3CMOH

Hiv neutralizing monoclonal antibody yz18
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
b'AVQLSQSGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCTRWPHYYGGSRYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title HIV neutralizing monoclonal antibody YZ18
rcsb
molecule tags Immune system
total genus 43
structure length 222
sequence length 222
chains with identical sequence Y
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoH02
4OCWL 3MCKB 4O9HH 5DJ8B 4LSTL 2PW2B 1JPSL 2A9MH 5IVNA 1LNUA 2R23B 4LRNH 3QAZC 3QEQE 4PRNB 1Z9SA 3O4LB 3QWOB 1OSPL 3ZDYF 3EHBC 3PWNB 4F9LC 4OZHF 2CGRH 4OLUH 4U1NA 1UZ6F 3ARGD 4LRIA 4Y2DC 3F6IA 5I15L 3E3QE 4OAWB 1RZ7H 3NA9H 1XIWB 4A6YH 2R2EA 2ESVB 4JFEA 3L3IA 1BLNB 1G7MB 2NY2B 2E7MA 1T0PB 3OXRA 1CD8A 4QRTB 4JHWH 1B0RA 3PV6A 4X4ME 2NNAA 3I6LD 1JV5B 1OGAE 4NC1C 3ILQD 4NWTL 2XA8L 4WFED 3ZLQC 4QEGA 3KR3H 4LHUG 3OJMB 2IMNA 4P2CG 1SJHB 5AYUH 3RY6A 5IB3B 2FZ3B 5E2VL 1MFDH 3RWCA 3CUPB 2IPTH 2V17L 1VGEH 2XZCL 4P3DB 4EN3B 2FEEL 5F1NA 3GKZA 4MAYD 1A1OA 4H88L 3W0WB 5IVXF 2VDLH 1EO5A 3EO0A 2AI0L 4J3TA 4X6EA 1RK0B 4HIJA 2HFEA 3BQUD 1AXSA 4V2BA 2UYLB 5I30H 1F4XH 2OJZL 2YD1A 3QHTC 4YPGB 2R1YB 5FV1L 5C0AA 5D93B 1F3JB 3HKFA 4R6UA 2A74A 4PJIF 3UBXB 5CEZE 5FA4A 3BGFB 5EU3A 3JWNC 2X5PA 4K7PH 1S9WB 1QSVA 1U8IB 1U8KB 5C0GA 2PYFB 3GSRA 3SDAA 4X9FA 4F80A 1JK8B 3B2UC 5I6XC 5HHOB 1U91B 4UV7L 8FABB 5L88L 2AEQH 2ICCA 3S4SG 1LK3L 4NZDA 4K71B 5D7IB 2MJWA 4U7MA 4J8RB 3C08H 5IK3A 4Z7VB 5DJXB 2AJ3B 2X7LB 3VG9C 3K46A 1HHJB 1CXFA 2EDLA 4Q0XH 3V4VL 3MOAH 1LE9B 2JK5B 1HYRC 3G5XA 1QRKA 4H26B 2CRMA 2NR6C 1K4DB 3BPCA 4RMSA 1I7RA 1FL3B 4TUJA 3C5JB 4M7ZC 4Y5VB 2DIJA 3V95A 1G7PB 5DVMA 3UO1L 2OJEB 2RR3A 4P59L 5ERWB 3D39A 1OB1B 5MHSE 2VLLB 2C1PB 3VXOA 3TEUA 1CD1A 4OBRA 5IFJB 1TNNA 2AW2A 2GAZB 5IG7A 4U1HA 2FD6H 3C6LA 5A2IH 1ES0B 2DQUH 1G9NL 1A6UH 5EA0L 1ITBB 3D85B 3GRWH 2X1OA 2BDNL 2BHUA 2HVKA 4YAQA 1BFTA 1FG2A 5E56A 4N1HB 1YEDB 1J1PH 3T4YA 2E7LC 4TPRL 3VWJA 1U36A 5F3BB 4RGND 3UTSD 1UM5H 2P5WA 4FQCL 4NZTH 4KK9D 4FP8L 1EEZB 5T1MB 1LD9A 1LO5B 3A67L 4LCWB 1IGCL 3VW3H 2NW3B 4OD3H 3BVNB 4H0HB 4Q2ZB 3OAUL 3I75A 4QRPD 1TCRA 2P44B 5HVGB 3WDJA 2KUTA 3NZ8B 4NQDE 2D9QB 3KWWB 4LLMB 1QFOA 1MHCA 1DE4A 5GSVA 1P4BL 2ZSWB 2FO1A 3T0ED 4ODXA 2X9YA 3I6GB 3WXVH 5GRYA 1DCLA 4EBQL 1T4KB 1FDLH 3ROOB 3VFOB 4QOKD 4F7EA 1OWRM 1S7XA 2MPAL 3DXAB 5FO7A 4AEFA 4HS8H 2R39A 3FN9A 1G7JA 4D0CB 3VDBA 1NJ9A 5IM7B 3EZ8A 1VERA 4I1NB 5FOBB 4NQED 4P5TC 4ELMB 2I9TB 4MWFB 7FABL 4LAQH 4WTZG 4WW1A 1DSFL 1D5XA 3CFBA 3HZKB 2VXSH 4X6DF 3IXTB 2P7TB 2VR4A 1RURH 2GYSA 3PP3H 4XWGL 4FQLL 2WBJC 5HDBF 1MPAH 1HHHA 1TETH 3AU1A 4FMKA 3V6FA 4JQXC 1T7ZA 5E8OA 1QYGH 3P9LA 5IMMB 2NZIA 3UJJH 3LAFA 1G6RH 2I27N 4X6CF 4FZ8H 1NBZB 4Q9RH 3FQRB 4OM0L 3MGTB 1GZQA 1OAUH 4HWZA 4R7NA 1T1YA 2JJSC 3DX7B 1A6VH 3OF6D 4HSQA 4U6YB 5J9PA 5KW9L 1FGNL 4PB0L 4MCYA 5D9SA 1WTLA 5F1SA 1GZPB 3HNSL 4K8RH 4O2CA 1UENA 2QQNH 4MA1B 4F3FA 1DANU 3PWPB 3MV9D 3U4BH 3QO0B 2DBJA 4RDQG 3JUYA 5HGAA 3QEUA 5IQ7L 2UWEB 4OV5B 2Y5EA 3QA3A 3GSUB 1ZHKA 4K3EH 4W68A 2DQGL 3RY4A 5TDNA 3RP1A 3FQNB 3NN8B 4JGJA 3SPVA 5BOZG 1JUFA 1DQLH 2FO4B 1L6ZA 3EDKA 3QPQD 3RGVA 2NY3D 3T2NL 3GUTA 3LKOA 1YECH 4HDIB 4HS3A 3VXSB 4GG8B 5EN2A 4HIXH 5HI3C 2HJLA 4HH9B 1FVDB 5IV2A 3MRPA 5IESH 3DYPA 2V2TB 1JHLL 3N85H 3CDYA 1LDSA 2N1KA 5EO1A 4JFDA 2YWYA 3OKMB 3AM8A 5BZWA 1Q9KA 3PJSA 1X7QB 1S3KH 1LDPH 5MENE 3JWOC 1MOEA 1KTDA 1T03H 1KPVB 4URTB 4NN5B 4TSCL 3IJHA 1MAML 3V9FA 2WQ8A 1A3RH 4MJ6A 4PJCB 1FYHB 2MCG1 3P11L 1C12A 3BP4A 3V79C 3OKKB 1KC5L 1ZA6B 3O11A 4TULL 1A4KB 2D7TL 3MLZH 4G7YH 1X5GA 4ODTH 1CCZA 5E9DA 4Z0XB 3WJLC 2XTJD 3BKYL 2E7CA 1DUZB 3SGEH 1CLOL 4HJGA 3HCVB 3D18A 1AXTH 3WHE0 4Z7OE 43C9B 1OVZA 2CLVB 2R0LH 3AFLA 4NC0B 4LMQI 4DK3A 3FHAA 1OM3H 2HJFB 4D0BA 5JA9A 2R69L 1CTOA 1YNTA 1FN4B 1DUYA 1I9IL 3JUZA 4U1GB 1XF3A 3PGFH 1DBKH 1UM4L 4MJIE 3T3ME 3MOBH 3X17A 1YQ2A 2BVQA 1G7IB 3C60B 3DRTA 4PRHA 3V4PL 4UI2A 2AJZA 4X9GA 2OI9B 3HMXL 2IAMB 3T2QA 5A2LH 3HAEH 3MRLA 3HC3H 5BVPL 4RISH 3VG0L 4NRYA 5KAQG 2EIEA 4LLUA 4RWYL 4X99B 4YWGL 3QIBD 3EYVB 2YBRA 5D7IF 5BJTB 5E99L 1WWWX 4P2RA 2HLFC 5DGRA 3WJJC 2R2HA 2BSED 4HAGA 1VGKA 3TFKC 1S9YB 5DUPH 4Z5RB 4MD4A 4TNVF 4PLKC 1OAQL 1RZGA 3BPNC 1SMAA 1YEEH 3MRGB 5CJQH 3U30C 1YEGH 3NIGE 2ENSA 1J05A 2H32H 3S96A 1WBXA 4NN6B 2CQVA 2EYSA 3O3DB 4X4XB 4NO5B 1WSST 1P2CB 1OP5K 1FGVH 3U2SB 2HT3D 4TUOB 2CLRA 5LQBH 5KJRL 4Q9QL 3ARBD 1WZMA 3CFCL 2YRZA 1KLGB 3C5SA 4JQVA 4KRPD 4XT1C 4QRUB 4QY8B 5DD1L 1DLFL 5JHDD 1JIBA 3KXFA 1UVQA 3MXWH 4M6MH 1WCQA 1E27A 5EULV 4JE4B 2EE2A 4PJBB 3D48R 1HCFX 1AGDB 3BPLC 2DL9A 4YFEA 3C9NA 4YUEL 3U9PH 3QUMA 2NW2B 2YD4A 5CMAB 4WEUD 2Y5TA 2BNRB 4D8PA 3OKNB 2ADFL 5GRVL 1A21A 3RHWF 2OYPA 3WKML 4R96A 3OR7A 4PJDA 3O3AA 3RWJA 2D2OA 1M71A 3RY5A 1SY6L 1G9EA 4RFOH 3CMOL 4XI5C 2WZPD 1LO2L 4MA7H 4CVXB 4MJ5B 4G6KL 5IVXA 5GRXG 4LPCA 1GGBL 4XHQA 5HHNA 3RVXC 1JHTB 1ED3B 5DJYB 4NNYA 1GIGL 2VN4A 2HWZL 1IZJA 1FL5A 4GKNA 1NGXA 2NXZB 1I7UB 5BV7L 4NUJB 3BEVB 1VDGA 3H3BC 4JM2A 5C6PB 4KKAD 1UWGL 1EAPA 2FEDC 3O2VL 4RA3A 1N26A 1LEGA 