA 5M7QA 5KG9A 4RAUB 3GHEH 1HWGB 1B4JH 1I1YA 4JQIL 5GRUL 5I74C 2GW5A 2APXA 4YPGA 3GM8A 1CICC 5INCA 5C07D 3LSOA 3AM8A 3NFPA 4HBQA 1NGYB 3MLRL 3HPLA 5HYEA 1OWWA 1HQRB 3IDMA 1CFVH 1AXTH 2R29L 4F57H 1WV7T 4PY8J 1UQSB 3SDCB 1LE9B 2VLKB 2W9EH 3LEYL 5FUOH 4ZMAT 1FLRH 1X5LA 5I1DB 4RFOL 4PP1D 4WGWB 1HILB 3L3OA 4GAJH 1UM6L 3VRLF 5IOPA 1KIPB 5DFVD 3QDGA 1J0IA 4HGMA 4LCYB 3VD4A 1GXEA 2ADIB 5E6IB 1XGYL 4ZFOL 3D3VB 2D7QA 3L1OL 2I07B 1U3HC 4MJIE 2CR3A 5E00A 4I77H 3RA7L 1H15B 1R5IA 1GGBH 1IQDA 1YUHA 4JANB 4NFCA 4P99A 1F4HA 3BEWA 1NMCC 3BP7B 2JJWA 1T6VN 2IQ9H 2GJ6A 4JM2F 5CUSH 2DBJA 5JDSA 3V4UH 3BZEA 3TJHD 5TQ2H 3EGSA 12E8L 4YC2C 4ETQB 4UT7L 1U0QA 4P2OD 1X5YA 3TPKA 4MNQB 1ZANL 5FIEA 3TPUA 2BVPB 2R29H 4F57L 4NNPH 2F74A 4OSUH 5J8OA 1FLRL 4NQDD 3RVXD 4J1UB 3QUYD 5HGBB 25C8L 2FRGP 4FFYL 5D2NE 2YC1A 2AXJA 1YJDH 2FH6A 3HC4L 4D0DB 4PGBA 3SGJA 3V5DA 3H9SE 1U8MB 2W38A 4WHYG 3T2OA 4M4RA 1ADQH 3O45B 4X7SH 1HYSC 3NBNA 1FJ1B 4QRRE 1RU9L 1JGUH 3MRIB 2YUZA 5J6GB 1HKLL 3PL6B 1LO5A 3BKYH 3PQYA 3OJVC 4IRSC 4LLDA 2QHLA 1AI1L 1EAJA 2NX5D 3BZDA 1KEGL 3LS5H 2W60B 2N4IA 1QBBA 4OGXH 3MODH 2RHEA 4OCYL 4HF5L 2HP4A 4L3AA 4JCLA 4A6YH 5HPMA 4PUBH 3VGBA 4EI5B 3ORJA 4Y16A 4FABH 1G9NL 3QCTH 3WHXA 43C9A 1BOGA 2NXZB 4BZYA 1BVKA 1T3FA 1KTDA 2W92A 1J05B 3OJ2C 5D1ZD 4KKBD 1WBXA 1H3XA 1DL7H 2ICWI 3FAWA 3I6KA 3C6LD 3QEUB 3BH8B 4HQQL 3HC4H 3W0WD 5I19L 2AAVA 2R2EA 4F2MB 1U95B 3K4ZA 5EU6D 3GO1H 2DLIA 4PJDE 1MJ8H 1CLYL 3O3DA 1RK1B 3I50H 4JFXB 1XCTB 1HHHB 3OR7A 4B7LA 4JFPB 2X09A 1RU9H 3W9EB 2ICCA 4I1NB 4YR6A 1ETZB 1BZ7A 2CJUH 3NCCB 4LCWB 5IVZB 1T04B 3HKFA 1A7QH 2BC4A 5H35B 3VXPA 1BX2A 3U30C 4OD1H 4XC1L 4G9FA 2OSLA 3NZHL 3ZKQD 2HJFB 5IQ7L 4OBRA 2X1XR 5J1SC 4HKZB 5D2LE 1WF5A 3DV4A 4A6YL 3IRPX 5H2BB 5J6HB 1G9NH 5BOZG 2IPUG 4POZD 3OAUH 1DUYA 3ARQA 3U9UA 3O3BA 3VFWA 1GCFA 4QCIB 1BD2D 1SY6H 3PGDB 5EO9B 4L5FH 1MRDL 3TT3H 1XF1A 4U1LB 3LKQB 2QADD 3ARFC 3AREC 1CFTB 1MJ8L 5T1MB 4HLJA 1OAXH 2C7UB 1GZPB 2DQHH 3DVNB 2DQTL 3I50L 1Q0XH 1CVRA 1MSPA 3CD4A 3GIZL 2BMKB 1MPAH 1I85A 1ZGLP 1AKJA 2BSRB 3AMLA 1DANU 1DQJA 5E8DL 1JPST 3T1FA 2FR4A 4JN1H 4R26H 1JHTA 2A38A 2QQNH 1S9WA 1X5AA 2HFFB 3R0NA 4YNYA 1OM3H 1LP9F 1OSZB 2VZSA 4L4TD 3EOAA 5F6HI 3WJJA 2OX5A 1ZVHA 3QUMB 3T0EA 4NKMB 2Q6WB 3S8WA 3BO8A 4O5LH 5HY9B 5LGKA 2APWA 3LEXB 4MWFB 5I66B 5F6IC 1X5FA 4OUUB 2WIIB 3SBWC 2DQCH 2AV7B 2OXHA 4Z7VA 1WISA 1HEZB 3W5MA 2ZUQC 2P5EB 5EDXA 2ICWB 2WZPD 4OV5B 3I84A 1EEQA 4PJDA 1Q0XL 2AABL 2X4SB 1CGWA 3FJTA 1NMAL 3SE3A 4EN3A 1NLBH 5GGVH 4HWUA 4X6CE 5JOFA 2E7LC 3IDXL 3O2DA 2XFXB 1RHFA 1VERA 2Y9RT 1BJMA 1X6NA 2HRLA 1J5OH 3ARUA 2ADIA 5E6IA 4RMSA 5HI5C 1FL3B 4XP6H 1MCDA 1DFBL 1RZKC 2OP4H 2OL3L 4I0PA 2AEPL 4U1JB 5AUMB 2P44B 4NZRH 3LPWA 3U36A 5C0NC 1LP9B 1OT2A 2V17L 5GGTL 2C3GA 2DQCL 4M7LT 4G8GD 4PIRF 4QT5B 3RNQA 4LOUD 3V4PH 4XHJD 3BPCA 4YDVB 1OB1B 5EBMA 3BDBA 3ZDZF 1SJVA 4MAYB 3GEWB 1HE7A 5GGVL 5CINL 4M6OL 1J11A 5KVEH 1TLKA 1G9NC 3VI3E 2P8MA 4R3SA 1RZGB 3HZVB 3Q0HA 4H0IA 1L4IA 2LVCA 1JTTA 3L3JA 4PGBB 4YDJB 2ID5A 2XPGB 4MNQA 2FB4H 3DO7A 1FL6A 2VR5A 3MJGX 3REVB 4J1UA 3SDAB 2XTJE 2Z0BA 4JGUA 2B5IC 2Z31A 1A6PA 4F37K 5DURB 1JPTL 3ARFD 3DBXA 5EC2A 2Y5TA 5FYJU 4PFEA 4D8PA 1T5WB 3EOBB 4OKVA 1QLFA 4H1LB 5DMYA 5EU6E 3RY5A 1P84J 2VDNL 1AD9B 3BWAB 4M61A 3ALWA 3QHZL 1A7OH 4AEFA 1BF8A 1KB5B 4BZ1H 3I6LD 2EYSA 2PO6C 1JHLH 1XR8A 5CP3H 1NKRA 1I8LA 2EE6A 3CFJA 3BZFA 4TVSa 4KFZC 3VXUE 1EFXA 2NQCA 1A9EA 5GRVK 5EWIL 3H0TB 4WDIB 5E24E 3WHXB 2EEBA 2ZNXA 3CZJA 5HGGS 1NC2D 5HPMB 4Z7WB 4LCIL 3AY4C 1EHLL 1GVIA 1IBGH 4HC1L 2IH3B 2VRAA 5L2KD 5IJKA 4L9DA 4M62H 4K3EH 5IWLA 3AU1B 5D5ME 4LEOA 2OR8A 4N5UA 3TA3D 5I8KH 5C92A 1KCUH 1DLHB 2EIEA 2FD6H 5HGHA 1CFQA 1JIBA 3ULUD 1U8MA 1IGMH 2NY0C 1WZLA 2H9GB 3MJ8A 1ONQA 1Q9KB 2SEBB 4FP8L 4Z0XA 1XF4B 3SEPA 1W0VA 4PRHB 5ITBH 5CEZH 3MRBB 3MNZA 4U1SA 5SWQA 3RFZC 3FO1B 1AE6L 4OF7A 1RZFL 3DOSA 2CGRL 5B8CB 2AJ3A 3QFJD 3C9NA 1HXMA 1G7LA 2K3TA 4HH9A 3KYOA 5D7IA 3E2HB 3W39B 3C8HA 3T2NH 1SBSH 3W81A 1CL7L 2MNUA 3C2AL 2ITDB 1HCVA 1HH6B 4KK9D 1U3HA 5KSBB 3LIZH 4GUPA 3GFUA 1NUDA 4MB4A 4NQSA 2QL1A 3BKJH 3SDYL 3W82A 4NQTA 4S11A 4HEME 3RWCA 5BZDB 3S5LG 1BQUA 1TVBB 5I15L 5I8KL 4K9EH 3WEXA 4WCYL 4OF5A 4JHBA 1IGYA 2JJSA 3Q2CA 4FXKB 4U1KB 2Z35B 3UTZA 5J12B 1B90A 1JGDA 5EU6A 2FIKA 2MCG1 2AJXH 2QR0A 3O4OB 3VXOA 5GGVY 1RHHB 4ALAH 2EYSB 2F15A 3WFCL 3PWPB 2CGRH 1UACL 2XQBL 1RZIA 2D2OA 4WUKH 5J89A 3MREB 3RZCC 3GMNB 4W6YB 3RAJH 2ENSA 1A0QL 3TZVB 4KJPD 2D31B 3OKMA 5BJTA 5EOQH 1IGIH 1T2QL 4PJEA 2DRUA 1WICA 1CFSA 5JMRA 1VSCA 3LAFA 3REVA 1RZJL 1A1MB 4G3YL 4K9EL 3STBA 4GKZA 2WMPA 5KSBF 3FT2B 5C0DB 1U8PA 