3CN7A

Crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
214
Chain Sequence
SEPLILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQAPSQAVTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAKGIAAERIILAGFSQGGAVVLHTAFRRYAQPLGGVLALSTYAPTFDDLALDERHKRIPVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDYPMGHEVSLEEIHDIGAWLRKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the fatty acid chain length specificity of the carboxylesterase PA3859 from Pseudomonas aeruginosa: A combined structural, biochemical and computational study.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 71
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cn7A00
4UHFA 1E8DA 5FP0A 1U8EA 1EDDA 5E4JA 5LZ2A 1P0MA 4P93A 2G5TA 4K5QA 4AZ3A 1ORVA 1UK6A 3AZPA 4BCDA 4C89A 3QMMA 3T52A 1L7AA 1IUPA 1GQRA 2K2QB 5CBKA 2G4LA 4XX1A 4UUQA 3VKFA 1N5RA 2VJDA 3ZPXA 2DHEA 3OG9A 5ALTA 1XZJA 3O95A 1ZICA 3MUNA 4AO6A 4HS9A 2DFPA 1AMNA 3WQHA 4Y2XA 4IH4A 2WUGA 1QZ3A 3YASA 1H23A 3D0KA 4MQMA 5HF6A 4EA6A 3DKKA 5EI5A 2XUHA 4PO3X 1QIKA 3I2IA 2WIKA 3X3HA 4B84A 3ZV7A 4BZZA 1BU8A 1I6WA 2QZPA 4I19A 5I8PA 4P08A 3TGLA 3QMVA 1KU0A 3OM8A 5FV4A 3KDAA 4UFNA 1ISPA 4A16A 4X3CA 5C8XA 5AIBA 1CUJA 3E1GA 1F6WA 4WJLA 3HI4A 1ZD3A 5AP9A 3AILA 2GYVA 1DT3A 1MPXA 2GBGA 3AIKA 2VT7A 3G0DA 3WL6A 3QPAA 3W06A 3KWJA 2XMRA 3QM1A 3K6KA 1QIEA 5LP1A 4GI1A 4X00A 2C5FA 3I2KA 5AI8A 4QE3A 5T4FA 4F0JA 5CH3A 2IITA 2RIPA 2JEZA 3GZJA 1VXRA 2V9ZA 4P92A 3ESBA 3WK8A 4AMYA 5IH7A 4C4YA 4LXIA 2V97A 4K6KA 2BFNA 2W6CX 2WTMA 1CUVA 1LLFA 3AUKA 3R3WA 1EXWA 1XQYA 3FYUA 5EHZA 4TGLA 4DGQA 1VZ3A 5A62A 2BUAA 1LZKA 3OC0A 5A7FA 2WFLB 3F96A 1AURA 1WPXA 2OGZA 4PV7A 5KBYA 3K2IA 5JD6A 2FUKA 4BVKA 1UOPA 1ODCA 3IUNA 4J0JA 5JAUA 5EFZA 5JIBA 3DQZA 1OILA 2OQVA 2ZJ6A 5AH0A 3BDVA 4BYMA 2WU3A 1TRHA 5AOCA 3LIPA 5AK3A 4MWSA 3GELA 5ALLA 2AJDA 2AJBA 3HACA 2QOEA 4FLMA 5AKYA 3DOIA 1RYYA 5JZBA 2ZJFA 1Y7HA 3CN9A 1IZ8A 4BE9A 1XZBA 1BCSA 5CXXA 4DMFA 3VJLA 3BF7A 5ALJA 1IVYA 1WB6A 4G8DA 3C8HA 3WYDA 1U2EA 1BE0A 3DYVA 1MN6A 4M0EA 1E8NA 1HPLA 4C01A 2RHTA 4P9NA 1THGA 2VEOA 4Q05A 1XLWA 4XWGA 5C8ZA 1C7IA 1CUIA 3AIOA 5JD5A 2I78A 5ALYA 1R9NA 4BVJA 1UT6A 4OB7A 4HXEB 3WKBA 1L7QA 1MO2A 1QFMA 5YASA 1H2WA 1DQZA 3B3QA 1LPSA 4QWWA 3WYNA 1TCAA 1TQHA 2VSQA 5ALHA 1CUUA 4CFSA 1YB7A 1YASA 3FBWA 1CIJA 2O2GA 1VXOA 3H19A 5JARA 5JATA 1YB6A 1ZGBA 2V98A 3O4HA 1MAAA 3H18A 4F21A 4X6UA 3HRHA 5FDFA 2QXUA 1E89A 2Y2VA 4UFOA 1E8MA 5T4BA 4QDUA 4BZWA 4U2EA 4E11A 5LIPA 4K6HA 3OURA 5HK8A 4Q34A 4G8BA 5AM4A 2DSNA 1L7RA 2XT0A 1HQDA 1QO9A 4GECA 1DQYA 5AKZA 1TCBA 5LZ8A 1CFJA 1UFOA 4YK7A 1XRNA 1OXMA 1G5FA 4NMWA 4OD0A 4QWMA 3SK0A 1XRMA 4HRXA 4DNFA 2HU7A 4X90A 1Q83A 4EY6A 3FAKA 3F97A 1EINA 5ESRA 2PUHA 3I6YA 1XZMA 1DU4A 3V1NA 3GFFA 3PUIA 2OCIA 1AX9A 2GBIA 3IBTA 1E5TA 2D5LA 4QA9A 5HQ3B 1USWA 4GLBA 3AIMA 1QOZA 4PW0A 4BAGA 5FOQA 4U2CA 3EQ9A 2AJ8A 1JFRA 1CUHA 2PSFA 1K5PA 2ACKA 1N1MA 5AJHA 5JZ9A 5HF5A 3W2TA 4MEAA 3V48A 4F5ZA 1X70A 3G7NA 1EHYA 4ZXFA 4EY8A 5AIAA 2B61A 3AINA 4WDRA 3V1MA 2Z3ZA 1UK7A 4BC1A 1CEXA 2C0QA 1VZ2A 5ALQA 5E4YA 3PUHA 2XMSA 4LYEA 3QPCA 5KREA 4EB0A 1CUFA 1K63A 3QH4A 1LPNA 4YPVA 4UBIA 3W9BA 2Z8ZA 4GBGA 4DNQA 4AQDA 4NZZA 4DIUA 1LBSA 3I6MA 5AK4A 2Y6UA 3VXKA 1TK3A 3IULA 1Q0ZA 2YXPX 3DOHA 1XKLA 3W9UA 3QZUA 4E46A 2XUOA 1SC9A 4KR0A 3HJUA 2HFKA 4ZGBA 4C4ZA 5K3CA 4HTAA 5K3FA 5DNVA 2DCMA 3GBSA 1JMYA 2WG2A 5AKKA 4IQ4A 2QUBA 5HCUA 1RWQA 4X71A 1R4ZA 1CLEA 1ORWA 2HM7A 4K2AA 3OTQA 3ESCA 4FNMA 4V2IA 3WI7A 5I9IA 3MGAA 3ZLUA 1BEZA 5C81A 1W76A 1BROA 3WK4A 2XQIA 1M33A 4X85A 1X2BA 5ALEA 2QT9A 2QM0A 3P2MA 4Q82A 2QKYA 4EY5A 1MNAA 1JJFA 4OYYA 2VJAA 4AO7A 4U2FA 4Y9SA 2H7XA 3ICVA 4BE4A 1D07A 1QIJA 5I7UA 4C87A 2ZYIA 4J0DA 2VAVA 4U2GA 3G9TA 3CCCA 4ARBA 5K3FB 3FVTA 3WK6A 5AI6A 3G8YA 1DX6A 4CCWA 4HXFB 3TEJA 1XRRA 5K3BA 3O9MA 2JF0A 4BAZA 5FPPA 2FJPA 5AM5A 4H77A 2J4CA 1GPLA 1EI9A 2X8BA 3DKRA 3NUZA 4KE6A 2QMQA 1XQWA 4LXHA 3SC2A 2OXEA 4OSEA 3V1KA 2XB6A 4DSZA 1K6EA 4J7AA 4J0CA 3H2GA 5FLKA 4W1RA 1VLQA 5HKAA 2VA9A 2RAUA 5CT4A 4OU4A 1LNSA 3BXPA 1G4HA 2HA3A 3FOBA 5AI0A 4QZVA 4ZI5A 3IA2A 3PI6A 4G4IA 3DCNA 3PFCA 4B83A 1FFEA 3JWEA 2WJ4A 2WG1A 5DTIA 2QJRA 4X7BA 5IKXA 1J06A 5ALKA 1HL7A 4J0HA 5JAPA 3IVMA 4DNOA 4LIPD 4DYHA 3KSRA 2ZYHA 2J3DA 2J4FA 4FLFA 3WA7A 2YASA 3A70A 3IUMA 4LYDA 4FMPA 1WOMA 1FFDA 5ALSA 4G1FA 2JGJA 3A2MA 4UHCA 1A8QA 3WL7A 1BRTA 5J3JA 1QIIA 1ZJ4A 4CG1A 4B7ZA 2H1IA 3DL7A 1LGYA 4FFWA 5SYNA 4AXBA 5DWDA 1ZD4A 1A88A 2RHWA 1YAHA 2OPHA 5AI5A 1QFSA 1KU6A 3HXKA 1Q84A 4NS4A 3DL4A 5C8VA 3FCYA 1DWQA 3G0BA 1YR2A 3M83A 4MEBA 1G66A 5LKRA 1F0NA 4UBJA 2P8SA 3M3DA 3R3YA 5ALWA 2XUIA 1QLWA 1THTA 2YYSA 5ALFA 1CUGA 4JUIA 2O7RA 2XMBA 1A8SA 3WL5A 3W04A 2QS9A 3GA7A 3A2NA 4ZWNA 4CIBA 5JALA 1CUWA 2NW6A 4UBMA 1HDEA 1VKHA 4Q1VA 5DNWA 4KRYA 3CCBA 2GZSA 4B80A 4F60A 2WUDA 1LZLA 1F8UA 1W75A 4WY5A 4H7FA 1RP1A 3AZQA 2HA0A 4I3FA 1JKMA 4FNGA 4G4GA 4RE5A 1XZCA 4GDMA 3NGMA 1N8SA 4IHAA 3QITA 1XFDA 4CG2A 1T4MA 2OGTA 5AO9A 3U1TA 2XDWA 2JGKA 3DLTA 2C7BA 4FFVA 2BAGA 2PUJA 2WHQA 1NU6A 4ZV9A 5CT8A 3FYUC 2WG0A 3BE8A 4WY8A 2HRQA 3KWFA 3R40A 4BC0A 4J0GA 4EUSA 2PKYX 