3O0RH 2NY6D 1T66D 2ZUQC 3HE7C 2CUIA 2H2SC 3QCTH 2H8PB 1ZT7B 5JXAH 4PB9H 1BF8A 5IT2L 1R5IB 3UC0L 4PJ9D 4LVNB 4MDJA 3BW9B 1EO8H 4X5WA 3TN0B 2JJVA 5C0DB 2DQCH 2GI7A 3TGXA 3C5ZD 1C5BL 4HXBL 2JTDA 3VFTA 3NAAL 3QQ4A 1YEFH 4P48A 3LOWA 1RZJL 3OJDA 5B3JF 3MNWB 1A9EA 3QIWA 3PHOA 4G8GB 4PJEA 1S9VA 5GS2D 5JO5B 3QYCA 5AZEH 2ADIA 1SY6A 3MOQA 4ZFFA 4UAOC 5CCKH 2UWEF 3MFFB 4NM8L 2R29H 2ICWJ 1AGBA 1GH7A 1T7YA 2JCCE 3M8OH 3FB6A 2F15A 3WCYA 5FYJU 4L29A 4UTAL 1FH5H 4Q6IB 4S0TD 2GCYA 1VPOH 3ULVF 3CGTA 5D7JB 4L3ED 1CXIA 32C2B 4M3KB 3UTZB 3ZKMD 4ZXBB 1T7VA 3KPNA 4YDVA 2P24A 5BRZD 4B7IA 3TO4B 4K94L 4P49A 1XGRB 1EH9A 1I8MA 3RWHA 5JA8B 4RAHA 3BIAX 1SEQL 5K9QI 3KPRA 4C59B 1I3VA 2IG2L 5M94B 3DV4A 1HZHL 4DTGL 4RRPG 4OQTL 4WUKL 5C8JA 1OTUD 1TJIL 4JFFE 3RKDD 5TF0A 1G7LB 4LMQE 3BEWB 2ORBH 1QKZH 5D5ME 1AGFB 1GGYA 1ZHBB 4EVNB 1A6TB 1IRAY 3QRGH 1ORQA 3L6FA 5CWSA 4JANA 3PWUB 1JBJA 4OCSL 1DL7L 4LPUA 5EU6B 3QUYD 4BYHA 5LXGH 5MEOB 4NUGL 3WLBB 1UWEH 3CLEH 1HHKA 4GBXA 2HMIC 3WNMA 2FJFB 4KUCF 4PP1C 4X7TA 3FCTB 5TDOB 4CRPA 3IDXH 3VRJB 4BFGA 3CLFL 1MFNA 1FNEA 1JWSB 1HHIB 5I75B 3ZSSA 5DLMH 4KUZH 1F97A 3HC4H 3DURA 4KJYB 3UAJC 4XP4H 5ACZB 3K2UL 1U8QB 5E70A 3VGHA 3HNTL 4HFUL 1M05A 2FJHA 3IGAB 4G6AD 1YYLL 3TH4T 3GMLB 1S5HA 3UPCA 4OBSA 4X6CA 3FQXB 1AHWC 4XNXH 3R4DA 5C07B 2CDFA 3KPQB 4OKDA 2EDHA 2YUWA 3RL1B 4Y8AA 5MEQA 5I1JL 5IEHB 2NY4B 2FL5A 5IF0B 3VD7A 5C0BA 1SYVB 3FQUA 4M61B 15C8H 1QR4A 5TH2A 5I2IB 2R0ZL 3DBXA 4OQTA 2HKFL 3FOLB 4OLEA 1D3CA 3RUGE 3BP6A 4LBEB 1FNGB 5CHNA 3VXUB 4JFOB 4PJGF 2MHAA 1FLTX 5D7LB 3LB6D 4X7FC 4NKIL 2EC9U 3PL6C 2B1HH 3BRDA 5ITBH 1NFDA 5DJ8A 2YPLB 2PW2A 4YDIH 4BM7A 1A0QL 4EEEA 2OCFD 5HGDB 3OBAA 1MJ7L 5EU7E 4MHHI 4LCIH 4FOMA 1R0AL 4X9IA 3O4LA 3QWOA 2OBGA 3PWNA 2VLKB 2X4TA 1FYTE 3FKUS 4W4NA 1H3GA 1J1XH 35C8H 5I17A 2FDBP 4IS6B 1N0XH 3MA9L 1BMGA 1HKLH 2G5RA 2MQ3A 4H20L 4OAWA 3HR5B 4YR6B 1FQ9C 1XIWA 2ESVA 2Z31C 5AAWA 3WE6A 1CLYH 5JXED 4DKDC 3SCMC 3S6CA 4PJBF 2DMCA 4JDZB 1XF4A 2NZ9C 2V5MA 4QRTA 3LZFH 1JV5A 1JRHH 5BXFB 3CVIL 3S37H 5I8CB 3EFFA 1RHHB 4PRPB 4MJ4A 4O02L 2FZ3A 2NXYB 4XPBL 4YFLF 4HUWB 4NJ9H 3DIFA 3IFLL 4P3DA 2IWGA 1EIBA 3GM0A 2ZNXA 4KJQC 4OGAD 3B9VA 2EDDA 3KLAB 1INQB 4PRAB 2LABA 2QTEA 4M6OL 2P5EE 4HT1L 4Z6AT 3W0WA 4HWBL 1NMCC 1HNGA 1QHPA 4F33B 1RK0A 3RZCC 3QCUH 3S5LB 5ADPH 4AEHL 1MQKL 4YO0B 2P8MB 2UYLA 5IOPA 3N9GL 2R1YA 5F7EH 2E6JA 5F89B 5A3IC 3H6JA 1F3JA 3UBXA 2J6EH 1ZTXH 2R15A 4CJ1A 4Y4KD 3QUKB 2I07A 4QWWD 5DJCB 3IRZA 3I9GL 2BMKB 4K23L 3MRFB 3U4EB 3WL9A 1CQYA 1RIUH 5TFSH 1CN4A 1S9WA 1U8IA 1U8KA 1IGMH 2PYFA 1QUNA 3QJFA 1JNNH 1JK8A 3MYJB 1U91A 1A7NH 1PKQB 4ODHL 8FABA 2FGWL 2F5AH 4KZDH 2FGZA 2VUYA 4NGHL 5FKAA 3VXRB 4EIGB 2EC8A 4QTIL 2VDKL 4J8RA 3GJFK 2APWA 2PO6C 4Z7VA 5B21A 3NA4A 2AJ3A 5FA3B 3HZVB 2G2RB 2X7LA 3BAEL 3VXMD 5F9JB 1HHJA 3DUUA 1LE9A 4IJ3C 2JK5A 3AY4A 4H26A 4P57B 1A1NB 4GQ9H 3GBMH 3STLB 4KTDH 5GS1B 5T3XL 2BVPB 1EFXD 1CG9B 2EDNA 4JKPH 2C3VB 4LSUL 3FN3A 1CGXA 3BIKB 3QQ9D 1CFSB 1OB1A 1EGJL 5BS0E 4HWBA 1NUNB 2C1PA 3CD4A 2OM5A 1JFQH 5C0RH 1B3JA 1A7QL 1KCSL 2GAZA 4EXKA 1OTSC 4MD5B 4DJMA 1ES0A 5EZIH 1WBYB 3HA0A 3NPSB 1A5FL 3MZGB 2Y06H 1XR8B 4FQQA 4JG0L 4I3GA 4O51A 1I7ZB 4ZTOH 3UP1A 4ZAKB 1AY1L 2VIRB 4KXZH 3PV7A 4LEXH 4GO6B 1YEDA 4UT7L 4L9LC 3NCJL 4WV1B 3STBA 5J1TC 3IFOA 3MUJA 5DRNB 4S11A 3MRCB 5C08B 3TBTA 3LKRA 3WUWG 4YE4L 4LCWA 3DMMC 2ATPB 2VR9A 2NW3A 5E4IA 3BVNA 4ZFOB 4Q2ZA 3K2MC 4E42B 5F96L 3NZ8A 4NWUH 1KCKA 3S8WA 4LLMA 3SO3B 4WO4D 2PUQT 4JY5L 4P9HC 3SE4C 5ANME 5ISZE 2E7BA 2HFFA 1J8HB 3ARFD 4PUBL 5SWZE 1MCPL 3HAEG 5IR1A 3EJYD 2D7NA 4G43B 2YRLA 2ICEA 3V0VB 4G9DB 4NYLB 3VH8G 4JRXE 1QPXA 1T4KA 3GBNL 3ROOA 3VFOA 3AS2A 3QUZD 5DZLA 5EOCH 1J10A 2XWTB 5BO1H 5F7DB 4POUB 1YUHA 1UQSB 3CSBA 5GZND 3U9UA 4KV5F 4NQDD 2Z93B 4JO1L 4JZNB 5T1LB 5FOBA 4GAFB 1U8LA 2YK1H 5F1IA 4ELMA 1QNZH 1EGJA 3F5WB 4MWFA 2I9TA 3MQIA 1MCNA 4WJ5A 4N0YH 3P4NA 1S7WB 2ZZUT 3HZKA 3PHQB 4F15C 3H2WA 4R4FH 4KTEH 3VE0B 3SDCC 1A7RL 3CAFA 1RUAL 3BE1L 3I84A 3QULA 1OQXA 5F21B 3MBEA 3E0GA 3QDGD 4R0LC 2YXMA 5FYJD 3HS0B 1N59B 1WLHA 4KPHL 2OQJB 4XPGH 3EJZD 1A22B 3P30H 3TV3L 4APQA 5AZ2L 4O5LL 3ARDC 4NZUH 4PJAF 4WNQB 5T1KD 3MGTA 2R8SL 3FZUD 3D2UB 2LVEA 5DJ2B 3T04D 2VZOA 5IVZB 5DRXB 1YNLH 5J11C 3DX7A 3C2AH 1CVRA 1DQTA 1W0VB 4U6YA 1QLEL 3DSFL 4LL9A 4JVUA 2J8UB 3RGHA 2ZCKL 5CZXD 3VWKA 1U8NB 5JORA 3EYQD 5A1AA 3PWPA 4G80B 1OF2B 5MP6L 3QO0A 5IQ9B 3B9KB 4OV5A 4KMTL 1WBZB 3GSUA 5EIQA 5D2LF 4IRSC 1C5DB 5JW4Q 1ZT1B 3HE6B 1UJ3B 3FQNA 3NN8A 2FO4A 4JY6B 3REWB 1CBVH 1YJDL 1INDL 5F6HI 4UIMB 4GG8A 4PGBB 4G5ZH 1IAIM 2EYTA 3NCBB 4TVPL 4WUUE 1HH6B 5GHWH 2V2TA 2DMKA 2D03H 4KY1H 1K85A 2CKNA 4H1LB 2HN7B 2D0GA 2ZUYA 1JZ5A 3PE9A 3RNQB 2CKBL 4G9FB 4Y19E 3RVWD 4WI9A 1IC7H 3H3PL 2G60H 1DBJH 1UC6A 4KHTL 4Y4HB 2NMSA 4JFED 5L6YH 1BJ1J 1I85C 1C5CH 2B0SL 1CFTB 4QXWA 3ROLB 5DJ0B 4PJCA 5E2WH 4JM4L 2XRAL 1F3RB 2GITA 1CFBA 4OLWH 1UYWL 4F57L 5MEND 4WY7H 3O9WC 2DQEH 3OKKA 5C92A 4KI5F 3BRGC 5DT1L 1A4KA 3T08A 3LD8B 5E8DL 5F7FA 1JYNA 2H2PC 2Z8VC 3RVUC 4DQOH 3H42L 1BFVL 4JFZH 4YHZL 3HCVA 1TTGA 1T5WA 4G6MH 2Y6SC 5IJVA 2CLVA 