1BWMA 2BY1A 1REIA 4PRIA 5DHYB 5KS9B 1N6QH 4M1CD 4NJ9L 1NFDE 2CXGA 1QSEA 2DIBA 2AJYL 2PYFB 4H88L 1LEGA 4D9RE 2HKHL 3DO7B 4KGLA 3VFPA 1MNUH 3KPMB 4J4PD 3FTGB 3UZVB 3ETBF 6FABH 2OTUA 1OSZA 5C07B 4HZAA 4LNRA 1S9VB 3EIFA 2D0HA 2J4WH 4D0CA 3MLSL 3JWDH 2FWOA 3HAEG 3SO5A 2FR4B 2GJ6D 3L7FA 4A6YB 3OJMB 1N7ML 5AYQA 4Z7UA 5DMKA 1B88A 3S88L 4JFYA 4M3KB 4PJAE 4PYGA 4BFBD 5JNYB 1TQBC 4G3YH 3HI6H 4JRXB 4OFPA 3GRWL 3TF7C 3FRUA 4CAGA 3Q3GA 1J0JA 2J1KA 1I7ZA 3KWWA 4Y7MA 4PREA 4KUZH 4K8RC 2BVTA 3EYVA 2FX7L 2XOTA 1FGVL 2DQJH 3QDAA 2F5AH 3K81A 5EOCL 4KVNH 35C8L 5HHNB 5I74B 1U36A 2AJYH 4H88H 5TQ0H 3E3QE 2HKHH 1AR1C 1OCWH 5I2IB 3CLEH 4XPFL 4XWGH 3WIIH 2AQ2A 1AO7A 2EICA 3P77A 5C0IA 4D94A 3MLVH 4BUGA 5A16A 6FABL 2HN7A 5ELIA 5EORH 1A6WL 3TBTB 4JY4B 1YMHA 2YD6A 1JZ7A 1PLGH 5L2JA 4U33A 2NR6D 2Y36L 4M7JH 4WHTB 4C56D 1AC0A 3P11L 3MA9L 2FO1A 1ES0B 4HC1A 3NPSB 4I0PD 1T0PB 2QADC 4WEBL 2W65A 1I3VA 4CVUA 4LVOC 1XIWA 4NYLA 4PJXA 3VRIB 4JFEA 5T1LA 1MCCA 5JIIA 1BD2E 1KBGH 4KUZL 1XGPB 1GC1C 2E7BA 1UVQB 4L8SC 4NNYA 4LVOB 4MYWB 4DN3H 3QULB 1AIFA 3KS0J 3PHSA 4JFDB 3NA9H 4QXUL 2EEDA 3WIIL 1HWHB 4IDLA 3LCYA 4TNVF 3SDDC 2LU7A 1FNEA 1FL5B 2MMXA 4QHNB 1T1YA 1Z5LA 1AO7D 2N1KA 3C2SA 3RVTD 4R7DA 5HBBA 1TCRB 2GUOA 2Y36H 3AREB 2X1PA 3LKOB 5BW7A 5DVOA 1KIUA 5FM4A 1F4WH 1JWMA 4UT9L 3QO1B 3BSZH 2NY6B 1D9KA 4WEBH 2R2BA 2XWJB 1D5BA 4NT6A 1FFPA 4JZNA 1NGPH 5A43C 4FQJL 2YXFA 3L3HB 2VLMD 3G6JA 2PKDA 4Q0XL 1V7ML 4PD4J 4WHYH 5J11B 2R8SH 4QNPF 4WJ5A 3WXVH 3ROOB 1ZVYA 3KAAA 2ENYA 4HIIB 4ODHL 2GAZB 1P53A 2OJZL 5ESAB 3U30B 4DUVA 4OCXH 5E99H 4MQ7A 2ZKHH 5ERWB 4NQDE 4YQXL 4ZO6A 1NCAL 1IM9D 3IETB 4ZAKD 2ESVD 3PWLA 1KCVH 4TSCL 2EYRA 3J8F7 4P5KA 1O5DT 2VQ1A 3W9DB 1RUMH 1JYVA 1NKOA 2IEPA 3LN5B 5EC1B 4LQ1A 2XT1B 4I9WD 1KG0B 2H3NA 1T6WA 3PDGA 2A6JB 4RGNC 4YDLC 5HVFB 3QEHB 4AL8L 1P7HL 1CFNA 3NA4A 4KDWA 4NUJB 1F2XK 4JRXA 4L3EB 1KIPA 4P5TA 2AKRB 5E2VH 1RHHA 5JZ7D 1KNOA 3D69A 2X4NA 4ODHH 4Y4KA 4JFHE 4PREB 3PWNA 4GS7C 4O2CB 4X7TA 1EAPB 1JGDB 4KVCL 5EU6B 4YO0A 1TJIH 3V8OA 4WFGD 4Y88A 3X11A 2NXYD 4Q97A 4GO6B 2ZOKA 1JE6A 4XAWL 2FH8A 3PQYD 1NCUA 4FMKA 4M7LL 4EZMA 5EIQA 1CU4L 2A77H 2D9QB 3S35L 4Y2OA 1NGWA 1A1NB 4KK8D 3TN0A 5B39B 4FOMA 2AJUL 3OKDA 1LEGB 4BM7A 5KG9B 5HHOE 2PO6A 4ONFL 4LOUC 2FJFA 2APTA 1CR9H 3WFBH 3C9NB 4PRIB 3CU7A 4YX2H 5J56B 3CVHB 4HIEA 4BA8A 5ITFB 2A9NL 2VOTA 4GFTB 3MRLA 5DR5H 4JFHD 5D71L 4H1LH 4LCWA 2IBGA 5FYLL 5I1GH 4ORGA 5C08E 5T3ZD 5IWLC 1EA9C 1KJ2B 3P0GB 1IAOB 2VLJB 4JZOB 4E0RB 4NKOB 5FYKE 4JVWA 2BSSA 1CFQB 4NO0B 4ODXB 4YIQA 4QGTA 1JNNH 1PG7L 4M7LH 4EIGB 3TO4B 2NY4C 4ODBD 4PRPB 1AC6A 5I73B 1ZHBB 3VG9B 4LIQH 4YHZL 2OS7A 1UT9A 4U3CA 4HGKC 5IOPB 5F89A 4XVJH 4KY1L 4LPWA 4MB5A 2IG2L 1JRHH 2R4SL 5KJRH 2I07A 4ONFH 3S3PA 3EKCA 3O3EA 2W07A 1UWGL 2Q86A 2J6EH 4TQEH 2P24A 2BOCB 2QQQA 4Y16B 2VWEE 4OQTA 5E2TH 3D9AL 1WLHA 2NY1D 3K4DA 3UTSB 1S78D 2A9NH 3VFNA 5HVHB 4LCCB 3AAZB 3L5XH 3QNZA 1FYTD 3V6OE 2EIZA 1DSFH 1Y18A 2IFGA 5FK9B 3TC9A 4AG4H 4CW1B 1FSKC 4A2LA 5JIKA 2F9BT 1CLZH 2DOCA 4LPXA 2VL5A 2G75A 2F54A 2WUBL 2BNRE 3UO1H 4JFED 4JRYE 2EE2A 3IDNB 4LQFH 5I0ZA 3DSFL 4HWEH 2DN7A 2DQDH 2BNQA 3DXAB 3T0DA 5TH2B 1G0DA 5DGRA 4MB3A 4WUUA 4UUJA 5E2UH 4U1HA 1GZQB 4R97B 1DN0A 3BQUC 1HZHL 5EBWA 2CLVB 2VLRE 1ERNA 1RUPL 1MCKA 3GMRA 3WKML 3DX8B 1QKZL 3H9ZA 1EZVX 5HYQA 2VABB 5CJXC 3CX5K 3L5XL 1MCEA 1FNGA 5F21B 4ZAKC 4H5SB 3DSNA 4JB9L 1SBBA 1F4YH 1OAUL 4L8SA 3RQ3A 1CLOL 3E8UH 4R8WH 4R2GD 3PGFL 4RDQG 1DE4B 3GMNA 4NZTH 3QFDA 4NKIH 1UH2A 4OAWA 1R3LB 4WO4C 3UZEA 3L7EB 1M7IB 3BD3A 4LP4A 1G7QB 2QQKL 3MO1B 5DQ9B 3VWJD 2VLME 3U0WH 1MWAA 3U1SL 8FABA 1KNOB 1CQYA 4AJ0A 3U36B 4D9QD 3F7VB 2OTPA 4NWTL 4RAVA 1UB6B 1ZHNA 3BJ91 1OSPL 2I25N 3PV7A 4LKCB 3EOTH 3BFOA 4TNVK 2XWBA 1A5FL 1CS6A 5GSVA 3RNKA 3MV7D 4X4ZA 1MVUA 2HTKC 2IADB 4XBPB 4ZXBB 4XXCC 5INCB 5GS0L 2NY0D 3MGOB 3UTTA 3IFLL 3MLWL 3N9GL 4U6YA 5E8EA 5TDOB 4LVNB 1ZA6B 4JB9H 4CDGC 4R4NC 1EHAA 4XPHL 4WW1B 3PGFH 4PTUA 4PJDB 2EC8A 1U91A 3QDJA 3TIEA 3K2UL 3MRFA 3X12A 3NN8A 1UENA 1MWAL 3FOLB 5C0BE 3L3JB 4JAMB 3FRPA 4MDJB 3LMJL 4RBPK 3OKOA 1CZ8H 1IKNA 3VFSA 5GJSH 3WHE1 5K9JH 4X5WA 5FM5M 2BNQE 3BGMA 3KDMA 3RWFA 3B2VL 3B4NA 3Q1SL 4NGHL 4WFHE 3EOAB 3IU3B 1A5FH 5I17B 3MRDB 3L3HA 4P5MA 3VXSA 1N8ZA 1S7UA 4W4NA 1P7QB 2DQFA 2VLRA 3ZTNL 1JFQL 5B3JE 5K9OB 4MXVF 2DYPB 2H2SC 3Q6GH 5D7SH 1EAPA 3MLUL 3MUGA 1Q72L 2J6EA 1K5NB 3DECA 5F8QC 3FRPG 4Y16D 1QEWA 2AKRA 5DRXB 1L9MA 4QT5A 5DJ6B 1GOFA 2PYEB 1FH5L 1EUUA 4NM4H 5JPNB 1MJ7L 3KPLB 1FG9C 2X4TB 5HHPA 1XIWC 5F7MC 3S36L 5B38A 4AT6B 2ZUUA 4HIHB 3LB6D 1N0XL 1SEBB 5I8EA 4UTBH 3HC0B 3TO4D 1UJTA 3PJSA 2Z8RA 5K9JL 