3CNAA

Structure of concanavalin a at 2.4 angstroms resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
237
structure length
237
Chain Sequence
ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQDGKVGTAHIIYNSVDKRLSAVVSYPNADATSVSYDVDLNDVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNSTHQTDALHFMFNQFSKDQKDLILQGDATTGTDGNLELTRVSSNGSPEGSSVGRALFYAPVHIWESSAATVSFEATFAFLIKSPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of concanavalin A at 2.4-A resolution.
pubmed doi rcsb
source organism Canavalia ensiformis
molecule tags Lectin (agglutinin)
molecule keywords CONCANAVALIN A
total genus 32
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 1976-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3cnaA00
4M3CB 4FPKA 1YRZA 3SISA 1MS5A 2NMOA 4XMIA 5H9RA 5DXDA 1JBCA 1CQ9A 4LBKA 2GNDA 3APBA 4XJZA 1S0CA 4HANA 1VALA 2PHTA 2YZ4A 4YM0A 4AVVA 4TZDA 5IK5A 1VAMA 1W6OB 3M3CA 2GMPA 2UURA 4PBPA 5GLZA 4Y22B 1LGNA 5KXBA 1QOSA 1S0JA 1S1AA 1W6PA 5GZDA 3ENRA 1LOCA 2E7TA 2H0BA 1D2SA 1DZQA 1ONAA 2P3KA 4ITCA 4WVVA 3AZXA 3N7JA 2ZGPA 3M3OA 1SLBA 4IQPA 1LEDA 5HCAA 3WVJA 1DHKB 2DU1A 1ULGA 3I8TA 3ZSMA 3V64A 1CN1A 1C1FA 3O0XA 1IKQA 1ZA4A 1AX2A 1GZCA 3VKNA 2D6PA 2ZKNA 5JMCA 5DUUA 1DQ5A 2JJ6A 4Q2FA 5LK5A 1W0OA 1SBDA 2W68A 3ZXEA 3SLIA 3AFKA 5F5QA 1DFQA 4YW3A 4ATEA 1IS3A 2V5YA 1F31A 4GWMA 2ZZJA 2D3PA 3ZYRA 1W6OA 1BJQA 1LHVA 4BMEA 1BQPA 3B3QE 4Y24A 3O0VA 1GNZA 2NZ9A 5JOXA 1WBLA 2VW0A 3OJBA 1GBGA 1ULDA 1V6JA 1OQ1A 5T5JA 4RA0A 1DIWA 3LSDA 2CNAA 1FV2A 5E88A 2VXRA 1ZM1A 1GZWB 5DZEA 4FPEA 4YM3A 2ZHMA 1RINA 5DUXA 2DUOA 2R0HA 3PVNA 2YMZA 3IN9A 3GALA 3WCSA 1GLHA 4XXPA 2ZGNA 3AYDA 1G9DA 3AYEA 2ZGQA 3POWA 4LBQD 1N1TA 2ZHKA 5JOYA 1EPWA 1QNYA 3SNMA 2HYKA 1V00A 4FP3A 2A6ZA 2DTYA 4LBLA 1LHNA 2ZGRA 2GALA 2P37A 3FBYA 3L2YA 2JECA 1MZ5A 2D44A 3DGTA 2A3WA 1GSLA 3O0WA 1ENQA 1ULFA 1W6NB 3AXDA 1UPSA 4YW1A 4L8QA 3T1LA 2AREA 4AGRA 3WDUA 4BLIA 3V0BB 5JOZA 4XTPA 1LHUA 5GZCA 4M3CA 5DUWA 2AYHA 2A5ZA 4YM1A 1GZ9A 2YXSA 1DBNA 1WW6A 4UW4A 2ENRA 4Y1XA 1I3HA 2C5DA 3OBTA 2GNTA 4NO4A 1QOTA 2WT1A 5IK4A 4YM2A 5T5OA 1BYHA 