3JTSB 4Z7WA 2OMBA 1Q0YH 1F5WA 4JO2H 2LE9A 1JGLH 3QRFM 3INUH 4FABL 1PW3A 5EC2B 5C0AD 4X7SL 4NHCL 2ZWLT 3KYNA 1S7SA 1QQDB 5H37H 1UACL 5HYJE 1IAKB 1Q9OB 1XGYL 4NO2A 3KHQA 3RBGA 4U3CA 5DVOA 1L7IL 5KZCD 3FT4B 5IB1B 1CE1L 2CKBA 2E3VA 1PY4A 4XBEH 3QXVA 2E9JA 5I1DA 1TNMA 3V6OA 4DW2L 5FYJH 1S9KC 1T7XA 5J6HA 4ZPTB 4UQ2A 4PREA 2QR0B 2LAAA 3LS5H 4RMUA 4I9WD 2NY1C 1REIA 2XXCB 3SKOA 5K9OB 3ARVA 3EDFA 4Z5RA 4AK1A 1NFIA 4ZSOE 3F58L 3NH7L 4ZTPH 4XP9L 3MRGA 3ZHLA 1C7SA 4F7CB 1ZSDA 4FQ2L 3GHEL 1EEUA 3ARGB 1FHGA 2HTLC 2P8LA 4IRJA 5C6TL 4NOFA 1QR1B 3O3DA 4FXLA 4NO5A 1URLA 4MLIA 3HI6H 4YHNB 1WWAX 1GGCL 4M7LL 1FVCB 5K9JH 3D39D 3FB5A 4PJFE 4Y1AA 1BQHB 1AFVH 1XF2B 3I02B 1R5VB 4XNQB 1WZ1H 3QSKB 4JR9L 2QQQA 1P1ZA 3SE9H 3MLXL 1RUMH 3SE3A 2CRYA 5GGVH 5K9QG 5LVEA 3ZHDA 1DVFD 4ONFH 3KYMB 1NGZB 5L9DH 4PJBA 1NCBL 4NNPL 3GJEA 3VWJD 2XACC 4M93B 4OD1L 4RBPK 5FM5M 5IB4A 4K3JH 4PGEA 4HWEL 1Z3GL 4FRWA 4UU9A 2P5WD 2UV3A 1UXWB 5DI8B 3GEWB 4K3DH 1IT9L 3OKNA 3S88H 4MAYB 4OGYH 4XC3H 3U7YH 1OOAA 4X80H 4Y2DA 5HVHB 2AJYL 1RIHL 3LRSB 2EKSA 2OL3H 4HC1L 3I50H 4GXVL 3BQUB 3HUJE 1B4JH 4EKXA 5CIPB 1C1EH 3MV7A 5E95B 5DC4B 4MJ5A 3ZE0E 2EE6A 3G6JB 2PCPB 5FGBA 4K9EH 3N06B 1BAFL 1MRCH 1ZLUH 1YMHA 1RZFH 1JHTA 1ED3A 3DUSA 4LPVA 3KJ6H 5DJYA 3GSNB 4QGYA 4JN1H 4GLRI 3TNMA 1MCRA 3GJFB 4YBHA 1CICC 1DFBL 5LGHL 4JPWL 1MHPL 1I7UA 4NUJA 4OZGB 4FXGB 2DTMH 3JVGA 2EEDA 3ULUH 2KZWA 3L3DB 4FQHB 5JOPE 1I9JH 4NP4L 2H8PA 2YUXA 1W8NA 2EH7H 1ZT7A 2VLMD 2Z4QB 5I18L 5DVNA 4L4VE 2FBOJ 4N8CH 3MGAA 1R3KB 1QSEE 3U0WH 3AREC 4OSUH 3WN5B 3L9RB 3BW9A 4ALAH 4HPYH 2OR9L 5JOFB 2L4OA 5I1EH 5C0DA 4XCFH 4O2EA 1I1CA 3CIQA 4YHYC 1FPTL 2FATL 2V7NB 3UYRH 4ZUWB 1U6AH 3U6RA 2CPCA 1DN2A 2V9QA 5FYKH 4HC1A 5JO5A 4ZNEA 4OZFA 3TESA 3UTPE 2BSTB 3BKJL 4BQBA 1EMTH 5ESVA 3GMQA 2A6KB 4F8QA 4MHHG 3OL2A 2CMRH 2W1NA 3SKJL 3OMZA 1H3UA 4KKNA 4M5ZL 2BVTA 4CKVX 1F90L 3VXTB 4RGNB 3UTSB 4GKZB 2DD8L 5FGCB 1RZIB 3KPMB 1QBLL 5KVGL 2X09A 1CDYA 3L3KB 4M5YL 4Q6IA 5E1HB 2W38A 3EAKA 4CU8A 32C2A 1C08B 1X5FA 1T1ZA 3NVQA 1PG7W 4ZXBA 5D1XB 4MS8D 1ZLSH 4ZODA 2GTZB 4N5ED 2YD2A 4XC1H 1JMXA 5IKCB 3TO4A 3FO0L 2VXTL 4Z0BL 3ZTJH 2ICES 4XVJL 3T1FB 2IBZX 4WIQA 5SX4I 2CRIA 3H9SE 2NPLX 1VEPA 4JFDD 3T0EB 4EI6B 1D9KC 4FFYL 2QSCH 2O5ZH 5L7XL 4HGWB 1X9QA 4JRYE 3VFWA 4QHKJ 4QOKB 3GFUA 4PPTA 4G8IB 4XXDB 1BBJB 2FX8L 4B41A 2E7LA 3BEWA 4LFHG 1AGFA 1Q1JH 1ZHBA 5E4EC 4EVNA 5DD5H 4R90H 2F54A 1SQ2N 1KCRL 2AK1H 3PWUA 4HK3J 1KXVC 5EU6A 3VXNB 1V3KA 5SX4H 3U0PB 3WLBA 4AJ0A 1QZ1A 4UV7H 3JV4B 1MJUL 1H8SA 3EYFB 4XCCH 1MCJA 4HXAH 4TVPE 4MYWB 5IROC 3B2VL 4JFFD 2HH0L 5E9DD 3WFZA 5TDOA 2J7LA 4KROD 1KGCD 4ZO8A 3VRJA 5GISH 4CDHA 4CVWA 4WDIB 5HY9A 1HHIA 2ADJB 1EZVY 2YN5A 1NQBA 2E7HA 4KJYA 1KEGH 5SX5K 2EO1A 3WHXB 2OK0H 1I1AC 4NT6A 4NQCB 5C7XH 2LAGB 1A4JA 1KTKE 3ALXA 3GMLA 1FNHA 2EDJA 3HLAA 4I2XA 5T5NF 3AUVA 1NGPH 1F8TH 2KZ1B 4HWNA 4HUVB 1QLFB 3RL1A 3MV9B 5IEHA 3RTQC 2B1AL 3EDJA 3P0VL 1LGVA 1SYVA 3I2CL 4MXVF 3UDWC 1FLRL 1YQVL 2CXKA 1H0DB 1OY3B 1RZKC 2W91A 1U8OB 2WBWB 5I1KH 4WU5A 4QCIB 1DBAH 1A7OL 2ITDA 4JQXA 2NY3B 4P2RD 2Q1EA 1FZKB 1CU4H 5TE6L 3K0WA 2WIMA 4PRIE 3E3QC 4J1UA 3GSWA 3BPOC 1O0VA 1SVZA 4ZUUA 1WT5A 4GW1B 1CI5A 4YHIA 4I3RL 5HGDA 2QSVA 3EYUL 5F7HA 1KCLA 6FABH 1YEHL 1U58B 2VLKA 3E2HB 3GI9H 3HI1A 1P4BH 5E5RB 3VFMB 2ZCHL 1EEQA 1A6AB 4LSDA 2AK4E 1DBML 3K81A 3QZWB 4WFHE 3ULUE 5BW7C 3IB4A 1ZKAA 1F58L 5DMKA 1RVFL 5KSBA 1EVTC 5IGXH 4JDZA 5GS0H 2H1PH 1AI1L 4X6BB 4NKOB 5JPMB 1N64L 3DVGB 2XKUA 5DJAA 5BXFA 5I8CA 2NLJA 2C1OB 5IIEA 5T5FL 1OPGL 5I19H 1RHHA 3W2DH 1S9XB 1OT2A 4PRPA 3T0XA 2WM0A 2XTJB 1JYWA 4L4JA 4MNQA 4HUWA 3A6BH 4KK5C 1U95B 4K07A 3DROB 4NC1E 4E0RB 1Y6KR 4JQIL 4XWOC 4PRAA 5FGRA 3V4UL 4JDVB 5FYKE 3G6JF 3IJSB 2GIYA 3K4DA 4F33A 4N8VB 4OT1L 1CGWA 4Y4FD 1W2KT 2BVYA 1MEXL 3P73A 4AH2B 2GSIA 3RIFK 3VFRB 2EEBA 1EUUA 4KK8C 2J1KA 1IGJB 4OZGF 4ODUA 3W5NA 4WWKC 4BFIB 3QUKA 5DJCA 3VXQA 2P5ED 3U4EA 2BMKA 3MRFA 3ZE1F 3HNSH 3G6DH 4E5XB 1D5IL 3P77A 4QHMB 5CS7A 4JM2D 4R3SB 3QIBB 3FB7A 2WNGA 1QSZA 2J4WL 3BT2H 4P2OC 2O5YL 5I9QC 4R8WH 3LN9A 3T0BA 4Z95L 2DQGH 4ZOAA 5BCAA 1PKQA 4HIIA 1F6LL 3KYKL 3V8OA 1KN2H 4U6HB 2RGSA 5DHYA 2NCMA 4XMLH 1UKSA 1P7HL 4XNZB 1Z9MA 4GKSB 3L5IA 1QBML 3EO1B 4R7DB 3ZE2F 3LEVL 1NSNL 5FA3A 3HZVA 1KB5L 2EEAA 5F9JA 5EBMA 1E6OL 3E8UH 2Q8BL 3ZHKA 2EIZB 1WFUA 3VD4A 3BSZH 2YC1B 3STLA 3T77B 4M43H 5GS1A 3OAYK 4YXHL 2BVPA 3CFKA 2GHWB 1W0WA 5JMOC 1CG9A 3ARBB 2C3VA 4IIQB 5ALBH 1CFSA 4DEPB 3V5HB 2V5SA 2GUOB 3NGBC 4I13B 5I16A 1VFOA 1NMBH 3GMPB 1UXSB 4UTBH 5JHDB 3OR6A 1MLCB 4FZEL 4PJHA 1KEML 1VACB 3D3VA 3WJJA 1ODAA 5LCVL 5EUOA 1KXQE 1XR8A 1I7ZA 4DUXA 4ZAKA 4PG2C 1MFBL 3HZYB 4LIQH 1RU9L 4TSAL 2VIRA 3BH9B 1YC8A 2DRUA 1I4FA 4OLXH 4WV1A 1V7NL 2B8OT 1PX4A 5C08A 3PDGA 4DZ8B 1TJHH 2D7PA 2RB8A 3LKPA 3WFHB 3GSOB 2ATPA 1NGWB 5ITFB 1HSBA 1U3JA 1Q72H 4E42A 1HK6A 4MQXC 2V5TA 3OZ9H 3SQOH 1S7QA 3PABB 3MX0A 1U3HD 4JHAL 2VITB 1I9IH 2A6IB 1X4ZA 1B90A 3X3GH 2YPKB 3QCVL 4G43A 1KB5A 1D6VL 4G9DA 4NYLA 3V0VA 4NQSB 3X3FL 5IBTL 4ESKA 1FAKT 3GMOA 4HZLB 3QUMH 2Z8SA 3WXWL 2OTUA 5CJ8A 5F7DA 4KJPD 2MWCA 2ZUXA 2Z93A 