3CMOH

Hiv neutralizing monoclonal antibody yz18
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
AVQLSQSGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCTRWPHYYGGSRYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV neutralizing monoclonal antibody YZ18
rcsb
molecule tags Immune system
molecule keywords Fab light chain
total genus 43
structure length 222
sequence length 222
chains with identical sequence Y
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cmoH02
2IPTH 2CLZA 2NX5E 4Z18A 4APQD 5CBEB 2Q8BL 3BN9D 4WIQA 1CGYA 1QLFA 1FNHA 4CU7A 5FECB 4LNVA 2DYPB 2APWA 3NBNA 2X4UA 3QFJB 3KXFA 3HE6C 3P30H 5SX4H 5DQ9B 3RY6A 4AIZB 2WUCL 5DD6B 1KT2A 4I77H 5HHMB 4HZLA 3MRGA 3GUTB 1RUAL 1A21A 4QTHB 4BKLA 5INDA 4ODVH 1P4BL 3MQIA 5BZWA 3EJYD 2M2DA 2W9DL 4K23H 5I1IH 4JHWL 2CKBB 3NIFF 2FR4A 3MLWH 4TRPL 4EXPX 5C0AE 4WW2F 2PYFA 5GSVA 1LO3H 5CZXD 3G6AA 5J11C 3DURA 4F7EB 3GKWH 3BD5A 1F13A 2FYYB 4JFPB 4JO3L 5EU6D 4WFEE 1FZMB 3PNWB 4YPGB 2OL3L 4GW1B 2JKXA 5HDLA 5HYQA 2D7TH 3ELAT 3MV9D 4LLUB 3S5LA 5E99H 5JW4N 5DK2B 5E6IA 1OPGL 4XRCA 3U7AA 3HI6H 2X70A 4C54A 4R0LA 2NY0C 3JTTA 4GKOA 3RVUD 3KLHC 5E5MB 2XTJD 4KTDH 3VFOB 4YXLL 3HKFA 1MCPL 3NN8B 1WTLA 3CLFH 4C56B 3X13B 3IF1B 2XNAB 4JE4B 1I85A 5ESAA 5B4MD 3PP4H 1I1FB 2OZ4L 1FYTB 4DKEH 4HWUA 5TFSL 3RL1B 3IXTB 4GRWB 2F9BT 2PYED 3FO0H 4P5TB 3IFOB 4KK9C 5DHVH 2VLLA 4P2OC 4PS4L 5DEGB 1AE6H 2A9NL 3E8UL 4PG2C 5C09B 3MNWA 4OZIF 1G7JA 1Q9KB 4OGXH 1T80A 2E7HA 2JJVA 4NJ9H 4LQFL 3CSBA 4K2UH 1FO0A 2MSPA 1T22B 5D1XC 4JFED 4RAUA 1RIUL 1JPSH 1E6OH 1MREL 5GGTH 3OMZA 3ZDYF 2R2CA 4JPIA 5ANMB 3IJHA 4NQCB 4MA1C 2QR0A 3QI9D 4PGDA 5T1MA 3IDXH 1PG7W 4PJ8B 3UDWC 2V2WA 1FZOA 4OQTL 1JGLL 1JHTB 4BFGA 5HYJE 1R3HB 5IB5A 2DL9A 4W4NA 4G80A 3ZYZA 5C92A 2PXYC 4LEOB 2ZCKH 3L5XH 3ZO0A 5I75C 5DVOA 4K7FB 3H9HA 1FGNL 4L29B 3O41B 1A7OH 5IBTH 4GMTL 3H9SD 4HFUH 3RZCB 4P2RA 4Z5RB 4PRDB 2B7DT 4PY8I 4QRRA 1C5CL 4NO3B 3DX9A 2LTQC 4G9FD 1KYOK 1CLZH 2EO9A 5SX4I 2ITDA 4GKNA 3DJ9A 1CLOH 1KJ2A 3V7AG 3LSOB 1EMTL 4ERSH 4GLRH 2X4UB 1J88A 3PWJA 2Y6SD 4L4JA 3HR5B 4LCWA 1MEXH 5JW5A 3ZYOA 3DUUB 1BOGA 2GJ6B 1XF2A 5HGDA 3VXRD 2HRLA 5GSVB 1C5DB 2OS7A 1VESA 4F9LC 3HUJA 4OZHF 1ETZA 1ZT7A 3ARGB 2LVCA 4K3EH 1U0QA 1W72L 3ES6A 4IRJD 4RIRA 5TDNA 4IDLA 4FTVB 1NDGB 3BP5B 1FO0L 4PJ5D 2GCYA 1A7QL 1FV1B 2BVQB 2ATPA 2DM7A 2UZIL 1FNEA 3BGAA 3D3VD 5C1MB 4BJLA 1XF5B 2CQVA 3LD8C 4M6OH 1QRND 5F9DC 2DQHH 1BJMA 3JTTB 3SDXB 5JQ6H 2ZOKA 2A1WH 3HFML 1A3LL 1NUFA 5E5MA 2X10A 5GISH 4YHNA 3T2NH 3JXAA 5ADPH 3PUCA 2Z92B 1WFNA 5ETUA 2YWZA 3KPQB 1M71B 1U8MB 3WSQH 2NXYB 1OGAE 4ZD3H 2GTZB 3MXVH 1OP5H 1IT9H 1JPTL 1MQ8A 2JIXA 5KVGL 5J8OA 3OSKA 5IMLB 2J4WH 2WWMD 3TBTB 1I1FA 1BQLH 3OB0K 1X7QA 3MUJA 4XPHL 4YFLF 5GISL 2CKNA 2IQ9L 2ZJSH 4F57L 2DQHL 2HFTA 3HE6A 5JQ6L 1BVLA 2XXCB 1YPZF 3DV6B 2VTFA 3EFFB 5L88H 2C1PB 3L3HA 3HE7C 4B7IA 2YD7A 1IGJB 3RGVA 1I1AB 3B9KC 4LARH 1JFQL 5CEZE 3ULVE 3JWDC 3RP1A 2FLBT 4EEEA 1RUMH 1T2XA 2OR8A 1RZ8B 2XTJC 3QFDB 1WUNT 4OJFL 5FDWB 3T0EE 4JPWH 4I0KA 3LOWA 1DBAH 1WBZB 3MROA 4JVWA 3QIWD 3N1FC 4UT7L 2C3HA 2EIZB 3K4AA 2XZQH 2FHFA 4N0FB 4X6CB 3WN5C 3BN3B 3QUKB 1ES0A 3BQUA 4PLJD 5H2BA 1H0DA 5DFTA 1G9ML 1NLBH 3NAAH 3BN9C 5E4IA 3GSOA 4RX4D 5CKAA 1L0QA 1DTUA 3NZ8A 1FFOB 1I1AD 1JNJA 3FO1A 3PHQA 3FO9A 1B0RB 1MOEA 3GJFA 4KJQC 1T66D 4WFGE 1PKOA 4G9DB 2IMNA 2KQMA 3U30B 4J2XA 2GJ6E 3CXDH 3FB5A 4WNQB 3ZE2F 4NJAL 4OFVA 2ITDB 2I60L 4LCYB 2AXFA 2FGZA 1GGBL 3HG1B 5F7MC 1FIGH 2E8ZA 5FM8A 1A7OL 1QFHA 5MEND 2V2TA 2ESVA 4P0DA 1DQLL 4J12A 5DQJA 4HG4K 2E9JA 4XGZA 4CL7A 2WIMA 2DQTH 2ZUYA 3QFJA 3ZKXB 3W2DH 2H8PB 3HRZA 4XVTH 1FLRL 4K71C 1K4DA 3GUTA 4CW1B 4BKLB 4OQTH 3AREA 4QHNA 4OZIB 3MRCB 1IQWH 1H3PL 1A2YB 3QUZC 4TSAL 2VLKA 4OAWB 2FR4B 1DQQA 2A77H 5EU3A 1CDHA 3WO4C 2VUOA 5DRZB 3QIBB 2HJFA 1E6OL 1MREH 3BX7C 1CGTA 5IJKA 2WK2A 3ES6B 4N1HB 4WJ5B 3VFMA 5GS1B 1C8PA 5E08L 1JGEA 4G5ZL 4IMKC 3QCTH 4LGPB 1UVQB 1NSNL 5I0DA 5JHLL 5H8DA 1X5GA 5TJWK 1IGYA 1XF5A 3LHPH 2YN5A 2A9NH 2G9HB 4PPTA 4ZFZB 4NRXA 4PV8A 2NY4C 1UEMA 4OLEA 2Y5TA 2Y07L 4TULL 3ETBF 4G8GB 3FAWA 2OZ4H 1T7XA 4UNVA 1GCFA 3MNVA 4NQEB 4XNXL 3C2AH 1T21B 5E6YA 2BY0A 1KCSH 4LSVL 4P48A 4J1UB 3HPLB 5E2UH 1JTOA 1MCCA 3KXFE 4XNYL 5EBMA 5IVXA 1KCRL 1XF4A 4NWTH 2YEZB 3BEVB 1JRHI 1Q9LB 3QHTC 3K80A 1Q1JH 5HHPB 3QQNA 5C0AD 1FYTA 1B0WA 4MHHG 1V3JA 2WSKA 2Q7NA 2AV1A 2IGFL 1I7RB 1EHNA 1KFAL 3OKEB 2AERT 4PJ7A 5C0AA 4RCAA 4F8QA 1GGIH 5KOMC 3KPSE 3VXQB 4ZSOE 5BJTB 1KNOB 3A67H 3N50A 4Y1AD 3RTQD 3WS6C 2PTVA 3H9SB 1U8JB 2D3VA 3N9GH 5C8JB 4KTEL 2ZG1A 1U8KA 1QLEL 1W0VA 1VPOH 2VDRL 3DROA 4CN4A 1CWVA 4P4RA 5FDWA 1IKFH 3PGCB 1BMGA 4AL8H 1YEKH 1GPOL 4L4VA 4OGYH 2QR0B 4PGDB 5HVHC 5TE7L 5CJOL 2VC2L 2CR6A 2BC4A 3UPCA 1XAUA 3OL2A 4HWZB 3BHBB 5EN2A 1GOGA 1N6UA 4X7SH 3D3VE 3BZFB 3UYRH 3VA6A 35C8H 3U30C 5I8KH 4IOIB 1NFDA 2BVEA 4G6FD 3AGVA 4ONHA 4RMVA 2A83A 4GAGL 2PYEE 2IANA 4YZFE 2WBJB 3O9WA 5E95B 1E0OB 4EDXA 5T5NG 4OCLC 5I0ZA 4YXHH 5EO1B 4K3DL 4U1SA 4XCFL 5JR1L 3LN5A 5JOEA 3QNXB 5E4EC 5HI3C 3OTTA 1AHWA 1RZIA 2A6DB 4YQXH 3OWEA 5I1EH 4JFEE 4N8VB 1KCKA 3WNNA 4JN1L 