1WHTA 3WKCA 4OB8A 1CV2A 5ALGA 2EDCA 2WLSA 1KEZA 2XQJA 2HA2A 1ACLA 3ILSA 2QR5A 3WJ2A 4B85A 2BUBA 2C4HA 4PF1A 1QTIA 5A71A 3F8SA 1VE6A 2PL5A 5HFNA 4RNCA 3GROA 3PF9A 5IVHA 2XQFA 3TJMA 4G5XA 1XZHA 3C87A 4G8CA 2H9YA 2WHPA 2ROQA 3I6ZA 4GEGA 1QONA 2PPLA 2PBLA 2WUEA 1XROA 4WFJA 3D5EA 1ZOIA 3KXPA 3KOOA 1TKRA 1K8QA 3DDUA 3SX4A 4TPKA 5JAHA 4H7DA 2ACEA 4M0MA 1MT3A 1U4NA 5LZ9A 2CMFA 4G9GA 4X6XA 3WK5A 3C45A 5ISMA 1OCEA 3EBLA 3IB3A 2ONCA 1CQWA 1W4LA 5A2GA 3BIWA 4E15A 1WHSA 2OCGA 4BCCA 4KE9A 4B0OA 5EIHA 1UOQA 3WWOA 5D3KA 3H1BA 4DSAA 4B9AA 4MXDA 4OCZA 2C58A 1VE7A 3PE6A 2XUKA 5AKIA 3WIBA 1MX9A 5EIEA 3H17A 1EB8A 2I3ZA 4BBZA 2WFMA 3WWDA 2WIJA 3RK4A 2PU5A 3MVEA 3LLCA 3D7RA 1XZGA 2WJ6A 1GT6A 3L1IA 4DMKA 2ZYRA 2QJWA 2R8BA 5F4ZA 2HFJA 4GWLA 5A7GA 1CUCA 4W63A 4GXNA 1GKLA 1O6GA 4J03A 2Z3WA 2HDWA 1EDBA 3QMWA 3NWOA 3WJ1A 3I2JA 4Y7DA 1R88A 1ZI8A 4X92A 3BF8A 2CKMA 1GXSA 1MTZA 3IIIA 1SOMA 1XQXA 3I28A 1W52X 4KAFA 4BTVA 5K3AA 4L72A 3R3UA 3EQ8A 4Y2JA 1QIDA 2WHRA 1YA8A 5JANA 3HLKA 4N8EA 4DTCA 4KRXA 2HU5A 3ZLVA 7YASA 4YX9A 4HXGA 2H7YA 1IMJA 1YAJA 4Y2RA 3WA6A 2WJ3A 3FVRA 3LIIA 4JH0A 2OQIA 2I3DA 3M82A 5SYMA 3BIXA 4Y2VA 1XZDA 2BGNA 4FDMA 1W1IA 2HRRA 3RARA 4B0PA 1WCYA 1ZIXA 4IO0A 1SCKA 2PSDA 1H2ZA 1GKKA 3BWXA 3DEAA 2HADA 4XJVA 3QYJA 4FOLA 1QGED 5K5EA 1MX5A 1DTEA 1QIMA 1XRLA 2GBCA 3VVLA 4QLAA 2XUDA 1WB4A 4S0XA 2OCKA 2BUCA 1WB5A 2YH2A 2JGEA 3O4JA 1BS9A 2QRUA 4Y2SA 2JBWA 5AI9A 3GUUA 5T4EA 3WL8A 4BP9A 1VOTA 1XRPA 4UHBA 1PV1A 3R41A 1R3DA 4PQEA 1Y7IA 4B6GA 2WFLA 1DT5A 4ROTA 3UUEA 4W1SA 5LZ4A 4H35A 2IX9A 4X94A 3S8YA 2RGUA 2XQKA 2PX6A 4K6GA 1J07A 3STUA 1DINA 4BDTA 3OOSA 3L1HA 1HBJA 1ZI6A 1CUEA 4C88A 4H18A 3I2FA 3BJMA 5LKAA 1GQSA 3FCXA 5ALMA 1UKCA 4KEAA 4KE8A 2ZVDA 4HVTA 1XLUA 4CCYA 5CH5A 4QDXA 1AGYA 4EBBA 1VA5A 5D3ZA 4CCYB 2B9VA 3VJKA 1SFRA 2O2IA 4WCVA 2ECFA 3C6XA 3C5WP 3FLAA 1LPMA 3FLBA 5CT5A 5EIAA 1X2EA 2XUPA 4L3WA 1JI3A 5EHNA 2DHDA 5HQ3A 3RKSA 1CUSA 2HHAA 5HZGA 5CT9A 4Y2QA 3DNMA 1R1DA 1SCIA 3R3ZA 4FTWA 2VJCA 1P0QA 3PFBA 2E3JA 1CUXA 2HL6A 4UHHA 2LIPA 1CQZA 4Y2TA 2B4KA 3JW8A 4IH1A 4X91A 1CR6A 1WPRA 1LPBB 5ALIA 1QIGA 3R3VA 2ZYSA 4H0CA 1HKHA 1JT2A 3D4LA 4B9EA 3WKDA 1CUYA 4Q3LA 4RGYA 4W9RA 1BCRA 2I03A 4RE6A 4UBNA 1CUZA 4DMCA 2HA7A 2WIDA 3G02A 4Y2UA 2WKWA 5DNUA 1QO7A 4MJ3A 2EDAA 5ALUA 2HIHA 1UKBA 1ODTC 2BGRA 3AJAA 5AM1A 3BL8A 1UOOA 3G9ZA 3O4GA 3OPMA 3WZLA 1R50A 4QLOA 3B12A 2WHPB 3IUJA 6YASA 5DLPA 4OUKX 3FSGA 3WKEA 2GYUA 4BVLA 5AKJA 3VVMA 2BCEA 4B81A 2EEPA 3UMJA 2DHCA 3V1LA 1EDEA 5BOVA 5HK9A 2Y2UA 3NOXA 3DS8A 5AOAA 1FFCA 2PVSA 1A7UA 4E14A 5KWJA 3EQ7A 5K3EA 4MYDA 1EVQA 4JEIA 1LPAB 4FWBA 3I1YA 1ZGCA 3WWEA 3IURA 4JYMA 4J0IA 3FWHA 5CMLA 1BN6A 2WU4A 2XUAA 3G9XA 4EZIA 5ALVA 1ZD5A 4CIAA 4LHEA 3VJMA 4H7IA 3I2GA 1JU3A 4Y2YA 2OGSA 2G63A 1ACJA 5DJ5A 1H2XA 1LBTA 1FSSA 5HF9A 4AN0A 3WWPA 2IIVA 4J0KA 3UUFA 1YSCA 2XMZA 4UBKA 4UFPA 5FKJA 5AKEA 2Q0XA 4HAIA 5AKXA 5H3HA 1B6GA 3F67A 4Y2PA 3D2AA 4QNNA 4ARAA 3HYSA 5D7BA 1QIFA 1EX9A 3HEAA 1UK9A 3F98A 3FNBA 1H2YA 3DYIA 3WIOA 3CN7A 3FLEA 5K3DA 2G5PA 1W6RA 2O2HA 5AM0A 1F0PA 1MX1A 3WKAA 1UZAA 1XZIA 4DLNA 5CXUA 1TIBA 3LS2A 5JZSA 5DYYA 2VT6A 4AZ0A 2V96A 3VISA 1DX4A 3STXA 1J2EA 4EY7A 2CZQA 5ALNA 3STTA 2O7VA 4UHEA 1AC5A 4UPDA 4WFIA 2QVBA 3O9VA 2AJCA 1DWOA 3FYTA 4QDZA 1IUNA 4KJXA 1JMKC 3D2BA 5LYYA 3V9AA 3PF8A 1HLGA 4FLEA 4Z49A 5LZ7A 4H7HA 5E2IA 2QXTA 2Z5GA 4IH9A 1O6FA 1SCQA 2WTNA 4KACA 5ALPA 4L9AA 2J3QA 2HA4A 3AZOA 2GZRA 3H0CA 1EB9A 2DQYA 2RI6A 1BN7A 4FKBA 2XUJA 3C43A 1ZJ5A 1AZWA 4X97A 4I4CA 2JGMA 1CPYA 1E66A 5C7YA 1AQLA 1JJBA 1T2NA 5CH8A 3L1JA 1XRQA 1LPOA 5FUMA 3ZI7A 3ESAA 2XUFA 4FBMA 2D0DA 3T4UA 5CW2A 4M0FA 3DJYA 5LZ5A 3KD2A 3C5VA 1UWCA 1GGVA 1XZAA 1CRLA 2HU8A 4GW3A 5AK5A 2PM8A 4U2DA 3C6BA 5ALXA 3FYUB 1YS2X 2WILA 1QTRA 3E0XA 2XE4A 3R0VA 5A6VA 4HZGA 4W1QA 3G0CA 1WM1A 2BJHA 1EK2A 5BV7A 2XMQA 3U0VA 1AUOA 2XLBA 5IVDA 1ZIYA 4X6YA 4KYVA 3W05A 3M81A 4YASA 5JASA 4BDSA 3HC7A 3ESDA 5AI4A 2WFZA 1CUAA 4QDTA 3C6ZA 4D9JA 1BEEA 3H04A 5ALRA 1K4YA 3LCRA 1NU8A 4BTLA 1TAHA 5IVIA 2CBGA 3H1AA 1VA4A 4BCBA 1CUDA 1ODSA 4G9EA 4WDQA 3FSGD 1MJ5A 5ALZA 4OYLA 5D6OA 2RONA 3HZOA 4MYSA 4UBOA 2XMCA 4BATA 1ETHA 2VQ6A 1EH5A 2WM2A 2FJ0A 1R9MA 1TCCA 2PSHA 2XI4A 4AX4A 1P0PA 4BRSA 5DYWA 3WWCA 4INZA 1EA5A 2W22A 2ZSIA 3EIOA 3WK7A 4AN1A 2WIGA 3R3XA 3AFIA 5FPQA 4MQLA 5AKGA 2CB9A 3ZLTA 1QE3A 2OAEA 3E3AA 4N5IX 1MAHA 5HFAA 1S8OA 4Q3OA 4G4JA 2OCLA 1H22A 2WUFA 2XMGA 4CG3A 1YS1X 5AKLA 3HSSA 5HF8A 5A7HA 4TVKA 3G0IA 3STYA 2CEKA 5DTJA 4BB0A 3WMRA 4B82A 1J1IA 4JNCA 1UKAA 4J3JA 2JGLA 3ED1A 5FRDA 4AMZA 3A6ZA 5T4HA 1QJ4A 4GHWA 1GPKA 5CRIA 4OU5A 4C6HA 1G42A 1XKTA 1Z68A 3O0DA 1MNQA 4H7EA 4ZREA 1CVLA 3H2HA 3C6YA 3EF3A 4NVRA 2Z8XA 3CXUA 5JD4A 4BRZA 3QBJA 4W1PA 3WK9A 2XMDA 1PFQA 3D59A 3I1IA 3QPDA 3RLIA 5DYTA 2VF2A 1XZLA 4AO8A 4X95A 1EK1A 3DD5A 4A23A 3PICA 2WIFA 1IUOA 2PSJA 4DMHA 2GBFA 2FX5A 1XZFA 4PSCA 5LLSA 3WZMA 5EHXA 2B20A 3D2CA 1FFBA 3LP5A 1P0IA 4N5HX 5BWCA 2JGIA 1YCDA 3QVMA 2Y1KA 5AICA 2CUTA 2OAGA 1C4XA 3H2JA 4CI9A 2C5GA 5FXMA 4MWTA 2JIDA 3STVA 3ANTA 4RPCA 4ZV7A 2CJPA 3K9BA 4PSDA 2DQZA 2WSLA 5AKHA 2DR0A 2WQZA 3MUOA 2JGFA 4AB1A 