3CN9A

Crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- orthorhombic crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
214
Chain Sequence
SEPLILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQAPSQAVTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAKGIAAERIILAGFSQGGAVVLHTAFRRYAQPLGGVLALSTYAPTFDDLALDERHKRIPVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDYPMGHEVSLEEIHDIGAWLRKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the fatty acid chain length specificity of the carboxylesterase PA3859 from Pseudomonas aeruginosa: A combined structural, biochemical and computational study.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 74
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cn9A00
2YXPX 3F9CA 3PF9A 4KR0A 1E89A 3DQZA 4MQMA 5K5EA 5AO9A 4WDQA 4NS4A 3WK7A 4A16A 4QZVA 3OOSA 3ZLUA 1Y37A 4DMFA 2RGUA 3PICA 2WM2A 3D2BA 3E0XA 1E3QA 3L1JA 2RAUA 3VJKA 3E4DA 2R11A 3O0DA 4LXIA 3BE8A 2VQ6A 3STXA 1ZD4A 5AI9A 3BIWA 5FXMA 1GPNA 2G63A 3ICVA 3GUUA 1FFAA 5IKXA 2VJBA 2H7XA 5AM0A 1BCRA 5C81A 5EIAA 1MX1A 5DLPA 3O4IA 2PUHA 4RE6A 2QR5A 4U2DA 5ALXA 2WU3A 5DWDA 5CT8A 4B9AA 1AUOA 1QIDA 3AILA 3F98A 4ZXFA 4UBKA 2AJ8A 4YPVA 1XZDA 3JW8A 1VLQA 1CUFA 2GBGA 2JGEA 1CUGA 3I2FA 2QZPA 1P0PA 2FUKA 3VJLA 3DL4A 3D7RA 5T4FA 5AKGA 5LZ8A 1EXWA 3WZMA 1F6WA 1L7QA 4YASA 2ACEA 4UBJA 1Z68A 4W1RA 1J06A 2XQGA 5FPQA 4U2EA 5D6OA 2HU7A 1ODSA 1CUUA 5FOQA 4BBZA 2ZSIA 1ZI8A 4F60A 4B0PA 2B20A 4QNNA 2OCIA 2XE4A 4HXFB 4OU4A 4WJLA 2ROQA 3F97A 4FLMA 5CXUA 2WJ3A 1Q84A 2GBIA 5AI8A 1K8QA 5FUMA 3HRHA 2J3QA 1MAAA 1T4MA 1EINA 5ALQA 5DTJA 1R9NA 1XLUA 2ZVDA 3D0KA 1NU8A 1BU8A 3F8SA 3QMWA 5A7FA 1LLFA 4B85A 3K9BA 4B80A 1QIKA 4KACA 4EZIA 4AO6A 3RKSA 2RI6A 3G0GA 3IDAA 2HIHA 2WQZA 1G4HA 1QIMA 1TQHA 4OD0A 1GQSA 1UK6A 3G0CA 4GECA 4UFOA 1FFBA 4DIUA 3DYIA 2OCGA 1EI9A 1DTEA 3M81A 2WKWA 1YCDA 3QZUA 4QWWA 3GA7A 2VJDA 4AZ0A 2WSLA 4TGLA 3MVEA 2WHRA 1UT6A 5ALMA 2C0QA 1F0NA 4FFVA 3IUQA 2AJLI 2JIDA 3F67A 2HA5A 3WK4A 3AJAA 5AK3A 1TCAA 4AZ3A 6YASA 2XUQA 1R3DA 2G5TA 1JJBA 1FSSA 5JARA 3STVA 5EHNA 1XZMA 3LP5A 5CH5A 5AKEA 4DMCA 1TRHA 4YK7A 4BDSA 1XFDA 4C89A 3U0VA 1YS1X 1R1DA 1ZD2P 2PUJA 3HABA 1CUIA 3ED1A 4HVTA 5IVHA 2PSEA 1J1IA 4X90A 1H22A 4UHBA 4PV7A 2RHWA 2ZYSA 4BTLA 3H2IA 1R88A 3DKKA 5AM1A 2XUJA 3R3ZA 3BF7A 3W04A 4DSZA 5KREA 1MX5A 2WJ4A 5DNUA 3TGLA 4M0MA 5JZBA 1ZJ5A 5LKRA 5LZ9A 3KXPA 4U2BA 1UWCA 2Y1KA 1SCQA 2WLSA 2O2GA 5IVKA 5CH8A 4ZGBA 4KEAA 1VOTA 4J3JA 2ZJFA 2XMDA 5AI0A 3DDUA 1YAHA 4BVLA 2ZJ7A 4C6HA 5KBYA 3I2KA 1YR2A 2CUTA 1XRMA 3HACA 4Q3OA 4CCYA 1W52X 1WB6A 3RLIA 3X3HA 3FVTA 2LIPA 5DTIA 4UHHA 4GEGA 1YAJA 4KE9A 5ALEA 1S8OA 3R3WA 2YYSA 1XLWA 4Y2SA 4J0IA 2VT7A 4JH0A 3PFCA 1TIBA 2GBFA 4G8DA 1WCYA 4Z49A 4X91A 2WTMA 3QVMA 2HRRA 4EY8A 5AK5A 3D59A 3IULA 5JIBA 2QMQA 4AN0A 2G4LA 4ARBA 5EFZA 3E3AA 2H9YA 3KWFA 2OPHA 4S0XA 1XRLA 3ESBA 2Z5GA 1E5TA 5DYTA 5CT6A 1EK2A 1U65A 2PSDA 4AX4A 3QM1A 2HA2A 2J4FA 4CI9A 5EIHA 5JANA 5A62A 1JI3A 4BRZA 1JMKC 2JF0A 4JNCA 3C8DA 1EDEA 4OUKX 1HPLA 2FJPA 5A2GA 3QPCA 1GKLA 3VXKA 4D9JA 3ICWA 3C6XA 1AKNA 5CT5A 4QDUA 3DEAA 3WWCA 3HZOA 4RE5A 4C4ZA 4ROTA 1G42A 5LKAA 5KWJA 1UK9A 4JUIA 5IH7A 2ECFA 1HBJA 1W4LA 2CBGA 2ZYHA 1CPYA 1BEZA 1CUJA 4EBBA 2DHDA 1LPBB 4UFPA 3R0VA 2OGSA 1CRLA 3G0BA 3V9AA 3AZQA 5C8XA 2R8BA 1MTZA 4KE6A 4MJ3A 3H2KA 3ANTA 5AKYA 1A7UA 4GLBA 4Q3KA 2CMFA 4F5ZA 1BRTA 2DFPA 5H3HA 1EA5A 4J0DA 2PX6A 4HZGA 5CRIA 4ZV9A 4CFSA 2XQFA 3WK6A 1MT3A 2WG1A 2XLBA 4J0KA 3GELA 3EIOA 4CIAA 2Z3WA 1WPXA 5AIBA 2HRQA 3FCYA 3C5WP 5C7YA 1DU4A 5DJ5A 2VF2A 3V1KA 4BP9A 1HL7A 4BZWA 3PI6A 4FNMA 2QT9A 2HFKA 3WKAA 4ARAA 3HYSA 5AM2A 2XDWA 1CUDA 3H0CA 3O4HA 4HTAA 2XMRA 4H0CA 3D4LA 3C6BA 2BJHA 1GKKA 1JJIA 2RHTA 5EHXA 1WHTA 2W22A 4E15A 2K2QB 5JAOA 2GYUA 3WK9A 1LZLA 2Z8ZA 1XZEA 3GFFA 3EF3A 3RARA 4U2CA 5AKJA 4X85A 3VKFA 5I7UA 5AOCA 4E14A 3SWWA 2BAGA 3PUIA 1NU6A 4Q1VA 2VSQA 2DHCA 1JU4A 3JWEA 4UUQA 4Y2VA 5ALLA 1ACJA 4BRSA 5ISMA 1OCEA 1MJ5A 5ESRA 1H2ZA 2DSNA 5K3FB 2BKLA 1A8QA 1DQZA 5E4JA 1XZAA 1D07A 2WFLA 5SYNA 4FLEA 2OAEA 1VXOA 1UZAA 4QA9A 1IUPA 4Q34A 1DT3A 1UKAA 1QGED 4I4CA 1UOPA 1CV2A 1H23A 3WYNA 4LXHA 2XQIA 4EHBA 2QJWA 1QTRA 5EHQA 4QLAA 4N5HX 4H7EA 4LYDA 4AN1A 1UK7A 2GYVA 3AZOA 3WL7A 1XZKA 3C45A 4RPCA 4OYYA 1THTA 4MYSA 2EDAA 2D5LA 1GZ7A 5HZGA 5DYYA 1EX9A 3A2LA 2OCLA 5K3AA 4BCCA 1ORWA 5AKHA 5AK6A 3W06A 2XUKA 4X97A 5CURA 4N8SA 3ZPXA 5FRDA 4X71A 5JASA 2XLCA 3G9UA 4H35A 2GZRA 3G9TA 4XX1A 3T52A 2FX5A 1W76A 3G9ZA 3KWJA 2QM0A 1DX4A 2HU5A 1E8DA 1SFRA 1A8SA 4F0JA 1U2EA 1RWQA 1MNAA 3G8YA 3ZLTA 3WIOA 3MUOA 4W1PA 3H2JA 2BFNA 3WA7A 4OB7A 1JT2A 1SCIA 3H17A 4LYEA 1X2EA 4BC1A 3VISA 1UKBA 1XROA 2Z8XA 3E1GA 5CT4A 5ALFA 4LHEA 4J0CA 4C87A 3CN7A 4Y2JA 2WIDA 3WLAA 4B7ZA 1QIJA 5FLKA 3JYHA 4X92A 3VDXA 1SOMA 2OAGA 2PBLA 3WI7A 3O4JA 4AO8A 1YA8A 2WFMA 2XUOA 2VATA 2WILA 2ES4A 1W75A 1RP1A 5FKJA 4Y2QA 3NOXA 4CIBA 4Y7DA 4G4IA 3HEAA 1AURA 1ZI9A 2IIVA 5YASA 4X6UA 1H2XA 2C7BA 3QYJA 3AZPA 3G0IA 3YASA 5EIEA 4MWSA 2XMGA 4GI1A 1P0QA 3AUKA 4L0CA 1A88A 3BL8A 4Q05A 1K5PA 1CUVA 1K63A 1QTIA 4G8BA 3OG9A 1NX9A 1O6FA 1CEXA 3FLEA 4X93A 1WOMA 2BCEA 4MQLA 