3VG0H 3LH2L 2NY6B 2YD8A 4GXUM 5DQDL 3SE8L 4WEMB 1HOCB 3UJTH 4P9MH 4YWGH 5ISZD 4MNHB 2VUOA 3GSVB 5KVEH 3L5JA 2X44D 1S7WA 3PHQA 3BRFA 5E99H 1J7VR 1FAIL 2GJZA 3VE0A 3IJYB 1DBBH 2PXYC 2W07A 3MLTB 4PJ9B 1J0YA 4IRZH 4PJ5B 2ATKB 4NFBA 1HNFA 3RVTD 3IKCA 3HS0A 1OAYH 2BY1A 5IHUL 3C5ZB 1N59A 4KJWC 1IFHH 5CD5D 5HPOA 3FMGL 2RCSL 3Q6FB 1KNOA 1AP2B 1UEMA 5D2NE 4XRCB 4WNQA 1TJGH 5ESAB 3D2UA 1S7RB 3ARQA 1NKRA 3JV6A 1W72H 1BD2B 4HMCA 4OF7A 4HUXB 5IVZA 3KDMB 2Z8WC 5DRXA 4HCRL 4YXLH 1OP3K 1T20B 2OZ4L 1S8DA 4HD9A 3FT2B 3EOBA 3OKLB 4HK0B 1YMME 3REVB 1XF5B 3U79A 1D5BB 2J8UA 5C0CA 1U8NA 2H45A 4CADA 4G80A 4W4OC 1OF2A 4GAJH 1I8LA 3MJ9H 4M9PA 4L3EB 3F7YA 3B9KA 1GC1H 4HPOH 4R26L 4OLYL 4XP1L 3L5WA 1C5DA 1HWHB 1ZT1A 3IAPA 1NLBH 3HE6A 4KAQH 5EZOL 5BRZB 3P0YL 3WYRA 1IAIH 3QJHB 4JY6A 3REWA 2AJVL 1ADQL 2ADFH 3FFDB 1KIRA 1MAJA 3BYTA 1MNUL 1S5IH 4PGBA 4KGLA 3I3EA 1HH6A 3OPZL 2FNBA 4R4BA 1SY6H 5KVFH 4TTDC 4P4KC 4G9FA 4LSRH 4FQXD 4I5BA 3JBG7 2WUBH 4H25B 1FC1A 1TMCB 1BOGB 4LLVB 4IOSD 4Y4HA 3F7VA 3E1F1 3QG6B 2V6HA 5I1CH 2A73B 4WUUD 2NY2D 2ZOLB 4ODWB 5DJ0A 1TZIA 1NCDH 4L8SC 1A7PH 5BV7H 1NAKL 5DFVC 2G5BA 3QUYB 4AIOA 4MAUH 1HCVA 1IM3B 2WV3A 4XPHL 4Y19D 4HCRA 5DUMH 2OZ4A 1SM3L 3MRBB 4UB0H 5MEPB 4LCYB 5FHBL 4FG6D 3VD3A 1BZQK 4MVBD 4OCMC 2W65B 4PBWD 2EE9A 3R1GH 1YDPA 3QNZB 4LFHD 4Y8DC 5I1LB 1KFAH 2AXJA 4CAGA 5KN5B 1VFBB 3LS4L 4U0RB 4QRRA 3NCYP 3S3PA 4XH2A 3W0WD 5TPWH 1AE6H 3JTSA 1ZVYA 4WTWA 2VJXA 1MWAB 4Z78B 5EU4A 3NIFE 2ITCA 5DEFA 1C5BH 4LF3B 2DKUA 2JJTC 1NCAH 3SKNB 4PJ7E 1UZ8A 1ADQA 1YEJH 1JZ3A 3V52H 5EC2A 3MODL 1TQBC 2IEPA 5L2KA 4PS4H 4I3SL 4LIQE 4D9RD 5DD0H 5GJSH 3S7GA 1MF2L 5IMKB 3VFSA 3KYOB 5IB1A 4D3CL 3WFEL 2DS4A 4GSDH 4RGOL 5F3HA 5FCUL 5FO8A 4ZPTA 3ZDYE 3QFJE 5E00B 1YNKH 4HFWB 1H15B 4OZHE 1DDHB 1UZ6E 2CJUL 2C3HA 2F19H 3AC0A 5HYJD 5K9OA 1I8IB 4ONGL 1BBDL 3C09C 4NPYB 3QEGH 1AO7E 3B5TA 5CGYD 4YK4B 1NDGB 2YR3A 4K94H 4BELD 3DO7A 1F11B 1AHWA 1TIUA 4UILL 1DQJA 4LHQB 3ARGA 4F7MA 4UT9L 5C0IB 3WNNA 1QR1A 1D5MB 4J6RH 1HZHH 5SV4A 1TVBB 3LMJH 2B39A 4OFKA 3BN9D 4TNWK 3SHSA 1FVCA 3FFCA 3U7WH 5E2UL 1TJIH 1IAOA 4UOW0 1WIUA 1BQHA 1AKJB 1QTYT 1JWMA 1R5VA 4XNQA 4P4RB 1GYAA 1A02N 4G7VL 4NCC2 4Z7UA 4XCEB 1ZGLP 3CSYB 5DS8A 5F9WC 1AGEA 5JIHA 4OCSH 4CN6A 3NPZB 2GJ6A 2O5XL 2AXFB 3KS0J 3O4OC 3IDYC 4K8RC 1WWBX 2X4RB 1UXWA 1NANI 1BFOA 3BZ4B 1FFNA 5JDJA 4L8CB 4PJIE 5GZOD 4U1SB 1HINL 2VAAB 3P9MB 4Y5XC 4LKCB 6CGTA 2AERT 3LRSA 4KHXH 1IGYA 4HJJH 3SDXB 4CW1A 2Z31A 4AL8L 4HGKC 4HJ0D 1A14H 1N6QL 3SCMA 4NDMB 1K8DB 2F58H 3OKEA 4ZD3L 2PCPA 5F7YC 5IBLC 4HLZG 5M7QA 4Y4KB 3QQ3B 3LRHA 4ELKB 3W11D 5IW1B 5C09A 3GJFA 4PFEA 4B53A 3MBXL 1OAKL 2WWMD 4OF6A 1NCWH 2DLFH 3DV6A 1JGEA 2IH3B 1HDMB 3ARYA 2V2WB 4PR5A 4LSQL 4FXGA 4M1GH 3P40A 4MQ7B 4MDIA 4S2SB 2DIAA 4JPVL 5T3ZL 3IFNH 2YZ1A 3L3DA 4FQHA 1U41A 3V0WL 4N0FB 5TF1L 3SKMA 2Z4QA 3LHPH 4NKIH 5HHPA 1FORL 2HT4C 3MBED 2MSPA 2VDQH 4KK9C 3FO1A 3VXMB 2VL5A 1R3KA 1MCHA 5HGBB 4WHTB 1W0YT 4TRPL 1MJ8H 3CPLB 4U6XA 3EFDL 2CK2A 4JZJC 5JOFA 3U4AA 4EUPA 1MI5E 1UH2A 1EFXB 4APQD 1S78D 5I66B 3TCXA 5I1AB 2EZ0D 1CLZH 3O2WH 2QHRL 3O6LL 3K1DA 2A0LC 4L4VD 4DKFH 4YDKH 4M7JH 5HPMB 1OTTC 1QSED 2XPGA 3VWKD 2A6KA 1JGDB 1CF8L 2A1WL 3PGDA 2DLTA 1MVFA 1NAMB 1WCBB 4P9HL 1ETZB 3LDBB 3H9HB 3VXTA 3TYFA 3UTSA 4GKZA 4JPIB 1LHZA 4MNGB 4X4YB 3B8YA 5TE7H 5F7LB 1ZLWH 4O02H 5HHMD 4G42B 4LLAA 3WFDH 1C08A 4LQFH 4OCRL 2QADD 4LU5H 5FHAL 5D1XA 3CXDL 2PR4L 3HN3A 4M6OH 5FUCC 1TVDA 4H0IA 1YEKL 3DX6A 4GRWE 4MX7B 4WO4B 1A1MB 3ARFB 3P4OA 4EI6A 5HXMA 1ZANH 3GMRB 5J12B 2C7UA 4RA0C 4FNLL 4NNXB 4X5LA 4Y89A 1GAFL 4HGWA 4UV4L 3UMTA 2AJXH 4EI5D 1GHFH 1ZWIA 4QOKA 3QUZB 4X6DE 4JGUA 3MRMB 4G8IA 4XXDA 1K9TA 1SJEA 4NQDB 4I18B 4NQXB 5HDBE 4M8QB 1B0GA 1FO0L 4L9LA 1KJVA 3GHBH 3W39B 1E6JL 4YHOL 1RULH 5I1GL 1XGPB 3CFEA 5A2FA 2FIKA 3DMMA 3QIUB 3VXNA 5JHLH 2X4QB 3MNZB 3QDGB 4ODHH 3EYFA 3MNVB 1CXLA 1CDCA 3D1MC 1VENA 4NGHH 2WUCL 1F2QA 4HKZA 4AG4H 1OAZH 2O61B 2X4OA 2EKJA 2E8ZA 4YXKL 1V7MH 1LEKB 4DVRL 1NCCH 1RUKL 2FSEB 2NY7H 2Z0BA 3WHXA 5HYSB 4NQCA 5T3XH 3SDDC 2QV2A 4J3OC 3OF6A 3O6KH 2R1XA 3G9VA 4TVPD 5GJTL 1EGJH 2X4UA 5CD3B 5A2KH 3WIIL 2QKIB 1QLFA 1XH3A 4FTVE 3RDTC 4QRSB 4P23C 3MXVL 5F7KC 5E6IC 5C71A 4RDQF 5HGGS 4EDWL 1OARH 1YEIH 1RUPH 5HHXH 5H2BB 3E6HB 1JJUA 4PJ8C 3QXDB 3ZKSD 1HILA 4UIKL 5B8CC 1UCBL 3MRIB 5J13C 4D2NA 3ARDA 3F8UB 4GW1A 1ZS8B 4KKBC 4OFIA 1IBGH 3TVMC 2A83A 3O6ML 1FP5A 1ZV5A 4IRJD 2ARJB 3QXTA 5IJKA 1ITCA 4OCYH 3VFMA 2B7DT 3D9AH 2VDNL 2Z35A 4PUBH 4FHBD 1TTFA 4Z7QE 4UINL 4JFEB 5KSAC 2VZSA 4AZ8A 3L3IB 3JSSA 4BQ8A 2ZKHH 3ARUA 2B5IC 1A6AA 3OXRB 3QZWA 1U8HB 4Y1AD 3MGOA 1UH3A 3QFDB 5TQ2H 4JY4B 2XIDA 2NNAB 2Q87A 5EORH 3E6FA 3IU4H 4ORGB 5EH1A 3RIFF 3ZTNH 1FIGH 4X6BA 4NKOA 4I77H 5JPMA 1E4XH 5MENB 4G3YL 3DVGA 2A38A 3ULVH 2Q8AL 2C1OA 5FECB 3T0DA 4XMPL 4P5MB 1VEOA 2VC2L 3ZYOA 1S9XA 3LIZL 2AK4D 2XWBA 2DQIH 4OM1H 3EHBD 2AJUL 4WFHD 1U95A 3K4ZA 3KG5A 3DROA 4E0RA 3SDXF 3MA7B 4Y2DD 5FAAA 5A43C 1E4WH 2HYMA 4WCYH 3DWTA 4HIJB 1NCNA 2ZUTA 2OP4L 3MLUL 4KPHH 3RWGA 1UB6B 2FHCA 2HFEB 3BP5A 4JREB 1K8IB 2IPUG 3IFPB 5HHOE 1S7TA 4PRDB 5E8NA 5C0AB 