3QWRA 2NY6B 3UYRL 2QSQA 1WICA 3ZKSD 3D39E 4NFDA 3DOSA 3STLA 2LV4A 1MCQA 4NQVB 4YR6B 4YXKL 4PGEA 4WUKH 4HV8A 1HDMA 1S7QB 3MRCA 1UCTA 5CJOH 3CVHH 1U8HA 4M62L 3V5KA 1TQBB 3DVFA 3DPBA 3U36A 1OP3H 4I0CC 4OCSL 2AEIT 5KVEL 3ULVD 3QIBA 3MRQB 2CLVA 1OT1A 3RY6C 5KZCB 3ARGA 1TETL 1I7TB 1I9JH 5DT1H 4WJ5A 1DBKH 1MCNA 2B4CC 2R1YA 3VD9A 1HKLL 1JK8A 4ODHH 4XCYB 3N9GL 1M7IB 1FV1A 1B6DA 5KSAC 3NFSH 5ITBH 3E2HB 1IGYB 1Z0NA 4X4MA 5ANME 2FSEB 1RZ7H 3GDBA 4LRIA 3VI4F 2F5AH 2DB8A 3F6LA 5E7BA 1R3IL 1GIGH 4YHNB 5B39B 1GC1L 5HYSG 5IGXH 3ORJA 3O4LE 3L7FB 1JZ6A 4JQIL 5JXAH 3O6KL 3D6GA 3T3PE 2HT3D 2UUDH 1AGEB 3H0TA 5ESQB 3RKPA 4P2QA 3PWNA 3T65A 4WFGD 2P8MA 1XGUA 1IC7L 1Q0XH 4JFYA 2WUBL 3C2AL 4Q9CA 3MGAA 1X44A 2Z31C 1BIIB 4LKCA 4XC1H 1AGBB 1O7VA 4MXVF 5C0NC 1WZLA 5B3JE 2GT9A 4PJHB 3IJSB 1YY8B 4TUKH 2BJMH 1I7RA 4F3FA 1CD8A 4ZS7L 5KANI 3O6LL 3OPZH 4NRYB 3ARYA 3S35L 5C0GB 1ZLUK 1DQMH 4PJ5E 3RGVB 5D6CB 4L8BA 1B2WL 4L3CA 5I6XC 3LD8B 1RMFL 3T0BA 1R0AL 1OY3B 1BGXH 4L3EA 4MQ7B 3JTSA 4Q2ZB 3MROB 3BW9B 2Y72A 1RZJH 2EEDA 4K3JH 1HEZA 5LVEA 5FFLA 5IP4A 2YA0A 3VXME 3QHZH 2VAJA 3P3YA 3QIWA 4KI5C 2PW2B 4E9LA 4XVTL 3VXUB 1A3RL 3VXNB 1DLHB 4BH8A 4OFPA 1DQLH 4QLRA 5ISZA 2FHCA 3SCMA 1MJUH 1FIGL 4JZNB 1FL6B 1CT8A 1ADQL 4MA7L 1NC4B 5IB2A 3JWDL 5K59E 3VXRA 2ILLA 4OD1L 1MCRA 5CD3A 3OGCB 2GHWB 4XCCL 1Q9OA 2K3TA 5IG7A 4Y16A 4YDJB 2XA3A 1PJ9A 2VXTH 1YY9C 4TOYH 4LCYA 4LPYA 4FG6D 2CGRL 5F8RC 2V2TB 2AQ2A 5IBLD 5DJDA 3DX8A 1OGAB 4UTAL 1MHCB 1F4XH 1RULH 1ZT4A 2OQJA 4NQSA 4YE4H 3PE9A 1BQSA 4PJIF 3N1QC 1X5LA 3C08H 4YR6A 3EO9L 3IDIB 4LNRB 5CHNB 4ONGL 1AFVH 4KK5C 2N7AA 4NCC2 5FKAA 1X5KA 2NNAA 4Y1AE 3V5KB 3EYQD 5GGQH 1YEGH 4NZUH 4GRWF 4PJ9B 1CS6A 2Y4SA 3S4SB 5B8CA 1DBAL 3GM8A 3BYYA 1XGQA 2X89A 4M1DH 4WFHD 4QNPE 4RA0C 3QPQD 1JNNH 1AGCA 1ZS8A 4LASH 5CP3A 1QA9B 3WO4B 2HH0L 4JFFB 4FXKA 1SJXA 4OB5L 4IS6A 1RURL 3GHEL 1S9XA 4ZUWA 2VR9A 3C5ZC 2GJ6D 3STBA 1B0GB 3BWAB 1MHPL 1SYVA 4HUKB 2VE6B 4QO1A 2BK8A 3MO1A 3ECBB 4IBLT 3KPRE 1L6XA 5JOPD 4FZEH 1T1YB 4OI9A 5IM7B 5MENE 3V7AE 3RDTA 2QV2A 3LVEA 4I3RL 4JJ5A 3ULUC 1HXMB 2V5SA 4I13B 3VD3A 5DI8A 5TH2B 5FUZH 1CIUA 5D2NB 4X6BB 3QO1B 3MPCA 3O81A 3GEWB 1R3LA 3FFCD 3LS5H 1XF4B 4OCXL 4OZGB 4F7PA 4JAMB 1A1OA 1MAJA 4OFDA 4OZGF 3T2NL 4I3GA 2VUYA 1Z3GL 4PJAF 1KEGL 4ODXB 3DGGA 3WNKA 4RWYH 3VG0L 5KSAD 4F7TA 2EH8H 5J6HB 1IFHH 2R23A 4RAVA 1AR1D 4GSDL 4XPBL 5GS0C 5F9JA 2YPVL 1KENH 5KG9A 1WCQA 5KSAA 1G6RH 4HX1B 1CLYL 2GI7A 5IQ9A 4UOJA 1OW0A 4J3OC 5FB8A 1EPFA 2MKWA 4GKZB 4L3EB 2X4OA 4MQ7A 4EI5A 1XGPA 5DURD 1GGYA 3BGMB 4HUWA 1MNUL 3HMXH 2DLEA 5GRYA 2EYRA 2ZOLA 3HNTL 3H9YA 3QDJE 1TCMA 4MDIB 4L9LB 2QTEA 5C0FB 4L4VD 2D2OA 2R9HD 1R6VA 1YDPB 4WENB 4HSQA 3KWWB 2H26B 4IOIA 3SDYL 5T33L 2F5BH 4LSPL 2A6KB 1S3KL 3DVGA 1OQXA 1CT8B 1ZVSB 1ZLWK 1I8IA 3N06B 3S37X 1JGDA 4XP4H 5JLZB 3O9WB 3EHBD 2F54B 4GRWE 1HHHB 4PRNA 1BBJA 5HJ3A 4FQ2H 4U1SB 2WQ8A 3OJVC 3K2UH 1AY1L 1MJ8L 4H0HB 4P46B 4PJ7E 3FQNA 4FQXA 3CFEB 3O3EB 1JMXA 3IU3A 5DJYA 1CXKA 4R0LC 1OGAA 3MSPA 1PY4A 4MNGB 3MJ9L 3G5YA 2NY7H 1QP1A 3GSRA 3J7HA 5DYOA 5A16A 3LQMA 3NIGF 3QUYC 4J6RH 4QHLA 4PJXB 5LBSL 4QYOA 3TEUA 3WFZA 2XN9B 4L1HA 3SKOA 1WIUA 2DDQH 2B1AL 2EDFA 2FIKB 4X5XB 5H35B 3ZTJG 4QKXB 4RISL 5DC0A 1E4XL 1A6UH 3NABH 1MUJA 3HI5L 5CINH 3L5WB 1D5XB 2I24N 3GI8H 3D85A 5DD5L 5HVGB 3F5WB 2FATL 1MFAH 3LB6D 5FOBB 1I9RL 4GOSA 1LO5B 3BQUC 5INCB 4L1DA 5CMAB 1JCKA 1KTLB 1ZA6A 5E56A 1MJ7H 2I5YL 2FEDC 3QEQD 5TQ2H 4ZUUB 2WBJD 3IAPA 4XP6L 1CU4L 1AJ7L 2XZAL 3AAZB 4NO0B 3VWKB 2VDOL 4G8EB 4KJYA 3HZKB 4MMXC 5FIEA 2R0WH 3L7FA 4IMLB 3V6ZA 4OM0L 1CDBA 3FTGA 4X7CC 3H0TB 4Q9RH 4NPYB 1W0WA 3B3IA 1R3LB 5MERA 5JDSB 3IFLL 4KUZH 5ELIA 3NIDF 3GSVB 3QEUA 3QSKB 4OZGA 4JHAH 1QFWH 1W8OA 4YXLH 4CDHA 1IGMH 4BFIA 5IHLB 5MI0B 3S96B 2MCPL 3PJSA 5AWNH 4ODXA 2F74A 3BKCL 4H8WC 1ZLUH 4LPVA 5EZLA 2OTWB 1FP5A 4NUGL 1KJMB 1LD9A 4RZCB 4TYUA 5KSAB 2Y1VA 3GZKA 5EH1A 1DQDH 4XMLH 5EUOB 4H1LB 4X80H 1XGYL 3H42L 1YUHA 2LAGB 5HGAA 1CDJA 2ZCLL 5I8OH 1ZGLM 4PLOB 3WIHL 4TSCH 2PYEA 1A7PH 4UOW0 5GJSH 1I1YB 1QFUH 4JFZH 4N0YH 5MP6H 1MCEA 3DGCR 1MQKH 3KPMA 5F1IA 2H32B 3WV0A 3KLDA 4GXUM 5ACLA 5C0FA 4JFEA 4Z7UE 4I77L 5ID1A 1HYSD 1NGYB 1J0ZA 2WUCH 2ZCHH 4O5LL 5KS9E 2L7UA 3EAKA 3VFRA 3EZ8A 2YD6A 1WAAA 2H2SC 3NA9H 3T08A 2FX8L 3C09B 2A6KA 3STZB 1ZVSA 2EDKA 5ECJE 4R2GB 4K8RH 4P4KB 3SHSA 3OR6B 4M8QB 4PBWD 2ARJB 3FT4B 4IDJL 5TGBA 4R7NB 4HPOL 5IG7B 3WFDL 3NCMA 4Y16B 2HMID 4FQXB 4AIXA 4PJIB 1U95A 3V2AR 2AJYH 2OP4H 1JUFA 3MYZA 2QQNL 3VDBA 4MGXA 3ALPA 4MNGA 4EI5C 1OT2A 1DVFB 2AQ3A 1H15B 3AM8C 2Z4QB 3QQ4B 3ARBC 4P59L 2X9XA 1LK3L 1TENA 5A16B 5EIIA 4LRNL 4MX7B 1N6QL 1XGTB 2HAZA 5EB9A 2PUQT 3SDDD 3ZKNC 1H5BC 2NY0D 3BP4A 2Y7QB 5KSVA 2W59A 5BCAA 1IAII 2X4RB 1U8PA 1GGCL 1V3MA 2H9GA 3TWCL 3ZZ1A 1RK0A 1U8IB 1AGDA 1KCUL 1UB6A 3MACH 3WHE1 1S9YB 3Q1SL 5GS2D 4D94A 4JFDB 1MI5B 5FYLE 1TQCC 1QA9A 2YPLA 3MJ6A 4PGBA 5CEZL 15C8H 2GTWB 2RFXA 4N5EC 1INEH 1Z6JT 2P4AB 4OLWH 3NFNB 1MVUA 5DWUH 4TTGA 4PLKD 4L4VE 2FWOA 3WNOA 1GGCH 3VMOA 3VWKA 3NGBC 1WZMA 3MREB 5KW9H 4XPTL 3RDTB 5E8OA 3V6ZB 1ZT1B 5TDPA 4U1KA 1NAKL 1CFNB 1IEAB 1VADB 