2PM8A 1F8UA 4L3WA 1N8SA 3CN9A 3O4GA 3B3QA 4UHCA 1DX6A 4P93A 1QOZA 3OM8A 2C0PA 3C6ZA 4NMWA 2WHQA 4BDTA 1FFEA 1CUAA 3I1YA 1P0IA 2WIFA 1XRRA 3STTA 3KD2A 4UHEA 2JGFA 1UK8A 4AB1A 4UBOA 2AJCA 4Y2TA 4B0OA 3FLBA 4ZRDA 2DQYA 2PVSA 1UOQA 3K6KA 1CVLA 3TRDA 4Y2RA 3HSSA 4H7FA 1X2BA 4B83A 3PF8A 1XRPA 3FYUB 1BEEA 4RNCA 1UOOA 3CCCA 4E46A 4GDMA 3DD5A 1GQRA 1QO7A 3BDVA 1QFSA 1A8UA 1DWPA 4J7AA 1ZIYA 1ACLA 1I6WA 1QZ3A 3H18A 1GT6A 3R40A 5CH3A 3WL5A 2FJ0A 3IUNA 3F96A 1U8EA 3ZLVA 4PQEA 2VA9A 4B84A 2I78A 1CUEA 3ESAA 4UPDA 5HFAA 4Q82A 2HU8A 5ALGA 4KAFA 1HQDA 5CBKA 4P9NA 2WG2A 1QIEA 4N8EA 1B41A 2QXTA 3EQ7A 4FBMA 1MO2A 4BAZA 1E8MA 2OG1A 1XZHA 2NW6A 1DQYA 2WUFA 5AI6A 3WK5A 3FSGD 4XIIA 1VA4A 5ALNA 1BCSA 5HF5A 3BJRA 3CXUA 5HK8A 3ANSA 1PV1A 4CG2A 3K2IA 2WFZA 2XUDA 3DNMA 4L72A 5KWIA 3H19A 2CB9A 5AICA 4K6GA 4K6HA 1CUYA 5ALRA 4GBGA 2PL5A 5HQ3A 3LIPA 1BN7A 1FFCA 2PPLA 1CIJA 2V98A 4X94A 3RK4A 3EQ9A 5LZ5A 3WWPA 3C8HA 4QEKA 3FCXA 4W1SA 2XMCA 1QIIA 4J03A 3QITA 3TEJA 2X5XA 1W6RA 5AKXA 4Q3LA 4BCBA 4YX9A 2HA7A 4XJVA 4QE3A 5AJHA 3WK8A 4WFKA 4BVKA 3V1LA 4DGQA 4PSDA 2JGLA 1IUOA 1QLWA 4W1QA 4DNFA 1ODCA 5JZ9A 1SCKA 5JADA 5ALOA 4OSEA 5LP1A 1LGYA 5T4BA 3FVRA 1ZICA 1MAHA 2XB6A 5JATA 4B82A 4OB6A 4JEIA 4ETWA 2OGZA 4ZWNA 4BC0A 5EGNA 2RONA 2WIJA 5CXXA 1VE7A 3MUNA 4LXGA 1EVEA 4XVCA 2AJDA 3WKDA 2E3JA 4H7IA 4L9AA 4K2AA 5HCUA 3SX4A 3S2ZA 2XUAA 3KSRA 3ZWQA 1DT5A 4TVKA 5LZ7A 5D7BA 2XMZA 1E66A 2JGKA 3DYVA 1L7RA 1ZGBA 1LZKA 2XUGA 4OYLA 3N0TA 2I3DA 3OTQA 3DL7A 2HDWA 1C7JA 4UBNA 4G9GA 3NGMA 3A2NA 4IO0A 3FOBA 1YA4A 5E4TA 4E11A 2YASA 1EDBA 5BV7A 2OLEA 5I8PA 3WL6A 1EB8A 3IUMA 1W1IA 4A23A 4FKBA 3U1TA 4FTWA 3VVLA 4B9EA 1ZD3A 4KJXA 3QMVA 5AKIA 3WKEA 2D0DA 4UHDA 3A70A 4DNOA 3H1BA 1ZGCA 1CQZA 4BB0A 1VXRA 4G9EA 2AXEA 5BWCA 1EH5A 5K3BA 3QH4A 1QIGA 5JAUA 4MEBA 2ZYIA 2WHPB 1DWQA 5ALWA 5ALTA 1TCBA 5I9IA 4DNPA 3I2HA 3S8YA 3MGAA 5JD6A 3H2GA 2OXEA 2X8BA 3I2IA 3STYA 2XUPA 2HM7A 3R41A 4FWBA 4BP8A 2HA6A 4MYDA 2BUCA 3Q0TA 1LPSA 2O7VA 3I2GA 3HJUA 3QMMA 2OQIA 5AKZA 1IZ8A 4TPKA 2HADA 3N2ZB 3ILSA 2QXUA 4Y2XA 4IQ4A 2ACKA 4OB8A 3O9VA 5LIPA 1R9MA 5AH0A 3W9UA 3LIIA 5BOVA 3IB3A 1QO9A 1H2WA 4BYMA 2B9VA 2V9ZA 1BS9A 2CKMA 4MEAA 1QIHA 3B12A 1G5FA 4IH1A 4UBIA 3FSGA 4AMYA 1Q83A 5SYMA 1G66A 3OPMA 5F4ZA 1UKCA 2DCMA 4EY5A 2GZSA 4BAGA 4P92A 2JEZA 4WCVA 4KAJA 3W2TA 1VJ5A 2Z3ZA 4EY7A 2QVBA 2JEYA 4WFJA 4WY5A 5FDFA 1CUBA 1F0PA 4H7KA 1J07A 4PF1A 4OCZA 2WIKA 2AJBA 2XUHA 4PSUA 3QBJA 4BVJA 4DSAA 1AC5A 4NZZA 1EB9A 5LLSA 3CCBA 3I2JA 3SC2A 4Y2UA 2PSJA 1MNQA 3H1AA 2QTBA 3R3YA 2VTVA 3WJ2A 2WUGA 2PSFA 2QUAA 3NUZA 5LYYA 7YASA 1LPMA 4KE7A 5LZ4A 1AQLA 2XQJA 4H7JA 5HF9A 5AI5A 1XQWA 2PSHA 3I28A 1GGVA 1CR6A 2P8SA 5AOAA 2PU5A 3FNBA 1RYYA 3PDCA 5JD4A 3IUJA 1WB5A 4J0GA 4HRXA 2WUEA 2J4CA 1Y7IA 4U2FA 4ZV7A 3DOIA 5ALZA 3LCRA 1EK1A 3AIMA 3STUA 1HKHA 3WWDA 1JU3A 3WZLA 4QDZA 1DINA 4H77A 1XZCA 1CUZA 2CEKA 5E2IA 1BROA 4OU5A 4X6XA 5HFNA 4KAAA 5K3EA 4KYVA 5A6VA 2H7YA 3L1HA 1VE6A 1XKLA 4ZI5A 1U4NA 1MU0A 2O7RA 5AKKA 2RIPA 1AZWA 2YH2A 2O2HA 4HS9A 1T2NA 3ESCA 1YASA 5D3KA 3IBTA 4G4GA 4IH9A 3UMJA 1KEZA 4Y2PA 5D3ZA 3HXKA 4BCDA 4N8DA 3BJMA 1YB6A 4BTVA 4Y9SA 4G4JA 1K4YA 2EEPA 5JAHA 3I6YA 3HC7A 4IH4A 1OXMA 1VZ2A 1MPXA 1P0MA 4AMZA 1JJFA 3WJ1A 4KE8A 3KDAA 1LBSA 5IVIA 1B6GA 4H7HA 5DNVA 3FAKA 1EHYA 5ALUA 1IUNA 2DR0A 5JAPA 1YSCA 1MN6A 4CCWA 4JYPA 3V1MA 3AFIA 3PFBA 5LZ2A 4FLFA 2ONCA 3HI4A 4Y2YA 2B61A 2C5FA 3DLTA 4GW3A 5DNWA 5ALDA 4FDMA 5AK4A 4K6KA 3UUFA 1N5RA 2V96A 4M0FA 3WKCA 4DTCA 1M33A 3EQ8A 3L1IA 2B4KA 4C88A 5ALPA 3RM3A 3OURA 3GROA 1QFMA 3AIKA 1CLEA 3W9BA 3A6ZA 4M0EA 2OGTA 3IVMA 3P2MA 1Y7HA 5FPPA 2CZQA 4W9RA 4I3FA 1KU0A 1N1MA 1ZD5A 2WG0A 2DQZA 1OILA 5DYWA 4V2IA 4G1FA 4C01A 4FOLA 4QWMA 3WMRA 1JKMA 1XZJA 3B5EA 2Y2VA 3FWHA 1WHSA 2PU7A 1YS2X 3Q8WA 5K3FA 2JGMA 1PFQA 3DCNA 4P08A 4DLNA 1LNSA 4FHZA 1LPPA 4ZREA 4QDXA 2OQVA 1XZBA 5CW2A 5JALA 4INZA 5EI5A 4GXNA 2WTNA 2WU4A 1GXSA 4AQDA 2I03A 2HFJA 4CG3A 4X95A 2ZSHA 3IIIA 5AI4A 2V97A 3WWEA 3I6ZA 1ODTC 2QJRA 3H2HA 3VVMA 4EUSA 3C6YA 1IMJA 2H7CA 4NVRA 1CUHA 3G02A 3UUEA 5C8ZA 2GBCA 5ALKA 3FLAA 5IVDA 1EVQA 3AINA 1PJAA 3R3UA 1QE3A 2UZ0A 5JD5A 5HF6A 4DM7A 5ALVA 2BUAA 4GHWA 1HDEA 4X7BA 4EY6A 3DJYA 4FMPA 2JGIA 1IZ7A 3M83A 4CCYB 4H7DA 4PNZA 3V1NA 4B81A 4AO7A 1KU6A 4N5IX 1ZJ4A 2HA4A 4AXBA 1AGYA 2X76A 4PW0A 1GPLA 3DS8A 3OC0A 3T4UA 1XZLA 5A7HA 2ZJ6A 4LKOA 4HAIA 3QPDA 2JBWA 3I6MA 3G7NA 4FFWA 1WPRA 2OCKA 3BF8A 4CG1A 4KRYA 2H1IA 3G0DA 4QDTA 4IHAA 4G8CA 2BGRA 4ITVA 3WYDA 1LPNA 1XZGA 1CFJA 3ZI7A 2HL6A 3BWXA 3ESDA 4HXGA 4RGYA 2IX9A 2HA0A 1E8NA 1XRNA 5HKBA 1CUCA 1DWOA 2JGJA 5AM3A 1VA5A 4EY4A 3WL8A 1WM1A 3G9XA 3C43A 3PUHA 1AMNA 2XMSA 3A2MA 4JYMA 5JZSA 4BATA 3BXPA 5BWBA 5K3CA 3O9MA 1XZFA 1IVYA 4HXEB 3WQHA 5ALYA 4UBMA 4OPMA 1QIFA 3C70A 2Y6VA 5AIAA 2QS9A 4W63A 5AP9A 1GPKA 2WFLB 2EDCA 3STWA 2CJPA 1HLGA 5C8VA 2XT0A 4WFIA 3LS2A 1VZ3A 3SK0A 2Y6UA 1R50A 1TK3A 1TKRA 1XZIA 2VT6A 4BE9A 3H04A 4DMKA 1XQVA 4I19A 3FYTA 4BZZA 1CQWA 3QPAA 5ALIA 4XWGA 5AOBA 4EA6A 5ALSA 2QOEA 3C87A 4LIPD 5FV4A 2VAXA 4J0HA 2QKYA 4U2GA 2I3ZA 4PSCA 2XUIA 5A7GA 5HQ3B 3DKRA 4EB0A 5FP0A 3M3DA 1QJ4A 2GYWA 5T4HA 2QRUA 3GZJA 