1SLAA 2A75A 1LHWA 4UW6A 3B9CA 3WDVA 4M3CF 3SITA 3JU9A 1Q8OA 2CYFA 4KBBA 3ZXJA 1Q8SA 4XJWA 4K1YA 2JE7A 3SH5A 2ARBA 2BQPA 3N7LA 3NV2A 3T1MA 2EXKA 2LALA 2NM1A 1G9AA 4XILA 2NN8A 3AJZA 1QMJA 2PHWA 2ERFA 2PHFA 3MW2A 1DQ4A 2E51A 1GKBA 4BM8A 1G7YA 2RHPA 1YO8A 5FREA 4LBQA 1W6PB 4ZKTB 4Y1UA 1CPNA 1JW6A 4GALA 4PQ9A 2GN7A 4XXAA 1KDMA 1KDKA 4Q26A 1WUVA 2EAKA 1FAYA 3RMXA 5GZEA 3AP6A 3AZYA 4LBMA 4U2AA 3WG2A 1W6MA 4AGVA 1SCSA 2D43A 1X50A 1IS4A 3UJQA 3WUDA 1Y7BA 1Q8QA 2P3IA 3HN1A 1URXA 1C4RA 1LTEA 1S0BA 1S0GA 2ZABA 1SACA 4FP2A 1AXYA 1W6NA 1NXD1 2AGSA 3BOPA 1MACA 5GJ6A 3RQ0A 3PMEA 2CY6A 1LU2A 1MS9A 4BOWA 5IT6A 3QCWA 1VIWB 5GZGA 1G9BA 4JRAA 2R0FA 4BLJA 1O4ZA 3LSEA 4FPHA 4BQ1A 1C57A 3INAA 1GICA 3LCPA 1LOGA 3IPVB 1PZ7A 1WLDA 3ASIA 3MW4A 3AK0A 4GKYA 1H9WA 2GN3A 2ARXA 2D3RA 5GALA 5SV8A 3IPVA 1JXNA 4YZ5A 1S0IA 1BZWA 4YW2A 1Q8VA 2P34A 1IS6A 2R1DA 1W6QB 5CB7A 4GA9A 4XYXA 4DPNA 3SH4A 2GMMA 4FPJA 2EXIA 1JHNA 2DVFA 5T54A 1HKDA 1LESA 4LBJA 3UJOA 1OKQA 4R9BA 4XIKA 1GNHA 2PHRA 3AXEA 1SBEA 4YG3A 1CVNA 1N1SA 2CTVA 2YROA 3BODA 4Y20B 5DUVA 1DLLA 1V6KA 5GLUA 1WCSA 1W6MB 2DV9A 1AZDA 3N7MA 3R05A 5BYNA 2ZBJA 4I30A 2XB6C 5IK8A 1PZ9A 3N7KA 3OY8A 4PF5A 2FHRA 1LOFA 1FYUA 1KQRA 1QGLA 1QF3A 1UZZA 1LODA 2JD4A 1D0HA 1AJKA 2OUJA 1N3OA 4XZPA 4YZ1A 5JDBA 4FPOB 3FFZA 1QOOA 1DYPA 4D69A 1V6NA 3AP4A 4YW5A 4RL7A 4JCKA 4UW3A 1JUIA 3I4IA 4AGGA 1G8WA 1HDKA 1LOEA 2D6OX 4ZXKA 5HCFA 2A3YA 2OVUA 5E8AA 3WDXA 1LGBA 4F83A 2A6WA 3ZVXA 2Q5TA 1SCRA 1KJRA 2P3JA 4FOVA 3NV3A 2ZGSA 1O4YA 4XOGA 5DZGA 3PVOA 4JC1A 5T55A 1N1YA 3AZZA 4ISRA 1AXZA 5EYYA 4R9AA 1C1LA 1YI7A 2DUQA 2VH9A 3MPPG 4Y22A 2JKBA 2SLIA 2W39A 4ASMB 4DRRA 1YXWA 3B01A 2R16A 3USUB 3A0NA 1LU1A 1N1VA 4FOYA 4K21A 3V0BA 3A0KA 4DRVA 3JUUA 4XBLA 2EIGA 3M3QA 2AENA 4M3CE 3Q9OA 2KM2A 4NOTA 4Q8LA 2WSVA 3NWKA 3OPZA 2A70A 2ZACA 2JDZA 3RRDA 3OYWA 4XJUA 4FQ4A 2DU0A 2LTNA 4PBOA 3D4KA 5HCBA 2DVBA 4YGEA 2W52A 4SLIA 3AYCA 2AH2A 2A3XA 3POYA 3IM0A 4R9CA 3HR9A 3AP5A 1G9CA 3N35A 1AVBA 1HQWA 2GMEA 2ZGTA 3D5OA 4YG6A 4C1WA 4YG0A 4Y1VA 2WSUA 3FLTA 1QDOA 3OBRA 3ZPYA 1SBFA 4CTEA 2SBAA 1GZWA 5GLWA 5GM0A 1R1ZA 