1UXOA 2Y6VA 3Q8WA 1AKNA 3F9CA 3SWWA 2JEYA 4KAJA 2AJLI 3IDAA 1JJIA 1XLVA 5CT6A 1ZI9A 4BAUA 1ZD2P 5HKBA 3B5EA 4DNPA 1MU0A 3H2KA 2QTBA 3O4IA 4N8DA 1EVEA 1GPNA 4QDOA 5AHXA 3HABA 3JYHA 3STWA 3C8DA 4C4XA 2VJBA 1YA4A 2C0PA 3RM3A 4BP8A 4L0CA 2XUGA 2PSEA 4U2BA 1CUBA 3A2LA 2HA6A 4H7KA 1NX9A 5E4TA 3BDIA 4X93A 3H2IA 1PJAA 4XIIA 3N0TA 3ANSA 1XQVA 5EHQA 1Y37A 5IVKA 4PNZA 2OG1A 1QIHA 1A8UA 5ALDA 1DWPA 4EY4A 4HRYA 1FJ2A 4O08A 3WLAA 5JADA 5AK6A 2QUAA 5CTAA 2GYWA 4KAAA 2XUQA 4LXGA 2X76A 2ZSHA 4FHZA 1LPPA 4DM7A 2ZJ7A 4EHBA 1GZ7A 2VAXA 1VJ5A 2VATA 1FFAA 2AXEA 1U65A 3G9UA 4XVCA 3D3NA 3S2ZA 1Q0RA 4UHDA 4A5SA 3TRDA 1IZ7A 3ZWQA 2R11A 1XZKA 1B41A 2ORYA 2XLCA 3I2HA 5EGNA 4N8SA 5JYCA 5KWIA 4H7JA 4FBLA 4OPMA 2H7CA 1XZEA 5AM2A 3G0GA 4JYPA 5AM3A 1UK8A 3IUQA 2UZ0A 1C7JA 5BWBA 4ETWA 3BJRA 2HA5A 1JU4A 4ITVA 3PDCA 5CURA 3C70A 4ZRDA 1E3QA 2OLEA 4UBLA 3VDXA 3ICWA 3N2ZB 5ALOA 2X5XA 1N5MA 4Q3KA 5AOBA 4LKOA 2PU7A 4WFKA 5JAOA 2BKLA 2ES4A 4PSUA 2XQGA 4OB6A 4KE7A 3Q0TA 3E4DA 4QEKA 2VTVA
chains in the Genus database with same CATH superfamily
1WXIA 1H9BA 1SOVA 2DUMA 4B2YA 3UAYA 1U8EA 2BF7A 3ROTA 4H15A 2R1ZA 5T8KA 1JI0A 4MLZA 4DOMA 1TQ4A 2PBFA 2CC2A 2VC2B 3D7NA 4ZU6X 3EE6A 4X84A 4EB6B 3T1OA 4FFDA 4TQAA 1M2OA 2VEDA 3B52X 1PDVA 4PCVA 2EP5A 5LXTF 4DIBA 1P7YA 3IIKA 3WGJA 1LJUA 3MYYA 4G41A 2J0VA 3EVZA 2Q0QA 1A71A 1JFFB 3VAYA 4C89A 2Q2WA 3T52A 2D7DA 3R24A 3N3AC 4ZPJA 3U0BA 1L7AA 1T4GA 1V16B 1NXSA 2K2QB 3T15A 2Y4NA 2V65A 3ZTYA 2POCA 4UVHA 4C6TA 2JFOA 4YECA 2IOFK 5KNLA 1K88A 4RPHA 4ZCLA 3Q12A 1NPTO 2JJ1D 2NXEA 2H29A 2ZDQA 4Y1FA 1ZVVA 3OG9A 1EHIA 2Z5LA 1KE2A 1WXQA 3WJ7A 2VO1A 2HK7A 1GFZA 3D7LA 3KT0A 5LD2B 4RM3A 4FSXA 5J40A 1HLFA 3SZOA 3WQHA 2D8AA 3QF4B 2R8YA 4I1SA 5JXJA 4IH4A 3LUHA 3U7EB 5JO9A 3BWVA 2WFAA 3YASA 1H23A 3D0KA 3GFPA 2WTUA 4F06A 3K8YA 3TTVA 1FYXA 3RABA 3II6X 1E2PA 3DA8A 1J97A 3PEEA 3WNQA 1GV1A 4IJ5A 1MH1A 4LC9A 4ZI7B 1VBFA 2H6EA 3IAM6 2X40A 3W5VA 1QG0A 1FYDA 3QW2A 1I10A 5F5LA 2ZULA 1TUIA 4QYWA 4YDHB 1U0GA 1W5EA 5EI5A 3ZN2A 1O0CA 1CWUA 2QN2A 4I7EA 4L3OA 3TX6A 3QVGA 4I8XA 1YGPA 1K8ZB 2WIKA 2GR9A 2ZYTX 3VYRB 4OLAA 5A0TA 4F9FA 4ZI7A 1USIA 1HFWA 3X3HA 3B5IA 1IEVA 5HWSA 1O9BA 5D86A 1HRKA 2WINI 1Z7GA 2MYPA 2SICE 3EULA 1MOPA 1NUQA 1Z22A 2NVWA 3FR7A 3ELUA 3LLSA 4MZDA 4YWHA 4DC9A 2IBSA 3KQVA 2AX4A 3PNVA 3TMKA 3W6ZA 1BU8A 2ZS9A 1DAGA 1I6WA 1OTHA 3BXGA 3N75A 4LI0A 1NLYA 2H2FA 2E5LB 5G41A 3RYHA 1SKAA 4P08A 4WGGA 3EOBI 4UOZA 1I4WA 4U9UA 3O74A 3U3XA 2HV8A 1RS0A 3TPFA 2C7VA 1P7VA 1WJGA 5DASA 4FE3A 3SBXA 3ZDXB 3L3BA 5CX1B 2HIAA 4X3CA 3RS7A 3OU7A 1Z0ZA 4GOMD 3SLGA 1JTFA 1RQNA 2BHNA 4DYDA 4G81A 1C4WA 3WV4A 5C8XA 3ADBA 4WJLA 1E6UA 4PLFA 1ZD3A 5AP9A 3AILA 1E1YA 4ZC8A 5B2ZA 3RUAA 1E4OA 4FHCA 2ANCA 2GYVA 2J59A 5LQDA 5B3JA 1LBIA 2PIAA 1T1JA 2Q9BA 2AN5A 2JS7A 3T1QA 1T24A 3AIKA 2I22A 1C4OA 3PQ7A 4AROA 5B4UA 4L76A 3G0DA 2FSGA 5FWDA 1ZVQA 4CM5A 1YRLA 4CT0A 1RZRA 3W06A 4DZRA 3U3DA 1ZMXA 1OJ7A 2BZ1A 2E5WA 3N2GB 3KWJA 2C7RA 4RPLA 1OJLA 4UTXA 1C3LA 4K9SA 1W0JD 1R27A 5JW6A 1Z0AA 2PZFA 3H5RA 2EBUA 3H8WA 1SR8A 5AVSA 5FUBA 1F5SA 1S0UA 4R7ZA 4ANFA 4QT0A 3FCEA 2ZAYA 1T2DA 4E3ZA 1GILA 3I2KA 1RRCA 3K09C 3EIWA 1M2VA 4M83A 5AI8A 5IDWA 2FW8A 3CMMA 3HJAA 3MMPA 3QFHA 2EJUA 1Q0UA 4JKIA 2DZDA 3GAMA 3IKLA 4QYIA 1QQBA 3U09A 1A2BA 4QE3A 3DCIA 3FVVA 2ZJYA 1Z2NX 5T4FA 3L84A 4BNJA 4F0JA 5CH3A 4HYYA 4IJUA 1SHJA 1F9AA 3D8RA 2PBRA 5C5IA 1BX3A 3VUFA 1FP4A 2PGOA 4MA4A 3SHQA 2I62A 1SVUA 3EZLA 2WMYA 1I33A 3LUPA 5FHRA 1VXRA 1OU0A 1BQ4A 3ESBA 4P92A 5K03A 4FNOA 3EN0A 1STOA 1RE1A 1QHHA 1ZK3A 4UVIA 4GRIA 5IH7A 3GH3A 3T41A 2HJRA 4B35A 4TWAA 2HRCA 2W6CX 3WBBA 1E69A 2JCXA 4PYJA 3OSZA 4CMIB 3R3WA 1EXWA 1XQYA 3FYUA 1ZN2A 5DB4A 4NY1A 2M98A 1ATZA 1IXSB 4CMBA 4CMKA 3F4BA 1KMHA 1J5XA 4DGQA 2AOWA 4HDSA 4ZO4A 1VZ3A 3FW1A 5A62A 5KTSA 1CSEE 1FLAA 4M21A 3UK1A 4QAJA 4BZPA 2WFLB 4HGPA 1QS0A 3CRQA 4V02A 3R7NA 5KBYA 2QNRA 4X8MA 1L2TA 3NDIA 5BQXA 3BWMA 5E9AA 2FUKA 2GWRA 3ZW7A 2ALJA 3FHCB 4BVKA 1NMEA 2O59A 3T1NA 4KNYA 4TTJA 1F2TA 4JS0A 4TN1A 1Y9AA 1VSTA 2Z3VA 2VCEA 5ICMA 5A5DA 1KSJA 3OPYI 4ZPXA 5EFZA 3DQZA 1OILA 3VZDA 5HIAA 4LRUA 4JP3A 3LXXA 1KI1A 3WMEA 1Z0UA 2H48A 3BDVA 4XGKA 4OX9B 1F6BA 1FZQA 4ZJPA 1ADBA 2CLSA 2WU3A 4REQA 1TRHA 3EODA 3LF1A 2EU8A 5BYKA 2PLAA 3NXKA 5IKEA 4JLDA 1KEEB 4AQYB 5DW0A 1S2OA 4KN8A 2HBQA 3BIJA 2A1UB 2I6SA 4L7QA 5AK3A 4MWSA 1EAMA 1W0KD 3MJHA 4JVLA 4Z6KA 1A04A 1PG5A 2BGUA 3C3JA 3EAGA 4B3TB 1CP3A 4FSHA 1W96A 5CVTA 4FZJA 4RK7A 1T0BA 1Z29A 2C3MA 3LW7A 4B79A 1RQRA 5ABPA 5BUSA 2LD4A 1FK8A 1UKVY 4L27A 3CN9A 3TLAA 1R16A 1BCSB 4Z51A 2FUCA 4BKMA 3NDPA 1JDBC 1BWSA 1JLHA 2O0LA 2ZJ1A 3QEJA 5K51A 5LYJA 3ZWOA 4DIEA 1NDUA 5ALJA 1IVYA 1RWXA 4O1IA 3MMSA 3BKWA 3WFJA 3C8HA 3WYDA 4PG5A 1P29A 3L8EA 3U3RA 2Z83A 1YE8A 3DYVA 3PRYA 3SNHA 2HJSA 3THOA 1S7CA 2QG6A 3T3OA 5J59A 2RHOA 1JAXA 4C01A 4G09A 4Z54A 3WQQA 2PS3A 1JDPA 2HREA 3Q4GA 4MVJD 1N92A 1SU8A 2WZQA 3AHEA 1UJ4A 1N2IA 1Z07A 4Q05A 4BFZA 2J0SA 3DW3X 5C8ZA 2XB8A 3BGOS 3OD5A 3NIDB 1C7IA 3DHYA 3NLLA 4B75A 5IABA 3JZDA 2I78A 3DWIA 3KSDO 3E2PA 3O8LA 1KBZA 1TLFA 1W46A 1VI5A 3B2QA 4KQWA 3FROA 4N1AA 4RCYA 4P3XA 4OB7A 2J33A 