1SC9A 2HHAA 3FYUC 4A5SA 2C58A 1J2EA 3KOOA 1MX9A 1CUWA 4X3CA 4UHFA 1JFRA 2Q0XA 1XQYA 1ZIXA 2VAVA 4UFNA 3FBWA 5ALHA 4WY8A 1X70A 1K6EA 2BGNA 4WDRA 3BDIA 4GWLA 3V48A 3NWOA 4J0JA 4C4XA 2WUDA 5AM4A 3LLCA 1H2YA 5E4YA 3D2AA 5CMLA 4DYHA 1XRQA 1TAHA 1XLVA 1CUSA 1R4ZA 2VEOA 3IURA 3WA6A 3O95A 1CUXA 2XMBA 4KRXA 3VJMA 2IITA 3BIXA 1FFDA 1BN6A 1LBTA 1LPAB 1XQXA 4MXDA 3TJMA 2G5PA 2C5GA 1L7AA 3D5EA 3AIOA 1ISPA 2HA3A 4C4YA 3GBSA 4QLOA 4UBLA 2ORYA 1UXOA 2W6CX 1QONA 1ORVA 1EDDA 4BE4A 2QUBA 3D3NA 3WIBA 1USWA 5HK9A 1C4XA 4FNGA 2Y2UA 4H18A 5A71A 1N5MA 5AHXA 5ALJA 4HRYA 1Q0ZA 3W05A 2XUFA 1Q0RA 1VKHA 4F21A 2WIGA 5JYCA 5T4EA 5K3DA 4X00A 4B6GA 1C7IA 4O08A 3ZV7A 3EBLA 3R3XA 3IA2A 2WJ6A 1ZI6A 4DMHA 3WWOA 3DOHA 4DNQA 5EHZA 2XMQA 2XQKA 1YB7A 5HKAA 1TCCA 4FBLA 2VJAA 4BAUA 1ZOIA 2O2IA 1ETHA 2VJCA 1LPOA 3WKBA 5J3JA 2ZYRA 2PKYX 1FJ2A 4MWTA 5HF8A 2XI4A 5AKLA 3M82A 5CTAA 3R3VA 3D2CA 2WHPA 4K5QA 3HLKA 3PE6A 1BE0A 4G5XA 2C4HA 3I1IA 2BUBA 1AX9A 1WB4A 2J3DA 5CT9A 1O6GA 4QDOA 2DHEA 3FYUA 4PO3X 1THGA 1XKTA 1JMYA 4X6YA 5AM5A 3C5VA 1UFOA
chains in the Genus database with same CATH superfamily
5JLAA 1JRLA 5CPBA 4YROA 4OKIA 1Y6FA 5LB4A 4X64B 1RQPA 4HNSA 4IOKA 3DBRB 1KZGB 3B3AA 4L9WA 2NMVA 2H8GA 3OCZA 5IJAA 2FW9A 3FNGA 3T9DA 4FSXA 3ZQUA 4DJTA 4X45A 2PCLA 3BC1A 4FMDB 4NS4A 4XDYA 1AJEA 1M2EA 5KHLB 4FHEA 4JJIA 4QZVA 4A16A 5GTDA 2A9QA 1AS2A 1HT0A 4IDOA 3SQOA 1NBEA 3U4DA 4ETNA 2JFFA 1QU2A 1EZZA 4HZUB 4KQHA 3H8WA 4RGQA 4L9RA 5CLQA 1F8GA 1PFVA 4JCCA 5C5IA 4YAIA 4F5YA 2I2WA 5CHYA 2HLPA 2NZJA 3ZGNA 2EYQA 1U3TA 2QTLA 4CTNA 4C0WA 3NVDA 4AJKA 3D2BA 4E31A 3ZX4A 1D2HA 1E2QA 1SVKA 1UWLA 2R11A 3RODA 3UFBA 3WLEA 1IDN1 3R7BA 4LXIA 3BE8A 1MZPA 3GVCA 8LDHA 2PKWA 1A69A 2X1VA 3IOYA 2DFNA 4KRFA 3QA3E 1W73A 3COSA 1AZTA 4MQEA 2ZYGA 1Q6ZA 3L2OB 1HYEA 3JYNA 2ZM5A 4ZAZA 3LP8A 2QNBA 4KPEC 1YZVA 4WUTA 4MV1A 2FMXA 2I2AA 3PCTA 4Q4HB 4JC0A 4N49A 4URUR 2YWJA 3R6GA 5L3SA 5IM4F 5IKXA 3QPVA 4C7JA 1PWEA 1UINA 1V45E 2NTJA 4NZPA 1YZUA 3OOWA 3SDZA 1DIOB 2YNMA 4X7RA 2C9BA 1X7DA 2VNJA 4K46A 2XCQA 2GGSA 1KDYA 4C03A 4K9DA 3M1LA 1YVUA 4G5HA 1NV9A 4UXJA 4R7GA 5D5QA 4AWBA 5EKTA 1E1LA 2FMTA 1G5PA 1UXIA 4G23A 4N40A 4PAQA 5DLPA 2BH9A 4A92A 4US1R 2CLHB 1KAEA 5J5VA 2IV2X 1PJQA 4UZFA 1CS4C 3EF0A 4URWR 1W25A 1KBZA 1ZDMA 4W82A 1DQNA 4REMA 5EKUA 4LZPA 5L3QB 3REQB 1YE5A 3ZWOA 2AX3A 4ZO4A 3U9TA 3LHIA 1Q2UA 4ZXFA 2YHAA 1C0LA 3BCHA 1GSHA 2JAWA 1CJKC 4BNMA 2F9MA 2IOFK 2J3KA 3DW1X 1BC5A 1TIPA 1WL8A 1L5KA 2JRCA 3UK7A 3EXFB 2BFBA 1QG4A 2GBGA 4HNQA 4DHEA 4YJ2A 1L7MA 3KEQA 1A27A 2YC2C 3PTZA 3TFQA 1OYVA 4MDHA 3TAXA 3FOWA 2ZK7A 2XAUA 1TUBB 3CE6A 1TYCA 2OESA 1SD2A 3IUPA 1B73A 1G6OA 1YKSA 3EFOB 2IIQA 3KSBC 2HWKA 3I2FA 1Y7LA 4PLHA 2JGRA 2WKPA 3EAGA 4RVGA 1B15A 3RYHB 4UZSA 1XUOA 4JB3A 3WRWA 5IAJA 1GOTA 3EBOA 4P83A 1P0PA 3WSWA 2WAOA 4F4DA 3AW9A 4DV1B 2JJQA 1WZEA 3DL4A 4FUQA 3ETJA 3FTPA 2J5XA 3K9FC 1GTVA 3N8GA 1WSBA 3DHWC 1EXWA 1IHPA 4LVUA 3WWYA 1C0IA 3JV7A 1EU1A 2ACEA 4RHYA 3R77A 4AJEA 4ZYLA 1TZMA 2PRZA 3MC1A 1OJLA 1DG9A 2HV8A 4W1RA 1L7OA 1QP0A 3Q9LA 4QFCA 1QFJA 1J06A 1DKNA 2XQGA 3F1KA 1GUDA 3GJ0A 4U2EA 4XLLA 3VHLB 3I45A 4MW9A 1YJQA 4BBZA 1QS0A 1EJ2A 1EX7A 1JQEA 3DFIA 3M6WA 3ODGA 2DGDA 3IH5A 4YQYA 3GLFB 3G5TA 3P5SA 1KYXA 1M1ZA 1P2VA 2B20A 4Y0VA 4E5NA 5KOIA 1RJFA 1Z8FA 3A0RB 1VI6A 4C14A 1KA9H 3QYPA 4Z0HO 5CA1A 3HO6A 1GCUA 3O4RA 2QUHA 1I01A 5FTMA 4ND4A 4EA7A 3OZRA 2UYYA 2WFAA 4IY1A 4ZOLB 5HQTA 5CIQA 2GBIA 1PR5A 3OU6A 4PRYA 3SXPA 2BKAA 3E35A 2X1MA 4MGKR 3SBOA 5JT1A 1R0CA 3H1EA 5G0TA 4DKXA 1MAAA 3H4MA 2OAQ1 1PEAA 1NLFA 1Q91A 2I6XA 4Q3CA 1Z8HA 2JNWA 3N8DA 3B9RA 3K15A 3N2NA 2HK8A 2V55B 4UMEA 2YWDA 4BNDA 4E2WA 5DBHX 1G16A 2QP3A 2VQSA 2DH6A 1B00A 2OOKA 2DT8A 3WMFA 1YZYA 2ZVDA 3D0KA 1ENPA 2RCNA 4ZVUA 2AZMA 1SKUA 3FJOA 4FHCA 3QMPA 1CS0A 2Z1NA 3N2LA 3ZE6A 3KXDA 4EI7A 5BYKA 1RI3A 3M6AA 1L4MA 2HXSA 1MO6A 4QUIA 2YFYA 3QMWA 3UOWA 3V2UA 1NW6A 2G77B 2VSYA 1LLFA 2VBGA 3JAWB 4AUKA 3B20A 4BN4A 2I1LA 3LOQA 3NXKA 1A9QA 2E18A 2FPLA 1ANKA 2IY8A 1N5OX 4JI3B 2CD7A 2YINC 3LF2A 1SVSA 2CW5A 3DE1X 3RIYA 3G0GA 1J5EB 2IYRA 1ZJZA 2JKZA 4DBVO 4YACA 2PMEA 1G4HA 1N6OA 1JI0A 1QIMA 1N5LA 1GQSA 2H48A 4MV0A 1GL3A 3RS3A 3JALA 1SA0B 1SOVA 3IIMA 4Y8VA 2BEVA 3B8EA 1N2SA 3AV3A 4I14A 2BC9A 3KEGA 3G0CA 3P45A 4U7HA 3D6JA 3GBVA 2R1VA 4JODA 3DMGA 4UFOA 2WPDD 1JR3A 2C1EA 3BIFA 3NM4A 3N0XA 1WW3A 4AS2A 4DIUA 2XRFA 2QE6A 2OCGA 2CDNA 1HT2E 3GNLA 4E2FA 2CT8A 2EFYA 3RADC 3L3BA 5KVCA 2WKWA 1YCDA 3LUDA 3NTOA 4BGUA 3QZUA 1UODA 3CLTD 3NAZA 3GA7A 4HNAB 2VJDA 1DWUA 2UYGA 1BMQA 1S8FA 4FYMA 4TGLA 4YJHA 3HZZA 5IJXA 2HC9A 2BM9A 3BFPA 1TMOA 3BXZA 3IMGA 4R01A 3TLZA 4KI7A 5KSYA 1M2OB 3AF1A 2Z30A 4TSFA 4CKBB 2ZAMA 1Z07A 3F2IA 1BHJA 1WEHA 5SY6A 1P8JA 2Z3VA 5CVDA 4M36A 5I7HA 4UOQA 2HYIC 1NVKA 3ZCXA 1AK9A 3DM5A 1DAKA 4WBSA 1JN0A 2A88A 1NOJA 2C82A 2ID7A 2PFSA 3D9QX 3F67A 3MTEA 3ND8A 4B3DA 1Y5RA 1ONOA 2VJMB 2Q4DA 2ZBQA 3CWCA 3F3KA 3IA7A 3WK4A 3MLAA 3O73A 2KW5A 3DOOA 1USUA 3OZWA 4XDGA 1MJFA 1RZVA 4GBJA 4NJMB 1M2HA 1TCAA 1CRQA 4F3TA 3HB5X 5CP8A 3M0EA 4B6EA 2VHTA 1LUAA 1FSZA 1J8QA 1R3DA 3JWIA 4W9NA 6YASA 5I8WA 4Z7OB 4AKGA 1QE0A 4RNDB 1II8B 1Y3AA 