1RPQA 1KACB 3BRDA 2PR4L 4PD4K 4LMQE 1CDGA 5E0QA 4KRNA 5IROA 1MFNA 1DUYB 3U9UB 4O4YH 4XMLH 1KEMH 5C86A 2AXHA 1CGUA 3CPLA 5C08D 3FO9A 1PGRB 1BQSA 3EOBA 2X05A 3ZDYF 3AGVA 1L7TH 3SDDA 5CBEB 1HK6A 4Y19E 4G7VL 1A7RH 5I6XC 2H45A 3E6HA 1GAFH 1R3KA 4PRID 4LLWA 4M6ML 4K23H 1KCLA 1HHHA 2I24N 2CRMA 5IBTH 2ZCLL 2IAND 1S7RA 4NM4L 4LDLB 2R0KL 2EDKA 3MOBH 2VXUL 4G42B 4G8FB 4U4BA 3O8XC 4UAOC 5HHVL 3KPRE 5EPMA 4AIOA 1N0XH 3QXWA 4GRLC 2JCCB 4JRYA 5DD5H 1TPXB 4OFYA 2MOVA 5EUKA 2DI8A 2CLZB 3RVWD 4GRWF 1YNLH 1XGRA 3BPLB 5E5RB 1OQOA 4GQPH 4QOKD 3U83A 1WT5A 5HI5D 1NCDL 1RUAL 2YWYA 2Q87A 5INDA 3RWGB 7FABL 3UPRB 3QNXB 4PJAB 1M7DA 3QO0A 4MD5B 4N0RA 5DRZB 3QEQA 2BY2A 2CKNA 2CIKA 1J8HB 2EH8H 3MNWB 2DQGH 1UB5A 4FTVB 3SDXE 5DWUL 5FA3A 1D3CA 3S96B 3UBXG 1KYOK 3LHPL 1GZPA 3D39D 4QCIA 4U1NB 1NCBH 3RGVD 3FCTA 4C83B 1VADA 3FT4A 3ME0A 2OZ4H 2ZCLH 3QAZB 4XTRD 3VD5A 3GSWA 2Z8VC 3K0WA 3OHXA 4Y8AA 3NABL 4IS6A 2AXFB 4PJ9D 4ZTOL 1EO5A 5EU7C 3FAXA 5I30H 3HAEH 3FHAA 5I8CB 2BCKB 3BP5A 3HR5B 1E6JL 4JCMA 3TO2A 5L8LB 2FECI 4U1IA 5IUSA 2FX9L 1NCDH 3W11D 1R3IH 1ZS8B 1ZHLB 5FGBC 1KTKE 4Y4KD 3B5GA 3BPNB 3MRRB 1MFAL 3TA3B 1A6UL 4C57C 3VI4F 3HC3L 3WN5C 5L0QC 3KNBA 5K59F 4YHKH 5AG8A 3DX6B 5C6TL 1NGXB 2E27H 2R39A 4P57A 3IDJB 3QUMA 1T89C 3EJYC 5DD3L 3WN5B 4YAQB 5C2BL 4E9LA 2OZ4L 3ESUF 5FF6B 2DYPD 4NHUB 4UQ3A 4MVBC 5ESVA 1NFIB 2GJZA 3NABH 3F7VA 2D7OA 5DMIH 3ZLQC 4ONHA 1WVZA 3O3AA 4KQ4H 1B9ZA 4XP5L 4CUCA 3AFLA 5CIPA 1PG7X 1IFHL 4OI7A 4A6YA 1A8JH 3F58H 1KCSL 4F3FA 2HTKD 4RFEA 2CH8A 1HSBA 4F7CB 2LU4A 2R0LH 2VAAB 5JNYA 3CXDL 2FX9H 5EH1A 1QEWB 2E6JA 4DWHA 4O2EA 5DEGB 3VXME 3IFPA 4F9PA 3IXAB 3WS6A 3WIFA 3HUJB 2AI0L 4KKAD 1WJ3A 4XBGA 2R56L 4X99A 5BV7L 5FB8B 5DJDA 1FZJA 1G7PA 1QBLH 4KH2A 3TA3C 4IRZH 4PRNA 4Y5VA 1RUQL 4GT7A 1MIEL 2WV3A 3ARBD 4JJ5B 5C2BH 3T3ME 1U8PB 3DROA 1HIML 1C08A 4I2XA 1MCOL 3HHRB 3WD5L 4X5WB 4RFNB 5ETUB 1CT8A 2IBBA 2B39A 2JELH 1EJOH 1OP3K 1YY9C 3OKOB 1H3GA 4L4TE 1INQA 1T7VA 3JXAA 4LGRB 3NTCH 1C8PA 4DFHA 3GI8L 1DEEA 3MMEB 4FQCL 1V7NL 5CGTA 3P0YH 2ZCHH 1I1FB 3U46B 3QDMD 4OZIA 4JREC 4P59L 3Q5TA 1VKXA 3QI9A 5FKPA 2VL5B 3OKNB 2R1XB 5FV1L 1D5IH 4PJEB 1WAAE 1IQDB 3QUZD 2OK0H 4K7FA 4OLEA 3VRJB 5BJTB 4GKNB 5E00B 1NAMB 1NMBH 5IW1B 3I02A 4N8CH 4OZHB 8FABB 4N8PA 4TUJA 1MFCL 2D03H 1I7ZB 3KWWB 1INDH 3I3EA 1KPVA 2XACC 3HI5L 4F33B 1T21A 4O9HL 4X6EB 4JQXC 4QYOB 3WD5H 3EYQD 4DEPC 3BZFB 3MOAL 3SKOA 3ARBA 3QRFM 4XX1G 4C56B 5HSFA 3THML 1KJ3L 3VG0H 3FB5B 2EDHA 1KB5H 4X4YB 1A6AA 5KANG 2A73B 3IDMB 4LSQL 1AGCA 1CE6A 1IGYB 1NAKH 4Y5XB 4IHOA 1FPTH 3NZ8A 3GUTB 2PUQT 3RWCB 1N3NA 4MA1B 1FO0H 2Q3AA 1J0YA 2HG5B 3QXDB 5FFLA 3MACH 4Z7OE 3C8DA 3VFPB 3DXAE 3NFNB 1NMBL 3VFSB 5T3XL 5C0FA 1MFCH 4RQQB 4LCUA 4QHUA 1INDL 4PJEF 4LLUB 1J9CT 3HI5H 3KYKH 3MUZ1 1ONQB 4WTWA 2V5RA 5F1NB 4X6DF 3E6FA 1IC4L 4JHAH 4JO3L 4OZHF 5TE7H 4RGOH 3CCHB 1YEDB 1PEWA 2ATPB 4LPCA 5E8EB 1WBZB 4JHWL 1A7NH 5L8JB 1S7QB 4L4TA 4X7CC 3WNLA 1GGCL 5DT1H 4KWUA 3N1GC 1T2XA 3EO1A 3PP3K 1NEZB 1I1AA 2BK8A 3D39A 2ESVA 1DTUA 5H94A 5D8JL 2XN9D 3MRGB 4HXBH 4RFEB 1KB9J 2D7PA 2V2XA 3T3PE 3FQNB 2VQTA 2PTTB 2QJDA 1FVCB 3QB7C 4XTRC 2XYCA 1FG2A 5K93A 2VLKA 2W91A 4H1LG 4JO2H 4P46B 4BSVA 3WFZA 1YEFL 4R6UA 5IR1A 3MRJB 2VLJE 1FYHB 2CDGB 4LDEB 4PJ5A 3VG9C 3DYMA 4KK5D 3G08B 2Z92A 3WEXB 5KW9H 1IC4H 2AJZB 5HD8C 5LXGH 5KN5B 4U1GB 3ELAT 3T0EE 1KFAH 5K59E 1N6UA 1U8KA 1UG9A 2H8PB 4JHWH 4OKDA 3TVMB 2PYEE 1A7NL 5I1KL 1CT8B 3LZFL 3QFJB 3GSQB 3V5HA 4U0QB 3QPQC 3ZSTA 5TJWK 2A6KA 1VFAB 2FGWL 3L5IA 1FSKB 1FC2D 3BQUD 4HXAL 2C3WA 5T1DL 4HV8B 3BP5B 3QWRA 5TFSL 4S1SL 2B4CC 1JF1B 4PLJD 1XR9A 3MRLB 3TP4A 4YDIL 4H0HB 2NMSA 5ADOL 3ILPB 1LEIA 2VLJD 1QSED 3IVKB 4N8VB 1KXQE 3SCMC 1YEFH 1MHEB 1C16A 2AEIT 1AHWA 4GG6E 1IQWH 4NCC2 4PJGB 1PQZB 2BNUB 2VR9A 1D6VH 2NTFA 4P46C 2JJTC 5KW9L 3C8KB 1HSBB 1A02N 1GSMA 2VN4A 2CMRL 1R3JB 5HYFA 3GSXB 3PDDA 3PWNB 4X7TB 2VDQL 4R97C 1D6EB 2AVGA 2X5PA 4YDKH 3PL6D 4XP1L 3PHQB 4FTVD 3BPOC 4P3CL 4QYOA 2XKUA 4AMKL 2VH5H 5DD6B 4MNHB 2CKBA 1KYOJ 4OCNC 3GJFB 4JHZA 4HXAH 1FNLA 1TETH 3ZHDA 2XZAH 1RFDL 1HHGA 2Y1VA 4Q9QL 1U8LB 2GTZA 3DUHA 5FYJL 2WQRA 1JZ5A 4NNYB 3V5KA 5ADOH 1KCRH 3TA3A 3JV6B 3NPZB 5E2JA 4CU7A 3IDJA 4M5ZL 2VLJA 4JZOA 3FO0H 3RHWK 4EBQH 5IVXE 4D9LH 3D85A 3ALPA 4X6BA 1J87A 4P5KB 2D7TH 3F62A 3IYLW 3QBTB 2DL2A 5BRZE 1T7ZA 1IC5H 4JFPA 4LLVB 1CE1H 2EDYA 2XZQH 2DQUH 1J1PH 1I7TB 1RK1A 3O3DB 5FHAH 1YPZE 5EIIB 2CLRA 4BYHA 2D7MA 5I1LB 4Q2ZA 5HDBE 4L9LC 4P2RA 3G5YA 2M2DA 3STLA 3FHQA 5DYOB 5FYJH 5B39A 1PZUB 3BO8B 3KS0H 1E4WH 3MR9B 3QA3A 3HUJA 4YBQC 4DVBA 4PJBF 1NDGB 3IXAA 4LLQB 1MCLA 4JFDD 4NOBA 4RA0C 4KK5C 5CGMA 1JNJA 