2VLRA 5BW7C 1IAMA 1B6UA 3DXAB 4HJGA 3DXAD 4XWOC 4JDTL 2OP4L 2NZIA 1DUZB 3RPKA 5I1JL 4PD4K 5D1XA 1GJIA 4Z7VA 5IHBA 5JORB 1UWXK 2QHRL 4RWHA 3QZWB 1U6AH 1KPVA 1W72B 5HD8C 1FDLH 2BCKA 1YN6A 1KJMA 2Q3AA 1LD9B 4ODWB 4RZCA 3V9FA 4TSBL 3SKJL 3FZUC 4KVNH 4FFZL 4KDTC 2P5WB 4S2SB 3ARRA 4P57B 5ERWB 3FQRA 3KDMA 1KB5A 2YSSB 1TZGL 4Y4FB 1H9VA 1HI6B 3VRLE 3WIIL 1MCIA 2W0LA 4W6WB 3THMH 1R24B 3LCYA 5GJSL 4RDQF 4H88L 5K33A 5JHDB 5CLWA 4OSUH 4MD0A 3H42H 4R97B 1FFNB 2XQBH 4X80L 2C4FU 2H26A 4HIXL 4ZUTB 3MRHB 5DQ9A 3S6CA 3RVUC 4B41A 2WAHA 2FEEI 4PIRF 4X4ME 2F8XC 1EAJA 1SJEB 2BHUA 3QIWC 1JGDB 4Y4FC 5JLZA 3QXAB 3PWPB 4FFVC 1FQ9C 2A2QT 2HT2D 5ICZB 4MXVE 4FQXD 3QIBC 1G7IA 4HDIA 1LHZA 1ACYL 2B4CH 1ZGLP 2ED9A 4E41A 3DURB 1MF2L 3IGAB 4HS8H 4YNYA 1YN7B 4JO4H 4M43H 3AMKA 4P4KD 1FZMA 1UM4H 3FO2B 3G5YB 1MHHB 4IDJH 2C9AA 1U8QA 1VGEH 4PRHA 5EIIB 3UXFA 5HYQB 1XGTA 1N6VA 1G7QB 4O2CB 2Z93A 1KN2L 3NCFB 5M94B 5KVDH 2DLGA 2AEPL 1RIVH 3RNKA 2FEDD 2DMBA 5H35A 2H9GB 4XCEB 3WJJA 5MENA 2VL4A 2OTPA 1U8IA 4HPYH 1T1XB 1SJHB 1S7VA 3MRIA 3NN8A 4RGNB 5EORL 4U6HA 2YOCA 3HB3C 3CLEH 4F8TA 1FNLA 5IV2B 2FZ3B 3WD5L 1G9EA 4B0MM 3ARBA 3ZYJA 2AJZB 2R1WB 4H0GA 4PGBB 1J86A 5A2FA 2XNAA 3V6FA 2NR6D 3GB7B 1KTLA 4MLSA 5B22A 1KJ3L 1NJ9B 2P8PB 1NBZA 5DJCA 1NGWA 1DQDL 2HTKC 4JRYA 1TNNA 4G42B 4G8EA 1MFEH 2HN7A 1YMMA 4F37K 3QJHA 5KANG 1GOFA 4YDIH 3BJLA 3QRFM 4X99B 1YNLL 4FHBD 4U6VH 2YWYA 3E3QE 4HIEB 1FO0B 1GVIA 4NHCL 2QBWA 3VFNA 3VXSD 2Y23A 2BRRH 2DIAA 4LLWB 2ZSVB 3IDGB 1AQDA 1EH9A 4BFIB 4UINL 4XI5C 2BVUA 4Z76B 3RWEB 1WLHA 2J8OA 1MJJB 4YLQT 3IETA 3IDYC 3QZWA 2D4FA 1T89A 4HJJL 2QEJA 1KIPA 2R0WL 1BQUA 1MHEA 3MV8A 2D0FA 5F1KC 1JRHH 3ISWA 5IFJB 4M1CD 2B2XL 4YBLC 3ARPA 2DTML 3RU8L 1ZANL 2Y36H 1RU9H 3TH3T 1NCUA 4HS6B 4NSKB 1U3HA 1PW3A 2Q86A 5HGAB 2VLJD 3VWKC 5F96L 3FQRB 5C2UB 3EGSA 4UT9L 5MEOA 4Y1AA 2XWJB 5IBUG 2OSLB 1NCBL 2KL6A 1I4FB 5FV2A 2V17L 4KQ3H 3ZL4L 5K9JH 1SBBA 4NQED 3MLUH 4ZUSB 4V1DB 3LKNB 4XP5L 5IESH 4EDWH 3OKNA 2XN9D 5C0CA 3MA9L 1S78C 2GK0B 4KKCD 4MD0B 1XR8B 3HE7D 3HB3D 5EUOE 1BPVA 2DLFH 3HC4L 3O6MH 5DLML 5TPWL 5AD0A 5HBBA 4P4KA 3FONA 5F89A 1OTTC 3PWPA 1IFHL 3QIUB 2CUMA 3EYVB 4JG0L 3QG7L 3MV9B 4HKZA 2HFGL 3KPRA 3MJ9H 4UNTA 3FN0H 3F62A 3PWPD 1P4IL 3DX6B 4E41B 4KDTA 5F6IB 4ORGB 1U95B 4MXWL 1H3VA 1E4WH 4DKDC 3LZFL 4N8CL 3CFJA 1N7ML 3PQYD 5TDNB 1H3TA 1H15A 3PGFL 3VI3E 4N0CC 4DZ8B 1RVFL 5DDHB 4PRHB 3RWHB 2DQFA 4WWKB 2OXGA 4FN0A 1QNZH 1LO2H 5EU5A 4QY8B 4U1IB 1I8MA 2HT4C 1MCBA 1TVHB 4FZEL 1VACB 1FAKT 2X4RA 4ELME 4NKDB 1HILA 4DGVL 4XCEA 2ZOKB 5MENB 1MLBA 1F00I 3LH2L 3OG6B 3DARA 1IGFH 4JPVH 4X9IA 5EOCL 5HI5D 4MD4B 4Z7WB 1M71A 5IEKB 1FC2D 1R3KB 2HTLD 3REWB 2GTZA 5M95B 4X6DA 4JFFE 1DP0A 4UBDD 2CDGB 2RFXB 4WDIB 1BZ7A 3HCVA 5KN5A 4HPYL 5I8CA 4PTUB 4AG4H 4WV1B 3G6JF 1EO8H 1GGUA 1NGWB 2G5BA 4UI2A 3SDAD 1A5FH 3FB6B 5BQ7B 3GMPB 5AZEL 1JGVH 3V0AC 1J8HE 4QRTB 5DJZA 3L3HB 1J05A 1ZT1A 2O61A 1UGNA 1BF2A 2DQIH 1LE5B 1CFNA 1FYHB 3ARED 3O45A 4K94H 5DHVB 1BBDH 5CEXA 1X5HA 1YEFH 4GG8B 3M8OH 3GIVB 5EZJA 3BI9X 1EERB 2IG2H 3MLZL 3BWUC 3VI3F 2XTLA 2I27N 3MRPB 4LLWA 2I9LB 5DZNA 1YEEL 4R6UA 3W0WA 3DETC 3AXLB 3FHAA 5EZIH 3GFUA 3SQBA 1YJDL 4YHZH 1PQZB 4D0DB 1JIBA 1IILE 1KPVB 3JWDH 4KK8D 4LLYA 1GL4B 4XAWL 2FJGB 2R2HB 5GPRA 3L3GB 12E8L 2IADB 1PAMA 1EFXA 3GRWH 4OT1L 5FOJA 1UENA 5T3ZE 4U33A 4PJGE 4WEUD 4EUPG 2XWBB 1FL3B 1KB5B 3AS1A 4G7YL 2AK4E 5DRWA 3QT2A 3ARWA 3TVMA 3RJDA 5IKCA 5FYJH 1VERA 2ICWB 3QUZA 2BNQE 2NY0B 4P5KA 2NYYC 4XB7A 3OKNB 5JW4M 2P8LB 4IRSB 3JUYA 1YC7A 4LLMA 2ESVB 4Y8DC 4WCYL 4YUEH 4PLJC 3OR7B 4EN3C 3TYGL 4QXUH 5IIEB 2A9ML 3G5ZB 3JSSA 3MR9A 1QLRA 2EYSA 2H8PA 4DCQA 1DQML 2N7BA 2H6PA 1XIWB 3U83A 3U0PB 3CAFA 3EYVA 1N3NA 1T66C 3OJMB 2IBBA 1A2YA 3QDAA 1HHIA 1WEJH 1B4JL 2EDRA 1P9MA 3GSNB 4D0CA 5SWZB 4Z7WE 1CFSB 2VQUA 1S78D 2BY2A 4YDVA 5JHDE 3VFMB 1G7MB 3S37H 2IQAA 3FO2A 2DN7A 4DTGH 3P73A 4R90H 4UAOC 1KF9B 2DQFB 1UVQA 4KV5E 3I6KA 3MUY1 1U92A 3ARDC 2Z93B 3CFCL 4MAYC 3ILPB 3C5ZD 2G2RA 2W07A 2Q6WB 1G6VK 3SQOL 1TVHA 5JQHC 5KW9L 5GS1C 1A8JH 3MBEB 4P5MA 3O0RL 3TT3H 3HMXA 1MLBB 2Z8WC 1T0MA 4HUUA 5IB3A 3AY4C 4XAKD 5DZOA 5F9WC 4DKAA 4M4RA 1RJZB 2VH5H 2VWEC 5DRNA 4QF1A 3M17B 4NP4H 3WIIH 3O8XB 4WHDA 4ODHL 2RHEA 3ARBB 1S5IH 1OL0A 4X0KA 5LXGL 1RUKH 3OGOE 5T1LB 2UY6A 4YDLB 1TETH 5L2KA 1LE9A 1Q9LA 3L3JB 2YXMA 4Z7QF 3FOMA 3QO0A 3U9PL 1NBZB 5E9DD 3DYOA 4PJ7B 4KVCH 3NH7H 3S97C 4HULB 3OXRB 5EZOL 1X5XA 2CJUL 4HLJA 4PRID 1I3UA 3MUHL 4Y89A 5KS9A 4LRNH 1JWUA 4X99A 4R90L 3WFCH 3MODL 5C8JA 1QBLH 3HC3H 4Y5VB 1CQYA 1VFMA 4Y19E 3O2DA 2GAZA 4GG6B 4NBXB 3S34H 5CIPH 3X12B 1J0HA 3V5HA 5JOFB 3LPFA 4E42B 2AK4B 3KYOB 3MRNB 5J3HC 4GBXA 1RHFA 3MODH 4K3DH 3CDFA 5HDBE 4CRPA 2YD1A 1IARB 1KIPB 4OM1L 1L6ZA 1DVFC 4IEFB 2BNRD 2FJGA 3BH9A 2GEEA 4LLDA 5EULV 1LK2A 1QPPA 1FYTD 4JKWA 4NZRH 5CZKA 4ZTOH 3FKUS 2ENSA 1U3HB 2Q86B 4GW5B 3WFHA 1CGUA 4GXUN 1FL3A 4MJ4A 5MEOB 1T20A 1EA9C 1II4E 5MI0C 4G8FB 3GBNH 2YUZA 5HYSA 1GPOH 3BUYA 2EC9T 2DKUA 3HRPA 4JFZL 1T83C 1KEMH 4JDZB 1KELH 3TA3B 3D18B 3TBWB 2D03L 4QRSA 1QLFB 3WIHH 1NFIA 3C6LD 5EFIB 3VXOB 4OCSH 3ZE2E 2W60A 1URLA 