3I0MA 5BPFA 4MW2A 1U5CA 1FSSA 1GPDG 5JBQA 3STVA 1CJVC 1XZMA 2QV7A 1OT3A 1L5ZA 1Y1QA 5JJCA 3DBHA 3GH3A 2ENWA 4TQAA 4IIJA 4PVDA 1KK0A 1JA1A 1CIPA 1GEEA 2BKUA 2WF9A 1WMBA 3GJ7A 3L0PA 3EZXA 1TRHA 3X1YA 5AUNB 2VNKA 5K0FA 1XFDA 3KCNA 3OTWA 1TI7A 2YVQA 3P4XA 3U0VA 1X94A 3MWGA 4WCDA 1KO4A 4D9FA 5CAEB 2IS4A 3LDAA 4OGWA 4UVDA 1Z08A 4OQXA 2YWEA 5G0SA 4LXUA 5HS6A 4ZCTA 4G0XA 1DFGA 1CUIA 2ODBA 5JZVA 2PT5A 2W11A 1HQCA 1TYBE 3OQJA 4D4MA 1MA3A 3OF5A 5JNSA 3EOZA 1UL1X 4KYIB 3JVVA 1XF1A 1NIPA 4OQFA 2BELA 3T9EA 4II2A 1J1IA 2RBGA 5HKOA 1Y1TA 2AE2A 4C4OA 2VDWA 4FONA 5E0KB 4JA0A 2HHLA 3DLAA 2JLCA 2ZSEA 1XU7A 4MWBA 5IK2D 3BFVA 1JIXA 1IYZA 1NJ6A 3QF7A 4PV7A 4QASA 1YNOA 1VHDA 2PRJA 2ZWOA 1G0NA 2TSYB 2H16A 4BTLA 3OQNA 1R88A 2EBFX 2ZDQA 3BSWA 3MS7A 2JBHA 4CNQA 1ZJYA 4G97A 4J91A 1O94D 1E79D 1YCHA 1R8QA 2AC2A 4CW7A 2PGDA 5AM1A 3T3EA 3H11B 3KELA 4MOWA 1XN1A 4OQNA 3EPRA 3HR7A 4H1UA 1N6RA 2WJ4A 4C5AA 4CTJA 3CSDA 1AGXA 1Z83A 4F84A 2WABA 4WLVA 1YVDA 3PT5A 5LKRA 4W9MC 1Q15A 2BGGA 1USKA 3ER6A 1SWWA 4OQZA 5BRNA 3T9AA 4LHWA 1OWOA 2H1SA 4HDCA 5C37A 3QU5A 2Q41A 2OQ2A 3L6RA 3HA5A 4E6PA 1KZ6A 3UVEA 3T95A 3Q6IA 4HNTA 5E6SA 3GLQA 1VJDA 4J6EA 4TUYA 4YMWA 2Q6LA 5G4LA 5CH8A 1Q92A 5GGYA 4KEAA 4ZU6X 1VOTA 3CPEA 5E6RA 3SJZA 5A9RA 5AI0A 1XYGA 4O4LF 2FG5A 4DNXA 2IV3A 2R66A 3F0TA 3UKDA 3V7NA 1TM3E 2HSDA 3FYSA 2EJVA 5EC8A 1DQPA 1S3SA 1V71A 2M1XA 2PDAA 2ZJ7A 1YULA 1CY6A 4Q9JA 5F9MA 4QFBA 1LTQA 4CKYA 3HXQA 1YS6A 1NBMD 1MKYA 3I04A 2CUTA 3CF2A 1XRMA 3IE0A 2PPVA 5HVNA 1YI8A 4JUCA 5TX7A 1PYOA 1A9OA 3QEKA 3QWFA 3NGXA 2D13A 1W52X 1AO0A 1GG2A 2WUWE 3LLSA 1G7TA 2I7XA 4UREA 4XEHA 2NVUB 3RLIA 3T35A 4C0XA 4ILEA 4DZZA 4OL9A 1J0CA 3ZNPA 5L4LA 5DGDA 2HF8A 1M10A 1I2MA 2LIPA 2ODAA 5JRDS 1N2CA 1RRFA 1AUPA 2GK3A 3L8EA 4R84A 3DQPA 5DTIA 1FLAA 3SBDA 4CMEC 5BV2P 2O8CB 3K30A 1YAJA 2WYHA 3K16A 5ALEA 1SR8A 3GRFA 4ZARA 1S8OA 1KHTA 5CDGA 2YYSA 4IIGA 4BMXA 5IF3A 2W6MA 2FMKA 1XLWA 4Y2SA 4KQ9A 4BHTA 5F1OA 1RHJA 3CE9A 1NWCA 1KNXA 2XKBA 1ZM3A 3LC7O 3QEJA 4FILA 4ZP1A 2AL7A 3UICA 1NXOA 3WX0A 3UK1A 1KI7A 1QPGA 2OM2A 3M3HA 1HNWB 1CYEA 1OQAA 4GOMD 3RRBA 4ATNA 1FQJA 3P27A 2R6JA 1JBKA 1SUWA 4D9GA 3IV6A 4HMQA 3D6UA 4X91A 3OTGA 1K2WA 1G9XA 1QZTA 2Z2IA 4KW7A 5JNTA 3OKCA 2HRRA 4S24A 4E5SA 3R8FA 4MP6A 1T9HA 4CMIB 1E98A 2IYVA 1IWOA 3KTAB 1IB6A 4RK6A 1YZQA 4TTVA 3IULA 4HZIA 1T36B 3C3DA 3WIEA 4E70A 3IT2A 1V9CA 4UHJA 2W4MA 5SV2A 5LOVA 2G4LA 4WA8A 1G19A 4YV1A 4F93B 4ZTZB 2FOIA 3C1OA 2H2WA 5A3QA 1P72A 3N3BC 4O6VA 3KWFA 3L1UA 2EJCA 4S0XA 2C59A 1JEYB 3J7TA 1SEVA 3NB0A 1XRLA 2O2YA 1EVJA 4LJ8A 3N0RA 1QU3A 5HW0A 5JY6A 2EU8A 2H2FA 1F14A 1WWKA 1RZ3A 4M9UA 5DYTA 5GPBA 2NP6A 3HY4A 5CT6A 2DJ5A 4E5UA 5LQUA 2M32A 4MWEA 1Z7YA 3IHWA 4OHPA 2OV6A 1KBQA 1Z0IA 3JAKA 3NONA 4MW7A 4NBSA 2Z5VA 3PVSA 5IJWA 3A6FA 4S1NA 1E7SA 4CV2A 4K9QA 4OIFA 3Q1LA 4TVOA 2ILVA 2JA2A 3L05A 1PGPA 2X77A 2Q3CA 3KKKA 3PXAA 1VHJA 5ENDA 5F1YA 4YMHA 5EERA 3WLJA 1NLZA 5IZCA 5KAPA 5A62A 4JOSA 4CEHB 5KWSA 1JMKC 5FFNA 4K03A 3UV3A 1TQ2A 1DKPA 1W1WA 3IP7A 1X87A 1PWHA 1YJ8A 3SVTA 2BMJA 3FPGA 2E4UA 1QFXA 2ONKA 3FCAA 4RK1A 3HP7A 1DC7A 1C7ZA 2RGWA 5LXTF 2PO7A 3RRYA 2XOXA 3SZGA 5F2KA 3QPCA 4AS1A 5JRJA 1QGUB 2QORA 1ZAKA 4X1YA 3FIUA 4P4GA 3JQ9C 1MR3F 2KB0A 3RWBA 1NUAA 4DDMA 1P2GA 4J90A 2XYGA 4OAQA 3AHDA 3UBTA 2ZETA 3HPRA 4H0NA 4P36A 1D7OA 3C6XA 3NVAA 4TMTA 1O7JA 5CT5A 5LIRA 4D46A 2Y1OA 5A06A 3BD6A 3F6PA 3HZOA 3C5EA 5CYGA 1WETA 3EZNA 4C4ZA 2R6R1 1IZ9A 3BL6A 1I4LD 1VYTA 3MD9A 4ROTA 1ECPA 1YDWA 1G42A 4UVHA 2Y99A 2B83A 4L07A 3RIMA 3BEOA 1JKIA 3N7AA 3ROPA 4DY4A 5LKAA 3SLRA 3QLUC 1H8EA 3DBIA 3FAZA 4MWOA 3G6KA 4D4LA 3TTSA 3WQBA 2VHQA 3GXOA 3IPYA 4JUIA 4LUCA 3C3JA 1XAJA 4F2GA 4A2QA 5C9ZA 1G21B 3CLRC 2BTEA 2RAFA 4P2BA 3SYKA 2WHEA 1R0WA 2RH5A 2FWAA 1CUJA 3MMPA 4YJFA 1WW8A 4YCDA 2OO3A 5EQJB 4ALLA 4C2BA 3X1WA 2QJTA 5KINB 2DHDA 2IBMA 3FM9A 2JJYA 3JQFC 4I6GA 4R8KA 4N3BA 3A3OA 4I5FA 2QD4A 1XJWA 3BRQA 3H1PA 4MVJF 1JFFB 1XO1A 2QAGB 3ANYB 3R0VA 2OGSA 4BVEA 3UAXA 1EE2A 1KDPA 3H7IA 1JFSA 3E5HA 3HKEB 3NIDB 5HBGA 4FS3A 1CU1A 2A0XA 3IOBA 3GFSA 4PU0A 3EXFA 3VU9B 4BEBA 5BV8A 1VPWA 1AD2A 2QSYA 4PLCA 2F67A 2OPBA 1VCIA 3HK2A 2EP5A 4HT3B 1MABA 3OF2A 1GQQA 3DAFA 2DVMA 4PLVA 3T9CA 3A8TA 3NTUA 4EATA 3H2KA 3HCEA 3IDQA 5KCZA 3NOQA 5AKYA 1HDZA 2X9LA 4PRZA 5CB4A 1POWA 1W47A 5GV8A 4GLBA 4MCHA 2DWQA 3OJEA 3PZBA 3I9NA 2CMFA 2AHRA 3BA6A 2C61A 4JUFA 1YMUA 4E2ZA 1SXHA 2ZRNA 1PT7A 2ZU0C 4B2YA 8ATCA 1E6WA 4K86A 3RJMA 4BZXA 2WWGA 1Q14A 1JKXA 3FMOB 3A7DA 2NXJA 4UNQA 4MKXA 4HQKA 1EA5A 1NNLA 2YCLA 4JLAA 4DW8A 1KFCB 2QRQA 1IQRA 1L5YA 1UPUA 2FFBA 1H66A 2FZ4A 3ONDA 2P5SA 3TLYA 4EG1A 4Q7QA 5CRIA 4RTPA 3FRJA 2EF1A 3NHRA 1FW6A 2FPIA 3QE2A 2X0NA 2OT3B 2QR2A 3QUCA 3PWZA 2X4DA 4ZV9A 3RRXA 3TW8B 4D44A 3LTNC 4CFSA 2XQFA 4CJXA 4TS3A 3L07A 2QY9A 4RTKA 4QTUB 3SFZA 4JKYA 5J5CA 2L69A 3JQ6A 2O3SA 1EWTA 2CNKA 5BN4A 1KY4A 3C15C 4Q9IA 3BMNA 1FDOA 3EQZA 5JJLA 2DBVO 2ZTLA 3Q7IA 4L0DA 1DXYA 1EFDN 2YYAA 4K40A 1Z0KA 1CERA 5ABPA 3H3FA 1RIFA 1KBOA 2RGCA 3S2GA 4X66B 2OK7A 1QZXA 1F06A 3FCYA 1OI2A 4FUTA 4JI5B 4BUCA 3T12A 4YPOA 4KR6A 3GJTA 3NBZC 1T9BA 4FIDA 4W5NA 4EB3A 3NCTA 3UNXA 3RG8A 1A4IA 