2E53A 2EXJA 3AZVA 1WW4A 1MZ6A 3FLRA 5GZFA 1GV9A 2ES3A 1AXKA 4FPYA 3U4XA 1AJOA 1JYIA 1WW7A 4W65A 1I1EA 5AVAA 3GNEA 1MS8A 4XBNA 1Q56A 4MYEA 1Z78A 1SLLA 3OYWB 3UL2A 4PCRA 1UMZA 2R1BA 1YIFA 1QDCA 2NMNA 1AF9A 3WG4A 1ENRA 1APNA 3ZSJA 3ZYPA 5T5PA 1A78A 3FUOA 2VUAA 2GNBA 4FPGA 3A4UA 1BXHA 1J1TA 3RMYA 3USUA 1YYNA 4Q1RA 2R49A 4FQZA 4FOWA 3RG0A 4YFWA 4XHXA 1NLSA 5T5LA 1CESA 1F5FA 1ENSA 1FNZA 2WJSA 1JN2P 3ATGA 3UK9A 1IOAA 1ULCA 3AP7A 1S0FA 1DQ1A 4HL0A 4AYUA 5CAZA 2W08A 1DQ6A 1LGCA 5DG1A 1LENA 1LHOA 2D6KA 1LECA 4FPLA 1WLWA 4Y26A 5T50A 4AWDA 3CNAA 2ZGUA 1LOFC 5CBLA 2E6VA 1CPMA 1RITA 2OUHA 4DS0A 2ZGMA 1HQLA 1HLCA 1JYCA 3C2UA 1KJLA 2D7FA 4P14A 2WT0A 4YGBA 4WZFA 2AUYA 4YGDA 1OFSA 3TB0A 2YV8A 3W59A 1IKPA 2UU8A 1BKZA 1LULA 4AVTA 4BMBA 3AYAA 3V0AB 3O5SA 1CJPA 4XE9A 1H9PA 1RIRA 1TEIA 4ISQA 4XJ9A 3FLPA 1UAIA 4XJAA 2WLQA 1QNWA 4Y1ZA 2ZGLA 4YLZA 1GANA 1JOJA 3BIWE 2D6MA 1V6OA 2VW1A 3ILFA 5L73A 3OY8B 2OW4A 4WVWA 3B69A 3WLUA 4C1XA 5CNAA 1VLNA 3ZSLA 3R4UA 2AR6A 2FMDA 3WDTA 2DVDA 3TAYA 4CRQA 3T2TA 4LBOA 2DURA 1G86A 3NV1A 3SH3A 1V6IA 2DUPA 1U0AA 2DVGA 3VKOA 1QKQA 1DQ0A 3ZXKA 3R4SA 1ULEA 4U36A 3ZSKA 2WT2A 3FUQA 3H0OA 3OGGA 3POSA 1SLTA 2PELA 4M00A 1FNYA 2WQZC 2V73A 1AX0A 3M3EA 3MEPA 3MW3A 4YW4A 1DQ2A 2A71A 1F9KA 1MS0A 1MVQA 2CWSA 2CL2A 2NYYA 2VW2A 3PVEA 4P9WA 4XTMA 5FRAA 2A6VA 5T52A 1FATA 1CONA 2EXHA 2A7AA 3PJQA 1QU0A 2UWCA 2WKKA 3AP9A 3D6EA 4YGCA 3W58A 3N3HA 1Z0HA 3KQRA 3QLQA 3VKLA 1MR5A 2UWBA 4FPCA 4FPFA 2P2KA 4R9DA 5EYXA 5IK7A 4DFSA 5IUQA 4DQAA 3IMNA 2ZMNA 2GNMA 4ATFA 2DWRA 1MS4A 4Y20A 3WV6A 4H55A 4XBQA 1XQNA 3HMYA 3WG3A 1CR7A 2D3SA 4YZ4A 1S0DA 2DTWA 4XDQA 3VKMA 3ZXFA 3V65A 3WUCA 1N47A 3AZWA 3V0AA 5E89A 3WNXA 1GYKA 1MS3A 1LOAA 4YFZA 1W6QA 2G4IA 4K1ZA 1V6MA 3N36A 4OZXA 3WZ1A 4TYSA 4Z8BA 2C9AA 3BTAA 4LBQB 5H9PA 1B09A 2ZAAA 2EF6A 1UKGA 4BPZA 3M1HA 4XJ8A 3VV1A 3B00A 2NP0A 3ILRA 3ILNA 1UZYA 2DYCA 4Q8KA 4XIOA 5KXCA 3WDWA 3O12A 1AX1A 1H30A 5JVVA 3WDYA 2D6LX 4XMAA 5KXDA 1KRIA 4GWNA 1UN1A 2JE9A 2ZGKA 2XG3A 1W0PA 2ZMKA 1WD3A 3WHTA 2E7QA 5DZFA 1N3PA 3WOGA 2ZA9A 4GXLA 3VUOA 1LCLA 1UL9A 2WNEA 4YZ2A 5F9TA 5DG2A 