1T0PB 1RFDH 4LDLB 4ODSL 1QSFD 3CVHL 2EZ0C 3D39B 5FGBC 3VFWB 2ZUVA 1Q38A 5I1LB 1AO7B 3DHMA 4NQVA 5L8KB 3MRGB 1T6WA 3VJ6A 5INDB 5F89B 1U91B 4LEXH 3NOIA 2OMNA 3HAEB 1A6AA 1EHLH 3IDNB 5E2TH 4ETYA 5AWNL 1QSVA 4EI6B 4OLUL 1XCTA 3LKRA 2Z35B 3IDYB 5EU4A 5EO0B 3MV8E 3UC0L 4U6YB 1M7DB 2RCSH 2PCPA 2IQAB 3PNWA 3L5IA 2H2PD 3MBEC 1ZHNB 2LFGA 3VFUA 4YH6A 4PJEA 4PLKC 4GAGH 5DGQA 4XNXH 5EU5B 5CUSL 2G2RB 3PL6D 2M8XA 5LJYH 2VO5A 2XKNA 2FH6A 1IJ9A 2BVPA 4JRYE 3PV7A 2AXJA 4MXQC 4AG4L 3LKQB 2E9BA 3M17A 3M1BB 4YFEA 3PP3H 5IUSA 1CDIA 1UCBL 3G6JE 2E27H 5IEHB 1B88A 2P8MB 4KHTL 2KH2B 1KTKE 5EOCH 1IGFL 3DX7B 2DWEB 4K8RC 1QVOA 5I6XB 1M4KA 3PWPE 4U1JA 3RTQB 4DGVH 3IFOA 4KTEH 4UNUA 1I9IH 4IIQA 4EVNA 4PREA 2WP3O 3O8XD 3EW3B 3FB6A 4HC1H 4XPGL 3QAZB 5EUOF 1GGIL 3HPJB 3MRJB 4J6RL 5J1AA 3HC0B 5FKPB 4NM4L 1PLGL 1QUNA 2NY7L 3QUML 4OZ4B 4L3CB 4G6AD 4PFEA 3FFCA 3LMJH 3OF6D 3D9AL 1NBYB 1D5IL 3G9AB 4NKIH 4XXDB 4E42A 5CEZD 1KCRH 2FDBP 4U6XB 4GRMB 3X11B 5DSCB 4LSRL 4LL9A 4ONFH 5AEAA 4Q9RL 25C8H 3CC5B 4OM0H 1REIA 2YKLH 3SKNB 3ARDA 4MAYA 1F90H 2B0SH 3MV7B 4PUBH 2ADFH 1UWEL 2NLJB 1MCLA 5EUKA 3VMNA 4JFFD 3VXUA 2HKHL 5JO5A 4LLDB 5ISZD 4BH8B 4H8WH 1K8IA 2UYLA 5JPNA 1LO0H 1E4JA 3ZHKA 1AO7E 3KLAB 5TQ2L 4GQ9H 3WFEL 1AD9B 4XP5H 5IESL 1FE8L 1NC2B 1KIRA 2ORBH 3WE6B 1M6OB 3M07A 1KPRB 5B21A 4G8FA 5HYSB 5I17A 2EZ0D 4Q9QL 4PRPB 5GQBA 1J8HA 4IRSA 1KJ2B 1NEZA 1NCWL 5D6DC 3TVMD 4WI4A 2IH1A 1UXSB 2AVGA 1RUML 2XA8H 1FFRA 4KRPB 4LARL 1IMHC 3X17A 1UWEH 1EK3A 3D2UB 2EEBA 1JN6B 3U0PA 2EDJA 4ZFFB 1WCBB 2X6MA 2YKLL 5L0QB 2W91A 3QXUA 2Y9RT 3RKDC 5JZ7D 3DUUA 3GMMB 3IT8D 3RFZC 2XOTA 4G8GE 3RX5A 1CDUA 4RGNE 4G6ML 4K7PH 1XR9B 4Z7UB 3ESUF 3UTPE 3BIKA 1BF8A 1IT9L 1JPTH 3TH2T 3QUMH 3SE3A 4M61A 1VFAB 4JM2A 2NY4D 3SPVB 4DK6A 1KT2B 2JCCF 4O00A 1IGTA 5DHYA 3VGDA 4LSPH 4HC1L 1R5VB 3JV5A 4LHUG 1B0GA 2H3NA 2XPGA 3TCLA 1G9MH 3BKMH 1PBYA 4KI5E 1Z9SA 1T1YA 5LKNA 3G6AB 4HXBL 3EOYG 2HVJA 3LB6C 4IOFC 5KAQF 4JFPA 5EBGA 2AEQH 5EC2A 3RGVD 3TF7C 4UT9H 4RQQB 2BRQA 5JPMB 3CLEL 4KTYA 3N1PC 3DMMB 4J7RA 1HNFA 1X4ZA 1T5XB 3RVVC 4QOKB 3CVHA 3BGFB 5JA9A 3GSNH 4TVPH 1KIUA 2NY5C 3OXRA 2W65A 4R26H 2ICES 3RI5K 4OFYD 1EO7A 1VFBB 3KYKH 4RMUA 3IJYA 5KS9B 4G6JH 4HK3N 1D9KB 4XZUB 1P4LA 2BSSB 1WGOA 3OKYA 3QJFA 1HQ4B 3SOBL 3U9UB 5FA4A 2DM2A 3OAYK 3RVVD 4GKZA 2JJTC 4LKXB 1U3YA 3GMNA 1WBZA 1UZ6F 5B3NA 1C5CH 2VLLB 3WSQL 3VG9C 2V6HA 4YDIL 2BNRA 1XFPA 4YK4B 2Z31B 4PRPE 3B9VA 3VDAA 2I9TA 1ADQH 5DVKA 4CDGC 5JO5B 1T22A 3RWDB 1NFDE 4NM8H 5I74B 4ODSH 4XBPA 1MHPH 4NFBA 2R15A 4ZO7A 1C5BH 2CRIA 2VAAA 1UA6L 4WVRA 1JGLH 3UTQB 3TBYA 3ARDD 4MAYD 1HHHA 3P2TA 1DBJL 3SO5A 4NO5B 3VWJB 5BOPA 1XH3A 3K1DA 2DI8A 3GJEA 3MUZ1 4UUJB 3E6HA 1BM3L 4V1DD 4G80B 2EDYA 2R9HC 4O51A 4X6DE 5DQJB 1BFVL 4PJXF 3D39A 3EYFA 3O41A 1FZJB 5J06A 4C58B 3ULVC 3EO9H 3OJDA 4CW1A 3VJ6B 1LDPL 2W0PA 3V6BR 3VFTB 2YD9A 3SKOB 1DQQB 3RIFF 1VSCA 3I02A 2X41A 1TZHB 2K1MA 3MUGB 5IVOA 1IM3A 4G9FB 3UC0H 4YEFA 2X1OA 2NX5A 5LGJA 2HJFB 5CGYC 3BRFA 1YZZA 5EO0A 3WL9A 4M6NH 4IMKA 5E2TL 3BIKB 4XCCH 5BRZA 1I1RA 2FO4B 5KSUB 4XPAL 5F93C 5HGHB 2JJUA 5L2KE 3T0AA 4PJEB 2CR3A 3HS0B 2XRAH 4M6AA 3TNMA 5IBTL 1GOHA 2FBOJ 2XPGB 3IRZA 4Y5YC 4F80A 1J18A 3TN0D 3AAZA 4UMGA 3U9PH 1F6AA 1C5DA 3U1SL 2D03H 2E7LC 3LKQA 5E8EA 2BNQB 5DD3L 2V9RA 4OF6A 4ZUVB 1TJGH 1QSEA 5ITBL 3NCJH 2NXYC 1Q94B 4DFHA 1RUKL 1TLKA 3K8KA 2BMKB 4GJTB 3CXHJ 3ZLQC 5DJAB 4ZODA 5EC2B 3OKMB 5GRXG 4PGJA 5JPMA 1O7SA 4POZC 5E0QA 1BREA 4NP4L 4PJGA 4W6YB 1ZMYA 1FNEB 5BS0E 4NKMA 4U1JB 4XC3H 1B2WH 3PJSB 3KJ6H 4AT6B 4CGTA 3BIAX 3PXJA 1VEOA 4R9HA 1EEUA 3MV8D 1NGQH 1S9VA 2RJMA 4TSBH 4Z8FL 2HLAB 1HIML 3E8UH 3KPQA 1N6QH 3H9SA 4ODTL 4D8PB 1BEYH 3HC0A 5FKPA 2JELH 1P4LB 2BSSA 3FRUA 3K8MA 3QPXH 5E2WH 2X9WA 4YHKL 1W0VB 3V52L 2ZKHL 3CXHK 4JR9H 4G3YL 4M7KL 4G8GD 1AD0A 1B4JH 5DSCA 5GS3A 3X11A 1QBLL 3SE3C 5H37H 2E7BA 3O6KH 2CK2A 3DWTA 5AAWA 3Q5TA 2C1PA 1LEGA 5L8LB 2VNCA 2VISB 3RVWC 3Q3GA 4P23B 2DJ4A 1S8DB 2DWDB 2F5AL 3QPQC 5D2LB 1J0JA 3TYGH 3UCRA 3ULUE 2R8SH 3RA7L 1RZ7L 1C12A 1NFDB 4O5LH 4Y2DC 3KLAA 3RWCA 2O5XL 4I18C 1HZHH 2VAAB 3GMRB 1CDYA 3NFSL 4KKLD 4MWFA 4HG4J 3QIBD 4HGWA 3RPIB 5FYKE 4NQDD 2HJLA 4BZ1H 4YDKL 1S5IL 1MRDL 3WMSA 2YS4A 3WFBL 1T3FB 1WT5C 2OZ4A 3UROR 1I9JL 3TJHD 5F7UA 5HHVH 2ID5A 3MACL 4X6CA 5DQDH 4PJIA 3BPLC 1P7QD 1QR1B 3CSPA 2J2ZA 4F7MA 4S11A 5T3XL 1QO3B 2ADGA 4MB3A 5LQBH 4K23L 5I1IL 1AIFB 1OWWA 1KJVA 1TITA 2UUDK 3BIBX 3HG1D 4KK9D 3QFJD 4OCNC 4Y16C 4GG6E 1B0RA 4MA8H 4WW2B 1LMKA 2VDMH 3UTOA 5FM5M 5J0BA 3EDJA 1TQCB 3P30L 1FORL 2CLRA 2Y7QA 2GYSA 4WEBH 2HT4D 5KSBF 3UBXI 3GMMA 1QFOA 3MMEB 2FNBA 2NX5B 5LGJB 1Z9OA 4PRBA 2Q8BH 32C2A 1MRCL 4M48L 1A6ZB 1DJSA 4WO4B 3VD4A 3NFPB 3WFDH 4XNYH 1WBYB 5D7SL 5GRZA 4YWGH 3CFBB 2AKRA 2R56L 4ELMF 3GBLA 2QKIB 2VZ1A 2ZUTA 3AMLA 1LWRA 4TULH 5D7LE 5F1OB 1LP9A 4BZ2H 5I16B 4WCYH 4TUJA 4XP6H 2HFFA 1N8ZB 4U1HA 3LHPL 3SDAB 4POZD 3B9KD 4X5LA 1HWGB 1AXSA 4YHLL 4UTBH 2EDEA 2BP3A 2A6JA 1CK0H 3KPRD 4YHPA 3TT1L 3ZTNL 1JNLH 3IFNH 4M5ZH 5IFHH 5ESQA 2NY1D 3VXTB 5DHXB 2VZOA 4P2QB 4WO4D 5DJAA 3DXAA 3S98A 1CGVA 1IKFL 1A7PL 2NY3C 4PG9A 1GH7A 