1A7PL 4M6NL 4YZFE 1YNKH 2ZOKB 1YC8A 3V4VL 1D5ZA 4P2CG 4GKSA 5GGRB 3FO0L 3QQNA 4JFYB 4ODWB 2AEWA 1OAKL 3FN3A 4NM8L 4NIKB 3LH2L 4U1LA 3O4LD 2BFVL 1S5IH 2RFXA 2YBRA 5HHQA 1K8DA 1AGFB 5HPOA 4JFDA 2NY7H 2HT4D 4WI2A 3GMOB 2V5TA 4I0PB 5AUMA 3QHFH 5C0RH 1CE1L 4NUJA 2HTLC 1T66D 2GITB 5B39G 1NSNH 3UJIH 4BQBA 4JDZA 4XRCA 4BH7B 5KSAA 4OCRL 5CJOL 2UZYB 5GRXG 1F3JA 2ORBL 4J4PC 4ACPA 3LS4H 3VFTA 5JORA 3LN5A 4WWID 1U9KA 1YEGH 3MXVL 3QUZB 2ZP0T 4WFEE 3F7RA 4S10A 4DKFH 2IALA 3I2CL 3TIDB 3HRPA 2LTQC 3H3KA 2UV3A 5JUEH 3MBEC 2VKWA 2YXMA 3U7YH 1J0KA 5KVFL 1YNKL 2A6KB 3GNML 5C0BA 3MRFB 2BXYA 4BH8B 4NBZB 4GAJL 5J9PA 2AV7A 4NQVB 1G7MB 4PJBB 3MBEB 5F7WC 1S5IL 1W72B 5CP3A 1ZSDA 5HI3C 2IANA 4KAQH 5FDWA 1KELL 4WJ5B 2X10A 1R5WB 5L6YL 3T0EB 1T03L 3UJJH 1NSNL 2XTJC 3VXSE 3MV7E 4J3UA 3RBGA 3SKJL 4DW2H 1ZGLA 1CGTA 2HVJA 1I1AC 2IQ9L 3MBXH 2C4FU 3ARRA 5TQ2L 2QV2A 3OMZA 4J3SA 5D7JA 1YA5A 1AQKL 3FMGH 5JXEA 2AK4A 2G60H 1M71A 3HA0A 2F53E 4HUMB 4NNPL 5IB2B 2EDQA 4YHLL 2A9ML 2IJ0C 3MLYL 5KOMC 5DD6A 1WAAF 4HS3A 3U7YL 1YEJL 3GNMH 2JK5A 1AGBB 3PHQA 25C8H 5TF1L 3RX7A 1F2QA 5EBLB 4O2FA 3ZT5A 5MHSD 5EO0A 1K8IB 4NQSB 3T8XB 4FQHB 3LY6A 5LGHH 1TVHB 3HPJA 4GUPB 2AK1H 4G6AD 4KKCD 3UJJL 2DLEA 1JGUL 4MDJA 4K2UH 3QEGH 2BERA 4X8JA 4HV8A 5KBNC 3VI3F 1AI1H 2KDGA 3SKJH 3WIHL 4QHUB 4Y1AE 3CFKB 2HJFA 3TN0D 3MLTB 4EI6A 4ORZC 4CVXA 2DI9A 3BP4A 1JF1A 2ADFL 1NBQA 3BUTA 5D7LA 3QCTL 4N0CC 4ISVB 2AS5M 4QRPB 4OM1H 2Z92B 1URLA 5HGDA 1BP3B 1MCPL 2R69L 3ECBA 1RZIB 1TIUA 4U6TA 4ZFOA 4XNMB 5CEZE 4P46A 5FYKH 4N8VG 1AY1L 4TPRL 5C0GB 3OKKA 1OAZL 2H2PD 4LP5A 3O2DH 3QWQB 4K2UL 1FV1A 2CJUL 4Y4HA 5BRZA 3REWB 4EI5C 4FRWA 1BECA 4MSWB 4PJ7B 4U1MA 5IESL 5CSZA 1EFXB 5GSRA 1G9MC 1NCCH 1YN7B 2A2QT 3TYFB 5E2WL 1J8HD 1YPZA 1C5DA 1KT2A 1JP5A 5KVGH 1CGXA 4CBPA 1YYLL 1OL0A 2PO6D 3UTZB 4Z7VE 3GIVB 4UINH 1JHKH 1QA9A 4KROD 1YEDA 3H9SD 3OAUL 1YC7A 2ADGB 3N85H 4OV6F 1N8ZB 1S7UB 1Z9OA 3G9VA 4WFFE 4LF3A 1SY6L 2YMXL 4OM1L 3O0RL 5MEOA 3M17B 2JE8A 4M7KH 4WY7L 4H5SA 2VDMH 3RWFB 1IJ9A 1QPPA 5D1ZB 5EOTB 4RFNC 3U82B 5EA0H 3QZWB 1JPFB 1CFBA 3G6DH 2J12B 3VA6A 1KV3A 3P0VL 3WDHA 5I1HL 4UQ2A 4EOWH 5JZ7C 5D1ZC 3VFVA 1CK0L 3PL6C 2V5MA 1SEQL 4XP4H 5FM5O 3BYTA 5TDNA 1I4FA 1V3LA 4JN1L 2V6HA 2VTFA 4NO5A 2QQNL 5SX4I 1XIWD 3F12B 1DLHA 3MNZB 4F7TA 1QBAA 3GJFH 4HKBB 4WWKA 4KJYA 1U3ZA 1FIGL 2I60H 1W8OA 2GT9B 2VZUA 4RDQF 3RIAK 5H37H 2SEBA 5F3HA 3LRSA 2IBZY 3BRGC 1OF2B 4UINL 2ARJA 3KHQA 2W59A 4PJIA 1F97A 3RNKB 2B0SL 2PCPB 3H8NA 3D18B 1IM9B 4CN4A 3DURA 5DRWB 2I26N 4CN6A 4ZTPL 4ZUVA 3WSQL 4WY7H 5J3HD 2F58L 3RWEA 3JUZA 5I1AA 3WNKA 4Q74A 2DMKA 2VIRA 1CICD 1II4E 3L3GA 1ZLSH 4FNLH 1QRNB 1BWWA 3N1QC 3CC5A 1OPGH 1XCQA 2B7DT 3D48R 1ED3A 1CD0A 2DMCA 3P0VH 2XQYK 1SEQH 1MJJB 1J10A 2NLJA 3UTPD 1DVFD 3GI9H 3G6JE 2UUDK 4YHYC 1WTGT 2PTUA 3P40A 3SJVE 2R1YB 2Y07L 4YHNB 4IMKA 4ODUA 3W2DH 3DETD 4PS4H 4BH8A 4YBQD 4OIAA 4KRPD 4OKVB 1MH5A 4HDIB 5EZJA 4G8GA 2CK0L 1OP9A 4PY8I 2NW3B 2APFA 4ZPVB 5GISH 3BWUC 3EBAA 1IL1B 5ADPL 3WSQH 1KENL 4G8IA 2O5YL 2A83A 4U1SB 4LHUD 5SWQB 5FKAA 5E4IA 3CGTA 3T65A 4FNLL 1DDHA 1VEOA 2X4RA 3V4PL 2NYYD 1GHFL 4L3CA 3ARFB 3IDIA 4FXGA 3UJTL 5E4EB 4R2GC 3VH8B 5GHWL 3FT4B 5ICZA 4NT6B 5KVEL 5HI4D 4TVPD 3GI9L 3KLAA 3TFKC 3QJHB 1QD0A 3A6CH 1HKFA 3MPCA 4XBGB 3ARDA 4XMPH 3QDGD 3SGKA 1KN2H 4Y1AA 2VDLL 4I13B 2NXYC 4WI3A 3ULVD 4JDTL 4XGZB 2VAAA 1UJ3B 3B6SB 4S2SA 4I8DA 2QSQA 4Y4HB 5F44A 5I1JL 5D9SA 4CVWA 1YEKL 2O93L 4QXGH 1QVOB 3O81A 1TNNA 4Y16C 4X0KA 3FQWB 4CADA 5GISL 2CLZA 5T5FH 1JPTH 2E7MA 5ADPH 4IIQC 1MY7A 4LSSL 4M9OA 5B22A 3RJDA 5FDWB 2ZSWB 5CAYB 3J7HA 4G42A 4G8FA 3VD3A 1P4IH 3UJTH 3U0PB 1ZAGA 3QQ4A 4RZCB 2NY5C 1JZ2A 1N2RA 1ZHLA 1FE8H 1T0MA 1J1OH 3OGCA 4J6RL 4LASH 2XTJD 4R2GB 5CCKH 4YHIA 2DDQL 4JRXD 5HYJE 2YZ1A 3D25B 5L2KA 3BJLA 2OL3A 1G6RB 3W9EA 2VDLH 4LCIH 1G7HB 3MLTA 1JZ4A 1EHLH 1ZWIA 2FHFA 2X89D 3O9WC 4HC1H 5MEPB 3SGEI 3OHXB 4Z8FH 3C6SB 3MNVA 4P48A 4M62L 1NANI 5A16B 1G6RH 5DUBB 3VU2A 3ZE0E 1YEKH 2XQYG 1CYGA 3W5NA 5T5FL 2X44D 5F1SA 4IIQB 3OSKA 2QSTA 4XWOD 5DVKA 5DTFA 3UTSE 3UBXA 5KSVA 1NGWB 1K8IA 5CJ8A 4NN7B 1P1ZA 4FP8H 5DEGA 2VJXA 2X70A 3F65A 1Q38A 1U2CA 3IJYB 4YHML 1I7RA 4TUOB 2CO7B 2YHGA 1FE8L 4J6RH 3U79A 4P3WA 1VB9A 5CCKL 3CMOH 3HFMH 3LB6C 4HK3J 3TT1H 2P42B 5T3XE 1FL5A 2WBJA 3KPOA 4FQIH 5GRUH 2EO1A 5FF6A 3LIZL 4ELMF 3VDCA 3FN0L 4GSDL 1LE5A 1NFDA 5BS0D 3SDAC 4DOHE 3LKSB 1N5AB 4KJQD 1T04A 2W9EL 3LEYH 5FUOL 4BUHA 4WUUE 3W0WB 1QSFB 4RFOH 5J1AA 5BQ7B 1A3RL 4JR9H 5C09A 5IV2A 3DMMC 4FQ1L 5DUPH 2ICWA 1LVEA 1YMHB 2ICWJ 3BGFC 3B9EA 4G9FB 1N26A 3CK0H 3GMQA 2HN7B 3LRGA 4W81A 2P43B 2UY7A 5F7DA 1OLLA 1UACH 