5ESDA 5BRNA 3FSRA 4JB0A 4NBWA 1T8WA 1PJQA 3TXXA 2ZVJA 2ATEA 2FFBA 4F1WA 2N42A 2IZ0A 3IS3A 1H2WA 2G71A 2CNDA 2Q3DA 3LX5A 3NEYA 1FS4A 5YASA 4DIMA 4HNTA 2Y1GA 4QWWA 3I3OA 4WEQA 1DKMA 5F5XA 3NM4A 3WBFA 4MRVA 1KMMA 2C3PA 4DMLA 3ISVA 1IQUA 4IW3B 5FPTA 2YJTD 3SJCA 1N2SA 5ALHA 5DV9A 3GYGA 3H9JA 2QBYB 3UWKA 3BGVA 1OXVA 1H94A 1PJZA 2B78A 2ERXA 3FJYA 1YASA 1M76A 1RDFA 3FBWA 3HO8A 3PDIB 3H9EO 2XSZA 3BYZA 3BD7A 3KKMA 4L0DA 5JFTA 4H60A 2OT3B 3GGOA 3LNCA 1HY3A 3B8EA 4H16A 3NH9A 4LJ5A 1MQSA 1SU6A 4OA5A 3CW8X 2D2VA 3ETDA 4U0KA 3TQRA 3UW1A 1L6IA 2WDPA 1YB6A 5F33A 1J8QA 1AUXA 1GKIA 1SVLA 3INTA 4C3UA 4P3KA 1CXZA 3JQFC 4NBKA 2PNJA 4K9NA 2JCBA 3VJRA 5TGDA 4F21A 2Q1SA 3NOOA 4IUBS 3HRHA 1JEQA 1TEHA 3V6LA 1P5HA 3TXYA 5HOEA 4G2NA 4OK3A 3U6BA 4FDLA 2A4MA 4YRDA 1E3SA 5EWLA 3V7UA 2A9QA 2HLDA 3A0UA 2Y2VA 3L7BA 2O9JA 1WWKA 3CBGA 3AW9A 3ZR4B 4CODB 2C4UA 1E8MA 1GL7A 1L7DA 2IEIA 4EEXA 5E7QA 5U1PA 1DXHA 1ZNQO 5H9WA 3LOPA 4JR2A 1T2EA 3GRCA 2Z6UA 2DVMA 3KEQA 3K9FC 3GEMA 4HGQA 4KXXA 4U2EA 2DE0X 3U3JA 1T9GS 1U2RA 3CGWA 2ZJ8A 4K6HA 4KQIA 1S2MA 4KQXA 1Y3CE 5CDFE 5JBIA 4LJRA 2KLBA 2JLVA 3OCVA 1YO6A 1P61B 3A1CA 4H59A 3ZS9A 1HKUA 4Q34A 1JA0A 1KAMA 3HU3A 3QUBA 1M5UA 4NG4A 1CEEA 2FZVA 1KAGA 2P9QA 1KY2A 4F2GA 4HWPA 4XUDA 2DY0A 2JFYA 2QDXA 2R3SA 3AHCA 1DAHA 4US2R 2XT0A 1VLZA 3L0PA 1WUJS 3QE9Y 1QO9A 2NT4A 3FGOA 3LAWA 2DT5A 1DQYA 2OCYC 4MUXA 3OE1A 1P72A 3CT6A 4HATA 5LZ8A 4UPEA 1ZWLA 1ZMBA 1YXMA 2REQB 4BEWA 1XRNA 4ZKEA 1MZVA 3DF9A 4GOXA 2ERCA 2YXNA 1UDBA 4DLWA 2Y0BA 5F1PA 4IIYA 3PGVA 2XECA 1K98A 1SXJD 1ZM7A 3EZNA 4GYYA 1Z2EA 3BMCB 3MGKA 4HRXA 3TH5A 2DULA 2HU7A 5JEEA 4X90A 4IV0A 1EIWA 4XZ3A 4MR9A 3W6NA 1M67A 1TQ6A 3GCXA 1FP6A 1SC6A 3VZPA 1CY1A 1QMPA 3B60A 2PUBA 2QY9A 3UH1A 1QHGA 1SHZA 2Q8QA 2REXB 1EINA 2QD1A 5ESRA 1JGTA 1QHHB 2PL1A 4N4AA 3RVPA 4URHA 1R6VA 4KFUA 2JFUA 1OLUA 5F23A 2JFGA 3LZDA 3GFFA 3WG9A 4QFMA 1N33B 2JK1A 3FYDA 2NZ8A 3I9FA 5FFFA 2OKGA 3U56A 1LUAA 3IBTA 1T0IA 1VJGA 4IR7A 4II3A 1NUAA 4DARA 5AVQA 4H1UA 4QA9A 2NZWA 1W0JA 4OLFA 5FD8A 3EYAA 1F17A 3K0FB 5JG7A 5A03A 2BBOA 2WPDD 4X61A 3G5AA 1DO0A 2XJ9A 1ESEA 3KBOA 3R7SA 3IVRA 2AJ8A 4KQMA 3MJ4A 1JKIA 2FE4A 3NFYA 5FOTA 4GRAA 1RSZA 1KHHA 2E0IA 2HD4A 4NBSA 5IH3A 10MHA 1X70A 2I7CA 3TVYA 2OYCA 4I5FA 3TF5A 3KZXA 3H3XA 2G9UA 2AGVA 5C8DA 4BX8A 4BLUA 5AIAA 1IATA 4IGEA 1KL7A 2DG2A 3LOUA 1BQEA 1LX6A 3ZZMA 4BEVA 1LSOA 2FPRA 2OFPA 4Y6PA 3KETA 1VZ2A 5ALQA 3H4TA 1HZJA 1L7XA 1H8EA 1ST3A 2GA9A 3OQPA 3KZCA 3W5IA 5KREA 3D2LA 2C77A 2P78A 1XNJA 2PUVA 3EAFA 4F5EA 4EO7A 4D82A 5SZIA 2W6MA 1W25A 3F1KA 3IELA 5ERYA 2B82A 2Z8ZA 3AR5A 3PJGA 2XXAA 2WYUA 2ZW9A 4JLBA 2P9CA 2INGX 5K4GA 1O1YA 3B53X 2LKCA 5FFMA 1IXYA 4Q12A 2H1SA 1WP9A 4RZXA 3WNVA 4DSNA 2XNHA 5BYJA 3TCXB 2DERA 1VCNA 4V0MA 3I62A 5FBKA 3ZDYB 4EYSA 3CRW1 4U8GA 1EDOA 5J23A 3HVJA 3GLGB 2UUBB 4UMVA 4C22A 3TK1A 5GVSA 5IXYA 4RKYA 4C0XA 1IH8A 3KALA 3ML1A 4MW9A 4HBZA 1E64A 1YR7A 2HYDA 4NV0A 5E6UA 2XNCA 2EWVA 4I6EA 2PXHA 4LZZA 1IG3A 4O1HA 4UNQA 3DOHA 1PFUA 3EGOA 2WKSA 2C94A 2Q99A 3HRKA 4EA9A 4EG3A 1W4AA 1BRMA 1FMCA 1DUIA 2K87A 3AI3A 3QZUA 4IDEA 3KSBC 1C8LA 4R9UC 5EINA 5GM2A 2R7NA 1RLJA 1KO5A 2WVHA 4M7WA 4KR0A 1EFRD 3HB0A 1I01A 3HJUA 4Z9FA 3PJDA 2HFKA 3WDLA 3LXMA 2OECA 3WXMA 4C4RA 4EZBA 4CRWB 4ZGBA 3U16A 5KKAA 1NBHA 2ZUCA 4L2IA 4QM7A 2DFDA 3ZHBA 4IMJB 4UHJA 1A9RA 4F3NA 5BSKA 4EWLA 2DCMA 2GX6A 1O6ZA 1P17A 1USGA 3GBSA 4PZYA 1V3UA 5J4YA 4IUCS 2BC9A 3B9PA 4B47A 4C7OA 4QTUB 3FI0A 4OQEA 2QUBA 1NDQA 4MGEA 4TV8A 3UW3A 4U0JA 1RWQA 3ZK8A 3OBBA 2WJPA 1N6IA 4J1QA 1P5RA 3H11B 5DGTA 4C3ZA 1KFBB 3U48A 1PDOA 2IS1A 2HM7A 4KPFC 4D97A 1WSAA 1PX0A 4PFSA 5CPFA 3T0GA 3OTQA 1RVV1 3C7DB 1E9SA 2NZVG 2XYRA 4HEA1 3S2FA 1AZSC 5I4BA 2ACWA 3FBGA 5CA1A 2SCUA 4V0KA 5EERA 1U7PA 1I9CA 4FT4A 4K3UA 2OK7A 3UMVA 3MGAA 3ZLUA 5GGXA 5E3HA 1O5IA 3JQBC 2QVGA 4YQFA 5C81A 4QIHA 1JSCA 1W76A 1BROA 1U0JA 3IAAA 4BMDA 2IXBA 3U17A 3WK4A 1EX7A 4PYMA 4TXHA 4D6PA 2QT9A 3RTBA 4HGNA 2FEAA 2AOTB 4G24A 5TGTA 1JAYA 3MS4A 2QRJA 1RM4A 2Q5HA 3P2MA 2OP1A 2QKYA 1JQJC 3C41J 2UVDA 4MHSA 4ND4A 5FUQA 1I0IA 3BEDA 1O95C 1Y63A 3VHQA 1DQSA 1Q0SA 1VLLA 3AMVA 2XE6A 2ARKA 5JNTA 4DEXA 1JR3A 2QNIA 3GZ4A 2YWJA 3ZKAA 1T91A 3M9XA 4PX5A 5AYVA 4O2LA 4PX2A 2WSYB 2LW7A 1MC8A 5EE3A 1MV8A 2C9CA 4P80A 2AQIA 4P81A 4ZQCB 4ZVOA 3UTDA 3QXSA 1D07A 1JKJB 1TK2A 2IODA 4IZ6A 1WD7A 2MMGA 4C87A 1N2XA 2ZYIA 3W79A 1O4WA 5HJ5A 3G9TA 4E5YA 1VHTA 3W4JA 4UREA 1CY7A 1I4DD 3Q40A 4ZJUA 5JRZA 1UT5A 3QELB 2KQUA 5AJUA 3AFOA 3R5XA 3IO5A 4R3NA 5K3FB 4HUQA 2C2KA 3FVTA 2EG5A 1ECFA 3FMFA 3KJXA 5H83A 3RKRA 3K15A 3LHFA 1NLFA 4PHFA 3WK6A 4B3IA 1H1LA 4EI2A 4JHLA 5KVCA 1QRTA 4W9NC 1SBHA 3BA6A 2ZTSA 2JB9A 1NI5A 2JA2A 2REOA 2LUOA 1IYZA 1QBGA 5E1OA 2R84A 4BY9E 4E94A 4DJAA 2H08A 3ASYA 3NAGA 1XRRA 2XZTA 1LQUA 2H07A 2QRVB 5KOYA 4CKBB 5G3ZA 3J80A 4OGWA 2M32A 5AFSA 4ZOBA 2R97A 1ESNA 3AVTA 2J5XA 1VKNA 4BAZA 5B3KA 3UUWA 4IDPA 3I04A 5CUQA 1F48A 5FPPA 5CDUA 1X1AA 2I4LA 2P2SA 2Q4EA 1SURA 1DUSA 4H77A 4PG6A 3RK0A 1O6BA 2YY5A 4YCAA 5F2OA 3VVCA 1G8KA 5HJEA 2D54A 3M9WA 5JT1A 3N0RA 3GCGA 4IVQA 2FEKA 5JPIA 3AW8A 3HB4X 4GH5A 4YAUA 5K8CA 4UASA 2VPIA 3P45A 