3HTLX 4NQXA 1SEQH 5DJ8A 1VPOL 2VDRH 4OT1H 3SN6N 4JRXD 2PO6B 3C9NB 3KYNA 1ZV5A 4PJCF 4XMLL 4AT6A 4NRXB 2NW3B 5BVPL 4CN6A 3C8KB 1IQWL 1H3PH 4XAWH 5F7DB 3QH3B 4P3CH 1KOAA 3EOAB 1ZEAH 4LFHG 3MNVB 2NMSA 4NQEA 2MTPA 3HAEG 2DQUL 4JM2F 1F8TH 3ULUF 4LCWD 3IJYB 3EO1A 1UZ6E 1IEBB 4ZQKA 1OLZA 5H94B 4Q9BA 1PY9A 4WWKD 2BXZA 5I1GH 4Y19B 1QFWL 2HLFC 4ALAL 1JF5A 3SDCB 4UDUB 1FL5B 2I60H 4EOWL 2GIYA 4KAQL 3K2UL 4Y4FA 2AV1B 1TTGA 2ZUSA 4MJIB 4U2ZA 1HEZB 3QG7H 2DQDH 3CDGA 1FFPB 2OJZH 4I8DA 4N5ED 5D7IF 5CCKL 1AKJB 1RZGB 1KUMA 1RUQH 2VDOH 2LABA 4ZNEE 4PJ5B 4JANA 1C12B 5ISZB 1QRKA 4DFIA 4JDVA 5HXMA 1OTSD 3ZT5A 3WJLA 1Q8MA 4P9HL 1FJ1A 4CVZA 3UTQA 4E0RB 5IOPA 1F4HA 2W92A 5E03A 3ZL4H 5K9JL 2VRAA 3MJ9A 3ZKND 1MH5A 3U79A 4XMKL 2CK0L 2PETA 4HK0B 1V05A 3SJVE 5C70A 4LRIC 4U6TA 3HI5H 4KKBD 5CINL 4XH2A 5BZDA 2Z8VC 3T4YA 2VZUA 4IOFD 3RNQA 2E3VA 1YY9D 5FEBA 3BZFA 5I18H 4O51B 2J8HA 2X4NB 3AU1A 1JFQH 2JK5A 3H9ZA 4OFIA 1F2XK 1OLLA 1T1ZB 4M4PA 5ACZB 4RFEB 2FBJH 4FQ1H 1RK1B 1BQHA 1HSAA 1RVFH 4JHZA 1X5AA 3I75A 4KUCF 3HAEH 5E6IC 3I02B 4KK5D 2AGJL 5B8CB 3LZFH 4FP8H 4ZOCA 1OGTA 1S7RA 1RZIB 3QDGA 3UTZA 5D5MA 4PJHF 4WHTB 3D0VA 1AY1H 1CICD 1MJ8H 3F6IA 4FXLA 4YEEA 3TO4A 3FN0L 4ZFOB 4BSVA 1BLNA 2HFEA 3P9MA 1KXTB 3DV4B 3VGAC 3TNNB 2EDHA 4U6VL 1YA5A 2DS4A 4GO6B 3STLB 1A4KA 3LEYL 3O6ML 5TPWH 5C07A 1CIDA 2BERA 1ORSA 2R4RH 3X3GL 1U8HB 4JO1H 2A1WL 2CKBA 5DJXA 3SKMA 5C07D 3S9DB 4LLVA 5JA8B 4JRYB 5F6HJ 3HZYB 1S7UA 4JCLA 3QZWG 3GSUB 5DD1L 5SWSD 2OMBA 1YQVH 4YPGA 5E2VL 4GW1A 2I26N 4HJ0D 2YUWA 4OLYL 4XCYA 4LASL 1ZE3C 4OZGE 2X1PA 4JPWL 1WWAX 2LU4A 4JRWA 3SCMC 1KC5H 4OD2A 1KCLA 2X70B 2Y36L 4WGVB 3D69B 3IETB 1D5BB 2RBLA 4P5TD 2DTMH 1YQVL 2VSDA 2AEPH 1MCHA 2B2XH 4FNLL 2V7HA 5KVDL 5J6HA 3MGOB 4ZXBD 5IVXF 2YPVH 5DD1H 3ZKQD 3S4SG 2APXA 3KPPA 4MB5A 2DD8H 1H5BB 4KKBC 4FZ8L 1VGEL 2X4PB 4NGHL 1IEBA 3PWNB 3GGWA 4F9PC 1F4XL 4GAYB 1CL7I 1GSMA 2R4RL 4JY5L 1BQLL 3MV11 5IMOB 4M43L 1HYRC 3U0TA 3ZSTA 1N5AB 1BIIA 1A47A 1AGBA 4O2FB 3LS5L 4OCYH 1XGRB 1AD0B 3O4OC 3LS4L 1F3DJ 3AFLA 4QGTA 4NZDA 5FUZL 2ZOLB 1T6VN 5DEGA 3FHQA 1L4IA 4V1DA 5FM5O 2E6QA 3K8LA 1G7PB 3O4LD 1A3LH 3L3KA 4X6EA 5ADPL 1ROWA 2YHGA 1YC8A 1UH3A 1OAZL 3RBSA 2Q8AL 4M6OL 3RVWD 1D5ZA 2XQBL 3H3BC 4PV9A 1EV2E 4OSUL 4QRUB 5HGBB 1VENA 2DBJA 2FBJL 5BS0D 1OAQH 2R2BB 5DZLA 5IQ7L 3ARVA 1E28B 3A6OA 3U46A 1ZXQA 1RZJL 3VFPB 5CJQL 3B2VL 4PJ8A 4AEHL 1W72H 3O2WH 2C4XA 1RQ5A 2X4TB 4K3EL 4JFQB 3OF6A 3PGDA 4MVBD 3DUSB 1QR1A 2CO6B 1EGJH 2EKJA 1ZSDB 1D9KD 4C83A 5BRZE 5LAXA 5D5MF 1JBJA 5D2LE 4RBPH 4K2UL 1T1ZA 4PGZA 3BKJL 2X4SA 4L3ED 3C08L 1BJ1H 4QY8A 1HSAB 4U1IA 1F3RB 1MIML 1OTTD 1PD6A 5CEYB 3QRGH 3U0WH 5ABDE 3M45A 3CVIH 3AM8A 3MGTA 1JPFA 2EE2A 4DKEL 1KB5H 1QSEE 4G7VH 4TOYL 4CU8A 3LSOA 4WHTA 5CCKH 1ZK9A 2WUBH 4OLXL 4C56E 2CIIA 3J8F7 4EI5D 5IEKA 1DANT 2VN7A 5DJ2A 5T1LD 2AJVL 4OBSA 4I1NB 1DLFH 2AKRB 2HG5B 5AZ2L 3W39A 2DLHA 3WXWH 3CLFL 4NWUH 3QQ9C 4MYWB 3FQTB 4Z0BH 1ORSB 4AEFA 1NDMB 4O58H 3QIUC 4LHUA 1IZJA 1XF2B 2G5BB 1KACB 3MBED 2FLRT 2WWMC 1G9MC 2WINB 3FRPA 1F8TL 3HZYA 3KLSA 4KJYB 3QAZC 5DC9B 2NY4B 1ZT7B 2F58L 2OYPA 5DEZA 5E99L 2Z0BA 5IHUH 1J05B 3IDXL 1FAIL 3FTGB 15C8L 3JVGA 4JY6A 3I84A 4DN4L 5CS7A 1VHPA 1WWBX 2EDWA 3F12B 3Q1SH 4C59B 5I66B 2JJTA 4AENA 5GRVK 1YPZA 3VRJA 1CE1L 3MRPA 3L1OL 4OD2B 3BD4A 4NN5B 3S88H 3VGFA 3VH8B 1D5BA 3OKOB 1AP2B 2C5DC 2X89D 4TRPH 5F7DA 5HHXL 3CX5J 3EOAA 4NYLA 1FDLL 5BV7L 5CJ5A 3VFGH 1SY6L 4JM2C 4ZS7H 5ENWB 1AXTH 3QO1A 3QNYA 4GAYA 1ONQB 4BM7A 5J11B 5DC4B 5E1AA 2VMFA 5I1EL 3G04A 3MJ8A 4JAMA 2XWBA 1I1YA 4Z6AT 4JREB 2R56H 3FCTB 1B9ZA 5I2IB 4XBGA 1C1EH 4XWOD 3TIEA 2BFVL 3DV6A 3EFFA 2H32H 5I1CH 5JOPE 4M48H 1U2HA 1GC1H 5IGXL 2GKIA 5ID1B 1R3IH 2BSRA 3NCYS 4IOSD 3F7RA 2Z9TA 4EUPA 3LKOB 1RZ8A 3QFDA 5CAYB 3O2DH 5IB4B 2K9UA 4ZTPH 1LGVA 1MFDH 3TIDA 2PO6D 1RHHA 2VDPH 1JZ2A 3HHRB 1WSST 5B8CC 3ARFC 1J1XL 4R7NA 3GKZA 4WFFE 4HIJA 5DT1L 1FGVL 1JGUL 1PG7X 2ZNWA 3IKCB 3PGDB 3RGVC 4EKXA 4TSCL 2MNUA 2ZCLH 1QLEH 1XGYH 4YDVB 1U41A 5TE4H 3G9VA 5EDXA 4HKXB 4M62H 2DTSA 2X4NA 3AU1B 4PRIA 1EHAA 3MA7B 2VDPL 4LDOB 5D93B 2GSIB 3LEVL 3Q5OA 4RFEA 4AQOA 2VWEE 5BS0A 3BP4B 4MD5B 3ULSA 4P59H 2F54A 5CEYA 1LP9E 3K4DA 2VIRB 3GK8H 2JF1A 4P46A 2A38A 1HH9B 2GSGA 2AXFB 3H3KA 3SBWA 5D5MB 3H9SE 1BLNB 2HFEB 1YJDC 2NX5D 1IAOA 3P9MB 1XZ0B 2F53E 1TJIL 2MPAH 4S1RH 4BA8A 4DQOL 2C3XA 5IVNA 1ZVHA 1BZQK 1MPAL 1K4DB 4LVOC 2NQCA 3ZSSA 2G60H 1OSZB 2FX8H 3V52H 2XN9A 5C0CD 2XICA 4OAWA 5K9KA 1MFBH 5C7XH 2L7JA 3D87B 3UMTA 1WC7B 2GJJA 5L7XL 4Z78A 1S7UB 1CFTA 3EO0A 4W4OC 5MEPB 2AABH 5DJ6B 3GSUA 4OF3A 3NACL 4MZ3A 4L5FL 2E7MA 4ZDHB 3L3DA 5TDPB 4AM0A 1MAML 1IAIL 1IQDA 1QEWA 2YA1A 4OCRH 3MLTB 1A1NB 4Y5VA 2V2XB 1KN4H 5INCA 3F12A 1QFUL 5EWIL 1LDSA 1OAXH 3X12A 5CILL 1WTGT 5I8OL 4JM4H 1X3DA 2P45B 1E4XH 5GGSY 3KS0J 3OKLA 4TSAH 1WVZA 1RSFA 4PJIE 1YN6B 5FO7A 4NYLB 3G5VA 4I48A 4WV1C 5T5FH 3U7WH 4EBQL 3P77A 1Q0YL 1W0WB 3B3IB 1OAUL 1QRNE 5GHWL 1TNMA 5IMOA 1OM3L 2P5ED 4LSUH 2XRAL 2VLJA 3G04B 3RWJA 1SMAA 4NJAH 1EZVY 2WLYA 5C07E 4PBXA 5A2IH 4LSVH 1JYVA 1FFQA 2NY6D 4FQ2L 1AR2A 3QCUH 3VXQA 1WV7T 5T1DL 2AW2A 2OTWA 