1BIIA 5AZ2H 5F7UA 4O5LH 3MLSH 3MRJA 2XOTA 3MV7D 3FB8B 5F88A 2A74B 2WIIB 1F42A 4AH2A 1ZEAH 5EU3B 3VFRA 5D7IE 3QPXH 5B38A 5KZCB 2VXQH 4GAGH 5I1IL 3CSGA 2F8OA 5JW3L 1H3PH 4BFIA 5C0GB 1QLEH 4KRPC 2ZCKH 3I3DA 4LVOB 1GPOH 1GOFA 1YPZB 4E5XA 2PYEE 3PQYA 4PBVC 1PLGH 3CFJA 1BREA 4GG6F 1WJ3A 1KBGL 2FWOB 4KMTH 5EDXA 3U83A 4GAYA 5AD0A 5IK3B 4U6HA 4H8WL 4KVCL 5KBNC 2J5LC 3IS0X 3UZVB 4GKSA 2BJML 12E8L 4HH8A 3BD3A 1T3FA 1RI8A 3BPCB 4D9LH 1I8KB 1HI6A 2K7PA 1I7RB 2VKWA 5DMGC 2EIZA 4BZ2L 3T77A 4WEBH 3QQNA 1TENA 1X5ZA 2Y25A 3NZHL 5F9OL 1CR9L 1CD1B 4UMGA 5EZLB 5KS9A 4LARH 1MCDA 4KHTH 4LNVA 1UJTA 2NTFB 3ORJA 3B2UD 3UTOA 1VFUA 4K2UL 5DHVA 1PSKL 3GMPA 1UXSA 4RGMB 1DVFB 3GSXB 5JHDA 2HVKB 4J3UA 4YAQB 3S37X 4XP5L 1FG2B 3VWJB 4OGXL 5GRVK 3VU2A 1Q0XL 2XRAH 2VXVL 3WEXA 3BHBA 2UZIH 3SGDI 5GGTH 1LD9B 1NUDA 4CL7A 2X41A 3DXAE 5B39A 4I0PC 3CDCA 2P47B 3MFGB 4Y7MA 1ZVSB 1AGCB 2BFVL 2SEBB 3L5XH 2H41A 4LHUA 3Q48A 3SQBA 1PY9A 1A3LL 5GSVB 3TPUB 1EUTA 1N6UA 5EG6C 4ODXB 2X4SB 1A9BA 2QLVB 1OL0A 1F3DJ 5J0BA 4FABH 5C2BH 1LO0H 3GK8H 4ZFGL 2MNUA 2A6IA 4X7SH 4F7EB 1S7XB 3H0TB 3RAJL 3ZDXF 2B4CH 3L7FB 5FO7B 4P99A 1XGYH 1MQ8A 5I8EB 2F74B 5T1DL 1ZLVK 3TT1L 2A77L 4B50A 1NJ9B 1PZ5A 2R1WB 2AKRB 2F54D 4WW1B 3MRKA 2VNCA 3CFBB 1IKFH 4ZPVB 3ZL4H 4MZ3A 2XKSA 1FG9C 1HOCA 3SEPA 3QP3A 1ACZA 5FYLE 3GSVA 1CDJA 1RD6A 1KB9K 1NBVL 4OB5L 4DFHA 4UT6L 5B3JE 4IEFB 1MCOH 1R5WB 3AU1B 4PJ9A 1RUQL 2IFFH 3FQTB 2VH5L 4PJ5A 2ICWI 4RZCB 3F58H 3NH7H 1TCMA 1EJ6A 5JZ7C 2Z9TA 1EHNA 2UWEE 2IQAA 1BQLL 2XQBL 1GZQB 3CDFA 1LP9A 3S4SA 5FB8B 4GMSL 3Q6FA 3GGWA 2YA2A 3QXWA 4R7NB 3QG7H 4XRCA 1T1YB 3CJJA 3T1WA 1A7BA 3K4AA 1BVLA 3WKNA 4JFHE 5FUOL 1S7RA 4QT5A 4IHOB 3X12B 5J9PB 2BNQA 4M7LH 3VXSE 5HI4C 3ULVE 1BD2A 2DQTL 4MCYB 4HUXA 4P5TD 1MRFH 4O2CB 1LO3H 1KSRA 1T20A 4F3FB 3RA7L 1WUNT 1K4CA 2IQ9H 3FT2A 1T5XB 2HKHH 4HK0A 1IQWL 1D5BA 3QEUB 3QA3B 1CFVH 1QRNA 2DQJL 2YOCA 2WBJD 5B4MC 2FECI 4NKQB 2W9DL 3AREA 3AB0C 4PTUB 2F53E 3LKOB 4HUNB 1Z3GH 2MFNA 3KPPB 4DCQB 3FFDA 3O2DL 3OKYA 2P1YA 1WV7T 4Q97A 2HFTA 5FFLA 4W81A 1ZT4A 4JFDB 2AJYH 3BDYH 1RIHH 4G8EB 5BZWB 4HS6B 2IANE 1B6DA 3IDNA 2XTLA 2BCKA 3U36B 5HI5C 2VLKD 2FH8A 3WUWB 2Y7QB 1KTDB 3TBSB 3RPKA 4JHBA 5JQ6L 3IJHB 1T89C 4LLVA 5IBUG 4MJ6B 2A73A 1P4IL 5FM8A 5GRUH 4AEIL 2VDML 3LEXB 5KTEH 3N1GC 4YZFF 2ZOLA 4XTRC 4F2MA 1C12B 3BP4B 3A6CL 1KIQA 4HGMA 4WHCA 2DM7A 2PTVA 4IOFC 1IEAA 5HI3D 5F6IB 4DN3H 4DKEH 4JFFB 3BWAA 4AMKL 5IW6A 25C8L 4G6JL 4KROB 4LCYA 5CGMA 5MEPA 4MNQD 2H26B 3NABL 4HJGB 2JJWA 2YMXL 1WAAA 4RQQA 1VFBA 4WTZA 2E9BA 4KMLB 1DQDL 1RZKL 3WNKA 1YNTB 2VLJA 5JLZB 2BC4B 4RMVA 3VFGL 5F71A 4LF3A 3CZFB 1C7TA 2NX5A 3HB3C 4HKBB 4P46C 2UZYB 4UDUB 3AS3A 3O2DA 4XMKH 2IH1A 1JGVH 43CAB 4PJGE 2UVFA 4D94A 4U05A 1YPZF 5D72L 3MRLB 4F58L 4EOWL 1CQKA 4NRYB 3QNYB 1E4KC 3RWDA 1CK0L 4LCCB 2XZAH 3KLHC 3EYSH 2P45B 3R0NA 4KWUA 5DJDA 4NM4H 5DMJB 2YBRB 4RFNC 1QFWL 4P2RB 2R2HB 4U33A 4EUPG 2EO9A 4YPJA 2B2XH 4MD4B 1H15A 2XZQL 1CWVA 1NGQL 4RNRA 3C2SA 4RFEB 1I8IA 3CU7A 1JI2A 3KPLB 1J05B 1I1AA 2IBZY 1H5BB 1NDGA 4GJTB 5D71H 4OGAC 2AEPL 4XVJH 1IGFL 1WBXB 5GS3A 3RI5K 5TGBA 2EYSB 4L1HA 4XAKE 5KVDH 4FFYH 4ZUSB 3QFJD 2JJUA 4GMTL 4K3GA 3QBTB 2BNRE 2GEEA 3MRNA 3UDWA 3N50A 3JWDH 4QXGH 3OX8A 3WLWC 4HG4K 2CDEB 1AO7D 2WQRA 4O58H 4LK4A 3PHSA 3QEQA 5CAYB 2MCPL 5CEZL 2X6MA 3TJEL 1V5JA 4UNUA 1AKJA 4WW2C 2GW5A 1UVQB 3G5ZB 5ACMA 2HLFD 4P4RA 2CLZA 3D3VD 1BEYL 1E27B 1CIUA 4RMWA 5DEGA 1U8PB 1FNSH 4PLKD 5IHZB 4ZAKD 4XCEA 3CSYA 5JW4N 1CL7I 3JV0A 1MCKA 1JYXA 2LQRA 2E9WA 3WO3B 2AXFA 3ZYIA 2VXUH 2MKWA 2X4RA 3B2VH 1BFSA 2HH0H 1ZGLA 2GQHA 4PJDB 4L8CA 4X4MA 3RWJB 1EHLH 1M71B 4ORZC 1OGAA 2VAAA 4EXPX 1MIEL 3HI5H 4M62L 1KPUB 1T6VN 2EDEA 1HN1A 4EQ2A 4Y4FB 3WFCL 1QFWI 3UXFA 2YKLL 3GB7A 1R3IH 1X5JA 2CIIA 1RJCA 3SKUD 3K8KA 4NDMA 4NNYB 2W9EH 2P5EB 1FL5B 3QQ3A 1CL7H 4GKNB 3RFZC 1NGXB 3MROA 4YHKH 1IQDA 4JM2B 2P42B 3QEHB 3I2CH 4LSSL 1TPXB 5IFAL 4U6TA 1LEGB 4KVNH 4YEFA 5H35A 1QP1A 5LKNA 5MI0C 2AQ3A 4CMHC 4MQ7A 4O2FB 1XGUA 4G8GE 1K5NB 4C56E 4GXUN 4R4NC 4OFDA 1FBIL 1KPRA 4ZS7H 3O8XC 5TE6H 2QBWA 4MDJB 3L3GB 2P48B 4XXCA 4OIIL 3WS6C 1INEL 4XI5D 2FBJH 5HGBA 4WHTA 3WD5L 4KZEH 2F5BL 3RVXD 4L4TE 3V0AC 2Y07L 4HX1B 1EFXA 5IEKA 1YEHH 1EBAA 2RFXB 5I1AA 1S9VB 5J12C 2D9CA 4ZFFB 4LVEA 5I74C 4P2OA 5HPMA 2FEDD 1AXIB 1OP5H 3TIEB 1AGBB 4AM0A 3FB6B 2FB4L 3RVVC 4AY0A 3HE7D 5C0CD 2H2SD 3EOTH 1NLDL 1WZLA 1JGDA 1MCBA 1MI5D 5K93A 3S36H 4O9HL 1NAMA 1WCBA 5HD8C 4IMLB 2A9ML 2F9BT 5ID0B 5F93C 4JPIA 4YDVB 2AXGB 1PFCA 2RJMA 3HE6D 3VI4F 3RQ3A 2IGFH 5E24E 2CGRL 4OLUL 1JZ8A 1I9EA 3RX7A 4HIHA 1U3HB 4QNPE 3NCMA 4WO4A 1H3TA 3IDJA 1RZ7L 3NA9L 5C9JA 1UGNA 4ZO7A 1A1MA 4KV5E 3WIHA 4OFPA 5C0FA 3H3KA 3AGVA 4A2MA 3MLPA 1MEXH 1NCUA 1G7QA 4JHWL 5JW4R 3O41B 3MRMA 4FMFA 4R97B 3KR3L 4NQDA 5AYUL 4NQXA 4F7PA 3L6FB 3L1OH 4HEME 4JANB 2GSGB 5ANMB 5ISZB 2IPTL 4LVHB 3CFDA 1RIVL 3W39A 1N4XH 4QTHB 3MTRA 3QI9C 1XGPA 4LP5A 4NOBA 1FL6B 4X7TB 3QIUA 5C07E 2EDKA 5TJWK 3ET9F 4PJAE 2X4QA 4OUUA 2VDLL 3KYKH 1KB9J 3MNVA 5BZDB 4OZIE 3FO9B 1PJ9A 4MB3A 4NSKB 4P0DA 1QFHA 5I30L 1UM6L 1F4XL 4ZQKB 4F7TB 1JZ6A 1NSNH 