4NQEE 1NCWL 4N9OB 4YR6B 4KZDL 4EN3C 3HFML 3KPPB 3TZVC 3ROOA 2P7TA 5HYJA 3DX7B 5ILTL 3A6BL 1EEZB 4I77L 5BO1H 5LJYH 2HFEA 5IEKA 3SJVA 1GGBL 4WHDA 1MI5B 4NZJA 1IAKB 4P9HC 2HJLB 1L9NA 5FYLE 2VLLB 4HH8A 1K4CA 3C5JB 4Z78A 4P4KD 1KPUB 4JZJA 4UT7H 1WBXB 1CIUA 3L3GB 3BHBB 1P4LA 4ETYA 4ZUVB 5A1AA 1S78C 1T1YB 1Z5LB 4I9WE 4OF8A 3RY4A 1QSFD 3QIBB 4OBSA 1XF3B 5ID1B 2J88H 1N59A 1AJ7H 3GSNB 2OLDA 5GZOC 1S9XA 2DTML 1H8SA 3G6AB 4OLYL 1IMHC 2VMFA 5BS0B 4ELKB 2ATPA 1NL0L 4NO2B 4HKBA 3BN9C 1HH9A 3O45A 3ABZA 3PQYE 2J7LA 2XI9A 5F1NA 3HNTH 1SM3H 1CL7I 2C3VB 2J4WL 2JJVA 5H2BA 3ARFA 4FXGB 4N8VA 3E0GA 4AQ1B 3MODL 4HKZA 5EZJB 4FZEL 4N1HB 1ZWIB 5MEPA 4OD3H 4GRMB 3S88H 3KPNA 1H3PH 3HI6L 5E9DB 1EBPA 2W0FB 1T80A 2X2YA 2VB5A 3A6OA 1IGJB 2Z31C 4RA3A 1CXHA 1FGVH 2DQJL 4LSPH 1LEKB 3W0WE 3C08L 5EOCH 35C8H 4EKXA 1E4KA 4NZUH 5F7EH 4YBHA 5LWYL 2JB5L 3UEZA 2DTMH 3MYJA 1SJEB 4KRLB 4MD0A 2XG5A 3MLVL 1NL0H 3F7YB 1U8LA 2GTZB 5HHOD 1MCSA 4XWOC 1UGNA 4X6CB 3SGKC 4E42A 1EH9A 3TBYB 3LPGA 3S35X 4IOSD 5IF0A 1A14L 4YUEL 4OD1L 4S2SB 5C3TA 1S9YB 4PTTA 3NZHH 3V6ZA 4MX7B 3MV9B 2OQJA 4JDVB 1XZ0A 1YQVH 2IPTL 4GG8A 1XMWA 2BVQA 2VNCA 4S1QL 4ZSOE 1I1AB 4L29A 2ERJB 2FSEA 4Y4FB 2BNUA 3LOWA 3PWVA 4LSPL 4PLNC 1HNFA 3ZYOA 2DQEH 4GW1A 4GRWH 4YHPB 3R06B 3CX5J 2XV6B 4EN3D 3A67H 2RBLA 3O11A 1HYRC 3VW3H 1FBIH 4UIMA 3QYCA 1ITBB 1K3ZA 4YXHL 1C7TA 1S5HB 2FNBA 5E56A 4Z0XB 5I1IL 1T2JA 1A14H 2DMBA 3NZ8B 5B8CA 5D7LD 3MV11 3N1FC 1QLRA 3MFFB 5I71C 3BUYB 3RUGB 4DJMA 2A73A 1U8KB 5LCVH 3IDYC 1NGPL 1HINH 4YPJA 2A6DA 2F54D 4S1QH 2DM3A 1R6VA 1U58A 3O4LB 3DRTB 4LARH 2E8YA 3LQMA 2R8SL 4MAYD 3ZO0A 2NW2B 2Z4QA 3WXVL 5SX4H 4LEXH 4G6FD 1J1XH 4G6KH 3AC0A 4FA8A 3VD7A 3WLWC 3OKYA 3HCVB 3F7PC 3H0TA 1IAIM 4GOSA 2X4UB 3GMLA 3X3GH 1OQXA 2YN3A 4KTYA 3PGCB 3S34H 4HX1A 5IM7B 3VMPA 2IFFH 3B5TA 3UTSA 1FQ9C 1I9IL 2Z35A 2J8UF 4TSCH 5BVJB 4WDIA 2VXSH 2WBJC 5C07E 3ZYIA 4X6CA 1RUML 1PZ5B 4U6XB 4L4TB 2UVEA 4I3RL 3F7YA 3MROB 2G5RA 4IM8A 5ALCL 2X1WL 5FGRA 1MCWM 2YPKB 2Y5TB 4K7PH 4OFKA 3BIBX 5E5UB 4D8PB 1QFOA 1J5OL 4I5BB 5J13C 4AL8H 3T2QA 2OP4L 3SDAA 4MMXC 2PN5A 1CTOA 4NZRL 4H1LA 3KPSD 5C0BB 2EDEA 4E0RA 4YC2B 3O6FC 5DHXB 1D5MA 4OCWH 3KPNB 5GQBA 1KIRA 4H8WC 1MRCH 3H9HB 4FHBD 2HT2C 4QTHB 5DJXB 4OQ1A 3WHE0 2VZ1A 5SWZE 5KOVC 1YY9D 1LK3L 3R06A 1IZKA 2MKLC 3UTTD 5IGXH 2IMNA 3ESVF 4M6OH 3S35H 4NQCD 4ZO8A 4HBCH 4JPIA 2P49B 4IEFB 4I3RH 2WBJB 3KPOB 1RZ7H 1JHTB 1WWBX 3GRWA 5HHQB 4YDVA 4LVHB 3D69B 1FHGA 1JI2A 4JKWA 3O6LL 2IH3A 4K8RL 1MIMH 2F5BL 4Q58C 3K4AA 4Z7WA 1UWEL 1Q9OB 1VACA 2ADJB 2EZ0C 3FQRA 1GGTA 5D71H 3X13A 4E42B 3VFGH 3B9DA 3DVFA 5D6CA 3U4EB 5EUKB 5ESQB 1MQKH 4AZ8A 3MR9A 4PJCF 4RGND 2FL5A 4XXDA 2JCCA 3DX6A 2GSIB 2BHZA 4N0UE 1ZSDB 5CD5C 4EVNB 4Z5RB 1FN4B 5JA8B 5A2IH 4KROC 5AG9A 5IGXL 2EXYC 1JHLL 3FQTB 5JW4R 3JBG7 4HKXB 2H6PA 2MKWA 2M1KA 5L7XL 1F3DJ 1NGXA 2AJSH 2KZWA 4XVJL 5IG7A 5JOFB 5BS0E 4TQEL 2K7QA 5CLWA 3I3DA 4AH2B 1IBGL 5L2JB 2HKFL 3B2UD 4PJEE 3IB4A 1F5WA 3FO9B 3VA2C 1X44A 1DSFL 3PDOA 3EFDH 3M8OH 2NY2B 3HE6D 3WUWB 5IIEB 4P46D 1IT9H 3V5KB 4F9LA 1U3JA 1IGML 3ULSB 3RDTB 3T8XA 1NBYA 1NFDB 2QHRH 5EU3B 3CH1B 3RL1A 4EEEA 5EO0B 3UMTA 2RCSL 4FZ8H 4MVBD 5ITBL 4MAUH 3S36X 3ARTA 1MEXH 3FRUB 3OX8A 3VXTA 1IVLA 4GH7B 5FYJE 1WTLA 1AE6H 3BQUB 4PJCB 5DRXA 1G7JB 5L7XH 3V79C 4APQB 3FN9A 5IEHA 2ZZUT 5JPMB 3W11C 1HDMA 1OGAD 1HZHH 4YGAB 3MUGB 1C1EH 4OZ4B 1CDJA 4FFZH 3U6RB 5F9OL 3C2AH 3ULVH 4K94C 5FOBB 1NFIA 5MEQA 1UEYA 3NH7H 4XBEL 5EPMB 4L4VD 3PHOA 3L5HA 1KIQB 3EJZC 4Z7UE 4MZ3A 4OFYD 3HI1A 4BQCA 5I8OH 1NDGA 2A6JA 4PY7B 5CWSA 4X83A 4HUXA 2GJJA 5IEKB 1TZGL 2FBJL 1OAUH 4N1EA 3CVHH 4JN2A 4PRDB 5CGYC 1BX2B 4L8BA 4HFUH 5C0CB 4ZSOA 2JCCE 3D85B 5GS1C 2AJXL 2B4CH 1MEXL 1L7IL 1UADC 4PRPE 2WWMD 1LD9A 1Y0LA 3TO2B 4HJGA 3WFCH 4UB0H 2NY3C 5DD0L 1ZK9A 4P2OB 2YKLH 5FEBA 3TIDA 5CEYB 1CG9B 4WHTA 1R0AL 1BQLL 2NZIA 4PP2B 1FFOA 3BDXA 4G9DA 2R0ZL 5DC4B 5ACLA 1J0ZA 1M1SA 5JPNA 3RUGE 3P9MB 5ALBL 4XPHH 1QRNA 3EYUH 4M8QB 4JO4H 1QZ1A 3T3MF 3PGCA 4JFEE 3UROR 3O9WB 2VIRB 3GMLB 1MWAB 3HB3D 2X4TA 5EZOL 3EO9L 1ZT7B 1EMTH 1MWAH 1INEL 1A6VH 4DAGL 1SYVB 2I9LA 4OB5H 4PRAB 2EIDA 2EDNA 5DD1L 3B9AA 4J7RA 3CZFA 3OX8B 4N9GA 4F7PA 4ONGL 3LV3B 4K94H 4JEGB 2YKLL 4U1GC 4A2MA 2Z8WC 4LLAA 4ZXBC 1S7VA 3CCHA 2UZIH 3NCBB 3MUY1 3GB7A 3O3BB 3VXUD 3ZTNH 4N5ED 4V2BA 3JWDL 3V0WL 2ITCB 2R0ZH 3KYOB 4F15C 1KPRB 2L4OA 3VWKC 4L3CB 1AGDB 4D0DA 3T65B 1C5BL 2KZ1B 4JO4L 5ENWA 3NCEB 1E27B 1WGOA 5IMLA 2MWCA 1MFBH 3EO9H 2HG5A 3QXDA 2FX7H 1R5IB 1QHOA 4P23B 1C7SA 1E28A 1S7WA 3HAEB 4OB5L 5TQ0L 5C0EB 3FB7A 2IPKA 4Y5XA 1OCWL 5FO9A 4Q6IA 3ZKMD 5D1XA 1Z9LA 3BEWB 4NN6B 2R1YA 1VCAA 