2OFXA 2P41A 3MJEA 3NORA 4BJHB 1M8KA 1HGXA 1NW5A 4BX0A 4BP9A 2GD0A 1GGFA 2O3JA 3BQ9A 3PI6A 1KE1A 2QT9A 5TMDA 4DMUB 1E3DA 3IMKA 3QI7A 4EJMA 4P54A 521PA 4L57A 1GUAA 3DAPA 2XDWA 5THQA 1EXNA 2DKOA 2OD9A 4DG8A 2FE4A 1F8YA 3AU8A 3ISTA 5JCXA 3FE2A 1T5SA 3O4HA 3QBEA 5JNLA 2WWWA 1EAYA 3V97A 1AKYA 2GFIA 2RGEA 2C7RA 1TGVA 1GM5A 4IFBA 5GONF 2WWXA 1NVVQ 4MHOA 1KEWA 1GKKA 3PFKA 1TD9A 5EHXA 3ESYA 1U2SA 2D6FA 1T3TA 4JLOA 3K1ZA 4E15A 5FUBA 2AXQA 5G4KA 2K2QB 2Q3LA 4BP3A 3WK9A 4E22A 1Y3DE 2AV6A 3K2QA 4CHTA 1RHKA 4KO3S 1XC7A 2P69A 2Z8ZA 3H0KA 2B2NA 3BBPA 1G8HA 2BEVB 3SJCA 4TWBA 4BIIA 2VDNB 1CYDA 3QVVA 5K6TA 4WJZA 3ASUA 2XNDA 3W1VA 1B0AA 1VRVA 5ELLA 2IP1A 3JD3A 3VDMA 4U2CA 4B5LA 4X85A 1XPRA 2CLEB 1QJCA 3MT8A 1WXWA 3X1XA 5AOCA 5AW3A 3QHAA 4JUBA 3VU8A 1U8CB 1UKVY 2HCFA 4HKTA 4E14A 3SWWA 3PUIA 1WG8A 1WUHS 2NZXA 1YZFA 4WEOA 4C7BA 3U4QA 1NU6A 3PGA1 4UCFA 1SVLA 4IJVA 2OZKA 3LCMA 3WJAA 1T8WA 4HAVA 4R54A 2BY4A 3PGVA 4IL5A 1HFJA 1N5IA 1H1LB 4G0YA 5DXFA 2PX4A 4EGSA 1XEFA 3C7KA 3KLPX 1QF9A 1RAIA 4HS4A 3F3MA 2WWFA 1PI3A 4GH5A 5BN1A 3KJZA 1DQZA 3PQ2A 4E88A 4PHCA 4QQRA 2BBWA 4IHJB 4QG7A 1D07A 1W7AA 1ZKMA 3I8XA 1GLNA 4YRPA 1YO6A 2MSWA 5K0GA 1X8KA 1KDVA 1V8OA 2NADA 1ADJA 2OAEA 3OQIB 1VXOA 1FU7A 2CFCA 4QX6A 1Z5ZA 2VJMA 1D3AA 4BJ5A 3I37X 4RD6A 1IUPA 1R8SA 1RYEA 2UZ1B 3CX6A 2I1WA 4HADA 2LE0A 2RHRA 1DT3A 3USCS 1RJWA 4RHTA 4CF6A 2C84A 3KJFA 1CV2A 4D9BA 1L8QA 3EDRA 2AN5A 1KI4A 2DCUA 2HOQA 4HMOA 3FUWA 3RLFA 2PUBA 2Z6UA 4OHYA 1KOJA 4IGFA 2LGJA 4IKPA 2P0AA 2QJWA 3EA0A 1AKMA 3IOMA 1AV7A 2CJWB 2GN4A 4MHTA 1QTRA 5TIIA 4PICA 5EHQA 2HK7A 1A7AA 2JFGA 2YWCA 4G85A 4OHKA 1KPGA 1KJYA 1T8RA 1ZBDA 2O2EA 1ONSA 2AK3A 2FQXA 1V8DA 5ERYA 4WBNA 1MPTA 3GLGA 2O57A 3C45A 4C76A 1Q7CA 1FX0A 1QDLB 4JB8A 3L92A 1T9CA 3PDUA 5E9AA 5CDSA 3NBAA 2E89A 3HB7A 13PKA 3BQMB 3SQDA 1NVVR 3ONWA 4HGNA 3IXQA 4N47A 2GF2A 4TRMA 4JYZA 3CRW1 3MILA 5HZGA 5AJYA 1C29B 3EUAA 5J2TB 4DLVA 4GLLA 1EX9A 1P5RA 1N2HA 3A2LA 3KKLA 4HPWA 4AD8A 2HQSA 4LY6A 4JASB 2O0MA 1JXMA 1ES9A 5J1TB 2VOEA 1KYIA 1I7LA 3RYFB 3PQDA 1ZK0A 4GWGA 2Q4BA 2YDYA 4KAXA 5AK6A 1IN8A 1IOVA 3HKCA 3QWAA 1ZO8A 4KV7A 2CVFA 2DU8A 3S28A 1JB9A 2XDQB 4IZIA 4INPA 3SBEA 4CQLB 4MICA 3EC2A 1XDSA 3COYA 3DH0A 4YJ3B 4TXHA 4KR7A 1JQ3A 3AONB 5FA5A 4CDRA 4X71A 5HX7A 1AGRA 2QRVA 2ZBEA 4H35A 3L7DA 3KALA 3BD9A 2O8FB 1J9EA 2WNIA 1UZUA 3H11A 2B1RA 4A15A 1AN0A 1LNQA 4YJGB 2ORIA 1AHPA 4W8OA 3THOA 5EJ2A 4XX1A 1AGNA 4GSLA 3CR8A 1LF0A 2OOSA 3UBMA 4KLRA 3RSFA 5IBCA 1SU6A 1UDAA 1L5SA 4Z4EA 1D0VA 4NU5A 1ZEJA 4B2LA 2R86A 5F5NA 3GT4A 4PG6A 2BFPA 3A1UA 1CG6A 4JXJA 3MT0A 2CFTA 1NUHA 4YRCA 4C7VA 1NMYA 1E8DA 1XCJA 2XKJE 2QN2A 3OE5A 1U2EA 1J90A 4KGVA 4LC9A 2GD2A 1M1UA 3ROMA 5KYVA 1GA6A 1Q1ZA 3QVKA 4UATA 2AQHA 2OV4A 5E9JA 1UAYA 1L7DA 2X0FA 4RA9A 1BVHA 2GI4A 1NRIA 1R6VA 2GPTA 2ZSBA 3MUOA 3CXRA 4WZBE 4KQXA 3H2JA 5EPEA 5KYYB 4X7MA 2BFNA 3OSZA 5DHSA 2EFHB 4OB7A 4ENWA 4A91A 5H4GA 3CWZA 2IEIA 2FGKA 3CMMA 4NHEA 2JLWA 5K8LA 3GAAA 1HM5A 1XLTA 2UVPB 2AKAB 4DV4B 4HN2A 2YUIA 1GRRA 1R6AA 1V2GA 3VISA 2VP5A 1W36C 3E1GA 3GPCA 2D1QA 2Q3JA 3JQBA 3PI7A 2X41A 4RO0A 3MM4A 4J0CA 5ALFA 3DP7A 3RGWS 3SX2A 5EPOA 4E3WA 1NW9B 3EXG2 5JS2A 2FSHA 4JVOA 1CDOA 1XEAA 4C0AC 3U3OA 2DWPA 3JYHA 5KC8A 4HLCA 4AULA 2YY6A 1SOMA 1SZJG 3A1EA 3CW2A 4RA6B 4YLYA 3WI7A 3WSTA 3NOOA 4E1AA 1ZESA 3A6DA 1O87A 2X9NA 3RYCB 2A5DA 3BIOA 4ZDWA 2F64A 3PTAA 3ZVNA 3TMAA 3Q2IA 3LDHA 4OOEA 2XUOA 1USGA 3HJBA 4WIAA 3U3MA 3VX3A 5C7LO 2WILA 3BN3A 3OCCA 5BVHB 5LDDC 2ES4A 3I32A 4OHFA 5DHTA 5E3IA 4EKEA 1E1RA 3FYHA 4HH4A 1GPYA 4TL6A 1DRKA 3IXMA 3RDPA 3AOEA 4UCWA 1VJ1A 1JEOA 1CJBA 3LQYA 2FPOA 4C6TB 1VHTA 1E6EA 3MWDA 2OBFA 3HEAA 3LY7A 3PJGA 3RF6A 3ZY5A 4CMIA 4YRSA 2P8JA 5GP1A 4IMIB 1WY7A 5BNFA 4TWIA 4YYZA 4X6UA 3TGWA 5L51A 1J24A 4IIDA 1PNRA 3QYJA 4Q3EA 2D1SA 4OI2A 1HE4A 4DMRA 1M72A 1Q22A 5D01A 5THKA 4RVOA 3YASA 1GYQA 1U0HC 1NP6A 5I5EA 3ZE8A 2H0RA 5EIEA 4MWSA 4F5EA 5C35A 2OO7A 4HGQA 1UJ2A 2XMGA 5DGXA 2I1QA 1VMIA 1WXFA 1RZRD 4UARA 4L0CA 4ZAWA 5LMUB 1KMNA 3RT7A 4E94A 1K5PA 2JVJA 4QUBA 4UTZA 4A1FA 1E18A 4B3BA 1QTIA 4GS5A 3QU7A 4UNSA 1U7HA 4G8BA 4X63A 4EFLA 4BFYA 1K3TA 1V7CA 1VSVA 1OV4A 4JXXA 4I1IA 1E0DA 3A27A 1YBVA 3FLEA 2Q4OA 4G3XA 4MYUA 3BXEA 3KXKA 5AVVA 1R8XA 4EK9A 1BCRB 1F8UA 3AOEC 3NWEA 2F8TA 3IVRA 2E85A 2P7IA 3FHTA 3ACBA 4OXNA 5SZIA 3UHPA 3I6QA 1RFLA 1XTBA 3GCDA 4N82A 2ZM6B 4LE0A 3H2BA 1LTHR 3HU5A 4KDFA 3WFIA 4UOZA 2AEJA 1UBJS 1L1QA 3OM8A 2XWSA 1T8TA 3CPJB 2SKEA 5CD1A 4QO8A 5DBOA 1F6BA 1GAJA 2C0PA 5DMXA 5LYJA 4NMWA 3ED5A 2OBNA 1R4NB 1DJOA 3OCYA 1M6HA 4IJMA 1QX4A 5TMEA 4KIJA 3DEFA 4P98A 4BDTA 4AKIA 1US8A 4EVRA 4QTXA 4HHEA 2XYHA 4LRQA 4FDUA 4Q47A 1CUAA 3PC3A 1U80A 3TZHA 2IU6A 4JR1A 4TLLB 5HKKD 1S7GA 1FOEB 3D7LA 3ND5A 4LNUB 2PY6A 4JGIA 1XRRA 3BGWA 2Q8NA 3W4KA 4G01B 1UK8A 2ZT6A 1NYLA 4MMXB 1YUBA 4WMLA 1M1YE 1XTVA 3G8AA 3TTWA 4D4JA 2FZLA 4EZBA 5K45A 3UAZA 4HSGA 1RPAA 2AJCA 3BULA 4Q6WA 1BDIA 2W6JA 1W4BA 4FXOA 5ADWA 1KZ1A 3SS8A 1B23P 2EERA 4CT5A 3KTFA 3SF8A 1WE2A 1PNQA 1BJTA 4B0OA 3CLVA 1Y3IA 3QFFA 3ZVKA 4ZRDA 3QQPA 1D2AA 3IRUA 4Q1BA 1UOQA 1VRCA 5G1NA 2ATXA 2H4FA 4GZLA 2WDPA 3CT6A 3OZAA 3BQNB 3WMXA 