1FV3A 4P9YA 2I2SA 2Z42A 2ZMLA 4K20A 3VKFC 1WD4A 1Q8PA 4CZSA 1PZ8A 5KXEA 2DVAA 2ZHNA 3NV4A 4P9XA 5EXOA 1WLCA 1DGLA 1G9FA 3M2MA 4AVSA 2VY0A 4YZ3A 3IKWA 3AJYA 1VAVA 2A6YA 4M01A 1CIWA 2A6XA 4XHBA 3WG1A 1LEMA 1DYKA 2PHXA 5H9SA 1UX6A 3RSJA 5CA6A 1WBFA 5JOWA 4LBNA 1A3KA 1SFYA 2GDFA 2PHUA 3AX4A 1LJ7A 1MS1A 1WW5A 1A8DA 1N3QA 4GKXA 4Y1YA 1S0EA 2ZHLA 2UWAA 2CWMA 5EWSA 3DUIA 1SLCA 5GLTA 1FX5A 2B7YA 4Q27A 1IS5A 4UW5A 3WHUA 3KM5A 3ZXLA 2YY1A 1KITA 4FOQA 4Q1PA 1LOBA 2VU9A 1V6LA 5GLVA 4FVVA 2EALA 3RS6A 1SLIA 5H9QA 1MVEA 5JLVA 3WCRA 2ZGOA 2D6NA 4WV8A 2TEPA
chains in the Genus database with same CATH superfamily
4M3CB 4FPKA 1MQTB 5H9RA 4XMIA 1W2OA 1DYOA 4TLGA 4IEYA 3KV9A 1S0CA 4JRLA 4E2SA 3WR0A 2GP5A 2DF7A 5FY1A 4AQSA 3M3CA 1X8EA 3OG2A 1ZRDA 1W8FA 4CDXC 3VL9A 4DUXA 2G1MA 3ZFEB 4QXCA 3USSA 2RDSA 1LGNA 4NMIA 5KXBA 3MLLA 5EQUA 4AR2A 1S1AA 2BOJA 1SPPB 5DDJ3 3EB7A 4QWNA 3FC0A 4B1MA 2R041 1FT9A 4IV1C 5C5TA 2JIGA 3DEMA 1JYTA 4EJRA 1DZQA 3K3OA 4ITCA 3ELNA 1V9U2 1V70A 1HXS1 5LBFA 4IQPA 1LEDA 3MF6A 5D21A 3SKVA 3CJIB 1DHKB 2DU1A 2JDMA 3C7EA 1R093 4UFKA 4NE9A 3N9MA 1TQ5A 3ZSMA 1FXZA 1KD7A 3V64A 4EN6B 5D1IA 5JIUA 1IKQA 3S0MA 1POQA 4CDQC 3BB6A 1C5HA 4D7SA 1NA1C 2D6PA 2CGPA 3SXWA 2JJ6A 4XUQA 2R071 1VP6A 5LBBA 3VZOA 2VBDA 1PO21 2W68A 3ZXEA 1AL21 3AFKA 1RXGA 1DFQA 4OI0A 4YW3A 1YC61 2V5YA 4LLOA 1F31A 3FFQA 4QM9A 2ZZJA 2VUCA 2JDHA 4AW7A 1BJQA 3T4HB 4D6SA 1HJGA 2P6HA 4GWIA 4DNYA 4IUGA 1GBGA 2EIBA 2RR12 4WM8C 5FY4A 3VZJA 2CNAA 5E88A 2H0VA 3WX5A 2FMYA 4GIQA 3VZMA 4F8AA 3O1MA 3B94A 3C7OA 3AMQA 1UWWA 2X10A 3OTFA 4FPEA 4INDA 5J98B 2ZHMA 4Z07A 4A7YA 4CCDA 4QT6A 4BE3A 1UNBA 2JENA 1NX9A 4W8JA 1SMVA 2ZGNA 5FZ1A 3AYEA 5FQ0A 5FQ0B 2F17A 4CPBD 3ES1A 1N1TA 1COV3 2ZXQA 1F15A 2Y0OA 3N9PA 3U14A 1XYNA 2BVBA 4LBLA 2R042 1KGYA 2WDBA 2B9VA 2ZKLA 3BKZA 1O5LA 5J3UA 5CFDC 3VDDB 1W3XA 3TEWA 5IVJA 3DGTA 3Q8CA 4QX2A 1GSLA 3JQXA 1AYM3 5D2AA 1W6NB 1FMD1 3KQ4B 3MUZ1 4LJHA 5FZKA 2K46A 1BVP1 4CP2A 5JOZA 1QH6A 5LA1A 3N9OA 3VD4A 1LHUA 4NPLA 3LFMA 1OA4A 3H50A 3WNOA 2AACA 1H4HA 1NA1B 2ZEYA 2MEV3 2WS92 3ZM8A 4ARYA 2CSGA 1I3HA 4CEWB 1CZTA 3ACLA 