5DIZA 3RC2A 1M2FA 3J81k 3CA8A 3FN4A 1DPGA 2OB1A 2BP7B 2ZU0C 4OJKA 1XDDA 4BECA 4JWTA 2X8BA 4DQKA 1COWD 4Q66C 4S1OA 1T5HX 1THMA 1TB4A 1N34B 3A04A 1XQWA 5MN6A 4F2WA 1Z63A 2XVAA 1FIUA 3LU1A 5B7QA 3EISA 3SC2A 1MW8X 1UEXC 2UYGA 3E5RA 3Q8MA 3DVRX 3RREA 1DQNA 4F4CA 2ECOA 4RJTA 3BTVA 3TX2A 2EZTA 4ZEVA 5DNYB 2ZWPA 4Z86A 1LF0A 2GN8A 3SMVA 4D4IA 4DN6A 3FGNA 2XB6A 4FEGA 1K6EA 4J7AA 1E63A 4J0CA 4LX0A 1U0NA 4TV9F 2BISA 2XF2A 4ZVTA 3PQCA 1V1RA 3G8DA 3H5NA 4BMZA 5HKAA 1OYYA 2V5AA 4KX3A 5GMOA 2MSNA 2VA9A 5J2UA 1GGKA 1Z74A 4HWSA 2WEKA 3EH1A 3T5DA 1TU0A 3BSYA 1XKQA 3I9V1 4LVCA 4MO2A 3CUYA 3S70A 4DBLE 5LC1A 4POOA 1U3TA 4EHKA 4DV2B 1NAIA 5G1OA 5JPCA 8ADHA 1LS1A 1QRRA 2FZGA 5FI0B 4J8PA 3KNZA 2HA3A 3IFSA 2X0FA 4BQQA 3NHRA 2F8SA 1DIBA 2RGBA 2YC2C 4ZI5A 4ND6A 3DUWA 1RJ9A 2APJA 1D9ZA 2P9BA 3Q2IA 5HMLA 3TRFA 1RWKA 4PG7A 2YUTA 3PI6A 4GMKA 1L9XA 4P98A 4CTJA 1SUPA 4QGFA 4X20B 4C6RA 4MV4A 1WDWB 4C7KA 2GM3A 4BQEA 1H4TA 1OA0A 1V95A 1FFEA 3QF4A 2R6GA 1OIXA 2QN8A 1YJAA 2GFIA 2WG1A 4XQCA 5SZHB 5IFLA 2PV7A 1H3EA 3ITNA 3IR7A 2ZM5A 2AMLA 4EGSA 2RBKA 2WPDA 1GFIA 2Q46A 5C51B 4A10A 1EP9A 5IKOA 3WADA 1Q15A 4TYMA 3FWNA 2CDAA 4UDNA 1MRNA 4DJTA 1F60A 2B4AA 8LDHA 5AHWA 1BXRB 5JAPA 4RZIA 3KXDA 3KSRA 3C2QA 2ZYHA 4C20A 4NV1A 1UJBA 3A1DA 3AHDA 2FEOA 2I33A 2W90A 3HYNA 4GX0A 5A9SA 4YMUA 1HGXA 5BN5B 3QUSA 2DH6A 3L7OA 1ODKA 1BVUA 1C3EA 2H1VA 3SR3A 1Q3KA 1WOMA 5M29A 3QYAA 1MD9A 5BSEA 5ALSA 3LT5A 3AVWA 3UT5B 1H8ED 4I9FA 1ADGA 2FAXA 1TYBE 1JHVA 5T57A 4BZXA 4P58A 3SDSA 1PRYA 1ECJA 1ULBA 1T6YA 2A5LA 4FYWA 4CG1A 4EYOA 1AMUA 1FNNA 4OHVA 3ZS8A 1I32A 3DL7A 3MYRA 5CLHA 4QUJA 2LP4Y 4XGNA 2XGOA 3LHSA 3ZGOA 2EW8A 3PHBE 5CA1B 5F76A 1IM8A 2RI1A 3CNNA 4MIYA 3DZCA 1F20A 2K2WA 1DAIA 2A8YA 4NBTA 1OI4A 5KMGA 1UMDB 4DKJA 4EW2A 3DGEC 3HWX1 1KC1A 3L8CA 4TUYB 3HXKA 1QKIA 2QG4A 3UFBA 1XL0A 2QD3A 4EYKA 4EPTA 3HRIA 1E0SA 8ATCA 5JZMA 5HR5A 3OIDA 3KQQA 3GJTA 1JG4A 3ZIAA 1X14A 1MFPA 2QTVA 3GLRA 3B7WA 4JYZA 3LDAA 3JQAD 2HO5A 1MB3A 4XCQA 3FPGA 1A97A 2VR1A 4RVUA 2FN7A 2OV2A 3RWBA 1GPH1 3IP6A 4UXHA 2NSJA 4HNQA 2BI4A 4CU2A 4UTRA 2PRSA 4MVYA 3KYDB 1B8VA 4UBJA 2F62A 3R3YA 2XUIA 2OV8A 2QTVB 3ZBPA 1THTA 1EG2A 2YYSA 4RYLA 1LWOA 2ZUWA 3A7DA 1NF9A 3RRBA 1CUGA 3K09A 1QK3A 2HB6A 3ONVA 4TL6A 2O7RA 5L95A 1ACMA 1ZC4A 3ETEA 3GX1A 3I01A 2WSBA 3HN2A 4Z0HO 3J81A 4Z4GA 1KK2A 3N7AA 3EWIA 3JZFA 4AS3A 3O92A 5E6UB 4BU0A 4OHPA 3ORYA 1E1NA 3GA7A 2NAFA 1JHOA 4CIBA 2C2GA 4GKVA 5FCDA 3OF2A 3W77A 4UBMA 5TPWB 1U7WA 3K0FA 4KH0A 4CMIA 1VKHA 3B1FA 4R9SA 1CCWA 4XASA 1KH3A 5G0VA 4DDUA 5F78A 1JQLB 5DNWA 3NFRA 4Q3NA 5FWAA 5B1HA 4B80A 2H7VA 2ZRAA 2JIMA 2FQWA 3H83A 4X8OA 4J49A 3G5UA 4YAGA 1NXPA 2HMUA 3NTOA 4N54A 3VNSA 3NHYA 2GUGA 1MCZA 1NBEA 4R3WA 2C9ZA 3I34X 2VHTA 4GVXA 5JD3A 3NT5A 4R2KA 3I42A 3ANLA 1JKMA 4FNGA 4RE5A 3V8QA 4UTPA 4P4NA 2PUFA 3OP1A 4RKFA 2AI1A 1EUDB 3G2HA 4U6QA 3TPCA 4CUJA 3F73A 1VQ1A 3D0RA 2BN4A 2GTHA 1MDFA 2G36A 3MTIA 2G4CA 4RIIA 4XIFA 2IIPA 1BH6A 3ABIA 4IHAA 3MB8A 2CHUA 3ZHOA 3E9RA 2Z4RA 1MC4A 1NKTA 2JFHA 1FFXB 2OZLB 4FMDB 1ISSA 3LHIA 3ND6A 4ICIA 4O59O 1WOYA 4Q4AB 1T4MA 1U0OC 1U0EA 1U9IA 2AZTA 4I1VA 1MEEA 2UYYA 3DXFA 4OBBA 3D0OA 3OTHA 4C0BA 1X7GA 2JGKA 2VHYA 3UIEA 4QUEA 2IDJA 1T36A 2EFJA 1GUZA 1N2ZA 4WQMA 2WHYA 1OLSA 1WY5A 5D00A 4WKOA 1A4IA 4G1EB 1VI6A 5CT8A 3L5KA 4XRGA 4ZIRB 5A4MS 5KYTA 2WG0A 3BE8A 3VZQA 3JVUA 3R40A 1OPXA 2IEGA 4LCEA 3PLRA 3BG5A 2OLJA 3DFZA 3MT0A 4UD2A 4RK1A 5AJYA 4BWVA 1MOQA 3U61B 2FKAA 5DP2A 4QVKA 1Z38A 1JR3D 4TWRA 4YIKA 4Z0PA 1CV2A 1D09A 4Q3AA 1JFTA 1FW6A 3FMVA 2PRIA 1KEZA 4FR2A 4DUGA 2I2BA 2HA2A 2ZAIA 3ILSA 3IPYA 1G19A 1T8PA 1CC1S 3CZ4A 3EG9B 4GYJA 2GT1A 4UCXA 4OGFA 5AXDA 2JHAA 4HPJB 4DUPA 3BK2A 3WJ2A 3V3KA 3OOJA 4MLDA 4WV3A 2FQ1A 4MEJA 2FG7C 3V42A 4MKIA 3ZDBA 4LQCA 2IH2A 1NR5A 2C9DA 2GHIA 3R8CA 4LN1A 4W99A 3QTTA 2G77B 1NQUA 2J3KA 3DUFB 4WINA 1DV2A 1JIUA 5EJAA 1QTIA 1DHRA 1PK8A 1GSAA 1CF9A 1RT9A 4IAOA 4UMEA 1K92A 4B4WA 1GITA 2P5YA 5JXIA 1D1QA 3VNUA 1L5SA 4ZZ2A 4NNPA 3WGVA 2WF6A 3VTZA 2PL5A 1U5BB 4JBIA 2ZSBA 5K20A 3D43A 4M8IA 4RNCA 3MELA 4O1MA 3MWLA 4DREA 2B8JA 3IAM1 2R62A 5ADWA 3TJMA 5KWVA 4G5XA 1WIWA 1WVGA 3N59A 1U31A 1Z25A 4TM8A 2AR9A 1A2QA 2HJWA 3C87A 5K0CA 2ZCVA 2A3NA 2OZKA 1L5GB 3VSAA 4CVNA 3OZ7A 1G64A 2PIDA 2WHPA 4Y9DA 3U4HA 4EB8A 2Z08A 1Z8HA 1TMGE 5D1NA 3RKUA 1RU3A 2AFIB 3S1LA 4WFJA 1PR9A 5CP8A 3SIRA 2CDRA 1FDSA 3AJ8A 3PDIA 5F2NA 3ZGZA 4G37A 5EUBA 3IMCA 3EVNA 1A8IA 3HL0A 4TUYF 1XDUA 3DMRA 4X54A 3PGXA 1DRVA 4HGZA 3KOOA 1TKRA 1KP3A 2CXHA 3LFHA 4CL3A 5K9ZA 1WHTB 4DWVA 3AY0A 3SX4A 1CG6A 4AI6A 3EPPA 5U9CA 4WN9A 3NC0C 5JAHA 1VTKA 2ACEA 4X66B 5K4HA 4Q1CA 3COWA 3O8CA 2A84A 2VPZA 4NCAA 4BNVA 3GLIB 2X19A 2CMFA 1E6KA 2B1GA 4G0NA 1B7GO 4NJMA 5CHYA 3PENA 2W6JD 3BICA 3WK5A 4D0RA 5BSMA 2QL5A 3IB3A 2ONCA 3IQGX 3S4YA 3WNZA 2JIZD 3SR0A 4XPIA 4EB6A 3FOFC 3PNBA 4BRWA 5A2GA 5K0LA 3UGQA 1VFPA 2ID4A 2YV3A 2X9VA 4M89A 1QRAA 4G0XA 4E15A 4TRMA 3IEIA 3TL6A 3KE8A 4HAVA 1W36D 1LJLA 1T3LA 4TWIA 1UP6A 1TF2A 1JU9A 5ITWA 4M9ZA 1H8HA 1PUIA 3PTZA 5GOTA 3KUCA 4FQ5A 4B0OA 2Z1MA 5BN1A 3L7LA 1QH0A 2J6BA 4LDNA 2FPIB 3ZI0A 1C9EA 3BCHA 1R0YA 3OZBA 4PZPA 2J08A 4OCZA 