4L8BB 4QRRD 3EGSA 3SGJA 2FJHB 4IM8A 1LEKA 2Q8BH 1JWUB 3VXUE 4WHYH 4JGMA 2AGJH 5D7LE 5HDLA 5CBAA 2WP3T 2VDRH 4K7PL 1AD0A 2R56H 3LQAH 5JDSB 2ZPKH 5L2KD 5D2LE 2YPLE 5MEQB 3BYYA 3AXLB 4TSBH 3FQUB 5CD3A 4GT7A 4YIQA 2J12B 4OTXH 1PEZA 4OKVB 2QKIA 4ZFZB 3DBXB 5A16A 4S0SD 2HMID 3FT3B 2AEQL 4PP1D 4K9EC 5CHNB 1J9CT 2PXYA 4J7RA 3OAZK 2MHAB 4PV9B 5SWSE 3TWCL 3C08L 4GFTB 1EJOH 4GQPH 5H2BA 3E6HA 4BZ1H 2ZJSH 5AG9A 3QXDA 4Q0XL 1NFDB 4YBLC 3MOAL 3PWLB 1FFOA 3MRIA 2V9RA 3UAJD 4O4YH 3RU8H 4DGIH 5DSCB 1QLRA 1KCUH 4FTVD 3GI8L 4TUKL 3NFSL 1ZS8A 4J3XA 5L0QC 3ULUC 2X4TB 3VGAB 3NFPB 4FQXB 1OW0C 5I17B 2ARJA 5IW3A 2O26U 4U1IA 2DQUL 3WE6B 3T65B 5FK9A 2HFGH 3FFCD 4DUVA 3GRWL 4WUUB 4KI5E 1J86A 5CP3H 1U8HA 1XF4B 4S1SH 2VZUA 3QFDA 3SBWC 1J1PL 3DUHA 4JY4A 5CSGA 1BJ1H 5B39G 3WXWH 3ZMRA 2KL6A 4RRPA 1FRGH 1ULVA 4Y19B 4ORGA 3EFFB 3BO8B 1TDQA 3LH2H 4NZTL 3SDAC 5MENA 5J3HC 1A2YB 5FECA 2AABH 3VW3L 3DIFB 4P5MA 4PJDF 2GJ6D 4MCZB 5K9KA 5I73B 1NBQA 4H1LH 2AXHA 4WI2A 4PV8A 4NN7C 3MLWH 3MA7A 2QQLL 5IHUH 3NCYS 5CZVH 1UB6A 3WXVL 2E6QA 5IOPB 1K8IA 3IFPA 4PRDA 2Z31D 1P5VA 1FDLL 3SCMD 3FB8A 4RMRA 1MVUA 2WIIA 4HS8L 2NZ9D 4JM2F 3VXRE 1QFUH 3WO4B 5KANI 2I07B 3LEYH 3WL9B 3PWVB 1X5HA 3KNBB 2YD7A 1WK0A 3HG1E 4N5UA 2OZ4H 1CE6A 3TZVA 5C09D 4LAQL 2VXSL 1NKOA 3C6LC 3QJFB 4GS7B 4Y2OA 4XVSH 1YPZA 1RURL 3H7BB 4U1KA 3HC0A 5IFHL 3O81A 3O3EB 4MJIA 2HTKC 4FQJH 4KJQD 2FWOA 5HYJB 1TETL 4R26H 2CUHA 4OLYH 4XP1H 5FKAB 1QYGL 3UJJL 1RV6X 5CSBA 1G6RL 2Z92B 1FSKB 1HIMH 4FZ8L 5D96C 2JJTA 3DUUB 3LN4B 3ULSB 1MNUH 3KPOA 1OAUL 5A3ID 4PJEF 3OXSA 2PYED 2XQYG 4LSPH 1I8KA 1IVLA 4MA3B 1A6VL 5IP4A 1KELH 1CFQA 1OAXH 4K8RL 2YD3A 4NIKB 2QQNL 3U4BL 5EZLA 2ZCLH 1P9MA 3K74B 1S7VA 4LLWB 4JFPA 4XNUH 2NTFA 4WI7A 1UA6H 2DLIA 4FQQB 4O51B 4K3EL 1DVFA 3GSXA 1S7UA 4FFZH 1ZMYA 1DQLL 1NAKH 3LSOA 5DWUH 1EEYA 4HIEA 4ZOCA 1J8HE 1CDGA 1M7DB 3CCHB 3QB7C 3IFOB 1N8ZA 4KK6C 5D1ZC 2C4FT 3TBTB 3LKRB 5FHBH 4RSVA 1FJ1B 4PLNC 5D1XD 4X7DC 1ZVSA 1I9RL 2CO6B 1AGCA 2SEBA 1S3KL 1LDPL 1ZHNB 5T3ZD 4POZC 4AQ1B 3TPUA 3CX5K 1X6LA 3DOSA 2HFFB 2X4SA 4OJFH 2HA1A 5IR1B 3HPJB 3ZT5A 1OTSD 4CU6A 2ICEB 5GXBB 5ECJE 3MYZA 4WRLA 3CMGA 3MODH 3ZSTA 1LEIB 3H0TA 5GRWA 3L7FA 2BXZA 1YUHB 3IU3B 2F74A 5I8EA 3HUJB 3U9UB 1XCTB 3VFUA 1U8LB 5F1IB 2R1WA 2AKRA 3VI3E 4D3CH 1J88A 1M6OA 3MLZL 4WJ5B 3P4NB 4G7YL 4KQ3L 4ZPVA 4LEOB 4LLYB 3TYGH 4NCC1 4ODTL 5C0EB 3DMMD 3QULB 4Y5XA 1AXTL 3MBEB 2NY0C 3UTTE 2R0LL 3L3JA 3ZDZF 5D2NC 5JPNA 3G6AB 5GS0C 1R5WA 3RGVC 5CIPH 1VFAA 1JPTH 1OM3L 3VA6A 4U7SA 4XBPB 3FQTA 4HV8A 3MLVH 4RZCA 5F9DC 3PGFL 5DVKA 1DBKL 5DF0A 2H9GB 3MOBL 4APQB 3S35H 3MUGB 3GSNH 1SVCP 2I5YH 3NACH 5FB8A 5J4MA 3GJFH 4YC2B 5FYLD 1J5OH 2QSTA 4NQCD 4L4VB 2Y72A 1ONQB 2W60B 1QSEB 4NQVB 4IHOA 3X12A 3HC3L 1WIPA 3I6KA 4PRBA 3VWKB 1L4IA 5JORB 2LU3A 1JI1A 4N90D 1T5XA 5LBSH 3IS1X 3TCLA 4XCYB 3SDCD 1SMOA 4G7VH 3WNPA 5DUPL 1KULA 1NFDF 1MUJA 3TA3C 3I3BA 3RZWA 1YEEL 1RJZB 4QHKI 5HHMB 1PBYA 4JFHD 5CJQL 4PTUA 1YEGL 2QADB 2D7OA 4OCXH 5CJOH 5CZKA 4JZJA 4NBZB 5DD6B 5AWNH 1T0MA 3KPPA 4YX2L 2EYTB 4OV6F 3AAZA 3ARDD 4DCQA 1P6AB 3HFMH 2JCCA 2OXHA 5IMOA 1P4LB 1HINH 2IJ0C 5GRJH 3UYPA 3DX9A 4G8EA 1UB5A 2UY7A 5LQBL 4OZ4A 4C4KO 2CDGA 4HS6A 3SGEI 5BQ7A 2R0KH 3U36A 4EI5B 5LJYH 4RMTA 4FA8A 4LQ1A 5F6HJ 3WUWA 2Y7QA 4YDLC 3TBSA 4ZD3H 1IAMA 3S34H 3OV6A 4MXQC 1NMAL 2C26A 2CK0H 4OLZH 4XNMA 4PJXE 3R8BB 1N0LA 5ICZB 3MXWL 4M6ML 4PD4J 3T3PF 4IRSD 3LEXA 1KN4H 1EA9C 3LPFA 3U9PL 2HRPH 4JFYA 2GITB 3HAEA 5I71B 2IAND 5HHQA 2YSSA 3S5LG 4XP6L 3VH8A 5INCA 3SGKA 4EDXA 2JB5H 3L7EA 1Q9WA 2ERJC 2DQDH 4JFFA 2P46B 5TF1H 4RIRB 2H26A 2JKXA 4RFOL 5D5MA 1KV3A 5E2JA 1T5WB 5IJVB 5LWYL 4Z7NF 4Z7WB 1T1WA 2XY1A 5FF6B 3ARZA 1NUGA 1AR1C 2D7MA 2Q76B 5JLZA 2BC4A 1Z9LA 4MXVE 1J0KA 2DQHH 5CUSH 3BX7C 3CZFA 3KYNB 1S7SB 2NY5L 4HKBA 4UDUA 4C55A 4NO2B 3KPSE 4Y16C 1FZJA 4PBXA 2BX5A 43CAA 3B43A 3BOVA 3RI5F 3ZKXB 2VMFA 3RWFA 2CKBB 4WFGD 2C9AA 4M48L 3OKDB 3O0RL 4S1RH 4X4ZA 5I1DB 2VDOH 3QNYA 3O9WD 4V1DE 2NYYC 4CUCA 4LCCA 5J6HB 3PQYD 4UQ2B 4BK5A 4PREB 1PG7X 2LTQC 4JO3H 4MQSB 3D5OF 5JXAL 3D69A 4AYFA 4ENEC 2H2PD 4NZJA 4Z7VF 3SKOB 3RVUD 1K6QL 2X1WL 3FN0H 1EO8L 1JTPA 1JGUH 2Y6SD 1NFIB 4ETQA 3IETA 2DQCL 3MO1A 1NC2D 4DOHE 3QNXB 2JB6A 2VDPH 1T04A 4RFEA 3I6LE 3BKMH 3KPLA 4IOIB 1PKOA 1YEFL 1ZSDB 3CXDH 2PR4H 4WFEE 1H5BA 3SDDA 2P8LB 4IRJB 4OLVH 5DJ6A 1YEKH 3RUGA 2WW8A 2OL3B 3GMNA 3GNMH 3O6FC 5HTSA 4ZUSA 5CCKL 5F7MC 3DI2B 3JTTB 3FB5B 1LO4H 5TDPB 2R29L 4Y1AB 3BKCH 4R2GC 4N9GB 1LE5A 5CLWA 3OG4B 5BVJA 3M8OL 3KJ4B 4Y5YC 2CDEA 1P1ZB 1DANT 3PG2A 1FH5L 4FQIH 5J8OA 4PGCB 2VWEE 2NY1D 3G5ZA 5B8CA 3UJIH 1FYTA 3GKWL 5DQ9B 2D0HA 5DD3H 1U8PA 2VTFA 3GJEB 5IHZA 4WFFD 5IB4B 3HMXA 1U2HA 1E6JH 3G6JE 4PGEB 4UU9B 4EJ1C 2AK4B 2PTTB 1WFNA 3TVMA 1TZGL 2HTLD 4Y2DB 1MIMH 1JZ7A 3MUHL 1BP3B 2WUCH 2EKSB 4OZGE 4LHUD 1GC1C 5I8OH 3Q1SH 3W9EA 1KPUA 2VLRE 4YXKH 4YFDB 4NZRL 3MV7B 4Y4FA 2IF7A 4YH6A 1NGYA 1Y18B 2FX9L 1YMHB 1EO7A 4R9HA 3OB8A 3DUSB 2ORBL 1QKZL 5TQ0H 1VCAA 3QIWC 3TNMB 1QHOA 3QRGL 5MERB 4ELMF 5GGQH 2P5EA 3QDJE 5JW5A 1Q38A 1AR2A 1KJMB 3UTQA 5LXGL 3CLEL 3QEHA 4DVBB 3BH8A 4OI8A 4ZUTB 