4ZFFA 1MCRA 3OV6A 4XMLL 4WGVB 3QEUA 5A2KH 3CC5B 4HZLA 1FO0B 2QKIA 1YNTB 3OKLA 5KN5A 4HX1B 1BLNA 2CO6B 1PLGL 1PZ5A 1T3FB 1GGIL 1X5ZA 3QG7H 4R90H 3P11H 5AD0A 3MA9H 5TPWL 1ZT4A 4RMVA 3BMVA 3D2UB 1GAFL 3O3EB 4Y2DC 4PP1C 1DUZA 3EYOB 4Q9RL 4HMCA 2D4DA 1IEAA 3O6FD 2ARJB 5IW1A 1CF8L 1DVFB 5F3HB 3LKPA 1OGAE 1S8DB 4UAOB 1MFBL 1RMFH 4XP9H 2X9XA 3PIQB 4F7TB 4X7FC 5CILL 4GG6B 5HHVH 3MFFA 5EB9A 4Z7WE 3V5DB 3LRSB 5E8OA 5T5NG 2CR6A 1EZVY 4YXKH 4KMTH 1SYSA 1DDHB 5C6WH 5JO5A 4R96A 4TSAH 2P8PA 3CSYA 3IKKA 1JNLH 3M17A 1FVEA 5IK3A 3TCXA 2V2WA 1I85C 3O8XD 2Q8AL 4PJ5D 4WUUB 4Q9RH 3QZWA 5B21A 1QUNA 3QPXL 4UV7L 3UTSD 3LHPH 5JDJA 2H8PA 4FQJH 1QA9B 4NN5C 4XCNB 1V7MH 3S5LB 1N3NB 1RMFL 4JKLA 3BH9B 3WIHA 5SWZB 4S1DC 3T0EC 3KPTA 4ZTOH 1NAML 4OCXL 3QJFA 4QOKB 1KPVB 4KKCC 3VCLA 5IFHL 4KI5F 2FEDC 2Q86B 4UOJA 1E6JH 5F1OB 4PGEA 3SGEH 3MXWH 3I02B 3GHBL 1ULVA 3WJLA 1FO0A 2CD0A 3VRJA 1JYNA 1JNHB 4E41D 5JHDB 1L6XA 5EULV 3VXQA 1H3VA 2DB8A 4LRNL 4Y19B 4E41E 3ZKXC 1B0GA 4PJIB 3RKDD 5DK2B 5I76B 1QTYT 1OAYH 3VFMB 2XA3A 1OF2A 4UV7H 2R15A 3VE0B 3RGVB 4H8WL 4WUUD 1P4BL 3VXNA 1BFTA 2YUWA 3IFNL 3QRGH 5L88H 3F8UB 4M61B 1R5VA 1BPVA 4QWWC 1YQ2A 5ETUA 3W39A 3QDHA 1P7KB 3IDGA 1Y0LB 1LD9B 3U46A 1HXMB 3GMRB 5EC2B 5E03A 2DM2A 1JL8A 2BNRA 1IFHH 3KYMA 3V52L 4PRHD 3SE3C 1A4KB 4WNQB 1UH3A 3VWKD 3C60C 3QHTC 4U1HB 4V2CB 1YYML 1PSKL 5HXMA 2AW2A 2BSTA 2PTVA 3OR6A 4JM4H 1RULL 4NKDB 5IFJB 4JKKA 2A77L 4E5XB 4XPAH 3FONB 3CUPB 4L4JA 4UV4L 4WW2A 2ZWLT 3SE8L 1EO8L 3QEQE 3RNQB 1BQHG 4KXZH 4PJFB 3TN0B 3G5XA 1CR9L 3WFBL 1SYVA 2I9LB 3MC0A 1FYTE 1YJDC 3BEVA 4YX2L 3WXWL 1ZT7A 1JBJA 3GSNA 1BBDL 1I9RH 2WBWB 2Y06L 4LAQL 4PJHF 1HIMH 2FZ3A 2Y5EA 5CZXC 4HK0A 4PJIF 1QACA 1U42A 4NRZB 1FZOB 1ODAA 1QFWI 3NPSC 4PRAA 1WFOA 5E8PA 1Q94B 2Q7YA 5C7XH 3GK8H 1LO0L 3LKRB 3QDMA 2JIXB 3FB8A 1NC4A 4KKLC 3EDDA 1B2WH 3V52H 1D9KD 3DTXA 5K9KB 3FOMB 4FQCH 2XXCB 4X4XA 1AFVL 3N06B 3BDYH 4CMMA 3DX7A 3AXLB 3V7AE 2VE6A 4JM4L 1UYWH 4EXPX 1BQHA 2YUVA 3IAGC 3R0MA 4P2RB 4YHZH 1LO4H 1G7MA 4UV4H 4JLRB 2OK0L 4G9DB 3INUL 5BZWB 1JV5B 1JRHL 3RVUD 1EVTC 2EKSB 3FKUS 3T0BA 2A0LD 3TGXA 3WFHA 3HMWL 4JO1L 3SQOL 4X6BB 1AXIB 3LQAH 2PXYA 3IU4H 3LEXA 2W1NA 2FEEL 1PVHA 5D7LE 4WU5A 4JY4A 3L9RB 1LDPL 4RWYL 3MRNA 1OGAA 1YMMD 3MLPA 5ID0B 4DGYH 2WUBH 3TYGH 2X4PA 4Y5XC 3QUZA 1QLEL 3T3PF 4KKAC 3VFTB 1W0YT 3BDYL 4IS6B 2D4FA 2HH0H 1SJXA 43CAB 4JFFE 2DQDL 5JOPE 4H20H 3MJ9L 3RWJA 3LV3A 5DJ8A 2BY3A 4LSTL 4GMSH 1TZIB 5E2UL 2QQLL 5FYKU 1YY8A 3KGRA 2Q8BL 4HWNA 4F8QA 4LLQA 4OIIL 4JG1L 1F42A 3SY0B 2DM4A 4HUWA 1R3JA 5HDLA 4OZGB 4DVBB 3HMWH 4JO1H 3NCFB 2NZ9C 3B9KD 3UPRA 2YUXA 4CVZB 1JCKA 4G7YL 1Z2KA 3KYKL 4YE4L 5GGRA 1NH6A 5HHXH 2KH2B 4PJFA 2P5WB 2FATH 5SV3A 5T1MA 5F9WC 4JO3H 4GXVL 1TFHA 4P49A 3UXFA 2E6QA 2YA2A 3SDDD 2XFXA 3DUUB 3KPMA 1N6VA 3MV8D 2G2RA 5DJCB 1BJ1H 4NKIL 4PP2A 2YC1B 1QSZA 5DUMH 1GGCH 5DT1L 4XNQB 3U7WH 4DGVH 2HH0L 4NOFA 2BNQD 4B50A 2JJSC 4H20L 3VRIA 4C58B 1RVFL 5DHYA 3DARA 4K3GA 5FO8A 3NN8B 3MRKA 5F96L 5F1KC 2QQLH 3VXRA 4U6HB 3BAEL 2NTSP 2HLFC 5T3ZE 4XMKL 4PJ9C 4JO2L 1F45A 1RJYB 2IALB 3VGEA 3I6LE 3LKSA 1U8OB 3G04A 4LHUA 3RU8H 4LSVL 5HHXL 4CRPA 5GS0H 2DKSA 2FATL 4GXVH 4UILL 3GSOB 2NY1B 4UDTB 4OZGF 2ZUVA 4TSBL 1EK3A 1M7XA 3CFCH 1U2HA 1JNHA 1GIGH 3IKCB 5JHDA 3V7AG 3PJSB 3LZFH 3KLHC 4HPOH 3ULUE 2X9WA 4MHHG 1KULA 1TCRA 2GUOB 5DC0A 4PJXF 3KPLA 1FNSH 2VZVA 4PJAA 1RJCA 5T1DH 4PV8B 5GJSL 5I1EH 2YZ8A 1PAMA 5CJQL 1WCBA 3S37L 1BGXH 4G6JH 2XN9E 2C4FT 5D1QC 1BVZA 4YDIH 3RWJB 4XMKH 2JIXD 5DK0A 3HG1D 1F90L 1PX3A 2Z91B 1WIOA 3V0VB 1XGQB 3H9HA 3OWEA 3PXJA 4KJYB 1E4JA 4U7SA 4OGYL 3F7QA 3MLUH 4OD2A 3FTGA 2BNRB 5J1TC 1VFAA 4NKDA 2W65B 2VDQH 1BOYA 1N64L 2DBLL 4YDKL 3DGGA 1CIDA 4GAYA 2HRPH 2EXYD 1BJ1J 1MELA 4K7PY 4QRQA 5HVHC 1OHQA 4U05A 4JFQA 2HTLD 1CN4A 2LV4A 3QIWD 4JVUA 2FJHA 4PBWD 5GGTA 3DIFB 2PR4H 3H9SA 3QDJE 1X5KA 3QIBD 3MREA 3ZT7A 2FSEB 2HJKA 4Y4FA 2H1PL 3U7AA 3PIQA 1YDPB 3GIVA 3NAAH 4ZQKB 3UC0L 1ED3B 1H15A 4R0LC 4POZC 1F90H 5HHNA 1L7TL 3L3KA 3Q6FB 5SWZD 2P48B 3EYVB 3ARGA 1A7RL 5JQ6L 5DA4A 3HE7C 1LO3L 1F6AA 4PJ8B 4BKLA 5IVXA 1NEUA 3GMMB 2YSSA 4F33A 2D7TL 4MNHA 1UZ8A 3RRQA 3IAQA 5C0GA 2DBLH 2V7NB 1OTTD 1CXKA 1RIVH 5F89B 2XZQL 5GS0C 5KVDL 2K1MA 3MOBL 4DZBA 4YFDB 3C60D 4J3OC 3JUYA 3BIAX 1QO3A 4KI5D 2ESVB 1HQRA 2Z4QB 2NW2A 4U6VH 2H2PC 5E1AB 4ZAKB 4ZG1A 5EN2A 5B3NA 3BD5A 1F8TH 4ZFGH 3S7GA 1A9BA 4E5XA 1INQB 5F7YC 4CVXB 4Z7QE 1LO3H 2XY1A 5SWSE 4NM8H 4XCFH 4L3ED 5CMAA 3WJLC 4AM0A 2EH8L 5GJTL 2OZ4A 3LQAC 4MGXA 4PGDB 4YLQT 4LF3B 4PG2C 3CDCA 4AEHH 5HJ3B 4QKXB 3D2UD 2F53D 4I2XE 5IFAL 3BP6B 3UJIL 2WWMC 2LFGA 3RI5K 5MEOB 3OKMB 3IFPB 4HS6B 