1OD5A 5FZ6A 1TME3 5IK4A 4P02B 3ME2A 1SLAA 1OVSA 5IFPA 1L7QA 3K3NA 5A7WB 2WIIB 3VBRA 3ZFFB 3THPA 2IXKA 3H3ZA 3U1XA 5L9VA 4LUMA 1OHFA 2BQPA 2F4LA 3N7LA 3T1MA 2HEWF 4AHZA 3RWKX 3KLSA 3BI3A 3S6PA 1ZZ8A 4CSWA 1NCRA 1PX3A 3GYDA 2R30A 1W3VA 1OOPC 3MFCA 1QMJA 2PHWA 4LKSA 4JZRA 5I93A 2B9UA 5FREA 1QJX2 1JZ6A 2ZEWA 3K4DA 4ZKTB 3MV01 2WYSA 1EPZA 1JW6A 4PQ9A 4QB2A 4O7XA 3RZJA 4Q26A 5JZGA 1PVC1 2EAKA 1MQTC 3RMXA 5A33A 3AP6A 4LBMA 4FXKB 4Q4X3 2WR9A 5DQ0A 3VBUA 4EZ4A 3H8UA 1AR81 3NSTA 4LUKA 1RVF2 5C8CB 3LB9A 1X50A 1R1A2 4PF1A 2QNKA 1TG7A 2P3IA 5A3OA 3O1RA 2JE8A 4XFBA 3H8XA 1ZREA 1UMIA 1S0BA 2VECA 2JG9C 1KFXL 2ZABA 3AKSA 3POGA 4XC9A 5A7QA 3SEEA 4FAHA 3H9AA 5JAXA 1NXD1 1UIKA 3BOPA 4JDOA 5GJ6A 5A3UA 3PMEA 2CY6A 1LU2A 3NAPA 5AFBA 4BQ1A 2R0FA 3B9IA 3LSEA 4LO5B 1AL0G 4OULA 4KBZA 2VZQA 4UXAA 4UBHA 2DBIA 4CU8A 3P5BA 2XJVA 1GICA 4HFSA 4GKYA 1VB2A 1QY4A 4Q0UA 2VCAA 1OXCA 1YI9A 4YRDA 2DCJA 4YW2A 1IS6A 4PQQA 4CEYA 4XYXA 1JS9A 1QWRA 2OT7A 2GMMA 2VZRA 1C8M1 2PHDA 2HWF1 2E9QA 4GAZA 5FZ3A 4AQ2A 5T54A 1HKDA 4IXLA 1CD3G 2W92A 3LD8A 2PHRA 4X6QB 4Q4X1 5F7UA 1SBEA 4BXFA 1ZRCA 3ZFFA 1N1SA 3NW4A 3POIA 1DLLA 1V6KA 5GLUA 1OOPB 1WCSA 1YFXA 3I2GA 3MIBA 3R05A 2V09A 3H3LA 2ZBJA 4CXYA 3IDAA 2YPJA 1RHI2 5FYCA 1T6BX 3LAGA 5DAQA 1XNTA 1AR91 4S2HA 1O3QA 1LOFA 4CCOA 1GOHA 3LIGA 4XDPA 1OUSA 2Y26A 4AL9A 1NQJA 1LODA 3NNMA 3VHPA 4XZPA 1N3OA 4QDQA 1NY71 4E4ZA 5CADA 2LROA 5J09A 3VL8A 5L19A 4YW5A 5FPVA 2VQUA 5AFEA 1Q5OA 2P1BA 4J25A 1JUIA 3I2KA 3MPBA 1HDKA 4LHNA 1J3RA 1OVPA 4YARA 4ZU4A 3IIIA 3WDXA 4GB32 3WW2A 1NLRA 5FDBA 5DAXA 1SQ4A 5A7NA 3GBFA 5ANNA 5EJ3A 1RUD1 4Z2WA 1LKNA 1RYYA 4MG2A 1O4YA 3ZYFA 3PVOA 4HPKB 5SV5A 2RE9A 3NAPB 4CDUB 1AXZA 1YI7A 2OS2A 3WY6A 3VBSB 2JKBA 2W39A 2XWBB 4K40A 1JYXA 5FAXA 2LM3A 2R16A 4XFAA 2FDFA 4FOYA 1O7FA 5F3EA 3UKVA 3EHKA 4CCJA 2ZX2A 5M0TA 2WNUA 2EIGA 3M3QA 4WM7C 3HT2A 3NNFA 3WQ0A 3Q9OA 4Q8LA 3C3VA 4ZZ8A 2ZACA 3OYWA 1DDLA 4FQ4A 1RJ8A 3D4KA 4WM8B 4JHTA 3UNPA 2AH2A 4Q4W1 3L2HA 1REDA 4ZZ5A 4LE4A 4WVMA 1VBB1 3N35A 4CE8A 3D5OA 5A7OA 2VOVA 5JZGC 3PIJA 5IVEA 2CV6A 2TNFA 3PDQA 5BUVA 1Y3TA 3OBRA 4LHSA 