4I4WB 2DI8A 3ZE2E 1JPFB 4ZS6C 2ENYA 4AT6B 3WFBH 4DGYH 4JPKH 4ODSH 2I25N 3IDXL 2FYYA 4O2FA 1K5NA 3V5KB 1I7TA 2APFA 5D1QC 4GOSA 2N7BA 5EWIH 1MCCA 5DLML 3B4NA 4KUZL 5E08H 2KQMA 2DI7A 3HC4L 5BV7C 5HHVL 1WC7A 3L3GA 4XP4L 5IWLC 4PJ5D 5E6YA 3STZB 3MACH 3WSQH 4U1JA 2VOTA 1FNLA 4O2EB 5B3NA 4XNXL 4RGNE 5FGCE 1CXKA 3QUXC 5ICYA 4HX1A 3U6RB 2WLZA 4C56D 3WHE1 4HMDA 2RFXA 1X6NA 2ZUSA 2BSRB 1I3GL 1CICD 4YNYB 4JG1H 4OZFB 1B4RA 15C8L 4QRPE 2BNQD 5I6XB 3MLRH 1BD2D 3UEZA 5ESVB 3Q6GH 3GMQB 1RHFA 1NEZG 3TIEA 4GRLC 5ENWA 2AV7B 3T0EE 3QDAA 1QRND 2B1HL 1KCVL 1UG9A 4BQ9A 4F37F 2EXYC 4G3YH 3VG9B 1T83A 2AJSH 4FFWC 4IMLA 2Q8AH 3ARED 2AQ1A 1T1ZB 5ID0A 4HBCH 4OCLC 1TQCC 4C4KT 5AUMB 4GBXC 4HUUA 5BOPA 2AXGA 4M7ZB 1KF9B 4LCIL 4BSVA 1OQOA 1JCKA 4NQEE 3DYMA 2CD0A 4RBPH 3VFVB 1ZVHA 1J0ZA 4HMEA 4OF8A 3DVIA 1H3WM 1N0XL 1HKLL 1JTOA 1U3HA 1IM9A 2IPKB 4QXTB 1PZUB 3VFWB 1CLYL 2PW1B 3CX5J 1MHEA 1O5DT 3K8LA 4PJCF 1RAMA 5FUZH 4K94C 5FUCE 4DN4H 3V6BR 3LZFL 4G6FD 3O41A 1JRHL 5I1IH 3S37L 4Z8FH 4LAJH 2YRPA 1E28B 2F54B 4NKMB 4UQ3B 2GSGA 2BHZA 5ANMA 4XBGA 5F9AC 5ISZA 4NJ9L 5SWZA 3QR2A 5GQBA 1WIOA 3BD5A 4QTHA 4ERSH 4HBQA 2AS5M 1FL6A 2OTWB 4JRXA 5KANG 1T6WA 3S3JA 4BFBD 4Z7WF 1G1YA 3MV9E 2WWKT 4CMMB 3VDAA 5BZDA 1D9KD 1G9MH 3QXUA 3FO9A 4H8WH 5HY9B 4NSKA 5ADPL 3NTCH 4MD0A 5T5NG 4ZQKA 4F7TA 5F7EL 4L8BA 2Y23A 4HK3N 2VLJD 4NT6B 4XPFL 2XT1B 3P0GB 3DECA 1EFQA 1A4JB 1JWUA 1OCWL 1ZTXL 2NX5D 4BZ2H 3HLAB 4I2XB 5CBEA 4P5TB 1RIUL 5JDSA 3AXLA 1R3HA 4N1EA 1XIWC 1JNNL 4OKVA 1PSKH 4ZFZA 2NY2C 2WBJB 1FFPA 3CH1B 4WU5B 2F5AL 3FT3A 4KZDL 2DLGA 1T2QH 2ITDB 3TM6A 4KKLC 4PV9A 3QISA 1CDHA 1WQVT 3Q5YA 1PQZB 2L7JA 4J1UB 4FQ1H 2PKDA 3GSWB 4PGDB 1JRHI 3PWLA 4ZUUB 4YHIB 4XVUC 4GQ9L 5DSCA 3GBML 5D6CA 5I76B 1I1AD 4KTDL 4EN3C 5GS2H 4XCNA 2BFVH 4JKPL 4JKMA 1A3LH 3HI1B 1MRDH 5D6DC 2DDQH 4N9OB 3TBVB 3NFPA 4FQXA 3L95B 5C0RL 2RAMA 3RTQD 3LVEA 2XTJE 3DNKA 2W0LA 3BP7A 5EZIL 1I1YB 4ZFGH 3CVHB 3T65A 5D93C 2Y06L 1T0NB 2VSCA 4E9LA 4ZTOL 4WUUA 5DMKB 4K7FB 5KSBB 5ADOH 4ACPA 5T1DH 4L9DA 3BGFC 3QEQD 1ORSB 3MV8E 3GMMB 1AKJD 4U6VH 5DJAB 2NLJB 4HF5H 4Y19A 5IIEB 1GXEA 3BO8A 5E5UB 5A2JH 3FRPG 1ZHLB 4J12A 5EB9A 1A2YA 4MNQB 2I60H 5EPMA 2PF6A 1M1SA 1D6EB 1NBVH 2BOBB 4MCZA 4OB5H 5EC1B 3RX8A 3DRQA 4NO0A 4UT6H 3U1SH 4K71C 5CGYC 1BM3H 1OGAD 2JIXB 1IC4H 2HP4A 1GCFA 3PP4H 3AY4C 3P73B 2GSIB 4HUMB 5EOCL 4NKDB 1MCWM 4YGVB 3DLQR 4Y5VC 1GGIH 1QA9A 3BMVA 4XPTH 5BO1L 1A47A 1RFDL 1HWGB 1XGTA 4ODUB 1WGOA 2Q6WB 5IB2B 5SX5H 2DQTH 3VXQB 2YK1L 3PWVA 5EZJA 3IVKA 3KNBA 3VRIB 3P77B 3RA7H 4S1DC 1JNJA 3FB7B 4L5FH 1NC4D 4R4FL 5C3TA 4KTEL 3MRHB 4ZDHB 1PAMA 2JLLA 3H7BA 4KK5D 2A9NH 3TNNA 3OQ3B 3O3EA 1BGXH 4HIIB 4M6NL 4Q58C 4XWOD 5HYJA 1HEZB 5DHYB 5CEZD 3IAGC 1MWAH 4XPGL 2Z92A 2G9HB 1RJYA 4KXZI 3P30L 3HG1D 3LPWA 1IGTB 5EBMB 3O2DH 3MJ7B 3PNWA 3LN4A 5GZOC 3ULSA 2VZ1A 1DLHA 2EIBA 5T33H 3THMH 2G75A 3QFJB 1KLUB 4KK8D 4QO1A 3CFKB 4MA3A 3C2AL 1W0WB 1VEMA 4WWKD 5I1HH 1B6UA 5DQJA 1FFQA 3F65A 5LGJB 2OTPA 4MZ2A 4ZSOA 1AO7B 4DGVH 5I16B 1QG3A 3EYOA 5DJZB 4P2OD 4LLWA 3OR6B 3QH3B 4PJHB 3D3VB 4BKLA 2Q3AA 1P4IH 5EUOB 4AEIH 3HPLB 3QHZL 3BPNB 2VQ1A 4KRLB 1HQRA 2E9IA 1CBVL 3A6CH 2JE8A 4M1CC 3U30B 2Z8RA 3QHFH 1IC1A 1M7DA 5MHSD 1I4FB 3CCHA 2V5RA 4G5ZL 5F1KC 2EC9T 3JXAA 2XN9E 4PJFA 5GHWL 2H3NB 3IDMB 3PGCA 2JELH 4AMKH 1JPST 4G6JH 2D03L 1FJ1A 3LKPB 5L8JB 4IMKA 3KS0H 1HSBB 3LQZA 3VGEA 2GK2A 1IC7L 3G08B 1ZHNA 5GIRB 1VESA 3ELAT 1S7QB 2G60L 2DOCA 4GRMB 1BVKB 4LCUA 5L6YL 4JO4L 1C5CL 1DEEB 3HPJA 1QACA 5KG9B 1Z2KA 1KB5B 5E0QA 2FX7H 2YA1A 4PJIB 2DBLL 1LEIA 3GO1H 3BPLB 3GMOB 1JYVA 1W72B 3BXNB 1J1OH 2OTUB 2MMXA 2APVA 3IU3A 1HYSC 3BZFB 3HUJA 4EOWH 1XCTA 4QF1B 3RKPA 4K55A 2DQEL 1X5LA 1CK0H 4MA1C 1XT5A 1T7WA 4LEOA 4LLYA 3FL7A 2GJZB 5C0EA 4YJZL 2EDTA 4DQOL 4JFZL 3ETBF 3QIUD 5DMYA 3FONA 4LOUC 4JN2A 4G6ML 2XZQH 1NGQH 4MQXD 4RAVA 1L6XA 3IKCB 3G6AA 1A6WH 1Q0YL 4JJ5B 5DXWA 4JO2L 3V2AR 1CZ8H 1JGLL 4XBPA 3INUL 3ULVC 4IDJH 5DZNA 1K2DB 3X14B 2H9GA 1KNOB 1L0QA 4L3EE 3M17B 3MUGA 3TF7C 2HVJB 3DTXB 1F4AA 3JV6B 4S1QH 2J8OA 4N0CD 4GMTH 5BRZE 1KT2A 3UTTD 4L4VA 1CLCA 1ONQA 5ILTH 2W60A 4XBEL 1QSEA 1S8DB 4NQVA 3VD5A 3DHMA 3EOBB 2ZUQB 1AD9A 2VISA 4WU7B 5HSFA 1J87A 3OAYH 3HE7B 5C0CB 4PTTB 4NN5C 4CADB 3TJEH 3LS5L 1MI5B 3VGBA 4D9QE 2GY5A 4XCYA 1BEYH 3F7YB 5EO0B 3SOBL 3O8XA 1M4KA 3F12B 1D5ZA 2PXYD 3L5WB 2IADA 4X0KA 1RJZA 4ZTPL 3HZMA 1WEJL 4MSWB 5SV3A 1MFCH 4KJWD 1E4JA 4L3CB 1KIRB 5DD6A 5E1AA 1Z0NA 1N5AB 4ISVA 5I0ZA 3NFNB 1BHGA 2VERN 1NFKA 5HDQH 1P4LA 3QO1A 4R4BB 1MHHB 3HI6L 4OI7A 4M62H 1P6FA 2P49B 4UAOB 5K9JL 3MLYH 4I5BB 1RK1A 2YKLH 1XZ0A 1JMZA 2EDYA 2ZOKB 4EI5A 3EO9H 5FIEA 5KSBF 4U1GC 3F7VB 4YHLH 3SE9L 1RUML 5DRZB 1NAMH 5GGVL 3RL2A 5ICZA 4FQPA 3C60C 4GRWB 1TZIB 2WAHA 4ZUVA 2KH2B 3H9SA 5L9DL 2OI9C 4MXWH 5C86A 2G5BB 4NHUA 2IAMC 4K3JL 4L8DA 4JRYA 4K3DL 3OKOB 1ZE3C 2L7UA 5DDHA 3V6OC 3S88L 4OGYL 3SJVE 4N8VG 4X6DB 3DARA 4XC3L 4X80L 3MCLH 1F45A 1YN6B 3F62A 3TT3L 5CP7B 1FBIH 1YDPB 2OL3L 2EDWA 3I50L 3UPAA 4OFYD 5GGSY 1MREH 3WIHH 4TTDD 4RIRA 4PG9A 4QRRB 1C1EL 4P4KD 4XH2B 5EU4B 1QD0A 2ITCB 5DEFB 5FF6A 1G0YR 4K9EL 2F5BH 3ILPA 