3RY4A 3L95A 4Q6YA 3D18A 1CXFA 1NMBL 4OF8A 3RWFA 3L3KB 1VFOA 4X6EB 3GMQB 4NNXA 1SEBA 5EUOA 4JFHE 3QRGL 1M05A 5J7CC 4R3SB 3N1GC 2VQTA 3MRHA 3BYTA 2EDNA 1LDPH 1MCWW 3UJJL 4TN9A 2OR7A 1Q9WA 5I75B 1ODAA 3QWRD 1FG2B 3OAZK 1IGIL 4ODUB 5BMFH 4LPCA 2FGWL 1U91A 3B9DA 5CBAA 3HNTH 4NIKB 1Y18B 4WU7B 3VFPA 3NIGE 2UVEA 4HDIB 1PKQE 3GI8L 1M1SA 2PN5A 3QDGE 3BHBA 5F71A 3DUSA 5D8JL 5CJQH 4M3JA 3FQXA 1CLYH 1ZHNA 5IQ7H 1G0DA 3D0LA 5DUBA 2J6EA 1ULVA 4IRZL 4MQXC 1FNSL 4PY7B 4D9RE 4KU1A 4QGYA 5I1KH 1P5UA 5HI4C 2O5ZL 3VG0H 1C08A 1NANI 3QDHA 3LN5B 5DK0A 1BQHG 4D9QE 3TESA 2QSCH 3N1MC 3I2CL 4IIQC 2R0KL 5IB1A 2A6DA 5I73C 1KG0A 4XNUL 4JY4B 5L9DH 1S7VB 1TFHA 4GQPH 3M1BA 2YD2A 4XVJH 1SHMA 5ILTH 5C9JA 1YEDA 3O6FD 3PWVA 3OV6A 5F8QC 3U2SA 2EIDA 1GAFH 3MXWL 3LN4B 3KNBB 4UZGA 3MRKA 2C1OA 1SVCP 1QVOB 2WIIA 1QSZA 2PXYA 1TVBA 3HFMH 4MCYA 2P8PA 4BQ9A 3C5ZB 1ZHKA 2XY1A 4G6JL 5C08D 4PREB 1KCVH 1RK0B 1A0QH 4LSQL 5ICYB 2PW1B 4ZNEA 4A6YA 4LFHD 3E1F1 1Z9MA 1MNUH 1EO5A 2V2XA 5SWZD 1EDQA 1RV6X 2GTWA 2BDNH 5I66A 1NAMB 3CK0L 4U6XA 4O4YH 1ZHBB 2VABA 4JFXA 1JHKL 3RWEA 3VH8A 2V9TA 1QG3A 4ZAKA 3CC5A 1YEGL 2UZYB 2WP3T 3HNSH 4GUPB 4HIHB 3G5VB 4GSDH 4XPBH 5L88L 2EH8L 3K3QA 3MFFB 4KROC 3RVXD 1AGFB 2SEBA 2IQ9H 2ZJSL 1RZFH 3BPCB 1AHWC 2OTUA 2NY6C 3SE4A 3T1FA 1R3JA 5E1AB 5HD8D 4Y4HD 5FUOL 1DUZA 1UZ8A 4NNYB 1OGAD 3A6BH 2CD0A 2XWTA 3FCTA 3KVQA 4NBZB 5JORA 1VDGA 2PO6C 1S7WA 4ZUSA 2VDQH 1PG7L 3L95B 5FK9B 3BMVA 4JKMA 4YDLC 4F7CB 5C0CB 5EBLA 3U4EB 1JI2A 1SEBB 3SE8H 1M05B 2P5WD 2O5ZH 4EUPB 5BV7B 3O8XC 4F33A 2CUIA 4MSWA 5SV4A 3SY0A 1YEHL 4FQ1L 5K9QI 2UZIH 3JTSB 1LNUB 4Q2ZA 3L6FA 3BW9A 3FT2A 2NY1B 2D31A 3KPRB 5GRJL 3HUJF 4HIJB 5B4MC 5KVFH 4WO4C 4OGAC 2Q76B 2BVYA 5F6HI 3RJQB 1WQVT 1R0AH 4Z7UA 3O9WC 5I74C 4X6FB 3TCXA 3MRRB 3QXDA 4OF5A 4DZ8A 3SCMB 4JZOB 5DO2D 4NN7B 3TN0C 3G08A 4LHUD 3C60B 5C0BB 3RDTD 2Q1EA 5I19H 5KVMC 5I1HH 2PF6A 4C4KO 1U3JA 3OGCA 4WI8A 5HSFA 2VIRA 5EC1A 1Q9OB 5D93C 3ARGC 4H25B 3QUYB 1UG9A 1FCGA 4MHHI 2OJZL 4DJMA 4L8DA 3DBXB 4U3CA 1HWHB 1TPXB 3DYPA 4MNGE 3LQAL 1JF6A 1XIWC 1MI5D 43C9B 4RQQA 3SDDA 3OB8A 4JFDD 4LNRA 3ZDZF 5F7YC 1FGNH 1W0YT 1PGRB 3JV4A 3BRGC 1Q0YH 1PLGH 1P5VA 4PJ9A 3C87A 5T5FL 3JWNC 3U7WL 4EBQH 2CIKB 1T0NB 2NR6C 1CXLA 4PJ8C 3MRIB 2PW1A 4PD4J 2E7LA 5E9DE 4A6YB 3PQYB 4CVUA 1E6JH 3MLTA 2OL3H 1F58H 5CSBA 1HQ4A 4YBQD 4PRIE 1EFXD 2BVTA 3BH8B 4HMCA 4EIGB 3EYUH 1TQBC 4B50A 4P99A 3QULB 3QDMA 5C0BE 4KGLA 3W0WB 1L7IL 3MO1B 4Y16D 5DJCB 1DFBH 5KZCD 4MZ2A 3MNZA 1ND0B 4IRJB 1G9NL 2X1QA 4J8RB 4WUKL 4FQHB 4QHKI 1UJ3A 5TH2A 2EDLA 5HHQB 2VZ3A 4ENED 5IMMB 2BJML 3DRTB 1IC4H 5DMYA 1NMCB 2V9QA 5IFAH 4MCZA 3ULVF 1NGPL 3CFDA 4QXTB 5GGSA 4PJ7F 5T1KD 3F7PC 4GW4A 1AQDB 4FQXC 4D9LL 1G6RB 5C08B 4DQOH 3VA2C 3KXFD 1OAYH 5D7SH 1CN4A 2ICWA 3MCLH 5JXAL 1TJHL 3FQUB 2R23B 2VQ1A 1NMAH 1TTUA 2DQGH 8FABB 3L9RA 3MV8B 3P9LA 3BO8A 4KTDL 1UB5A 2WLZA 4Y0GA 1NGZA 3RWFB 1P1ZA 3RVXC 2VXVL 3O6FB 7CGTA 2EXWC 1RAMA 2F53B 3KPSD 4WEBL 4X7SL 1A9BB 3G5ZA 4X98A 4Q6IA 1QLRB 1NCDL 2F8VA 2VDML 4W70A 5I15H 3LEVH 1KPUA 2X9YA 1XIWA 3MV01 4EI5B 1WBXA 2CXGA 4LSSH 5EA0L 3FT2B 4JHBA 2FX9H 4TQEL 1DBKL 3R06B 1RFDL 4NOBA 1CF8H 1YEKL 1L9MA 2OJEA 4AL8L 4JO2H 5SWZE 5CBEA 3HMWL 1ADQA 3GKWL 1O0VA 1QYGH 1IL1B 2EC8A 3GSWA 2ZZUT 5HHVL 1NPUA 1CFSA 4YX2H 2GK0A 4PJ8D 2DYPA 4JHWH 2W9DH 3W11D 4KY1L 3KS0H 3NMEA 1G1CA 3C6SA 4PJEE 1HHGA 1UQSB 4YXKH 1JYXA 3H2WA 1MFDL 1M7XA 3QWOA 2VLJE 4XNZB 3T0EA 3FMGH 4U1MB 1DANU 4HKZB 2R39A 3U6RB 2IGFH 1A7NH 2H45A 2ZPKH 3ZHLA 4ORGA 1Q1JL 2ZSWA 1NMAL 1YMMD 4NWTL 4NKOA 3DBXA 3MLPA 4KDWA 3T4AA 4Y2OA 1OAYL 5JUEH 5IW1A 1DEEA 1YEDB 3PWVB 43C9A 3DI3B 2X05A 5I73B 4PJXA 1WITA 5F9WB 2ZKHH 4WI3A 3ALXA 1PYWB 5DR5H 2P46B 3LQZB 1U2CA 4MA3A 3ULVH 4X5XA 1IC5L 3EIFA 3GBML 2E8YA 5FGSA 3D39D 4ODTH 1J5OH 5B38G 4CUCA 5FDYA 2VC2H 1HNGA 5HY9B 4MD4A 3IU4H 5ESVA 3FZUD 3U7YL 3G6DL 2EECA 3U7YH 3X13A 5T3ZH 4OUUB 1NKOA 1Y0LA 2V5YA 5CMAA 2AS5M 3Q6FB 4WTZG 4DUVA 3ZE1F 1F45A 5A2KH 1U93A 1ZHBA 4WFHE 4GMSH 4JFXB 1E6JL 3KYMA 4AY0A 2XT1B 3P4MA 3QDJB 3LAFA 5E5RB 3HZKA 5E8NB 4UU9B 5FYKU 2BY3A 3O9WD 1RJLB 1UH4A 1DZBA 5F9OH 1UJ3B 1G7JB 5DUMH 1UC6A 1MCDA 3C5JB 4CNIA 3BH9B 5SX5H 3O45B 2J12B 5DHVA 3S3JA 2W0FA 4GG8A 4K07A 3B2UC 2BOBA 3CFCH 2A73B 3EJZD 2B8OT 3GMRA 4NWUL 4NNYA 1T20B 3LQAH 4Y4FD 3R8QA 4PRAA 3S96A 5C08E 5SWSB 3AXLA 2AJVH 3IJHB 4APQA 1S7WB 1TVDA 4LLYB 3L9RB 4LOUD 1UB5B 1I3VA 4S1SH 3D1MC 4F7CA 4PJFA 4JFDE 1N2RB 3CVIL 5JNYB 5D70H 4HWEL 5I9QB 4NC1E 1WEJL 2IADA 2F53A 2NY5H 1T2QH 1ZWIB 5J9PA 4JPKH 4F33B 1RY7B 5C9KA 2W0KA 4YX2L 1HN1A 3PXHA 3P0YH 4I4WA 2D9QB 3L6FB 4RNRA 5FXCH 4UT7H 2JJSC 1K6QH 5E08H 1EXUA 4Q74A 3TH4T 1BFOB 5J89A 2JB5L 5F1IB 2CLZB 5LCVL 1BM3H 1MCOH 4PJCE 3RY5A 4P5KB 32C2B 1Z9LA 2BOCB 3TZVC 3RX7A 3B2VH 4W81A 4L8SB 4U0RC 5GRJH 3OR7A 3QP3A 3BE1H 1OB1A 4H1LH 4BQ8A 2EYSB 1S7XB 4DCQB 2W9EH 3LN9A 4HZLB 3LV3B 4QTHA 2CPCA 3G08B 3OKDB 3GRWL 2EDBA 1KSRA 5DD0L 1KULA 3L7EA 5FGCE 5DRXB 4CVXB 5IW6B 2HFFB 3SGDH 3IVKA 3BZDA 3V95A 4F7EA 4N90D 4LVOB 4NKOB 2EXYC 5DK3A 1WFTA 2A6JB 4KI5D 4YHPB 3T4AB 5EZIL 1DVFA 4ZD3L 4WW1B 5FHBH 4KK6D 3I6KB 1F42A 1V7MH 