2YBKA 2UY9A 5I0UA 5IATA 2RDQA 1R1ZA 4H2AA 2W47A 2O8OA 4MHUA 1XE7A 4D7YA 5JXIA 2VAUA 1MZ6A 4KWJA 3WP4A 5GZFA 1TVGA 1GV9A 2VOKA 4Q4W2 1AXKA 1W8TA 4G9SB 2XQRA 2Y6FA 2J1UA 4XURA 5CFCA 3U4XA 2W95A 2Y38A 1SHWB 4W65A 5K7PA 1BBT2 1D4VB 1PIV3 1NLQA 3U10A 1QQP1 4EROA 1AF9A 2XJPA 4QGMA 1KEXA 1UZWA 5T5PA 3I7DA 3EJKA 2VG9A 4FPGA 4XF0A 1RUF3 3QH6A 4DOUA 3USUA 5DABA 5L9BA 3OGJA 4NHYA 3RG0A 2P3YA 1W2TA 2JDKA 1NLSA 2XKPA 4HVOA 4ZPIA 4BIOA 5ABJC 2YYOA 4CVUA 1ENSA 1FNZA 5C70A 4CDUA 1IOAA 5FZ8A 1ULCA 3GM8A 4Q0VA 3SQOA 1HQNA 1LAJA 4XF1A 1LGCA 4UWDA 4KI5M 3FHIB 5T3NA 3RWNA 3E6BA 1YQ2A 3CNAA 4Q4V2 4HBNA 1Y4WA 2OYZA 3ZXGA 5CBLA 1GZTA 2JG8B 2HWB2 1CPMA 2A73B 1BEV3 4GULA 3C2UA 4OHVA 2VQTA 2WT0A 4RQPC 1FPN2 2QQWA 4TSVA 4YGDA 2YV8A 4BH9A 1ZRFA 3W59A 3OGSA 5G04L 3V0AB 2EIEA 2QCSB 1WCQA 2WNUB 1CJPA 1HRI1 4N90A 4ISQA 2PTMA 1OURA 4XE9A 2RS13 4XJ9A 5A1FA 5KHIA 4XJAA 3GJAA 1WA4A 4ZY9A 1PX4A 3BIWE 3OB8A 4MHRA 3VBSA 5F1RA 3MIDA 5EJZB 5FLJA 5L73A 4I09A 1WGPA 1RGSA 4Y3OA 2Y6GA 5BY5A 4LO7A 1B35B 3GDBA 3ZSLA 3R4UA 2E32A 4NUBA 2L9LA 2DURA 2XKOA 5BXXA 1G86A 3WF0A 2W1SA 1FMD3 5CFCB 2QQOA 4OUMA 3ZXKA 2FCUA 2WRAA 3R4SA 4NIDA 1JZ5A 2LS6A 5CG8A 2WT2A 3H0OA 3OGGA 3W5NA 4M00A 1ND2A 1YQ8A 2MHFA 2V73A 1ASJ2 1VBB3 3HOBA 3U07A 3MEPA 2JB8A 1DQ2A 1VBA1 4LTAA 4CU9A 1W8UA 2CL2A 2VW2A 4P9WA 5FMCA 4UI9L 1H8VA 4CDQA 3H8OA 5LBCA 4MGSA 1FATA 1L7RA 1XC6A 3CEWA 3IBMA 4NHLA 4Z2AA 1PMHX 2B42B 4LO8A 3NQHA 3LEKA 3M70A 1RUC3 3LA2A 4GMP3 3OD4A 2VNOA 3CHXA 4CEWA 3K46A 2O0OA 4FPFA 4IV1A 5JI7A 1M06G 4CU6A 1GR3A 2QZ3A 3VB9A 4DFSA 2VZSA 2ZMNA 1WCKA 2DWRA 2VVDA 5FZ0A 2XJQA 2GAUA 4H55A 2ZX4A 4AXOA 1NAEA 3GBGA 1XQNA 3HMYA 1EAH1 2XHNA 3WG3A 1AR82 2PQSA 4P5YA 5JR2A 4E4DX 2XR4A 1PNGA 2CHHA 2DTWA 4ZU7A 4XDQA 4QPIB 3ZXFA 3PURA 3V65A 5LW9A 1N47A 5FO9B 3V0AA 5E89A 1H2MA 2XJRA 1ZZ6A 2N7GA 3EBRA 3MLJA 1W6QA 2V4AA 3HT1A 5FY0A 4YFZA 1V6MA 3N36A 3I59A 4OZXA 4XPVA 4Y5TA 4E8DA 3MF9A 2ZAAA 2FD8A 3A7QA 2TBVA 4FO9A 3M1HA 1RMU1 1H8TA 4L9BA 3X29B 2A1XA 2BZDA 3VV1A 3ZN6A 1F2NA 3CZJA 3ILNA 4QQLA 2HWD2 4A7ZA 3WDWA 1AX1A 4N43B 4IERA 3NNGA 4LORA 1RXFA 3BOWA 4XMAA 3VBOB 