3TBKA 1BGXT 3F4BA 4QXRA 1R6DA 4WKBA 1U3VA 1XRPA 3PHIA 4A0SA 2H2IA 4B75A 2IYYA 3LT4A 2VXCA 3CCCA 4RNCA 2GNPA 5IDXA 4K8RB 1RU3A 4UUNA 5MGBA 3DD5A 3EXHC 2OO5C 1J7JA 1KFEB 1FUEA 4IRMA 3TEMA 5K3OA 1K88A 4GFDA 2XBUA 2H7VA 1B42A 2VYNA 4BLQA 2PUFA 1KOLA 3PL1A 1MHPA 1A8UA 2HYDA 2Y0BA 1ZMXA 2VJNA 1KAOA 4NEQA 4BVAA 4EMTA 2H52A 5IF9A 5K2OA 3ET4A 2F90A 1ZIYA 1ACLA 4BNYA 2QRZA 1MFZA 2AHOA 5CA0F 3GAFA 2G9UA 3NFYA 4DR4B 3H18A 5EIFA 4EARA 1MAWA 5JDIC 3S29A 2RGXA 5FEUA 3FZYA 1KZ4A 2HJSA 2R8PA 3WL5A 1KSJA 3FFWA 5DP2A 3IUNA 4BBAA 1GRQA 3G5AA 5K1ZA 3EX7C 2ONZA 2YZKA 2EIXA 2ZZMA 4RHCA 1U8EA 2O4CA 1EFCA 4MUXA 3ZLVA 2VA9A 3GRVA 4B84A 3OTIA 4B6FA 1GZ5A 3KHTA 3TW8A 5HFAA 5KTSA 1RQXA 4Q82A 2C9ZA 1B8NA 4BLSA 3BHJA 3C97A 3TSYA 1D2RA 1A9SA 3IQZA 4EABA 5DSTA 1E1QA 1GP2A 4PTZA 2BE9A 2K2WA 5FYQA 3STHA 1YRQA 4R1SA 3SJUA 4C3UA 3IMEA 3U7GA 1EM6A 1WU7A 4N8EA 2H5IA 1V6SA 2W6NA 3GI1A 3RYTC 4YMGA 3BXHA 4ZI2A 2OK8A 1MO2A 4BAZA 2GDZA 3IUYA 1Z56C 1X1AA 4OK5A 3S2EA 3S55A 1PG0A 4DCJA 1L3BA 5JNUA 2FDCA 4EFMA 1A82A 3D64A 1ZY2A 4L9SA 1ND5A 5AI6A 3LNCA 3TH5A 1Y6JA 1TQ6A 3WK5A 4GKAA 2YKGA 3ZUPA 1Y1PA 4UUPA 1XNRB 3WHKA 1VA4A 5HRAA 1FTGA 3KXIA 1NN3A 5HF5A 1ZQ1A 2ZBPA 1YB5A 4GWKA 4JB2A 3BJRA 3NU1A 2VKQA 1C9DB 1ZMTA 4B6JA 1H85A 9GPBA 4PBTA 2KJQA 2O8VA 3GEPA 3B9BA 3F3YA 4M54A 2WA1A 5AXDA 3JQGA 4AXXA 1A8IA 1YOBA 1UXHA 3PFHA 2VQDA 2ZFUA 2XUDA 3K9WA 1VG1A 3IAUA 5B4UA 4GE3A 2DUNA 3BDAA 1HEIA 5ETJA 3V32A 5B2FA 1GQOA 1U1EA 1Y82A 2QD1A 4K6GA 4ZODA 1IN1A 1W5AA 3U80A 4TMZA 5EUMA 5H9VA 2AQ8A 2CXSA 2P62A 4QSHA 5HTOA 1JH9A 1VPDA 3NXSA 4PC1A 3FJ1A 5HQ3A 1E2MA 1C8BA 1OHHD 1OJ7A 3IDZA 3OFJA 5KTYA 3CPHA 4I50B 1FYFA 5LPNA 4RJ2A 4FQ8A 3R4VA 5B7PA 1D4ZA 1SVOA 1F2TA 4CT4B 2WIAA 4BO2A 1CIJA 1A9RA 4CR8A 5KDOA 3KEMA 1NKSA 3TGLA 2OD2A 3RK4A 2W2QA 2W8ZA 3PNKA 3PU6A 1AQYA 3WWPA 2A84A 1NVEA 2CXTA 4PLTA 4BNWA 4C30A 2J4DA 3WAGA 3FCXA 4Z7NB 1DSSG 1SBNE 3KL2A 3BFJA 3WLIA 4DVJA 2OCBA 2XMCA 1KQNA 1MZVA 5TC4A 3FPSA 2C5EA 3QITA 2QEQA 4ER3A 3Q3HA 3AF5A 4TN5A 1T26A 4EVSA 1RBZA 1ZHFA 2P9QA 4Q3LA 2FHPA 1N8TA 4MUGA 4RZIA 3DDZX 4Y1EA 2ZRCA 3S99A 2OBXA 2ZJ2A 2ZWAA 3AHGA 2ODNA 3GGDA 4JZKA 4KN6A 4DJFC 4HNUA 4I5IA 3TIGA 3LZDA 4D2IA 2GWRA 3PXUA 2XXAA 4JT4A 4W7SA 1KO8A 1PYDA 2H2GA 4Z4QA 3DE7X 1ZMBA 3P2JA 3PP8A 3EDYA 4LV8B 3V1LA 1N7HA 1FDIA 1G8MA 4W1QA 2HGZA 5J40A 2BEWA 1ODCA 3NCHA 3FDJA 4GI5A 2BDEA 3G2PA 1N9GA 4GP7A 4EFKA 4GD3Q 1C1YA 2BLLA 4LK3A 1WY5A 3WJ7A 4HO1X 4WRRA 4B32A 5JADA 3A3PA 5ALOA 1G17A 1Z0DA 3I3OA 3O82A 1Z2PX 4OSEA 3J80A 2CLSA 1GTSA 4AJIA 3MFQA 3UUGA 5TR9A 3T4XA 4UMFA 5T4BA 5CFQA 4M9XA 2XB6A 1JHQA 3M9LA 1NI4A 1SC6A 2WKQA 2O06A 1UT5A 1SY7A 2HJWA 3KLBA 4JEIA 2OGZA 5FLEX 1MB0A 4WAUA 3UA4A 3ZGXA 4RM3A 4QOFA 5EGNA 1SD1A 2IUFA 3LWNA 1RHRA 3S6JA 4BQQA 3E7FA 2G06A 2I34A 3CV3A 4WBNB 4HB0A 4ZYZA 2DUJA 5K99A 4R2LA 1M6EX 2EQBA 2Z2JA 4IDDA 2Z08A 3FKSD 1T3ZA 2AF3C 4K88A 4OJKA 5U4XA 7REQA 5MFZA 5TVGA 1E3EA 3LW8A 3NP7A 4NZYA 5FIUA 1CF2O 4KVFA 2NZUG 4L9AA 1ZGHA 1IIBA 1RCUA 1QUFA 2WJIA 1NYTA 3JALB 3KHUA 4IJWA 3M6FA 5EJIA 1P3JA 4AF8A 1U81A 2F7SA 1SBYA 5IDWA 4MS1A 1J9ZA 4CUJA 3P0FA 2NSDA 2XSZD 2YN0A 3I72A 3HDQA 5LZ7A 4LYAA 4CIDA 3P32A 1T1GA 5D7BA 4KKVA 1WXEA 5B64A 3W5IA 1H05A 5AQEA 2C42A 2C0CA 4B2PA 4CQLA 1TDJA 1X1SA 3SDBA 1L7RA 4YRLA 3LC1O 5JXGA 3UMYA 2R8RA 5KAMA 4MDFA 2HHCA 1A2QA 3N0TA 1SVUA 2I3DA 2PK3A 4YH1A 1PP4A 3D0RA 1LVGA 1E1CA 4FJ1A 1YC5A 5G2OA 2OBBA 2HCTA 3A4MA 3L4SO 3T61A 1Y63A 3VDRA 4DLKA 4PN7A 1A96A 4RSGA 1RKUA 1TJPB 2AMYA 1UR5A 3A2NA 3QWIA 3UXEA 4B8YA 2HR1A 4KFCA 2W2VA 5L3SB 1DJQA 2JZCA 2HGSA 3T34A 4FWTA 2XVYA 4Q4AA 1JAIA 1PK9A 3B9PA 3RBAA 4E11A 5IJ9B 1IFXA 5FPTA 4OJMX 1YI0A 2DBQA 3GUZA 3JQEA 3LPAA 5FOQA 3NGLA 1J00A 2B8JA 2ZB8A 5GJWC 2GVDC 2GMWA 4P3YA 3PHBE 4GX2A 5KYYA 3FNHA 3HVJA 1W30A 5IBRA 2CMKA 1T13A 3CGGA 4KJXA 1UBOS 5PGMA 1N6KA 2BE7A 1TM1E 3QE0A 5FADA 1JZTA 4L50A 3OUZA 1XALA 2F3QA 5D3MB 2UVPA 1WAMA 4L2IB 3ZK7A 3L0ZA 3HDTA 1ENOA 4BFLA 2CBZA 2C5AA 3H13A 3O1HB 5E2AA 1SC1A 3RKRA 2BW0A 4AAYA 4FHFA 3DBHB 3L4BC 5TEVA 1ZL2A 4US0R 2WK1A 1PG5A 1POXA 2GERA 3GO4A 3P0HA 4FYPA 4MINA 4DEXA 2C7OA 3IAEA 2VA8A 1EH5A 3RFUA 2DLCX 5FOTA 5H9WA 4BOYA 3LUGA 5JAUA 3KR9A 4IIXA 4J1SA 3N2KB 5KYGA 1P9RA 1VPTA 1Z29A 3DOUA 5ALTA 1P6UA 2H08A 5AMXA 4TKUA 2YMQA 3GMDA 4L6IA 1TVKB 3OCVA 2ZSUA 1V3UA 4IDNA 3MAGA 3I2HA 4FEEA 1SVMA 5F2EA 5A3SA 3TRFA 4DNPA 1SPXA 2BGMA 2YWRA 4Y6SA 3MGAA 3T41A 1IB0A 3H2GA 4FFDA 1M54A 4MKZA 3UYKA 3UAWA 2HF2A 3I05A 5KCMA 3STYA 3L6CA 821PA 2V7TA 3LBIA 3GLIA 2ORWA 4DQXA 1YCGA 1RJ9B 2YJTD 1BXZA 1I3LA 1NMSA 2YIVX 1OX5A 2J9FA 4MYDA 1R5OA 1U1IA 5EP2A 3RTAA 2CHQA 1LPSA 1HOTA 4FFBA 1ISGA 1XQ6A 3I2GA 2H07A 3N0VA 3O1IC 4PRLA 2HSEA 8GPBA 1TQDA 2CF5A 3L9WA 3PD0A 3QMMA 4WZAE 3TQHA 2VUSA 1FTSA 3VI4B 3QUSA 2O7SA 1YR3A 4F86A 3K9HA 1Y4AE 4DA6A 1G6KA 3BWMA 3PHCA 2V7XA 1QHNA 4WKCA 4GDFA 3O2QB 1AT1A 1O54A 4BZPA 2O0LA 3RTCA 1PR9A 3N2ZB 4FVTA 4NY1A 3T3DA 5GIPE 2JDID 2FN8A 4OAPA 4Y18A 2YFQA 3QG5A 2GZ2A 4HZUA 3T54A 5HGXA 1HLDA 4OB8A 4QPJC 3O9VA 1WZIA 3IEXA 4OGLA 1OAOC 3H1TA 1E61A 2W7TA 3F5MA 4S1TA 5HRCA 4R41A 4HTFA 1AMUA 1MW8X 3GWGA 3FTQA 3N70A 4L1KA 4KGZA 2R4QA 2RK4A 