1MP0A 2GEVA 2O0KA 2F2TA 2NM0A 5BPFA 5GIPE 2OBLA 3B3JA 1BSVA 1ZGAA 1D7OA 3FNGA 3Q7PA 4TKVB 4LGYA 4KLAA 3D6MA 2P3LA 5CDYA 3TQCA 5DNDA 1IG0A 2OXCA 3PE4A 4IDAA 4MI3A 3SICE 3WWDA 4DILA 1E59A 1BHSA 4YJ3A 1NJ2A 2G9RA 3D9QX 1Z5ZA 4BLVA 1DC3A 1D2NA 4EQ6B 4AECA 3D7RA 1XZGA 1HWYA 3GPDG 1UJ6A 1R9GA 9GPBA 1IM2A 1DUVG 2CHGA 1W94A 4GBJA 5TVKA 1ML3A 2QJWA 4LYHA 4ZKDA 1IN5A 1G8GA 1HT3A 4Y1RA 1IJKA 2LCIA 5BN4B 3T3HA 3FKSD 4R5MA 4WXHA 2V4MA 4YRIA 3UMYA 2BFFB 1LRLA 1OXXK 2PK3A 3EVBA 3CVVA 4CKCB 3BAFA 2JAQA 1I0LA 2PTGA 1DKPA 3V1TC 3NBZC 3UA4A 1W5AA 2EHJA 5FTJA 3T7IA 4CTNA 3OE7A 2JIOA 4NTZA 4J03A 2NG1A 3T99A 1MA0A 1XVLA 1EDBA 4K9DA 5EEGA 3WO1A 4OQXA 2AVNA 2VSFA 5LA6A 3TD9A 4JI7B 4P0QB 1PYOA 1Y4AE 4GO1A 2BFDB 3PUJA 4YRSA 5H0IA 3WJ1A 4ZI2A 1JW9B 1R88A 2Z2ZA 3NKVA 4Q18A 2FYTA 1O54A 2ZLBA 1ZI8A 1K8RA 3IP1A 2IIQA 1UMBA 2WWFA 3BF8A 3I72A 4MR7B 5ESXA 5JISA 4JNKA 5U4XA 3J7AC 3ESRA 1F3LA 1GXSA 1LLDA 1RKXA 3GJXC 4H6WA 2Q0HA 4IXNA 1XQXA 1GGHA 4H6VA 4LA4A 1V9SA 1VGRA 3R75A 2WU1A 2I80A 3UMCA 4B73A 1K3FA 2QPAA 3N7TA 3MWEB 5IBRA 2AKEA 5K3AA 3ITEA 4JJGA 1ZPDA 3KQNA 1AVTA 3V8RA 1S3SA 4CUKA 2GN9A 1ZGGA 4D41A 1YCHA 4YJHA 3ZZTA 3O1IC 3VPCA 5FUXA 3WGGA 4U63A 5CDTA 2XZOA 3O2JA 1W8DA 1GZ3A 1IB0A 1X92A 1S3IA 2PGAA 5JANA 2H5IA 4L02A 3A6DA 4R2JA 4NULA 5A4JA 4B2LA 1XTJA 1YTUA 4N8EA 5EPOA 4DTCA 1L8LA 1XVIA 2IE0A 8AT1A 9LDBA 3L7CA 3SC4A 2PLFA 3PC4A 7YASA 1P8JA 3E48A 3KSAC 2XYPA 4HXGA 2ZT6A 2H7YA 3AT1A 2BDEA 1QQ5A 1E99A 4PXSA 3WA6A 5J47A 3UQYS 2JLCA 4PX9A 3FVRA 3VU8A 3F3MA 5AHKA 1M2WA 4IHKA 4E2ZA 3LIIA 3JATB 1DC5A 5MFPA 1ZL2A 1GGNA 3MINB 4JI8B 1GARA 4KI7A 5JVDF 3CW2A 4R0NA 4PNPA 2ET6A 2FWPA 1OX4B 3PP8A 1YNOA 2NNWB 4Y2VA 4FDMA 1JALA 3ZCSA 3A6KA 2GN6A 1ZIXA 5EIBD 1GUFA 4IO0A 4WLNA 1EM8A 2I1WA 4HQ6A 1KP9A 5JAZA 2V4ZA 1H2ZA 4PPGA 3JD4A 2H2IA 1QDEA 1NJ6A 2LIVA 4I4NA 4I55A 4RH0A 1QGED 2BFBB 4QBGB 3TPZA 4MMYB 4DS3A 3SN6A 1P80A 2C2HA 4YHHB 1L5OA 2BKXA 3VU9A 3K0KA 1TJYA 1ONSA 2C5LA 1UWVA 2IE8A 3F9RA 1QIMA 3IJPA 1P3Y1 1Z6QA 2GBCA 4P8RA 1USKA 1EVLA 4AZVA 2C00A 3F6SA 4OVKA 2EW2A 5TMDA 5HMMA 1WB4A 1IULA 2G8NA 1T6XA 3L6OO 4O2AB 5BNZA 5BWOA 4R8VA 1T9KA 2BUCA 1JSLA 2TMDA 3PDJA 5LBIA 3B89A 3E5NA 1ZH4A 3JY6A 2ZI3A 3AI2A 3KV1A 4NZOA 1F7VA 3AX6A 4TLAA 2H9IA 3EXAA 3VKWA 3WL8A 4G07A 3LP8A 4DWJA 4NMLA 4I9HA 3ZY6A 2BMAA 1XMPA 1Z06A 4ZODA 4YCLA 3GWZA 1N0WA 2H2GA 3SX2A 2XYGA 4DMRA 4PC6A 2ATXA 1UR5A 5EPEA 1G3MA 1R3DA 4PQEA 4PONA 4C43A 2WWXA 3GLFB 3AG6A 4JDUA 2DTXA 4B6GA 3SJUA 4WH0A 5C7OO 3BM5A 3UUEA 3URMA 1PFKA 5LZ4A 1JG6A 3ZD9A 4DY4A 1JZTA 5FX2A 1CIPA 1XYGA 3JQBA 4UCWA 2C8VA 5JDCA 1I51A 3KAPA 4NJEB 1RI3A 1XJWA 1NNSA 4X94A 3DAPA 3S8YA 5E7MA 4MS4A 3PS9A 2V03A 1TL7C 3L8MA 2AN4A 3VHXB 1EXVA 1KI3A 4URXR 5JTTA 3OOSA 1A2OA 5B37A 2FNAA 3LRXA 3K9QO 4WNAA 1S3FA 3QVVA 3FHJA 4KLCA 3TW0A 4CQJA 4CGZA 1J5EB 3BJMA 1QVRA 4MUGA 4NWIA 5BNFA 1TEZA 1RC8A 2XB2A 2YVAA 3ZGXA 3HWRA 1T9DA 1I7QB 1YRBA 1KZ6A 4TL8A 5FLYA 1ORHA 3QUCA 4L51A 3HM9A 3NGLA 2V6BA 4J4HA 3L7AA 3EEQA 3R6TA 4XDYA 2WM9B 2OHFA 1E6WA 4KE8A 2FH5B 4I1IA 5IAKA 3L7MA 1Q1GA 1G7CA 5IYZF 3TNYA 2CE7A 2YHBA 5GONF 4GR9A 2MU1A 4C1BA 1G16A 5ERXA 4CCYA 3T7JA 2CXRA 2ENWA 3X1ZA 3A25A 4RKWA 5KDDA 3SFVA 1Z34A 2VLBA 4B09A 5F52A 5B3LA 2IFTA 2XKAA 1Q1AA 3O90A 1P45A 4LPSA 3LXUX 4QU5A 5JXWA 2JVIA 2B9VA 2PZ8A 2Z8YM 4FMDF 5KWEA 3B1KA 3SDZA 1IRXA 2EF1A 2V7GA 3A0RB 2ECFA 2X6QA 2R1TB 3EGVA 1W19A 3C6XA 2RAFA 3DMTA 4OFZA 1W44A 2R4QA 4ZARA 1WP4A 2FFQA 3FLBA 3MJDA 5CT5A 1O87A 1ADFA 1D5WA 4YMVA 2G1JA 4MYCA 1X2EA 2XUPA 4OATA 4Q9JA 1AMOA 2VDKB 1OZAA 1OZ0A 4NCNA 4WK0B 1E3MA 5E95A 1WEHA 3G7SA 4G6ZA 3CMCO 1KDOA 3KVVA 1Y5LA 1TPZA 4JQCA 2QJOA 2GVDC 3KB1A 3TGWA 1B16A 1VBNA 1HMPA 1NSTA 1V16A 4GOLD 1JYFA 3DW1X 1YD7A 2DF8A 3GOQA 5C8YB 5KX5B 5C37A 3DVAB 5H70A 1P8AA 2ZXFA 4ZN6A 1P0QA 3Q9SA 3L7DA 3OY2A 1Z5OA 1VIYA 1DLIA 2P7HA 1KETA 3BFJA 2FSFA 5DM1A 3UMSA 3UXEA 4UU0A 3X2SA 3KPJA 1NF8A 1N1DA 3LV8A 5DGDA 4NCIA 2O3JA 1E98A 2NSHA 3EXHC 3ROKA 2ZRIA 4LF9B 3SS7X 4MGHA 1JEQB 2WSMA 5GZ3A 1D6NA 1T9HA 4B5KA 4RIFA 1WPRA 3W3AA 1QIGA 4LKRA 4BN5A 4HDCA 5G40A 4JASB 4ALKA 1RBQA 3EG9A 4H0CA 1GADO 4EFNA 2C2XA 3N7UA 4IDGA 3D4LA 4PNHA 3EX7C 5CJPA 4E33A 5K8JB 2X7XA 4RTRA 1YDEA 4PRKA 4G5SA 4RGYA 2UZ1B 2VNIA 3DLHA 4RA9A 2CN1A 1GNLA 2BGLA 4ESOA 1WLYA 1FNMA 4Y67A 3AR9A 4A15A 1BMFA 1SPBS 4HYQA 1UBKS 1KMHB 4LK2A 1SRRA 4DMCA 3KYCA 4AMBA 2EWWA 3I83A 2X4GA 3HKCA 5DNUA 2HZ7A 2VTBA 3NBMA 4ZC1A 3P9ZA 2R7MA 4BV3A 5AW1A 1C7EA 3QWIA 1UKBA 2GLXA 4ZAXA 5JSYA 3WTCA 5JXHA 4ZHQF 3NONA 2Q6LA 2JW5A 5AM1A 3HBFA 1X8KA 1G63A 1YRHA 1UOOA 2EX0A 1N9ZA 1XTVA 2PVPA 4L9RA 4V3BA 4DSTA 2BFOA 3U7JA 5HRUA 1I1HA 3DR3A 4UEOA 2RH4A 5G4KB 1PS0A 1SWVA 2QK4A 3GZNA 4QARA 3EZXA 4YP0A 2DBYA 2ZWMA 3EUAA 3JR7A 4GRDA 1IOWA 4FHDA 5H4HA 1NXTA 5EE0A 1O08A 1TLLA 1BQ3A 3KTAB 1M6WA 4YR7A 3R0XA 4QLOA 3T5TA 4HOYA 2C7OA 3QTBA 2QZSA 3RF7A 2R85A 1EWTA 5I47A 3IUJA 4N47A 5A3RA 2ZAMA 4QUBA 5TQ2A 1VJCA 1Q1ZA 3VXKA 1OWMA 3L6BA 4XUEA 4K88A 3WLKX 4MKHA 1K06A 2GYUA 3BORA 1F51E 1UMCA 5AXBA 4BVLA 4B3DA 1DC6A 3N2GA 4DADA 4B81A 1NY6A 1PGPA 2IY9A 2XTMA 3FHOA 2VSXA 2DHCA 2OD9A 3IKVA 4MUMA 4X8LA 4KOEC 3UMJA 2QMHA 