5KXDA 1VBE1 3BTYA 5IHRA 2ZMKA 5BNOB 4Y5Z0 1AR93 2E7QA 2RS52 3IZOA 3MICA 4URTA 5FK7A 1XU1A 4C8DA 2DCKA 3MIGA 1RUI3 3I2OA 1CAXB 4S2DA 4DXSA 2IXIA 5F9TA 4S2FA 4MX3A 1X9TA 5L7OB 5FP8A 2I2SA 4YW7A 1FI2A 2VZUA 5FYIA 4YWAA 2ORZA 3WT3A 4AVBA 1VRBA 5KXEA 2ZHNA 1YQ5A 4P9XA 3VGIA 1WLCA 2W1UA 3HEIA 3VBFB 1DGLA 3HQXA 1O59A 3AJYA 1AYN2 2BDRA 4DMIA 1ULOA 1J83A 3GZAA 4JGZA 1PGW2 1FOD2 3BUCA 2PHXA 1Z7S1 5F6LB 1UU5A 1TZOA 3C8XA 1SFYA 2GDFA 2XVKA 3MFAA 3AX4A 1LJ7A 1WW5A 2Q0AA 3MIHA 2AEZA 1S0EA 4QD2A 4AAXA 2ZHLA 5FY5A 4NPMA 1YQ6A 4Q5OA 5EPAA 4C91A 5C4WC 3ZN6B 3IB3A 5F3GA 1PGSA 3MZHA 5CYYA 2H6BA 1FX5A 2X5IA 4EYUA 4HVRA 5A6YA 4EZHA 1Y9QA 1IZ3A 2F4PA 4I02A 2YY1A 1KITA 2GSYA 2R063 1NCQB 1CAWA 2EALA 1YIPA 4K9SA 4CDWB 5JLVA 1ZZ9A 3WCRA 2RR11 3IT8A 1CJDA 3KS7A 4WV8A 1YHFA 5DAWA 4ASLA 3T0AA 5F2SA 2XUEA 4E4SA 1UKRA 5LCWL 4RHV2 4HSLA 5DXDA 1JBCA 1CQ9A 2DDUA 4LBKA 1QXJA 2PMWB 5F8PA 4NIGA 1VALA 2YZ4A 1W90A 3VBOC 4CU7A 5IK5A 2XL9A 2GMPA 3ZDSA 3ABZA 5J96B 4BXSV 3J7NA 4CXXA 4M4RA 4J1XA 1QOSA 1ZBA3 2R072 2WNOA 5C4WA 4HPKA 2W94A 4QX8A 1ODNA 2IFWA 3ENRA 1W0NA 2E7TA 3RZGA 5FYVA 4DEQA 5L7OC 1LB2A 4X6RB 1UO9A 1ONAA 5FPZA 2P3KA 4QDRA 3K4ZA 4EV0A 3AZXA 1X8MA 4ORFA 3M3OA 4XZUG 2WQ8A 5CFDA 1UMHA 4KNCA 1ULGA 5KHJA 1HXS2 5IJRA 1YFYA 3TNQA 4HKLA 5FPUA 4Q0QA 4EE2A 4Z1VA 2WO1A 1C1FA 1ZRRA 1RMU3 4GH4B 2C4XA 4JKKA 4XF3A 4YVSB 4AI0A 3VBSC 3U0ZA 5FZMA 1AX2A 2BOIA 1QJU2 2VTXJ 4UF0B 1NQDA 2P4EA 2ZKNA 1Y9GA 1UF2C 3BPSA 5LK5A 1VBC2 4DO0A 1RUE3 1Z7S2 2RVAA 1FOD1 1X82A 4NJ4A 1IS3A 2ZOEB 3MGUA 3TEZA 4FXGB 4RSUA 4BB3A 1BQPA 3B3QE 3O0VA 2OZ6A 2Y6KA 3BVCA 1WBLA 2VW0A 3OJBA 4H7MA 1ULDA 1V6JA 4XAEA 3VLBB 4D6QA 4RA0A 4DZGA 4JV4A 2YHJA 3I2FA 4KWLA 3WQBA 1ZM1A 4ZU5A 3PHMA 2G19A 5LEJA 4YM3A 5JXHA 4CCEA 3T0DA 2PA7A 1W8ZA 3PVNA 3IN9A 1JZ7A 1NCQA 2W9XA 4I2OA 1TE1B 4XXPA 3WINE 3RZLA 4IE7A 1G9DA 2BJSA 1W9SA 5KC5A 2ZGQA 3FHQA 2PN5A 4IEVA 4B7EA 4L2NA 2HWE2 5JOYA 1NZCA 1ZZCA 4UFLA 2BNMA 3SNMA 5F37A 3UGGA 4FP3A 5KC6A 1RUOA 2FQPA 4ONUA 1LHNA 3NL1A 4AFBA 2R043 2IFRA 2WC2A 2ZGRA 2GALA 3FBYA 3L2YA 5C8WA 1MZ5A 4X8NA 3THCA 3ECQA 1UXXX 2Q30A 2ZX1A 3O0WA 