2ORBH 4OLUH 2BVOA 4Y5VC 5DDHB 1LHZA 4XHJC 1BIIA 4HS3B 5I30L 2XWTA 3KPQA 4XPGL 3K80A 4G5ZL 4PV8A 2JLLA 5IB2A 2BOCA 5I16B 2Y25A 3OKKB 5JUEL 3SO3B 4TUJB 2ICEA 3PWJA 1T1XB 2A0LC 5KVFH 4N0FA 5BVPL 3TESA 1FDLL 1Y6NR 3S4SG 3UAJC 3QIUC 4ZQKA 4NJAH 3L7EA 3DURB 2IAMB 4AYFA 4R4ND 5IVXB 1PFCA 3L3KB 3AM8C 3Q6FA 1QR4A 1VFBB 1OARL 2DLFH 2CXKA 3F5WB 2IH1B 2IAMC 4LGPB 1RK0A 4WFFD 3RVTC 4LHJB 3TBVA 2HT3C 2Z31B 1QBMH 2VQ1B 1AH1A 4HHAA 4HUUA 4JY5H 5D7JD 3DWTA 1EFQA 3PWLB 1VKXB 4NO0A 4OGZA 6CGTA 4QRUA 4U6HA 3DMMB 3WE6B 1JGEB 2P47B 1MUJB 4LK4A 1UM5L 4CJ0A 4D3CL 2DF3A 1KCSH 4UQ2B 4OD2B 5HI3D 4JFQB 2G60L 1IZJA 3UTQB 2VL4A 4TTGA 3UPAA 4RMRA 2EDFA 2B8OT 4G43B 3LEVH 1X5JA 1FNFA 3HZMB 3P4MB 3IJSB 4ZUTA 4MAYA 3O4LE 4DK6A 1JGVH 5B4MD 3VFRB 1KIQA 4QRRB 5K33A 1I8IA 3OKDB 4HUNB 3HMXH 4V1DB 5MERA 4Y4KC 3V6FA 5EUOB 1IKFH 1OB1A 5EBMB 1QBML 4UMGA 3HR6A 1MCOH 3ARBB 3KLSA 1TZHA 3VFNB 2WINB 3SDCC 2V9RA 3GI8H 1IC7L 2MCPH 3GMMA 2ZCHL 5DHVH 2VDKH 4FG6D 3BX7C 3DRQB 4UBDC 4MD4A 3TEUA 3PV6A 3O6KH 4LHUB 4WRLA 1PEZA 1D5IL 2JTDA 1C5CH 4KK9C 5CEYA 1EBAA 4UNTA 1W2KT 4X5XB 2FJGB 4G80B 4K8RD 3P3YA 5HYJB 5EO1B 1KJ2A 1CVSC 3I9GH 5DRNB 2KQNA 1A47A 5MEND 2EDWA 3DI3B 4DGIH 4UOW1 1IKFL 1E4XH 1RI8A 4MDIB 2UUDH 2A74B 4GAYB 4LSRL 1KLGA 3D0VA 5IESH 2NR6C 3IDUA 1N2RB 3B8SA 3TBTA 1NCCL 3LN4B 5E2WH 1SMAA 5CWSB 4PY7A 2G9HA 3QFJE 5EUOF 5HHOB 4ODTH 4OUUA 5M94B 4JZNB 1CXIA 2AXGB 3RIFK 1DP0A 2Z91A 4OLXL 1S7VB 3BKML 3EDKA 3QAZC 1FO0L 1G9ML 3G6AA 4ONOA 2YMXH 5IB5A 5C2UB 1H5BA 3HI1B 4F7PB 1I8KA 3ZDXF 2NX5A 3ARGC 2YPLB 1OAQL 5BRZD 4JQVC 2C7UA 1F02I 4XGZA 3PWPE 3IJYA 5E9DD 4GBXD 4JPVL 3MQIA 4UZGA 5DO2C 4MJ5A 3C60B 1P1ZB 3G6DL 2W60A 1AKJB 2VUYA 5I1HH 1LP9A 1ND0B 5A2FA 4X9BA 4KKLD 1NBYB 5MERB 1E4XL 4JZJB 4DTGH 4LSRH 4V1DA 1ACYL 4ZD3H 3ULUL 2XNAA 3I75B 3AVEA 4PRHE 4G8GE 3RX8A 4XAKE 1U8NB 2HJLA 1S3KL 1GL4B 5D72H 4PB9L 1N0LA 2UWEA 4C56E 2PW2A 4OUOA 1R3KB 3AUVA 3SE9L 4ZTPH 4YHIB 5IMOB 3KYNB 1ORQA 3RDTD 4PR5A 3Q48A 3H3BC 5CJXA 5E9DE 1CXFA 2OL3B 2NXZD 5JHLL 4HUVB 1UCBL 5D1QA 3VRLE 4OT1L 4PG9B 1KJVA 4MWFA 5JR1L 1YMMA 3R8QA 4ENEC 3TVMD 4WU7B 5LXGL 4GBXA 4K71B 2FHBA 1MVUB 4Z7NF 4HIHA 1ACYH 4HUXB 5ACMA 2P46B 3ULUH 4OQTH 4XB7A 5HHPB 4PJ5B 3WUZA 2KBGA 3JZ7A 5D72L 4EDWH 5F72S 3MLXH 1FGNL 3N0PB 3RI5F 2FGWH 1J8HA 3CSPA 2WLZA 3MNWA 4HKJA 5I1AB 2RFXB 5TFSH 2GEEA 3L5JA 1TCMA 5IB3A 4GKOA 4XNZC 4GKSB 1OTUD 3M1BB 4M6AA 4LLMB 1FZOA 3QUYB 2O5YH 3QDME 1I8KB 5T3XD 4POYA 2XN9B 3B2UC 4L9LA 1BFSA 1IQWL 4OT1H 3S5LA 3TBSB 2FWOB 5GZNC 3BP6A 1FJ1A 1JZ6A 2PYFA 5IBLD 1QLRB 5C0AA 4ODVL 4P9HH 4C4KO 5I1LA 2V2WB 2NY6D 2XG4A 3EYSL 3ARPA 2QBWA 4EDWL 3D0VB 4P3CH 4PB0H 5MENB 4XH2A 3EO0A 4LLVA 2VH5L 1A6TB 3CLFH 3PNWB 3BZEB 2FX8H 1G1YA 2ZPKL 4K7PX 3MGTA 4KTEH 1GOGA 3UTTB 1FCCA 3P73A 1AGEA 4GW1B 4QHMB 4LDOB 3I3BA 4XCCL 2Y23A 4LRIC 3PWVB 4TVPL 5E1AA 4ZAKA 3V2AR 3VGFA 4PTUB 5GGUA 1Q8MA 2G75B 1KCRL 5DGQA 2R2EB 3OXSB 2X7LB 1IGCH 1L0XA 1P6AB 1S8DA 1RK0B 1NUFA 1P4IL 5BMFL 4N0FB 4XBPA 1VFBA 3PV6B 4IOIB 4D9LL 5B38B 3CJJA 3FB8B 2OTWA 5GRZA 5DXWA 5JW5B 4K9EC 1Q94A 2Q7YB 1FV1B 5IW6A 4I4WB 3B6SA 1IC5L 3QDGB 4Y4HC 5FOJA 4DK3A 1TZHB 2DQUL 3HNSH 3HPLB 3GHEL 1PBYA 1VEMA 4JQIH 3LSOB 3NFPB 3OAZK 4PG2A 2QKIB 3OKLB 4JJHA 1SJEA 1X3DA 4O51B 4S1RL 2DYPA 1Y6MR 4U1KA 4DCQB 5D1XB 2HMID 2MPAL 1E4WL 2BVOB 4XXCA 1QYGL 2F53A 3PF2A 4UNUA 4IRJA 1CFVL 1Q1JH 4FTVE 4XAKD 3QWOA 3QZWG 4KXZI 3FB6A 2VZOA 3MJ9A 1HQ4B 3P4MA 1A7PH 1A21A 2PXYD 3S4SB 4KRMB 4G43A 3S97C 1FL6B 5EOTA 1JWSB 2YWZA 1NGQL 2BFVH 1WC7B 3C87A 3CFKA 5FXCH 3WO3B 1KN4H 1X6LA 2ATKB 1L6ZA 2EE3A 4X8JB 3L1OH 1UZ6F 2RGSA 4GKZB 2Z31D 3GJFK 1ITCA 4IMLA 4L29B 2GJ6B 1I1RA 4FQIL 4PRHA 1MAMH 3VXNB 1ZKAA 3RTQA 3TBVB 2UYLB 4I48A 3V4UL 5ISZE 1I9JH 12E8H 4O2EB 1AXSA 3SKMB 3IAPA 4OFDA 4FFWD 4RISH 1IARB 1ZANH 4HCRL 2L0DA 2ZUXA 5IB3B 2P5ED 3WNNA 3B9VA 1JYWA 5JIPA 4U2YA 2I5YL 4HIXL 4QRSB 4HKJB 4Y0GA 4GG6F 4F15B 5CD3B 4OZIF 2P5EE 3JTSA 4MD0B 4QY8A 3CK0L 3HCVA 5FGBA 3VGAC 3QJFB 4QOKA 3O9WD 5IF0B 4NPYB 4KAQL 3BISA 5TF0A 4MAYC 1YMME 1ADQL 4KZDH 1AQDA 4Z0BH 4J12A 2H3NB 4OJFL 1ZVSA 3TNMA 4X6DA 4LPUA 5E94A 3BKYL 5HGAB 1JN6B 3DETC 3IJHB 1WBYB 4ORGB 2VDPL 4P23C 4O00A 5F7FA 4KPHH 1E6OL 4PJBA 4F7EB 1BREA 3ECBB 2UY6A 1O7VA 3L5WB 5LBSH 4EI6B 4GQ9L 4APQD 4PUBL 1J8HE 3SDXB 3FMGL 1X7QB 3QR2A 1MLCA 4HCRH 5AZ2H 1HXYA 1AXTL 2V2TA 5GXBB 3TJHC 2WIIA 1MVFA 3N1PC 3OGOE 4OI8A 4LIQE 1U8IA 1WWCA 1YEJH 5TF1H 1IGTA 4NNXA 5FUCE 3VWKB 4HQQH 2Q3ZA 5TE4H 1XFPA 1DQQA 2J8UA 1BD2B 1A1NA 5I19H 2J88L 1UEMA 3GSWB 1HOCB 3GO1L 3MCLH 4O2FB 1U8NA 5MP6L 4OLYH 2AK1L 4EI5D 1A2YA 2PO6B 1AGBA 3VGAB 3I75A 2P5WA 5MEQB 5DA0B 4S0TD 