5EIQA 3S3PA 4NZTL 5MEQB 1JPST 4LLUA 3S5LB 1CD9B 3MLZH 3PABA 1NUGA 4NQXB 5DJ8B 4RA3A 4JN2B 1X9QA 3RTQA 5AG9A 4FZ8H 2NW3A 5DFVD 1L7IH 5DF0A 3EOTL 4KMTH 4KPHL 4TVPD 2J5LB 1Z5LA 4QXGH 1I7ZA 2VZSA 4WFED 2MKLC 3EUUA 3RIAF 2YK1H 1KV3A 1ED3B 2UY7A 4S0TD 4ZQKB 3UDWA 4O2EB 1RIHH 1NBYA 2APTA 4XB8A 1WISA 4RGMC 4P5TC 1FL5A 4FFVD 4B53A 3RL1A 4HCRL 2AEQL 4P5TA 4KKLC 3KYMB 2YBRB 3TBSB 2EIEA 1BD2D 5D1ZA 4L8SC 4XPFL 3T0EC 1MEXL 3LH2H 2JCCE 1K3IA 1NQBA 3CU1A 4JRXB 5F7NC 4XP1H 4PP2A 5FUCC 1EBAA 3QEQE 4EN3A 5HHQA 2VLRB 2WM0A 2W0FB 1UKTA 2C7UA 2XQYG 2KZWA 3T0VA 4A2LA 2N56A 4RAUB 4FMFA 1HH6A 4PJDA 1FH5H 3Q6GL 3WE6A 4JPIB 1ZLVH 5IOPB 5SWSA 4R8WH 3UO1H 4W4OA 4RMRA 5T1MB 3FQUA 2XXMB 2I25N 4G6MH 4N0FA 4WUUA 3W9EB 4HFUL 1R3HA 3QHFL 1TTFA 2RIKA 2OXHA 1MFCH 1ZWIA 4S2SA 1A9BA 4M9PA 3H9HB 3SEPA 4IRZH 3FO9B 4LVHB 3D2UA 5GGRY 1EJOL 1JN6A 5KVFL 2LTQB 3MLRH 3CZJA 4HT1L 3R06A 4NO3A 4HT1H 4Y7MA 3HE6D 2FL5A 1CR9H 4YC2C 3MA9H 1B90A 1OGTB 3DTXB 4JDZA 3SJVB 1HHJA 1F4WH 1S7RB 4HKBA 4GKNB 5GGUA 2JCCB 2CK0H 3D0VB 5IK3B 5F70A 3WS6A 1NCBH 4M61B 5FUCE 3DVIA 3WNPA 5BMFL 2ORBL 4LOUC 2NTSP 4NJ9L 2VN4A 3VFWA 1FE8H 4NN6B 4J3TA 3FFDA 5F96H 5HPOA 3QXAA 4OZIA 4TUOB 2Z91A 5F97E 1K5NB 3IFPA 5ICZA 1G7IB 2H2SD 5C09D 1OD7A 4ERSL 5F7HA 3VGAB 4EI6A 1FH5L 4Z7QE 2P47B 3IGAA 4YNYB 4M93B 1OP3K 3QCUL 4U0QB 4L4TD 2PCPB 1FG9C 5GS1A 4FQQA 1MHHA 4PGCB 1HKFA 1DEEB 3QUMA 4GS7B 3BP5A 4IJ3C 4LSRH 4WW1A 3OAUH 3VGHA 3ARZA 5C6PB 4JGUA 2BVQA 2ATPB 3QIUD 1OM3H 1EEZB 2FECL 3LMJL 5FF6B 4JN2A 5L6YH 1PEZA 2HP4A 3HE7A 3LQZA 3VXRE 3BZEA 3BPOB 4Q0XH 1J8HD 1H3GA 4JZJC 1LEIA 1D6VH 1HHKB 3TA3D 2H41A 2KZ1B 2NW2B 5IMKB 1I9IL 3D3VA 1SJVA 1D9KA 4XZUA 3UAJD 3QNZB 4I0PA 3SDAC 2IAND 1QBBA 1SEQL 3SDCC 1J87A 1VGKA 1E27B 5GGTL 1F6FB 2F19H 4OTXH 1OAXL 2RB8A 3DX7A 1U3HD 4ZXBB 1NL0H 4LQ1A 4QXGL 5EWIH 3UTTB 5HHPA 1XGRA 3VFSB 1U93B 4EQ2A 3A6CL 5I30H 3VXMB 4EVNB 3E3QC 4G42A 5EOTA 2BNRB 4YHLH 5D7JB 5E7FA 4UU9A 4UDTA 1YMMB 4ODVL 5F44A 4JRXA 5IVZB 1MWAB 1IGJA 3MZTA 1GAFL 1T83A 4BZ2L 4P2QE 2IH3B 5GJTH 1OSPH 1S7TB 1UWXH 4RMTA 2VITA 1CGSH 4XXDA 2R2BA 4XNUH 2JLLA 5L9DL 4KKAD 4FXGA 1CFQA 4NT6A 1JPGB 2BNQD 2APFA 5E24E 4APQB 3VXSB 3GSXA 3IDJA 4U49A 2EIZA 4HS8L 5ALCL 5I1KL 1LO4L 1UJTA 1IVLA 4O02H 3MJ7A 5E9DB 2DM4A 2X09A 4RMQA 4OCWH 1KBGH 3CGTA 2IAMD 3HI6L 5F1SA 4LEXL 5GIRB 3WUWB 3ZE0F 5J9PB 3GSOB 5FYLL 4XP9H 3KPNA 4M93C 2C26A 4HEPG 2XIDA 2CDFA 3TYFA 5C0EA 4Y1AB 4RNRB 1SMOA 4NKQB 5EO1A 5TE4L 2HKFL 2EE9A 5GGRA 5T3XH 1EXUB 2OCFD 4RRPG 1BFOA 2G75B 1TZHA 3MUGA 1N5YL 1KLFA 2V7NB 5DQDL 3V6OA 43CAA 1F2QA 3NCYP 2AI0H 4N8VA 1JVKA 2EE6A 5IWLC 2IH1B 3SE4C 2OM5A 5BRZB 4XGZB 3KXFB 5ISZE 3E6FA 5IHZA 4MAUH 3WDHA 2OK0H 3LV3A 1MCJA 2FCBA 4IHOA 2Z91B 1J0YA 5E2JA 4ZTOL 3RZWA 2R8SL 4PBVC 4LCIL 4UQ3A 4LLAA 3MRBA 1A1MA 4NQDA 3P11L 3QI9A 5CP7A 1X5ZA 4PJCB 5LWYL 4CJ0A 2FYYA 4DGYH 4WI2A 4FQQB 1BFTA 4M1GH 5GZOC 5BO1L 4JY6B 1IBGH 3SPVA 4G3YH 4M7KH 5DUML 4D0BB 3EOBA 3TBVB 3RKDD 3MCKB 4XRCB 4YHKH 1VACA 2BHYA 4MJIE 1SYSB 4BK5A 1SY6H 4FFYH 3WBDA 4DVBB 4CVWA 3SDCD 3VFVB 1K3ZA 3TP4A 4Z8FH 2FD6H 2CJUH 3EDEA 3K1KC 4WHYH 3T2PA 1WZKA 3OAYH 1DSFL 4OGZA 4L9LC 1HSBB 3EFDL 1FVCA 4HGKC 4KVCL 1AR1C 3KJ6L 1DQJB 3UTPD 4I0PB 3QNYB 1TMCB 2MFNA 3RWIA 2CDGA 3L1OH 3NGBB 2VLMD 4F9PA 1BZ7B 4RMSA 3IKKA 3NACH 3VFSA 4FQCL 3TJEL 5E8DH 3IXTA 3W82A 1D3CA 1IC5H 3CVHB 3TIEB 2ADJA 5BQ7A 3NCJL 5EIVA 5D1ZB 2F58H 4KJPC 1Q9KA 4GRWH 3SGJA 1GZQA 3U1SH 4P23A 3RZCC 5FHAL 3TWCH 1R5WB 1S8DA 2DWDA 1S9KC 5D6CA 4X7DC 1CFVL 3SGJC 2DQEH 3NVQA 5JUEL 3GIVA 1U8KB 5EZJB 3L3OB 1RUPH 4FRWA 1I3GL 4P4RB 1U58A 4KRMB 1MWAL 3PGCA 5AZ2H 1FCCA 1JYNA 1HINH 4MNQA 3T8XB 5CZVL 4L4TE 3WN5A 5DA4A 3PV6A 2HLFD 4OLXH 3VXSE 3QIWB 2AJSH 3FMGL 5AYUL 2I9TB 4UQ2B 5DMIH 4RRPA 3EYOB 2R2HA 4F9LA 4MAUL 1KGCE 1QSFE 4YHIB 1OAKL 4F7MB 2J5LC 4KY1H 3RWDA 1FHGA 2ADGB 2I07B 1NAML 1KJVB 3I3DA 1FVEB 4Y5XC 3FAXA 3DHJA 5LGHH 2JTDA 4G8IB 2J6EL 1WFUA 4HZAA 1ITBB 3HMWH 3HZMA 5ID0B 2CRMA 3EJYC 3ZE1E 1FGVH 2BSED 4LAQH 3RWGB 5GGRB 5DMJB 2DQCH 5HTSA 1FIEA 1ZLWH 5BXFA 3DX9B 4PTTA 1AC6A 5M7QA 4YDJA 1WIOA 4D3CL 3GJEB 4H1LG 2BNUB 5GGUB 1A6ZA 3EZJB 2JCCA 2APVA 5HHNA 4XVSH 5IIEA 3RVTD 4JFOB 4AIZA 4O02L 1HCFX 1IZKA 3IDIA 5JTWA 1OAQL 3FFDB 3UX9B 2ED7A 1HDMB 5BZWB 2NNAB 1LP9B 4XHQA 1U8LA 12E8H 3T3MF 4HC1A 4TUJB 4UQ3B 4NQDB 3BJ91 3HUJB 2AXGB 3QEGH 1F4AA 3HN3A 4S1QL 4ZOEA 3L3DB 1YJDH 1ZTXH 1NDGA 3MLSL 3LS4H 4FTVD 5HGHA 3H7LA 3R1GH 3MZGB 2D0GA 1M7IA 5BV7H 1UYWL 2DRUA 4D0BA 5AAMA 4ZPVA 4ZFGL 1EIBA 4JY5H 3BWAA 4HH9A 3HE7B 5T5NF 4MLIA 5J56B 2NY3B 5HYIA 1UM5H 1F6AB 1EJ6A 3VD5A 5HPMA 3QH3A 2Z92A 4CBPA 1ZVYA 1EUUA 1QSEB 4JJ5B 4I48B 2IBZY 1Q94A 3GJFH 2X1XR 1AJ7H 2XZAH 4ZAKC 4Q7DA 1EO8L 4R4NC 1CVSC 3BEWB 4M03A 3RWIB 3WYRA 1KC5L 4U1GB 1E27A 5IMLA 3O3BA 4PJDE 2VLJB 4DEPB 3G5XB 2MCG1 1JWSA 2WMPA 3DO7B 4BUHA 3FOMB 3IJSA 4LIQE 5CSGA 4YHYC 4LVNB 1TPXC 3LKPB 5FGCB 4O58L 2HRPH 2AXHA 1FFPA 3C8DA 4LPTA 1DBBL 4NRYA 1AKJA 4WUUE 2P44B 3CD4A 5C09A 4HUXB 3FB8A 3CFIC 1MWAA 4AMKL 1I1AA 2YUVA 4HAGA 4Y2DB 3HLAB 4JO1L 3S36L 1IRAY 1A14H 2IH3A 4P9MH 3VCLA 1U58B 4H0IA 1QR4A 2CDEB 4CVZB 5MHSE 3MLYL 