2ILVA 3GN2A 3VR6A 4BEBA 1EDEA 3KOXA 4WXMA 1Q3HA 3U3OA 3WGYA 5BSHA 2O2XA 1T1IA 2PVSA 4OP3A 1GRVA 1U2DA 2EQAA 4EF6A 2HMWA 3GVHA 2D2IA 4XGRA 1V1MB 3P9KA 5D87A 3O47A 1GKYA 4MWBA 1EFUA 2BGKA 5K3EA 3RRNA 4F3YA 4YRMA 3C3WA 3LT0A 3Q6MA 1R8SA 3NTXA 4PHTA 3G8CA 4QL3A 4BP3A 1HRDA 2GPBA 4K28A 3P4XA 4F8EA 2GS9A 5CK4A 4YP1A 3EDMA 4TSFA 5C0OE 3E7XA 4RD3A 4FWBA 2FU5C 1VJ1A 1H93A 2XKKA 1BMDA 5KDOA 4G2TA 2P30A 3I4CA 3OQVA 1UPCA 3BRWD 1KK1A 3QV2A 4IJVA 4QRDA 5C32A 4C4PA 1DP4A 3IPRA 3FWHA 3O4FA 4OOEA 4Y0NA 1MPTA 5DKFA 3F6RA 2O5EA 3ZJVA 5CMLA 4FX5A 1BN6A 4N0PA 4WZAA 1PI3A 4ZZ1A 2D5IA 2VDUE 1TZKA 3L7JA 1EM6A 5PNTA 1XD9A 3QY0A 2Q50A 2V7UA 4H0FA 4M0UA 3NHZA 4EZIA 1LFAA 5C9ZA 4O4HA 1G3QA 4DLUA 3B1WA 5TPZD 4H7IA 1VP9A 5AW9A 4F8YA 2X8JA 2HDNB 3KVRA 4PPNA 1JIQA 1QF9A 3LWZA 2G63A 5AJXA 4CUZA 4HZUA 1CY8A 1M2KA 1YR6A 5JQWA 1D1PA 1LNQA 3N6XA 4XKJA 3H1FA 1KK0A 3KL4A 3O91A 4J0KA 3A4IA 1SQFA 3VSDA 3WNCA 2XV1A 3FSJX 1NASA 2I54A 2P1DA 2XMZA 3MTEA 1RWBA 4UBKA 4CQMA 5ECDA 5FKJA 1HDXA 2GFQA 4DT1B 2J85A 4YDSA 4HAIA 1IN1A 1DXQA 2OGWA 2C4KA 1QZUA 1U2GA 1YMUA 1LK0A 2OESA 4RK6A 4CV0A 1ANKA 4R8SA 2E4ZA 5AKXA 2VT3A 1EXMA 2H4XA 4AICA 3LI2A 3ZHSA 1B6GA 1UAGA 1JEAA 2SNIE 3F67A 2QV7A 4QNNA 4QUKA 2OC4A 4OXKA 4ARAA 1CT9A 4BAUA 4IQ0A 3ZU6A 4GEKA 1DKRA 1W1UA 1LB1B 3VKHA 3G5MA 1IHUA 3WLTA 3ZWCA 2P5UA 2ADOA 2JBAA 3TW6A 3HEAA 5JJKA 3IALA 1TF7A 4H3SA 2Y1XA 1QHEA 1R12A 4WGFA 3GGSA 1A95A 2HZBA 1IJFA 4JLJA 1GNQA 2ZIFA 4WACA 3WIOA 1XAJA 3A4TA 1LC3A 4F2DA 2AZXA 1XDGA 4L5YA 3RYHB 4A5OA 5LQMA 3HCCA 1U3VA 5K3DA 2QYTA 2B8WA 2G5PA 2O3TA 3E9QA 1GRQA 4MVJE 4E08A 4G0ZA 5K8IA 1FMJA 4GL4A 1UDAA 1F0PA 2GPSA 2WJJA 1UZAA 2Q5OA 1AKEA 2WT8A 3CX6A 3SSOA 1B15A 3LS2A 5JZSA 3PITA 1LJ8A 4IIGA 4AJ4A 5LA6F 2Q45A 1Z8DA 3E9MA 2EC5A 3VISA 8GPBA 1E0JA 1E94E 3BMOA 1QR2A 2CZQA 1P7PA 3QEBZ 4AK9A 1WL8A 3CEMA 1N3BA 5K0FA 1ENOA 2GB4A 3STTA 3UJ7A 3WAJA 3Q11A 1S4QA 4LTNA 3HWSA 2EFGA 2Q3BA 4HNAB 2X13A 4JB8A 4RY0A 4JY7A 4UHEA 2KYRA 3JASB 1N4DA 1YJBA 1OR8A 1AHIA 1U9IC 5FI1B 5FUYA 5FWNA 1OXKB 1TO6A 2MHCA 3TB6A 5CCEA 3O93A 3ECAA 1VHDA 3UGJA 1MVLA 2ZSEA 5EIWA 1PGOA 4PX3A 5FWXA 4Z1MA 2DLCX 1IOZA 1K5HA 1KKMA 3CZQA 3D2BA 2CXQA 2A6PA 1XLTC 2H59A 3GT0A 4EVRA 1MGPA 2GHTA 1QO0D 2EEZA 4FDUA 2Q4TA 3WLNA 1IY1A 2OM6A 4PZ9A 3V3TA 4EHLA 1H3NA 4WASA 4RVHA 3ENWA 3THYB 4C29A 4FLEA 4PCUA 4RLQA 2F9MA 1R74A 3C3XA 2JLUA 4RPJA 5KYVA 2DWCA 1Q77A 1C30A 4IMPA 3EVTA 3A1NA 4FFNA 2WICA 4EX6A 4LBZA 1SUFA 3CWZA 5KPDA 3UPUA 1BHQ1 4IYJA 4CKEB 5JNWA 1RLTA 2XCSB 2G3YA 4LTMA 3I3SR 4A8JC 2HA4A 3D8SA 2GZRA 1UH5A 3H0CA 3L6DA 1EB9A 4YB8A 4ZOLB 2C9OA 2CE2X 2RI6A 1GUDA 3F90A 3DL0A 2J3IA 2HCJB 1RWOA 2NADA 1PL8A 1R64A 2VJYA 4XSHA 5JU6A 4FKBA 2VBFA 2II6A 4N18A 1KJZA 4URFA 3W1WA 4ENTA 2IUTA 2XCUA 1JA1A 3FJOA 3O8RA 2NQ2C 2W2QA 1ECPA 3JVVA 4NE9A 4PYQA 4ABYA 3W5CA 1D2HA 3JWGA 2XCLA 4D96A 2X14A 1JJBA 1YUMA 3PZRA 4AJOA 1PBTA 2G1PA 2YY7A 1T2NA 1O6CA 1RHUA 1A9ZA 2PKXA 1MB4A 2GJSA 1RI4A 1H6CA 1J8MF 3KJFA 3ZEAA 5JV5A 1M75A 2GYYA 2FA9A 5FUMA 3V9PA 2EP7A 4B4OA 3PT5A 1QGYA 4EGCB 3QMPA 2XUFA 3IQFA 4JFRA 1UFRA 2D0DA 1N9GA 1TIKA 4JBHA 4RZHA 3T4UA 4BO1A 5BMVF 3KR2A 4NP6A 4M7RA 4M0FA 4CQMD 4MPPA 1ZBQA 1JNYA 5CM8B 3ZBTA 1U7DA 1RRMA 2OFFA 4K9RA 1TZJA 1XZAA 3UKOA 4JROA 1IAVA 4UULA 3RADC 4EP1A 3HU5A 2NTVA 3ZCQA 5BQ5A 4CN9A 3ZJYA 1YQDA 3Q5DA 3NYRA 4KKXB 4CV2A 1C1HA 4PHCA 4NONA 1IK6A 3ZWBA 2KE5A 1L3IA 1E96A 4LGVA 4DG9A 3IDZA 1UBSB 4LWZA 4EG7A 2PGDA 2JJ1A 3VSCA 4U7FA 1D4AA 2OAP1 5FTKA 1VG9B 3HH8A 1B2RA 3LHKA 4DQXA 1YS2X 1TAGA 1XCBA 2FK8A 2WILA 2AOUB 3HVHA 1X19A 3QLEA 4JC0A 5I3ZA 1M5RA 1NN5A 3PNPA 2R6HA 4OMFG 5KNBA 4R8LA 3LJKA 5FWYA 4BMNA 3CE9A 2PFSA 4C7BA 1UXJA 4AF7A 1DAEA 1EK2A 5BV7A 1GG5A 2B2CA 1IQRA 3DT6A 3C0KA 3SIXA 1NLUA 3U0VA 3UAVA 2HF7A 2XLBA 3K2EA 3HP1A 3ORRA 2E82A 1XEFA 1RKBA 2FEWB 3BTSA 3DTTA 1XTPA 1ZVMA 2WWIA 3BIOA 3EUWA 5EMMA 1KYXA 3T9DA 1Y80A 4INJA 5D84A 3R6WA 4GC5A 1RFLA 1Z4IA 3ZX5A 4BJ6A 5I9NA 3HA7A 3I52A 2GEKA 4PZEA 3V55A 2OSBA 4YASA 5CEEA 3N2NA 5ICGA 3M1YA 3NDRA 1CU1A 5CLIA 1PBNA 1M2GA 2GTPA 2G07A 1GG2A 2X1MA 4WECA 3EARA 4FSDA 2NOAA 3DPUA 3B7PA 4YONB 4D9JA 1FBTA 3JQGA 3K9NA 1U9JA 1ZBDA 1V2GA 1N75A 3F78A 4RL4A 2GDJA 2KM1A 4ZMRA 3OHMA 3BD9A 3G1WA 3DOCA 5IVIA 1KZ4A 4B3GA 1VJDA 1T2AA 1NW3A 3KP1A 4JLKA 1GQ2A 2VDMB 4J76A 3VPDA 1LSSA 3VMMA 5BQ3A 2VK4A 3KXKA 3T1HB 4JLVA 3Q3VA 4DANA 3GUZA 4IXDA 4CG0A 3TLXA 1K3TA 1N5DA 1Z75A 3E3NA 1NF3A 2GBLA 4N9QA 4WT7A 3EW9A 2RONA 4F7DA 3HZOA 3RUCA 4ZAZA 4B6QA 3CKMA 2XMCA 4AFNA 3IVCA 4AYTA 2EL7A 4OGGA 4BATA 1Z0DA 1KDYA 3S2SA 4LSMA 5IJ9A 3OQ6A 1EH5A 1JKJA 1NUTA 4D0SA 3TRIA 3A9CA 2E4YA 4GPTA 5FBWB 3O94A 2H16A 5BSTA 3HXMA 3BSSA 5BUQA 1DEKA 3O8BA 1TDJA 2NPFA 1ZH6A 4BB9A 4AX4A 4QSMA 2FWNA 1P0PA 3BTOA 5AWFC 3HDJA 5IHXA 4BRSA 1NLZA 2VT2A 1XE3A 3KOUA 1FTWA 2F6RA 3KR9A 3PJEA 3VV3A 3ZIAD 5DGCA 4AAYA 1V1RB 4DBZA 3MGCA 1BS2A 3KYIB 2ORED 2EZ4A 4PLTA 4BNIA 3RSFA 4LDJA 5JYDA 3WK7A 1XEWX 2AK2A 1PE0A 5K0ZA 4LHXA 4F38A 3H3FA 3AFIA 4DLAA 5HRCA 2QX6A 1MQ9A 1AHNA 3VYUB 4K46A 1J21A 4ALLA 1YDGA 1XHLA 1XV5A 2X8JB 1WMDA 1BEUB 1MAHA 4OF4A 5I7RA 2G06A 3SXUA 4G4JA 1Z12A 3AF3A 4AP5A 2CXPA 4E2YA 