1MRCL 5GGSA 5DO2C 1RZFL 2Q76A 1UZ8B 3MR9B 4ODVH 2VSDA 2DMBA 3KJ6L 3FO2B 4JN1L 3Q3GB 4JB9L 5HDOA 5C0NC 5L2KB 3OB0K 4NN6C 3B3IB 2OX5A 3P2TA 2Q7YA 5JR1H 5FOJA 5M95B 1N3NB 5DFVD 5AG8A 3VFSB 4JDTH 4M00A 2DTML 3QDME 1N5YH 2XNAB 1B2WH 3TZVD 1FE8L 1KJ3H 3QI9A 3RRQA 3OKDA 2XA3A 4Y88A 3ULUL 5DK0B 3T0VA 5HBBA 1I9JL 3U48A 4EIZC 1NLDH 1OP3H 5F3HB 5FO8B 3SE3C 2EH7L 3T8XA 2P43B 5E8PB 4MJID 4N8CL 3WIFA 2VE6B 2C4FU 4LPXA 2B4CC 3S3SA 1EVUA 3U0WL 4OSUL 3ESUF 2NTSP 1R24A 3KPSD 2R9HC 4ALAL 4QXUH 4HPYL 4ONHA 1Z5LA 4FTVB 4HULB 1F4YL 5I1EL 3T09A 4XCFL 1HSAB 3QNXA 4TOYH 3DO7B 4IOIA 1AHWB 1XEDA 1DQJB 3UYRL 4YDJA 4V1DD 5DK3A 1U6AL 4F7MB 4FFVC 5FDWB 2E27H 5FYKL 4XNYH 3VRLF 2OL3A 1IGIL 2ZUUA 5CJ5A 2AP2A 1EMTL 2VQTA 3FFCB 1QEWB 4PJHF 4PRIA 4J4PC 5EUOF 3JTTA 1FVEB 1IAOB 3M1BB 5FGBC 5TDPA 3C6SA 4N9GA 2CMRL 5JUEH 5CINL 1JWMB 2IBBA 3WUZA 3PXHA 4UDTA 3T2PA 4Z7UB 3PL6B 4PGCA 3SDXE 5DS8B 1YY8A 2LU4A 4YGAB 1AGEB 3LPGA 2NXZC 4LLQA 3M45A 5DQ9A 3JVGC 3HNVH 3T2OA 5IBUB 1ZLSL 2K3TA 1RIVH 2GJ6B 2YWZA 2N56A 4XC1L 1KXTB 4POYA 3QWRD 5I8KL 1NBYB 2AK4A 4LP4A 1BFOB 1FFNB 2PTTA 4F9LA 5FM4A 4MB4A 4WGVB 1CGYA 1OW0A 4BFEA 2CIKB 2QSCL 2O5ZL 2X1XR 4MA8H 5ALCH 1IGYB 1UM6H 4CW1B 4LVNC 2Z31B 5JIIA 1P7QA 4XPAH 1U8JA 5EO9B 3ME0A 3SCMB 3TN0C 5IMLB 3OKEB 3VXPA 4E41E 1NL0H 3SBWA 1Y18A 4AIXA 1J18A 1XAUA 4GG6E 1Q1JL 2APTA 2FJGB 5DD5L 1QBBA 4R90L 5C09B 3VXME 2R4SH 5DRWB 5MERA 3VA2C 3DV6B 4P2QE 1JGEB 2AK1L 1KJMA 3TO2B 4PR5B 1L7TH 2XZZA 2W0FA 1NDMB 2VLRD 4DVBA 1JN6B 4K8RD 1X4YA 4N0UE 4XCCL 4ZUTA 5DYOB 4I4WA 4MDIB 1JPFA 4HXAL 4XAWL 3PDDA 4AT6A 1JNLL 3KGRA 4OCWH 1NMCB 1ZXQA 3TWCH 3SKMB 3DHJA 4BQ6A 5GISL 3V5KA 4Q6IC 5HHPB 3ECBA 3RZCB 3FAWA 1U93B 5D7JC 2LVCA 3FO1B 2BP3A 4LSTH 2VL5B 1JPSH 5FM5O 3QDJD 1KEGL 5J6GA 4ZXBC 1EZVX 1Q94B 2PYEB 4U6XB 3STZA 3GI8H 2OK0L 4TUKH 4NO3B 5C7XL 3TO4C 4EUPB 3NFSH 5IBLD 1OSPH 3ABZA 3J8F7 2YS4A 3IDIA 1NGPL 1F8TL 2FEEI 2Y1VA 2EDQA 4MNGE 4W6XB 1DZBA 5I15H 1WFTA 5INDB 3RIAK 5CSZB 2J8UF 2BSRA 2C3WA 4YNYA 4Q9CA 4KDVA 3DYOA 1XFPA 1LK2A 2XPGB 5I1KL 3DVNB 1DBAL 3PGDB 4PGJA 1QSFE 4X98B 2AV7A 3TYFB 4NWTH 2XA8H 3VMNA 1CU4L 5C6WH 1HH9A 1F6FB 2PO6B 2HT4D 2N4IA 4MB5A 5E2VH 4IJ3B 3GIVA 2V17H 2XZCH 1VHPA 5AUMA 2YUZA 1KYOK 4MQTB 2XQYK 3ZDXE 3DGCR 6FABL 3DX6B 3GI9L 4H88H 3VFVA 3K3QA 1JHKL 2QQLH 2AI0H 3P4OB 2C7UB 5I75C 2ADGB 4ZO6A 3GIZL 2A0LD 5GGUB 2IPKA 4QXTA 1OTTD 2OJZH 3N1MC 2PW1A 3QDGE 1ZWIB 4X5XB 4GRWF 3DETC 4X8XA 5FYJE 5IGXL 1F3DH 2DWEB 5GS0L 2H1PL 1SJEB 3WDHA 1UT9A 1B0GB 5EU5A 4L9LB 4ZNCD 1E28A 2NY4C 1KJVB 5I19L 3W2DL 4NKMA 4UQ3A 5D1ZA 1F4WL 3CFEB 2FIKB 2V2XB 3A6BL 3DMMB 3JWDC 5IFHH 2XG5A 5L88H 3HRPA 2OTWA 1P53A 1LK3H 3AROA 4HKZB 3SY0B 4JFQB 2ZSVA 4CMMA 3B9DA 2X4OB 3HMWL 5J1SC 1KIPA 3V4VH 2ARWA 3ARSA 1WT5C 3CVHL 4W6WB 2R0WL 3LKQB 5D70L 4LLDB 4UBDD 3P3YA 3UO1H 2R1XB 4KDTC 4HQQL 4P59H 3BWUC 4K3HA 2X4UB 3G6DL 1JTTA 4MJ2A 2DLHA 4P5TA 2X89A 2VABA 4L1DA 1XH3B 1IEBB 1AQKL 1BPVA 1AIFA 3BT2L 1UWXK 4R8WL 4F15B 2MKLC 1SEBA 3SDCB 4P3CL 1DQQB 1G9NH 2COQA 5EA0H 3MMEB 1HQ4A 3S36X 2WBJA 2BDNH 5D2NA 1U2CA 3CH1A 4R0LB 1KN2L 1MFEL 4PP2A 3PIQA 3Q5TA 4XMLL 1OSZA 4TPRH 3HHRB 3JWOL 1AQDA 1HILB 4JFEE 1KIUA 1FO0B 1PQZA 1SHMA 4FQCH 4FP8H 4M7KL 3ARDB 1X5XA 4PGDA 3E8UL 2NXYC 3A67H 1YMMA 3VJ6B 1IGCH 3P4MA 1A64A 3BSZL 3OAUH 1IC5L 5I76A 3MRQA 4M43L 4LGRB 2D31A 2A83B 2JJSA 1I9RH 3SDDD 5J11B 4KI5C 4Y0GA 1MCSA 5ALBL 4YZFE 2F53B 2Z35B 5K33A 3TBVA 3L95A 2CRZA 1NMBL 5ETUB 1BJ8A 3RDTD 2D4DA 4UTBL 5CFHA 1MCIA 4P23D 1I1YA 2DM3A 4EBQH 4Z7UF 4YBQC 3MGOB 1HXMB 3CVHA 4NRZA 3U46B 1T0NA 3BMWA 1DJSA 4IRSB 2MPAH 5E6ID 3TA3A 5DA0B 3WS3A 4K7FA 9CGTA 4LIQL 4BH7B 3E6FB 4Z7QF 4CBPA 1ORSA 3MRRB 4WVRA 2IANB 3GMMA 4PJ8D 2KQNA 4C58B 2YHGA 1HHGA 5C0AE 1FYTD 4OLXL 1YA5A 4PYGA 7FABH 2DF3A 1DSFH 4KQ3H 3K1KC 4KKCC 3ZZ1A 4LPYA 1TJHL 1ZHLA 2XWBB 3VFPA 4XWGH 4FQLH 4KKBD 2M1KA 5DFWH 2BOBA 1D6EA 1Q72L 5EC1A 3TVMD 5HYFA 3OZ9L 3SQOL 2ID5A 3MV8D 3RWGB 3BP5B 1YPZE 1AC6A 4HLJA 4PLJC 1ZAGA 1S7TB 4LDOB 5KSAD 4I9WE 5E8NB 1BIIB 2JIXA 3X3GL 5EIIA 4U49A 4OM0H 1CT8A 5D7SL 3MRJB 1KACB 4GUPA 5F88B 3W5MA 4WENB 5J57B 1DN0A 4NKDA 5GS1C 5B38B 2ILLA 3QUML 4YGVA 3DX8B 3MV01 2Q6WA 5KW9H 5IB2A 1FGNH 4PB0H 1I1FB 3O9WB 3UJTL 1CS6A 4P9ML 3VRIA 3PQYB 5KVEL 1YY9C 1N2RA 3CFJB 5AYQA 5IQ7H 3WJLA 5DC0A 3NPSC 1DBBL 4PJ7A 3MRHA 4ZDHA 2Y36L 3D39E 4GAYB 4IRZL 1XCQB 4ZAKC 5AD0B 1JF6A 4PJGB 1OAYL 1JF5A 1NC2B 1HEZA 5K59F 2YD9A 3T2NH 3O45A 1IFHL 2G9HA 4WV1C 1T3FB 4YX2H 4RX4A 5CGTA 1IGTA 1TJGL 1HI6B 3MJ7A 1JHLH 3M07A 4LNRA 4I0CC 1GVIA 4Y16A 1W72L 3A0OA 4B5EA 3QFJA 1KLUA 2BZDA 1WTGT 4YLQT 2OSLB 4OZHA 4YXLL 2P5WE 2RBLA 1MFAL 2OMNA 3SO3C 3VMPA 5KS9B 3PDOB 5LGJA 3BUTA 4H0GA 1P7KB 2WBKA 5DHVB 1AO7A 4GAJL 1NMAH 4TSCH 1IKNC 1MAMH 3MJ9L 2NY1B 5DJZA 1R3LA 3QH3A 1PG7L 1GC1L 4HPOL 3HPLA 2IALA 1T1XB 3P11H 1NLBL 3WEXB 4KAQL 4TTGA 4QRQA 1EX0A 1IAIL 3LQAC 3BHBB 4C83A 1FZOA 1U42A 4XP6H 1KC5H 4JLRA 4TULH 5BS0D 1S5IL 3NCCB 2D7TH 3NMEA 2BY0A 2H3NA 5EUKA 3IDMA 3IXAB 5B39B 3BKYH 5DMGD 2XFXB 5KVFL 1CLOH 4LHUB 3O6FA 1Z9OA 5LWYH 3VFNB 5CILL 4LSRL 5H37G 2WUBL 3G08A 5GIRA 3MJ8B 4JHZA 1A9BB 3G04B