1Y18A 4WU7A 2E7CA 3U0WL 2CRYA 4HK0A 4N8CH 3GM0A 1MIMH 4KJWC 1FZOB 2A6IA 2GJZA 4S1DD 2DI9A 2UVFA 5F7KC 1ES0B 2BHZA 4RGOH 3HZVA 2VXSH 1QKZL 4FQJH 5D2LA 4APQC 4FQIL 4LEOA 4RFOL 4PB0L 4DWHA 4L29A 3RWCB 4X6CF 1UKQA 4P23C 1S9WB 2EH7H 3RZCA 1A6TA 3EYSH 3P4OA 4KHXH 4PYHA 2F5BL 1I8LC 4QEGA 4NNPL 4Z5RA 4AEHH 3RWGA 3B83A 3IDMB 2IWGA 1HOCB 4PP1C 1AI1H 2CKBH 4Z7VE 2Y06L 3PDGA 2G75A 3VXMD 4RGND 5IT2H 5JIPA 5AG8A 1NCWH 3FQNB 1PKQB 1V8HA 1NFIB 2VLME 3MBXH 1IAIM 3BT2L 1IM9A 1MHCA 4KGJA 4M1CC 4FQIH 2OLDA 3DV4A 1QSED 4K94C 3SE8L 3U2SB 2HTKD 3ZMRA 4QHLB 4C56D 5SV3A 2P43B 3WFEH 5KTEH 1LILA 1A4KB 4QHNB 1FNGA 2DKSA 5F1NB 5J6GB 1LO0L 2P5EB 2VDQL 2CLRB 5JW5B 5D9SA 2P42B 3HAEA 3IDNA 5EU3B 3SKMB 1CZ8H 4K9EC 3MLYH 4R8WL 3S4SA 4DK3A 2YRZA 3WNMA 2P7TB 4KZEL 1G6RL 4PRBB 3LKRB 4WI7A 4MJ6A 1N4XH 1MY7A 2V5RA 3NFPA 3F5WA 4RDQG 4YHML 2GITA 3I9GL 4P9HC 25C8L 5GS2H 1JGEB 3EKCA 2YPKB 3L5JA 3NPSB 4YAQA 4P46D 5E00A 5C0JB 4NGHH 3T09A 2FB4H 1YPZE 2DD8L 2M26A 4OCXH 3TPUB 4ZUUA 1UEYA 2F8OA 3HNSL 4FNLH 2BVPB 4ZYKA 1KGCD 1SYSA 2LVEA 5JHDD 3SDXA 4NO0A 4JKPL 1NKRA 1JHKH 3D48R 4DVBA 3CK0H 3MGOA 4MMZC 5D2NC 4P3CL 2RR3A 1TCRB 1HSBA 3IS1X 3NTCH 4P2YA 4TPRL 5JDSA 2JIXB 3SGDI 3DVNB 4PRHE 2YEZA 4NC0B 2R4SL 3G5XA 1H3WM 4PG9B 3VH8G 1IKNC 3GHEH 3AVEA 1RPQA 1EVUA 4KHTH 4OB5H 2B39A 1UCBH 4L9DA 3HE6B 3LKPA 3AC0A 1CICA 3TO4D 4KV5F 4RAVB 5IWLA 2EXWD 4M1DL 3FB8B 1BAFL 3MRJA 4YPJA 5J1AB 1U8JA 3PDOA 1ERNA 2GUOB 5FHBL 5IBLC 1ZAGA 4NZUL 2FIRT 4PV9B 4YJZL 4PB9L 1KN2H 5A43C 1AFVL 4LPUA 4P2RE 3WXVH 3SDCA 4BUGA 1TZIB 2BVOB 3UBXG 1KJ2H 1MFNA 2D31B 1ZA3B 4JKKA 4MJIA 3HI1B 2APBA 3PV6B 2RCSL 2HWZH 3V6OE 3F7VA 2A6IB 2GJZB 1FNSH 4FOMA 4JZJA 4OIBA 2NLJA 5EN2B 2XG5A 1GYAA 2GY5A 1ZSDA 2W9EL 4R4FL 4YHIA 3MRMB 4OV6F 4JANB 4X9HA 1EHLL 3MRRA 3KWWA 2UYLB 5JPNB 2OI9B 2ITCB 1FVEA 4HW6A 1A7BA 3STZA 3P0GB 5JZ7C 4MA8L 1AD9A 1NC2A 1M6OA 3V8OA 3ZTJH 3T77A 3P40A 4AYFA 4G9DA 1PSKH 2JB5H 4FQLL 2NY2B 3MTRA 5BXFB 5T3ZD 4H20L 4MS8D 3LIZH 4WNQA 4R96A 2KKQA 4H25A 4PJBB 4F2MA 3TV3H 2BNUA 3CFEA 3T0XA 3BVNB 3RUGB 1KEML 1NEZB 2NXYD 3ZKXC 2VLRE 3ME0A 1IGCL 3RNQB 1NAMH 3FN3A 3KPLB 3KJ4C 4HWEH 5T3XD 1YEJL 3SDDB 1RUQL 3N85H 2DMCA 4N0UE 2ESVD 2P5EA 4NZJA 5T1DH 1CVRA 5KSVB 1JHLH 5D9SB 1N0XH 3H3PL 3U36B 4MNQE 4JGMA 3WUZA 1PVHA 3I50H 2AXGA 2UWEA 4M8VA 4G43A 4MJ5B 4EOWH 4OM1H 4Y4HA 1EFQA 2WWKO 3R4DA 4LSUL 1DR9A 1CI5A 3V6OC 3EJJX 4HWBH 4ZFOA 2QHRH 4Y5YB 4MA1B 5FOBA 3TO2B 2IJ0C 2NY2D 2WV3A 4R2GD 1ZKAA 3WEXA 4XC1L 2E9WA 2JB6B 1X6NA 4JDTH 1IC7H 4K8RD 3BDYL 1EEYA 2J88L 2B1HH 1BEYL 5DUPL 3GJFK 3MNZB 1JV5B 4XXCC 5DJ0B 2Y5TB 5B39A 1NCAL 3Q5YA 3RVTC 3LPWA 4GBXD 4OI7A 3WS3B 2NZ9D 5GGVY 4MVBC 5TQ0L 5T3ZL 4XX1G 2XZCH 1LQSR 3G6DH 3RHWK 4J1UA 5I76A 4DKFH 4JFYB 3PDDA 3GSVA 2FX7H 3O3BB 2A0LD 5B39G 3UYPA 3SGKC 5LXGH 5L7XH 1T03L 2NCMA 3FT3A 4QRRE 5C3TA 1P6FA 1T5XA 1U3HC 3D69A 2VLKE 1UACH 3OKEA 2G5RA 4UIMB 1I3RB 2W65B 4I3SH 1F97A 8FABA 3KPPB 2AJUH 5KVEH 4QHMB 4NFCA 1YNKL 5DMKA 3U4BH 3KR3H 4LVEA 5C6TL 2D7PA 3BD3A 3WDIA 1YUHB 5GRVL 3U0TB 1N5AA 1KPUB 4O2FA 3GO1H 4BH7A 3GMNB 5TE6H 1D6EA 3I6GB 4XPAH 1PZ5A 4PJGF 2VZTA 4DTGL 1ZA3A 1HI6A 4XWGH 4JN1H 2DIBA 4QRPA 3WLBA 2QQNH 2YN3A 2Z31A 2FJHB 5C0IB 3F7VB 4JFEB 5K93A 3MRMA 1FFNA 2C3VA 3SO3B 3QFJE 1QBML 5D7IB 4HMDA 3O2VL 5HGBA 1HHGB 1UQSA 5E1HB 5FCUH 1S9WA 3P4OB 3AB0C 5BS0B 3OR6A 3TBYB 5D72L 1FYTE 2AQ1A 1N64L 5I8KL 4ELMB 3U46B 3BOVA 1I75A 3RBGA 2ZCHL 1U3ZA 3ZT7A 3QNXA 3IDUA 3OZ9L 4LSSL 4PJBA 1SBSH 4JFQA 1HH9A 4UUJA 1AO7D 4A2MA 1UM6H 5JIKA 4C83B 2NZ9C 4D9QD 1DBJH 1ZT4B 2OQJB 3L3IA 4NQSB 2Z4QA 3QQ4A 1G9NC 4JLRA 4OZHA 4G7YH 3C6LB 4OZFA 3ARFD 4IRSC 3VD7A 1C5BL 2MMXA 5HVWA 3K81A 4U3XA 1S7QA 4WTZA 1BWMA 1QACA 2YRLA 4A6YH 1C1EL 5KJRH 3ARXA 3K74B 4OKDA 2NY2C 1K85A 3IXAB 1CFTB 4UB0L 1XGQB 4M7LT 4CMMA 5DJ6A 3GNMH 3CNKA 3KHOA 1I7TA 1L7TH 4YHZL 2CIIB 4P2RD 3V8CA 3FJTA 1MI5A 2MOVA 4X9GA 3V79C 1S5HB 3C6LC 2AJZA 2R1WA 4X4ZA 4LBEA 3QQ3A 3VFGL 1IGML 2QQQA 3FL7A 4RFNB 2HVKA 3DETD 5HHXH 3SOBH 1MVUB 5FCSH 2FWOB 4ZYKB 1I8KB 2KDGA 4XC3L 5DJ0A 1T7YA 2Y6SC 3X3FH 3UTSB 3KYKL 1P84J 4OD3L 3S88L 4J3WA 2QSTA 2YZ8A 3P4NB 3QJHB 1QSFA 2Y07H 3CSYA 3OHXB 4RBPK 5DI8B 4JRYD 3L5HA 1H3XA 3P77B 4U7SA 4I5BB 3T65B 1DL7L 3LKSB 4HHAB 4HEME 1XGUB 6FABL 2YZ1A 2YMXH 3DVNA 4X4XA 1MJ7L 2A73A 1YPZB 1CXEA 1TJGL 4WRLA 3SE9L 2D4DA 4BELD 4NKMB 5D1XB 3OBAA 4F3FB 2ICWI 1FPTL 4QRPD 4WWKC 5L6YL 1CICB 2YD4A 2BCKB 3T3ME 1A6UL 3NABL 4HX1A 4AJ0A 4D8PA 2GUOA 2OL3B 2B1AH 5GZND 2R29L 4R3SA 3DIFB 5KAQG 2P5WA 5AUMB 2AK1H 3O11B 1KB5L 3SDXF 1TZIA 3W2DL 4YBHA 3R0MA 2OSLA 3C5SB 1DDHA 3MOBH 4XBGB 3MRDA 5FYJD 2AJXL 1GGBH 5EBWA 1WT5A 1Z0MA 4M5YL 4JZJB 3MYJB 5C71A 3BP7B 1P4IH 4JM2D 3VXNA 3VGBA 2HFGH 1BFVH 4JG0H 2HMIC 1JWMB 2ZUUA 1BD2B 4Z7WF 4OIIL 1EGJL 2GY7B 3TIDB 1FL6A 4P2OD 1I8IB 4PY7A 4G6KH 4DN3H 1DE4B 2HJLB 3QIUA 2DLFL 3OKDA 4Y4KA 4PJDF 4B7LA 4OF0A 3F65A 3FN9A 5C0DA 3IVKB 4LSTL 3TPKA 1XIWD 4BSWB 3H8NA 4F2MB 1KG0B 4XX1E 5FO9B 1IEHA 3ESVF 2EDOA 1F02I 2E6JA 1MFCL 1NANH 3MA7A 5ICXA 3KLHD 1OWRM 4QYOB 4E5XA 5FGBA 1J1OH 2C1OB 3CSGA 3PABB 2ICCA 5FKAB 4CADB 5CJXA 3W0WE 5HVHB 2X44D 2FIKA