2DEUA 1CP2A 3ZWWA 1KYIA 2WUFA 4AX8A 2O8NA 2XA2A 2HF2A 2VTKA 1LXCA 2Y77A 4NFLA 5AKLA 4MAFA 1GHTA 3EMKA 1Z36A 3LY5A 5A7HA 4F04A 4NX2A 3GHHA 3G0IA 3LC1O 2OQ2A 1OXSC 2ZM6B 3I23A 3JARA 3DZBA 5JRJA 3PKJA 2C4VA 3MFQA 4LK3A 2DC1A 1SUEA 1I4OA 3UV6A 1VDMA 4V1CI 4YJFB 2FETA 4RUKA 2JGLA 3ED1A 3FZEA 1WNFA 2BH9A 3AJ9A 4Z0NA 1JB1A 3NRJA 4IY1A 5TNXA 2E4UA 2XHZA 1NWHA 1E4YA 3RS2A 4Q3DA 1GCIA 3ISJA 4GHWA 3QEOA 5ICSA 4INAA 3T5PA 2AI3A 3FUUA 3UG6A 1UOEA 3CUTA 3K1AB 1GPKA 3E5HA 4Q9LA 5CRIA 5IUJC 4S1VA 4KI0A 1G42A 4OH1A 1FMTA 1JFVA 1Z68A 5TB5A 4LBVA 3SHOA 4FJ1A 4JCCA 3RVOA 1RLMA 4ZREA 4UHKA 4DR5B 2VK1A 2PFGA 4Q93A 1LDBA 3ZGVA 1Y0BA 1UBHS 4KL8S 3UENA 3WYEA 3C6YA 5BW6B 1C0EA 2CFOA 2CJFA 3KHUA 4GMDA 4JLUA 4OJYA 5KSZA 4GQIA 3H3JA 1QYWA 2BMDA 2QMUA 2NZYA 3EF3A 5LMUB 1E2LA 5ELXA 4RZQA 4RWZA 1EUDA 2IY8A 5HIMA 2PRYA 4AY3A 4A8HA 2JLYA 2Z8XA 3G82C 1Y1TA 1JUDA 1OV4A 3AKYA 2Q3EA 3HDQA 3HLTA 2C1ZA 2J9FA 5LFAA 3QBJA 3QX9A 2XE8A 4K0RA 3V33A 3WK9A 2XMDA 1CY0A 1QO0A 2PO7A 3OJ0A 4MV0A 4EKIA 1H2FA 3D59A 3A6PC 2QMOA 4OHRA 4ERNA 2DPGA 3O83A 2FPLA 4ND7A 2BELA 4Y9UA 13PKA 1X87A 4X95A 4JSTA 5C31A 2FKNA 3JYLA 3DD5A 3B70A 4NK5A 2BR5A 3PUZA 2WIFA 3PQ5A 3L8DA 3H86A 2V7EA 3RHTA 3C3YA 3AF1A 1I1OA 2GBFA 4R83A 1L4YA 2FX5A 5BW8A 1PYGA 1QV7A 2QP3A 2PHZA 2H2WA 4MVJA 1QB7A 1W30A 1LD3A 1JFLA 3F9IA 3GGGA 3NOVA 5LLSA 1VLJA 3TZKA 3U7GA 4KDEA 4KQ1A 1XGKA 2IEBA 2VQ3A 3U7FB 4NU8X 3OCCA 4ZOLF 4Y1RB 5BN4A 1K89A 4YUVA 2JCVA 1SIWA 3NP9A 4KVGA 1U1GA 1P0IA 1DFHA 1PR2A 2E37A 3WGKA 5BWCA 3IP5A 2AOUA 1AH2A 4EFDA 2YY6A 3UUGA 1W93A 1X42A 3WE7A 4HRAA 4P38A 4FK8A 2HR1A 1I2DA 1RRVA 2ATIA 2OMEA 4P3OA 3W6OA 1CYEA 5IDQA 3I45A 4CF7A 2IXGA 3WRWA 1IEXA 2Q9UA 3CZMA 1QR6A 1MT0A 3TQOA 3DE2X 3VKUA 3AL0C 1OIWA 2WTXA 1QQ6A 1VSUA 2ZBRA 1AB6A 3KAJA 5DHAA 2AOXA 3IGFA 4TN5A 4YI3A 4ABTA 4CBVA 2C5GA 4DIKA 1IN4A 3STVA 1D6SA 3CX3A 1L4KA 4DRXA 1ZQ1A 4TRJA 1HT1E 4B7XA 1Y81A 2WJVA 2X5KO 3HG7A 3LECA 4KXMA 4YJDA 4CHTA 4MVJH 4DCTA 1OROA 2CF5A 2IA5A 2K7FA 2DQZA 2A9OA 3QNUA 2NV2B 5AKHA 3SSAA 5A5VA 6NULA 1HNWB 1ZXBA 3T5AA 5B6JA 4UTZA 5CM2Z 4BNMA 2JGFA 2IWRA 4TRRA 1HT2E 4FJ2A 3QIAA 1L5LA 3PK0A 3RQSA 4AB1A 3UJNA 2YFHA 2Y6VA 3M5DA 3Q8WA 5KJ1A 2O8BA 3H4VA 2Z1NA 4CKBA 4FPXA 2H18A 3OLYA 1KYQA 4BL5A 5AJZA 1RXVA 2OVBA 2D6FA 3LUDA 4KO3S 2X4LA 3GLSA 3IDAA 1CE8B 1EGVB 1TYDE 3LBFA 3WV5A 4AY5A 1V5WA 5BUCA 1XLVA 1I7PA 3COYA 4JBXA 1L4NA 2CFIA 1LY1A 2X41A 4ND8B 4XQ9A 3O8OA 3SF8A 4EB3A 2ID7A 3O3NB 4HLUC 4RZUA 2PWYA 4RGVA 4C7VA 1B4DA 1GV0A 1FVOA 1ZRMA 2VDNB 2UXBB 4QC2A 1ULTA 4XPZA 2XF8A 3VKGA 1MU0A 1WCV1 3MCTA 4LW8A 4E2XA 3LP6A 3HY4A 1C8BA 4M9CA 5CLQA 4ZCTA 1JEYB 3I76A 4KVFA 2GM5A 5DX1A 3AUSA 4KPUB 4LZWA 1KERA 1NURA 1YZUA 2JI9A 1X1SA 3WRXA 2DTDA 3DFMA 4N8DA 3U37A 1Y8RA 5E1BA 1P4RA 3GD7A 4MS4B 1PV2A 4E2WA 3T5CA 3KKEA 2H2AA 5HDBB 3EA4A 4RJLA 2FSVC 2IU0A 4QDOA 1NRWA 5AHXA 4EHJA 3MBKA 2W4MA 4RMNA 1UBFA 4WKNA 4YALA 4FD2A 1SQ5A 3FKJA 1VYUA 4YI5A 2EBWA 4C4XA 2BLLA 3QOFA 3GFOA 3EIEA 1OGJA 3OFND 5HIJA 2R6DA 1U1FA 4GAEA 2NU7B 2QXYA 2WHXA 2FPUA 2EGUA 4U2BA 6REQA 1CUBA 1NJ1A 2Q2OA 4LQLA 3UBMA 1ZEMA 2YHAA 3X1WA 4UXIA 3BDIA 8OHMA 2YQ5A 1GCGA 1W49A 2W8BA 5CFOA 5AMXA 1N3IA 3BJEA 3N0TA 4JJFA 3ANSA 1HLPA 1GGMA 1FEZA 1LVGA 2JA1A 1XQVA 3KELA 1ISHA 3DBRB 4GKAA 2XJ4A 3H2YA 4RDIA 3NAQA 4IP0A 2ZPUA 1U28A 1L4LA 1XMSA 1Z2PX 3FUVA 4M38A 4P7BA 4D4LA 2OG1A 2SKCA 5EIXA 3ONDA 2A57A 1QIHA 3QGMA 1PHPA 4KO4S 4RKRA 4W5WA 5ALDA 5TE9A 1PEDA 4ZK2A 3KQMA 1OMOA 4HRYA 3RIHA 1J25A 2FGJA 3GG2A 3ZIUA 5I7EA 2QBYA 4JKOA 4RACA 1NMQA 4HJXA 1NXWA 3GLHE 5JADA 1N9GB 3TUJC 2D0OB 2GYWA 2J6CA 3PC7A 4KAAA 4BUJA 2PD6A 1MG0A 3ZDAA 3OU2A 1EVJA 3D1JA 5BN3A 4IGFA 3S40A 3LRPA 3NBFA 3FCUB 2VVTA 1A9XA 2R6JA 3L0CA 2ZIXA 3WSWA 2GAAA 3ID6C 2QX4A 1UPUA 3GPBA 1KGDA 2QV0A 2CFCA 2JFFA 1DL5A 1U0FA 2IYYA 2AXEA 3LKVA 3NP7A 1M5TA 1SM4A 1U65A 2G40A 1F5NA 3G9UA 5IJZA 3QHQA 4CTOA 1E6CA 4I99A 3KL2A 3REOA 3CX7A 4HL6A 2FRVA 4WNAB 3I9V6 4YUZA 3S2ZA 2GJKA 1C41A 2REBA 5JVDB 3PDUA 3ZUPA 2IBTA 4BV2A 3HA3A 3I1JA 2HGZA 2FZ5A 4W5HA 5FBQB 3SPXA 1DC7A 1E3WA 2Q5EA 4FYMA 4YWJA 1Z7WA 3I61A 1HDYA 2YWRA 4N0DA 3EEBA 3THRA 2C5AA 4ZYVA 2WT4A 1DJNA 1KRXA 5EJ5A 4EMTA 1F2UB 1IPHA 3BS4A 2ORYA 2F9LA 1DVRA 2ZRQA 2ZPAA 3A1FA 1T2CA 4G5OA 2DQ4A 4XM1A 4Z4HA 4C3OB 5HRAA 2HDHA 5KU7A 2COUA 5EGNA 2WJYA 421PA 1PV4A 2H1OA 4MLPA 3PC8A 4MV6A 5K0BA 4UCFA 1X0XA 1AO0A 3IAUA 1FUEA 1ODFA 3CJRA 4LDPA 3VFDA 4Q7LA 2P9HA 5JYCA 1O5TA 2WSSD 1A7KA 1IQPA 1ENZA 4X1KA 3NTQA 4RULA 3LBAA 4OPMA 2H7CA 2M6RA 5G0SA 1T8RA 3IV7A 1SUWA 2PS0A 1R0ZA 3AEYA 5K0JA 1GQOA 2OORC 3DZFA 1EBUA 4YEDA 1UK8A 2WK1A 1JDSA 4RPKA 1CF4A 3DVLA 4ETWA 3BJRA 2W71A 1B0UA 3CUKA 4W4TA 3UN1A 3B9QA 2P1ZA 3QG5A 1RW4A 3UAWA 2ZCUA 1ZFNA 4K05A 3IVAA 5BPHA 1A1SA 1W73A 2JZCA 1OBHA 4EX7A 4JGGA 4WZ6A 2CVFA 2CV0A 1RHKA 2JFBA 4P86A 5K8TA 3BMCA 1T15A 2GZ3A 1R0WA 2OSVA 4FIZA 1Y34E 4WIAA 4M8KA 5EA2A 4WZZA 4MRMB 2XRZA 1SXJC 3Q9LA 4RF4A 5J5CA 3R8FA 4PLHA 3NRBA 4UBLA 1V4NA 1Y6GA 3CS3A 2F8TA 5FPSA 2JGDB 3V4PB 4FDVA 3U7IA 4PO8A 3MCWA 1M1YE 1B73A 4EF5A 1FQWA 3QFSA 2X5XA 3UJ3X 1NBMA 4H6XA 3L6CA 1GPBA 2YR0A 1HTBA 4Q9HA 3DJFA 1E2KA 2XY4A 1P77A 5AOBA 5P