4AEIL 1H8OA 3FB5A 5DK0B 1EFXD 2OM5A 4YFLF 3OKEB 5J0BA 4OZGA 1U93A 2VDPH 1QQDA 3CFBA 1M05A 1YPZB 1E6OH 2B5IB 5IJVA 1WWWX 4FZEH 5CSZB 5IQ7H 3AB0C 3I85A 3RVVC 1H3PL 2YSSB 1KLUB 3U0TA 5DEZA 4F9PC 5JW5A 4E41B 5JHDD 2J5LC 4I18C 3FQUB 3AB0B 5EO9A 2X4OB 4P57B 43CAA 4KJWC 4I3GA 2C9AA 4IIQA 3C08H 1YJDL 1MRDH 5TE4L 3KNBB 5E8NA 5GIRB 3T77A 4MJ4A 3QISA 4QLRA 4MZ2A 5HHOA 4P2OA 4HUVA 4KI5C 3MCLL 3MFGB 3H9SB 5MP6H 4B7IA 4MNQD 4TNWK 4X7SL 2DQTH 4ZNEA 3HE6B 1K6QH 5T33L 2IANB 4JQVA 1RJYA 5E8DH 1VGKB 5CEZD 1BZ7B 1KEGH 1DBAH 1P84K 1MI5D 4QF1B 5FYJD 1SQ2N 4NFDA 5C08A 2XKNA 4PJFF 5F7HA 2NYYC 5ANME 2H6PB 3CVHA 4YDJA 4L1HA 4FQXD 4G6AC 4MXWL 3MA7A 1VADB 4G6MH 1BQHB 1FLTX 4HIIA 2VISA 4O02H 1U8JB 1DL7L 2YD3A 2DQEL 2VYRE 1WFTA 4K3JH 5EIVA 2VDML 3ILQD 2CKBB 4CGTA 5DJAB 4NC2B 1U3YA 3NFSL 3M1BA 2FZ3B 5DVLA 3BXNB 4EOWL 1NMAH 3HG1E 1A7QL 1Q0YH 3K2MC 3IDXH 2Y7QA 4TUOA 4LGSB 5DFTA 4B0MM 5GS2H 1FL3A 1NC2B 3WS6C 5DO2D 4FXLA 4QNPE 5IMKA 4MXWH 2DKMA 3CH1A 3RL1B 1B0WA 4X5LA 2XTJB 4NDMB 1OP5K 2B2XL 1OLZA 2AEPH 4IRJC 3SGDH 4LARL 4WU7A 3BGMB 1G7IB 3ZL4L 1PW3A 2W9DH 4GAFB 3GSUB 3H7BA 4LEXL 4L5FL 3H7LA 4K3JL 4Q2ZB 3ZKNC 2NW3A 3HUJF 2X4SA 1OD9A 3DV4B 4G8GB 1X7QA 1XGTA 5ICYA 2EDRA 5CSBA 3DMMA 3WE6A 2VITB 2P5EA 2RIKA 4QXTB 1G7HA 3FQTA 3JVGA 4J3TA 4Z7VB 1OW0A 1XH3B 2OCFD 3RBSA 3CU1A 1EEYA 4FFWC 1S7TA 3BPLC 1Y6KR 4U6YB 4XNQA 5TDOA 5DVNA 2LU3A 3CX2A 3ARXA 3TZVA 3G5ZB 1UA6L 3QI9C 3ULVE 3DUUA 1OM3L 4PJHA 5F1IB 4CADB 5MENE 4KC3B 3V8CA 3CDYA 4K7PL 1RJZA 3HLAB 1X5GA 2RAMA 2GJ6E 4YNYB 1DANT 5DJYA 4BSVB 4QY8B 3W2DL 4QRRD 4TVPE 1AP2A 4O5LL 3QUKB 4TYUA 3T1FB 3ZL4H 3FO2B 1JF5A 1QQDB 3CFBB 3HN3A 3V6FB 4CKVX 4JPWH 5IEHB 1OOAA 4IBLT 5IW3A 4P0DA 4ZYKB 4HLZG 5F71A 3ZDZE 3T1WA 5I6XB 9CGTA 2OI9B 4X9IA 1V3JA 2EE9A 1FFRA 1T0NB 1F00I 5GS0D 1YN6B 1ZLWK 4NN5B 5ISZB 3D5OF 1QFWL 1YEEH 2BJML 3ILPA 4FMFA 1T5XA 1IGTB 5HJ3A 3A6CL 1UA6H 3QDGE 2DM7A 1MHEA 1HOCA 1RSFA 2VSCA 4R4FH 1LEIB 3PUCA 4LMQI 4JDTH 1LK2B 1DQLH 4P9MH 3O6LH 3S9DB 1W8NA 4K8RH 2GFBA 1T1ZA 2V2TB 5EFIB 3RZCD 1RZ8B 2QSCL 2ZUWA 4JPWL 3KPRB 3Q5OA 3VFGL 4LSSH 2FD6L 3DUSB 1DJSA 4K3HA 3IDNA 4KDTA 5EN2B 1U91B 1W0WA 1X9QA 4WW1A 3O2WH 3RGVC 4O51A 3VXQB 4X7DC 4ZODA 4DZBB 3IJHA 4M43L 1DQDL 1QFWH 1YEEL 2DLHA 2WP3O 4QHLA 5CINH 2FEEI 4X6DB 1T1XA 2XZCH 3QQ3B 4QRSA 3FQUA 3BT2L 1A3LH 1U8QA 1H0DB 2X40A 5D6DA 5HVWA 1V3MA 5T5NF 2PETA 4XNZB 3U0TB 4YH6A 4LCYA 4L8CA 3ARGD 4R4FL 2FB4L 3GBLA 3T2NL 3ZZ1A 1A9EB 1P9MA 3N50A 5GZOD 1T4KA 4L8SB 1DBKH 3RTQB 4V1DE 3M8OL 2QSCH 4FXKA 5I15H 4OAWB 2VLRB 2YD8A 1P7QA 5C71A 1UCTA 4DZ8B 3MRDA 3VFRA 1XF5B 3PP3H 5IB4A 2QLVB 1T5WA 3O2WL 3GJEA 4KZEH 3K1DA 3VDBA 4FZ8L 5F8RC 3MLZH 4ZUWA 1DQDH 5DK3A 2R4RH 4M3JA 1NDMA 5FUZL 3CDFA 2XZCL 5DS8B 3MRBA 1MCFA 4R96B 1VFOA 3CMOL 2UVFA 1A3LL 3WKNA 4HIEB 5EWIH 5E8OB 4JY6B 1C1EL 2DQIH 3QDJB 2P8PB 3CSYB 1A0QH 5F9OH 2NNAB 3ULVL 3TH3T 5K9QG 3NH7L 1R5VB 3FQXA 3SCMA 1T2QH 1V3KA 5I8OL 4Y19D 5AYUL 2HLAA 3VH8G 2VXTH 3SPVB 3MCKB 4Z7WF 3OJDA 2COQA 2KKQA 4HJ0D 4DOHB 5DK2A 4LPYA 3QIBA 4J4PA 4W4OA 5E70A 3D3VA 2YPLD 2BZDA 5BRZB 4J8RA 4TNWF 5IT2H 2PF6A 1ZLUH 4JR9L 2AK4B 4RMUA 4KZEL 4RAVB 1TJGH 4M8VA 1P4LB 1OD7A 4PJGF 4OZFB 2AGJL 3QUKA 5C9JA 5FUZH 1L7IH 3V6ZB 5MI0C 1RZFH 3KLDA 4HZLB 4MXQD 4CNIA 3VCLB 2ZUQB 1NCWH 5B3JF 3TBYA 4ESKA 1BIIB 1U8QB 2EYTB 3ARZA 2CIIA 2DQIL 5FDYA 5LVEA 5DJ2A 5EZIL 5BO1L 3EFFB 1AD0B 1JVKA 4K55A 4X6FB 4RMWA 2FYYA 4OLWL 2C26A 3WLBB 3MRQB 4G8EB 5D1QB 5KSBA 1F58H 2NY2C 4NRYB 4RAUA 1JZ3A 4GRMA 1LEKA 4D2NA 4QXTA 2CRYA 3OB0K 4M7ZB 4PR5B 1E28B 5GS1B 1IGJA 3MRCA 4H26A 1U3HD 3VJ6B 1H3UA 2DTSA 1EMTL 2F5AL 1QG3A 1TJGL 4X98A 3RWHA 4XVSH 5DD1H 1HI6B 3H6JA 4ALAL 5D2NC 4XPFH 4XWGL 3GJEB 3RVVD 3ISWA 2YEZA 2ZJSH 2GQHA 1CLCA 3QWRD 5E4EC 4I3SL 1A6WH 2KPNA 2GITA 1VEPA 1BMGA 3RAJL 3EW3B 4LLMA 1A6AB 1SM3L 4OLWH 1RUKH 4FQHA 4M7JL 2ZUYA 3TBSA 2CSPA 3OPZL 1ND0A 4WVRA 3V7MA 1BM3H 2G5BB 5DI8B 1LNUA 1IEAB 3DV6B 3MV9A 4OFVA 5CKAA 4PJHE 1PKQA 5CIPH 1B0RB 2RQ8A 3EDFA 4M7ZC 5JXAH 4TTDC 1N6QL 4NJ9H 2YK1H 4TULL 1G84A 1M4KA 3QIWA 4XVSL 4DN4H 4GKNA 2VISB 5F7EL 5C1MB 4PRPA 3MA7B 5CZXD 1XH3A 5HGDB 2ZJSL 3JV4A 4QRTA 5GGQH 4RMTA 1ZTXL 3UPCA 4W6WB 5I75B 1ZV5A 3MLSH 3JWOL 2EDJA 3FFCD 3OPZH 1KOAA 1BM3L 1BAFH 3O41B 4YEEA 3HE6C 3BSZL 3ILQC 3P30H 4P2QA 3V6OA 1JV5A 5JW4N 2HLFD 4LFHD 4X5XA 4JJ5A 1A6ZA 4KQ3H 4Q0XH 3WO4C 3ZE2F 4JGMA 4JN2B 1EGJH 4PRDA 3H3PH 4OCSH 2Y7QB 3DX9A 5CILH 4U31A 3K8KA 3WO4B 4NDMA 5ISZA 5E99L 5IMKB 1VDGA 4R7DB 1Q9OA 4JPKL 3QUYA 4MMZC 5EORL 5D7JC 4F37F 2XKSA 2EDDA 4RNRA 3X11B 5JXEC 3LKOA 2BSRA 1HDMB 1B6UA 4MD5A 5DRZA 2BMKA 5D7JB 1BAFL 2VZ3A 1MJUL 3E1F1 5ESVB 3P30L 1I7RB