3IB3A 1DL5A 1SBQA 2GJ9A 4BU0A 4U5XA 3W7AA 1NXQA 1CEEA 2JAPA 2JCXA 2WWTA 4G1BA 1IG3A 5TLSA 1ADBA 2CKMA 2GK6A 2WF7A 4X20A 1NQOA 4BQFA 1UZLA 2ZQYA 2JHFA 3OPXA 4B6PA 3EZ7A 4QLBA 3ICEA 5EJ7A 3OLZA 1G5FA 1GAQA 2N46A 2GA9A 4UBIA 5GY7A 1UMCA 3RS9A 3TTYA 2FPPA 1IZ0A 4G5YA 5SYMA 2CLIB 3VR5A 2CE7A 3QYAA 4PSAA 3KSDO 5AHKA 1JSCA 1L7PA 2NXNA 2PGNA 4B3FX 3HSYA 2DCMA 3F8TA 3G89A 4I36A 1GPMA 5K3SA 1UBKS 5A5DA 1PUIA 1JTEA 2JFWA 5AW6A 3VSCA 2AA3A 3WOVA 4CV0A 1QHGA 1F2UB 5LC1A 4EY5A 2QMEA 2JB9A 3A9TA 3QVOA 3RB8A 4P92A 3LCUA 4K9NA 1L5VA 3KZXA 2W2PA 4YUVA 1O0BA 5FTNA 3W2TA 3DLCA 1BZYA 2JEYA 2JIPA 3PKJA 1GVHA 4JITA 3RHTA 1RWBA 2G17A 3WGKA 2Q5OA 1V26A 1F0PA 4DDVA 4M0DA 1GAWA 2AG8A 3NJ4A 3NTXA 4ZHQB 1II9A 1ZH0A 2AJBA 3AHFA 1PQUA 4PSUA 3RT9A 2P78A 2HTFA 2F3TA 1JHMA 1KY2A 1WXIA 2OVBA 3RBXA 3O75A 3R0JA 2IXTA 4YNBA 4NZZA 1EB9A 1F5SA 2YVKA 5JDCA 3DZDA 1KR2A 1TIKA 3KB6A 5HDQA 3Q3JB 1E5QA 2V0NA 2WKRA 4D45A 4II3A 4GL2A 3H1AA 1M2WA 2HRZA 2QTBA 2TS1A 3R3YA 4GF5A 3VR6D 3FFXA 2JVIA 3ILYA 1KZ7B 2YNMC 5JS8A 2IYEA 1X9IA 4LV6A 1OAAA 3WJ2A 1V11A 4V3BA 1L7XA 3HHEA 1REQB 3A9RA 3I9KA 5LYYA 7YASA 1ADGA 1UBHS 4M3NA 1C80A 1EUDB 4CFZA 5LZ4A 1AQLA 4EL5A 4P22A 2ZSDA 4XGIA 3I3SR 5CDUA 2PMCA 4V2UA 1XQWA 1IN7A 1GKIA 3UMRA 2Q5EA 4JUAA 3JWGA 3AI3A 1GGVA 3ANLA 1JIJA 3MWJA 1JHAA 4MA0A 1T5IA 1NVFA 3NKVA 1SKYB 4R2MA 3ROTA 3MTBA 3Q7QA 1O6ZA 3ZKWB 2ENUA 2W0SA 4NJEA 3KOZA 1T9KA 2B2XA 4G0UA 2D7JA 1E0AA 2PX5A 1XNJA 2RJNA 2Y1XA 3BD8A 5EZ6B 1UDRA 1C5KA 1D04A 2O14A 3OZSA 5LQRA 1WB5A 1WXQA 3CHYA 3QEMA 1N6NA 1PSZA 4HRXA 3W6ZA 1JIVA 2J9YB 1II8A 2DR3A 4G07A 1XQ1A 3LSYA 1T2UA 3ELBA 4KH0A 1Y7IA 4ZV7A 1IBSA 2MSDB 1E5LA 3JWHA 3RJ9A 2VVTA 2BGKA 3DOIA 4RCZA 2NOAA 2BBOA 2DF8A 1G5TA 3X1ZA 4EVIA 4L6AA 3RJTA 2JAXA 2TRSB 5JSFA 3AIMA 1KORA 3RSCA 5H7XA 4IOLA 3WWDA 1WB9A 1DQSA 1P62B 1JU3A 2ADOA 2B8EA 2JJ1D 2VZEA 3WZLA 5K4GA 2YWGA 4QDZA 4BNZA 1DINA 1GGMA 2R6HA 1E9EA 2V9PA 2H4YA 4LHYA 2NM0A 1FUYB 4LDRA 4WTOA 3ECAA 1JPNA 3WNBA 4QGBA 1BROA 2CFOA 2Y67A 4KR2A 4QYIB 2BD0A 1A2KC 3AP2A 3WHLA 2VDWB 5B3KA 3JWJA 2RI0A 3AYZB 2GHQA 3R09A 4BNDB 4WKNA 5DI9A 4LBZA 2PH1A 2NNLD 5TMPA 4DIBA 4PG8A 2Q4RA 4MV7A 3ZOZA 1I1OA 1FQOA 2A92A 3I04M 1VE6A 1XKLA 3O9ZA 3VNAA 4D9NA 4JI0B 2YVAA 3K0EA 2MJLA 1FE8A 2QD3A 3LZCA 4HMPA 4NATA 4CLDA 4ZMSA 5JUWA 2FQYA 1G3IA 3EFEA 3FUTA 2O7RA 3BSYA 1QAQA 3GMIA 4IDAA 2YH2A 3ABQB 1QTNA 2CVOA 2O2HA 3NTVA 3R6LA 2BHRA 3D6TB 2ZJZA 2IYFA 5K0NA 3UT6A 4MCIA 1G63A 3D6NB 3LCVB 2ZR9A 4G4GA 1NBHA 5DEIA 2R2GA 3UMJA 3WISA 2YWFA 2QLLA 4V24A 4NYIQ 2IW1A 2DZDA 1LA2A 3K72B 1BSVA 1OAKA 3AXTA 2YJZA 4D79A 3JQAA 4CQMD 1YZNA 3WP1B 4G81A 1FNSA 3NVMB 2P9EA 2WR8A 3NZEA 1ZWLA 2N42A 4FMBB 1WRBA 3FWNA 3QW2A 2BIFA 1SO8A 1E0JA 4J0QA 1VI2A 4QELA 4Y9SA 1GAEO 4FGSA 5UKDA 5ER9A 2NPFA 5FWYA 2EJTA 2FG7C 3DUFA 3NHJA 1H4TA 4IBOA 3NWPA 5FLYA 2PLAA 4GKVA 1ZCBA 4OHXA 3SDSA 4G1MB 4YJKA 2OC9A 4HWRA 1VE5A 2MTBA 3ISVA 2WTUA 2JLVA 3AVYA 1OFHA 4JGGA 2PCJA 3FCCA 1J99A 1Z28A 2PLWA 4M6WA 3AB8A 1VZ2A 1EA7A 1JNXX 3I9OA 4HQLA 4M89A 4OSPA 2QQ0A 2NVUA 4UEWA 1O95A 5J9FA 1QX3A 1RR6A 3B3FA 3NLLA 4ZQGA 1NI3A 3IAXA 3KHKA 5GV7A 1CX9B 1HETA 2CZGA 4GG1A 1USVA 2YNMD 4F1JA 4O3FA 5B58T 1SCBA 2EGGA 1IUNA 2I6SA 2OSBA 2QAJA 5HPYB 5IT9A 3W3AD 4FFMA 4W8HA 3HB1A 3W8FA 3U44A 1LU9A 1WPGA 1ZWKA 3L06A 4G2NA 2IZ6A 1O57A 4E4RA 3ZDDA 3PXCX 1FUUA 3A4VA 2QE7D 5DULA 4LZNA 2JCGA 4RMGA 2WJAA 2ZI7A 1C3XA 3E6AA 3IEKA 3EEIA 4KQMA 4POOA 3GJYA 1MG0A 4AZWA 1MQ8B 5LZ2A 2A3NA 2HWUA 2ONCA 4FLFA 2AN1A 1QHEA 1NAIA 1WCXA 2GTHA 2IDZA 4DV2B 3R3JA 2VOJA 2W48A 5TDHA 5D3QA 4YRQA 5ALDA 4TSRA 3AYXB 3H4IA 3H5WA 4Y7CA 1XPOA 1W0JA 2EWWA 3ZWAA 1SXIA 3EVNA 1HT1E 2V96A 4UDNA 3MMZA 3KQLA 3UPDA 2ZVQX 3ZK9A 4I7EA 1AK1A 1TKCA 4Q4JA 3LT1A 1SELA 3WZ2A 3OOEA 4CMJA 3EQ8A 1G98A 5E7JA 2C94A 2Q3EA 5CX1A 2JLXA 4RK4A 5ALPA 2O5CA 4YHHB 4ZYUA 3GROA 1C1DB 1YBMA 2FZEA 1EFHA 2ZRGA 1JIUA 1LEHA 1RI4A 1SUBA 3AIKA 3OJFA 1CZNA 4NICA 2WLTA 5CG2A 1C9KA 2M2IA 1H6CA 4M0EA 3UHFA 1RMYA 4PR3A 4J2TA 5M04A 1M5RA 2QRKA 4J16C 3QJYA 5J2UB 3SPXA 3JASB 3N7TA 3Q12A 3QA9A 2CZQA 4LMPA 3RVQA 4ZIRA 1RRKA 4I3FA 3L0BA 5HS4A 4KIGA 1HL3A 1N1MA 4OBEA 4PZDA 2OTCA 4HDQB 3PDWA 1QC5B 4QO7A 1C9NA 4RFSB 4OI0A 3TTUA 1ZD5A 1NUTA 3ENQA 2ZE7A 5EEHA 2HF9A 5K0SA 4JMPA 2DQZA 1OILA 3LQ1A 2QUIA 3MG9A 2XJ4A 2ZS8A 4V2IA 3RVPA 4F3YA 3FY4A 2FJUA 3IPAA 4XB1A 5ITVA 1I7SB 3BSSA 5H80A 3LBHA 6ABPA 3HBAA 2DY0A 3K94A 4N5LA 4Q4LA 4QXAA 5EXXA 5KHAA 5I01A 4PZAA 3H8SA 1NVUQ 3WP0A 3ZVMA 3FZEA 1XZJA 2P27A 1K4KA 4E4YA 2DUWA 2Y2VA 1NTRA 1IM2A 3T5MA 1X15A 1WHSA 4V0SA 1E1CB 2ZRPA 3V6LA 3MT7A 3T1YB 5K3FA 2JGMA 4D9EA 1PFQA 2CMGA 4RY9A 4XPIB 1QGZA 2P2DA 3TLGB 4DLNA 3K0FA 2BMVA 3K20A 5H16A 3T4EA 1FC0A 1PQPA 1PVVA 2P9TA 3T6KA 4IGAA 2PH3A 4ZYXA 2DBZA 4J4BA 1Z12A 5EJ6A 4ZREA 5IJ9A 1OTXA 2II6A 2SKDA 4LWPA 4UASA 3U1VA 2O2JA 4DC1A 1RRGA 1LX7A 1SAYA 2FSSA 2JHGA 4IJUA 4CMEA 1YONA 4B47A 5A4AA 4R81A 3GPDG 4ZK2A 3PXEA 1AKQA 2WSYB 1XAIA 4P5DA 4QAJA 2QUJA 3IP1A 4QTYA 2RH8A 3PEYA 5CVTA 4QIHA 1BKSB 2QVGA 4NBTA 3IKVA 2ZTMA 4BKMA 1MXHA 5TSDA 1KJZA 2ZSHA 4C7KA 1PJSA 3O8QA 1DUIA 5AI4A 1MEJA 3C85A 5IC5A 2XVZA 3WWEA 4AMVA 2R7LA 3I6ZA 1SKBA 4JWKA 1EESA 4RELA 4OP2A 3VVMA 3FDXA 3NHSA 1SQFA 3AFHA 2AD5A 1Q0PA 3F6SA 3NUQA 1GRVA 5HCNA 2H7CA 2QF7A 2O8DA 3NIBA 5IKPA 4GR5A 3UUWA 3L7IA 2PLFA 4HN4B 5DM4A 1Y5LA 2WSSA 3UTCA 4DUYB 2UUPA 1VCOA 1P1JA 3KK0A 4I4TF 5JMTA 1RZRA 1W5EA 3DAHA 3NT4A 5C8ZA 4RDHA 1SHKA 3KLMX 2X4LA 1BNCA 1L4EA 2BZ1A 3N59A 3LPMA 3N2GA 1YZGA 3PNOA 4RKFA 5FUXA 3KC2A 1U94A 3I6BA 3KB2A 4MUHA 4N5NA 3RUAA 5AW4A 1ZBQA 2WAXA 1BDHA 1UM8A 4QREA 2WRZA 2FX2A 2ZSJA 1Y5IA 3AVXA 1D6MA 4DN6A 5JS7A 1EP9A 1GA4A 4HH1A 1TZJA 1DC4A 2BUAA 2O5RA 1OXBB 1PGQA 3QV2A 4QG3A 4R98A 1I5EA 4PQRA 3S27A 3GQBA 2YY5A 3QFHA 4IXTA 5MF6A 4FMCB 3B60A 1G38A 1YB1A 2AI2A 2GEUA 1JDNA 3JAKB 3BGDA 4LXQA 2C2WA 4CCYB 1KYZA 1JXQA 3K5PA 3NUGA 2XF2A 4M8KA 1X9HA 1P5HA 1Q7BA 2CCKA 2Q8PA 1KAMA 3V1NA 2XHEA 3THSA 3ZDEA 3PC4A 4P3PA 4HFNA 4AO7A 4N41A 3FFAA 3ZHQA 3DBOB 1KU6A 3AGPA 1ZJ4A 5CB6A 4AXBA 4CEHA 1KS9A 2JANA 2PJZA 3KX2A 3SP1A 3L8DA 4PO8A 2QMUA 1GPLA 3T4UA 1NXPA 1SZPA 3ZNNA 3AVTA 1P2TA 1DRUA 1TLFA 3A06A 4KX3A 2R751 4I3HA 3QU4A 2FI1A 4JVNA 4HAIA 2Y1WA 1TM4E 2QSZA 1GJRA 1Z2OX 2JBWA 3KOXA 5K3CA 1GD1O 4RUKA 1DO8A 1L4LA 1KE2A 3I6MA 3ZY2A 3UYLA 5IT4A 4RF2A 1JDZA 1SOUA 2OCKA 3BF8A 2X4IA 2PUWA 4JBLA 4NCJA 4ZC8A 5GIOE 1T0IA 4G2TA 3IFSA 2JLUA 2HNBA 4XDHA 2H1LA 4EY3A 4A0RA 1VJTA 3G0DA 1UBMS 1EGAA 4JL8A 1V35A 3HU1A 1EHIA 4IHAA 3K6RA 2BGRA 3UWPA 3FSRA 1R10A 2C8VA 4ZAGA 2GA8A 2IUYA 4ITVA 3QTTA 2O8NA 4MVJM 2OXTA 4JLDA 1R0XA 1VLVA 2PWYA 3NO4A 1F2UA 3JQFA 2QN9A 1YDEA 3CRZA 3ESDA 2H9IA 2I22A 3NHZA 4RTOA 3HNPA 1S2LA 3LRXA 3VMMA 2OUKA 3RVMA 2E21A 3BILA 3DV2A 3HBFA 5IANA 2OHXA 4BNUA 1UZMA 1BHQ1 4BLRA 1U8UA 3T0FA 4CLOA 5HKBA 1DWOA 5EXPA 4EI9A 3NW9A 4PR0A 1VA5A 4EY4A 2IEGA 1M0WA 3U1BA 4H7PA 4PTLA 1PSWA 1U2PA 3W8DA 1V7QA 3MINA 3IMCA 1TUEA 2XMSA 3A2MA 3C6MA 1C7EA 3P9IA 4ZVTA 4JI4B 4ZZIA 3T3GA 1AHNA 2CLLB 2CNDA 2QAGA 2QY6A 2ZJ3A 3GJRA 3LUHA 3O9MA 3MWDB 1DOZA 1EBFA 1I2DA 1PGJA 2CK3A 4HV4A 3IESA 3UGTA 2X2EA 1XYVA 2Q2OA 1T4CA 2G7ZA 2HIMA 5LUBA 3HGMA 4XYMA 3VR3A 3ZHCA 5C32A 4I6EA 4TLDA 4BV3A 4HXEB 5DHFA 3CSSA 1T2VA 5ALYA 3ZIAA 4CYMA 2EBUA 1UMDA 3VKGA 4P31A 1EIWA 3BCRA 1WIWA 3L82B 2R2AA 4PLZA 1CETA 1JH8A 3OEYA 5CIYA 2FLWA 2VZ0A 2PGLA 3Q7SA 4YDQA 2H5EA 5E1BA 5EWJB 1FB5A 4R5MA 3IT1A 1PTJC 3GRUA 4P4SA 2WFLB 4R1OA 1P17A 4YO8A 3WB9A 5FOUA 5IARA 3HJFA 4H17A 4LJ6A 4YRBA 1KYVA 3FFBA 1G2OA 1M7HA 4WOBA 4CE6A 3GLKA 1JS1X 3A9UA 2CJPA 4FGZA 3VMFA 1OBCA 2WHXA 1P7WA 4ZC1A 2SICE 2C00A 1B2RA 3KPVA 3NP9A 1S02A 3LS2A 4N48A 1C8KA 4EKGA 4JV5B 1TKRA 2VT6A 5EXTA 1P44A 1E2LA 1L4YA 1TK9A 2XECA 3H04A 1JEJA 2OC4A 3NFRA 4EI2A 2R6ZA 4XGRA 3WO0A 1CY7A 2DM6A 3MTDA 2I0FA 3FYTA 4BFVA 3CNLA 4HFRA 1EWVA 1TU3A 1X7HA 3QLJA 3Q6MA 5KMGB 1MGOA 3QVUA 4BNFA 2JLSA 5ALIA 1AF7A 1X1QA 1P7VA 1Z3IX 3TQRA 4CKZA 2RGNC 1AB6A 1CQJA 5IAAA 4QJ4A 5IKMA 2WT4A 1Y8RA 1XRSB 3OEWA 4PXAA 3GLGB 3NAMA 2QOEA 2KS6A 1O89A 2E4XA 4CETA 3IKLA 1E4YA 2XKAA 3DV0A 4MITA 1KOGA 1JIIA 1WV1A 2QQFA 1QH0A 3PQFA 4GPEA 2VAXA 1GU7A 4IDHA 4LNUA 4MGIR 4RHXA 1DZ3A 1JMVA 4B7AA 5BW8A 1K5HA 1K8ZB 5FL7D 5J2TA 5J59A 4DDKA 3Q85A 4CN9A 1W88B 3WRXC 3BXFA 3THYB 4MWCA 2QVXX 2I3ZA 4C0LA 3FPCA 3TL6A 1SXJA 5A7GA 2FVXA 3PWTA 4HPXB 4KLNA 3FOFC 3CA8A 3TDKA 2L42A 3P2KA 4O02B 3AFNA 3OESA 2KQUA 1MO3A 2R7KA 5FP0A 3RFTA 3VC7A 2NO7A 3WGYA 2ZIEA 5D6NA 4MVCA 1IY1A 2IOYA 4XUDA 3BHIA 5A5VA 2GYWA 2OLJA 2GNOA 2XGMA 2Y0DA 3LO5A 2FXIA 3QXXA 4KXXA 2AFIE 3BJIC 3Q8MA 2B2CA 3FYUC 3KQOA 2C58A 2NP7A 1J2EA 2DFVA 4DQKA 4AZ0B 3U40A 2O05A 5F3RA 3OF3A 4ZANA 5EXDA 3NBUA 4N0QA 3IUSA 4B87A 1RNLA 2JI4A 1E99A 4OUDA 4LRTB 2VAVA 4ZCSA 3RROA 3VPXA 4YXWD 1BXGB 2OZLA 3FBWA 3F49S 5IJ0A 1TF2A 1Z2EA 1X70A 1ZGZA 1TAUA 3IPRA 3P1JA 4L95C 3T7AA 3VO1A 1PWZA 4D1YA 3N2YA 3CX3A 1NF2A 1UFVA 1ZA2A 4NDNE 2R97A 2WU1A 4GI3A 1EHCA 4J0JA 2BPOA 4RLHA 2EP8A 1FSFA 1QLHA 1ZD8A 2YZNA 3LLCA 5ED4A 1H2YA 1OGYA 3E05A 3NALA 1U2RA 4DCOA 5BSKA 3U13A 4RHUA 4BJ3A 3EJWA 4LEIA 4FDTA 4KMRA 3IURA 4XYLA 2QU7A 2D5IA 1HTWA 2R85A 1CUXA 2V7EA 2XMBA 3VJMA 3BIXA 3CEAA 5JCOC 3FHOA 2R4UA 3D2LA 2GKGA 1Z33A 2Q4EA 3AJ9A 4HF7A 1XTKA 4RESA 4LZZA 5CB0A 1F0KA 1WA5A 1DCKA 2XYPA 4OHRA 5FA8A 3O4VA 4CKXA 3D3WA 5C2JB 5F2OA 5LJLA 4K05A 2G5PA 1IIRA 1J4AA 1B74A 3BE6A 3OLXA 3OQIA 3LDGA 2FP4B 1L7AA 1MORA 2HPVA 3D5EA 5H83A 3AIOA 3SQLA 3EIXA 4GGMX 5JH7F 3OZGA 1OH6A 4WQMA 2AUMA 2QL6A 3VGPA 4IHKA 3DSRA 2W42A 2WTAA 5HFJA 4GOJA 4QLOA 1PF7E 1SCUB 2P4UA 2WW8A 3ONVA 1U9JA 2J5KA 2VP6A 1VC2A 1W0JD 5THXA 3INYA 5JMWA 1ABFA 4K0RA 4Q9AA 4BE4A 1YUNA 2QUBA 3TB6A 4PX3A 1AS0A 2RGRA 1J0DA 2F17A 5INTA 4B34A 4DCCA 4FNGA 5TQ2B 3B1FA 2W8BB 2Y2UA 4H18A 4QUGA 1Z0FA 1OU0A 2QRMA 4D74A 1VIAA 5NLLA 1JXOA 3TRIA 4HRYA 3L4KA 1RHMA 1AG9A 1E77A 4EUFA 1GZ6A 4URFA 5LWHA 3CR3C 1Q0ZA 4II7A 4O4IA 1F2DA 4KBFA 2G9VA 1K97A 4OK3A 2XIJA 1ABEA 2I8CA 4HAZA 1A8PA 3OZCA 4IXWA 4PINA 4DDTA 3CVJA 2SCUB 1IM5A 1UBGA 4F21A 2WIGA 2QMHA 4GZ5A 5E3HA 5JYCA 1J5XA 1G8GA 1SCNE 2GAFA 5T4EA 5K3DA 3D8HA 2AX4A 1AGPA 3ZWXA 4CGZA 4ZJYA 4A73A 3KKNA 3F5QA 3DLHA 3ORHA 1LSUA 1IY0A 1I3MA 2WYWA 3MCWA 4LI3X 4RIEA 1SQ5A 1BQEA 1M2KA 1V8BA 2GXUA 2WJ6A 3CO0S 2IFTA 1Q17A 3IQGX 3SNHA 3U7IA 3WWOA 3NVKI 3RO7A 3SFTA 4LVCA 3T5TA 2VWQA 3PA8A 4LDN