5FYMA 3LDKA 5DPNA 1RUJ3 1JU3A 1UPSA 3AXDA 4L8QA 4IEPA 2AREA 2J7MA 3T1LA 1J59A 2FDGA 2VMHA 3OUJA 3AC0A 3Q8EA 4RD7A 4LMFA 5I8SA 1D4M1 4LKFA 3GCWA 2YUEA 5DUWA 2YBSA 2AYHA 4ZS3A 4PLNA 1DBNA 1UY3A 4Y1XA 1UY1A 3MHZA 3AKQA 4HK9A 4W50A 4SBVA 1JUHA 1QOTA 2WT1A 4FFFA 3TN92 5I0DA 3ETQA 5T5OA 3AVSA 3H7JA 1LHWA 4HN0A 1PK6C 4PLMA 4M3CF 4UW6A 3WDVA 3SITA 3JU9A 2OKXA 2R061 1Q8OA 1U5IA 1UY4A 4FFHA 1UOGA 4ZHNA 2FZ1A 1Q8SA 4LKDA 2JE7A 2PLV1 1AR63 5ABJB 2Q4SA 1OUXA 1ZZ7A 5CKNA 1SEFA 1ND3B 2LALA 5A1LA 2NM1A 4BQYA 1G9AA 3I54A 1GOGA 2X8KA 1VBA2 2NN8A 4HN1A 4D0QA 3A22A 2ERFA 1IGOA 2PHFA 2XONA 2CAVA 4KQ7A 4CDWC 3T09A 2RHPA 1YO8A 4MSVA 4KMQA 3UESA 4QPGA 4Y1UA 5C9AA 3ZKYA 3VBFA 2AC1A 1HJFA 2VZTA 2QUOA 4BJ0A 3AZYA 4KWUA 2OA2A 1PVC3 4AI2A 4PIXA 4QPGC 4RFRB 3ZO0B 1IS4A 3WUDA 3RZKA 1VMFA 4OZOA 1C8M3 1QJY2 1Y7BA 4K8RB 5JSOA 3B5LB 1C4RA 1SACA 2YPDA 3AVRA 2VMCA 1GOFA 4AHYA 4BOWA 1MACA 4KH9A 1NCRC 1MS9A 2QQJA 5IT6A 4LO6B 5FOJB 1G9BA 4NWWA 3H3UA 1HRI2 3P1IA 4BLJA 3WW4A 4XQDA 1AR61 1PO12 2Z2SB 1VBE3 2MPFA 2WN2A 4MZUA 4LNVA 1UIJA 2QQIA 3AK0A 2GC0A 2GN3A 2YGMA 1RUH1 5GALA 1RUG2 1JXNA 1VAKA 2NPIA 2K2SA 4IV3C 3ZKUA 3VBRC 4HG6B 1YLLA 2P17A 2Q1FA 3SH4A 5I0SA 1S55A 5A80A 3B7MA 3CO2A 2EXIA 3ON7A 2BGPA 3VHOA 2DVFA 4UYBA 5LA2A 1K45A 1LESA 1OH3A 4R9BA 4GMP0 1PMIA 2ZJCA 4YG3A 5JR7B 3SEPA 1OKOA 4IW3A 5BV6A 1OF3A 1C8NA 5DUVA 2OZJA 5L9RA 4NIIA 3GBWA 1RUJ1 1YQCA 1AZDA 1EAH3 3UGHA 2RM23 2IZWA 2XB6C 5IK8A 4AZZA 5IVYA 1DP0A 1XPWA 2FHRA 4XCAA 1QQP2 2ET7A 4EN0A 4FAGA 5BNPC 1UZZA 3VD5A 2B5HA 3KT4A 3HQRA 4COZA 2JD4A 4A45A 1OD3A 2O1QA 1D0HA 5ACA1 1BBT1 4C90A 4YZ1A 5D8AC 4AI8A 3JBG3 3RGBA 3FFZA 5JDBA 5A6QA 1CZSA 5A7PA 4IEXA 2JDPA 3KV4A 4R4XA 3AP4A 3TNPB 4FSJA 1UW8A 2WL1A 2VCCA 4FTSA 1G8WA 4ZXKA 5HCFA 4IL7A 4IGQA 1K5JA 3KVBA 3NAPC 1JU4A 4O65A 3U78A 4V2VA 3POJA 4IGOA 4WVMB 2HKXA 2P3JA 3NV3A 4FBFA 3R0RA 2X29A 2ZGSA 4XOGA 1KS5A 5DZGA 5F6KA 1KFUL 1SPPA 1UYXA 1REFA 2GU9A 5T55A 2J1AA 1QEXA 3ACHA 1C1LA 2DUQA 2Q1ZB 4S2GA 1Y9MA 3GXUA 1BHGA 2SLIA 3JB4C 4Y22A 2C1FA 3BTZA 3OPTA 3B01A 3RYRA 4JHZA 4XFFA 2OQ7A 2RR13 5FYTA 5FBJA 3NNLA 1F35A 4UFIA 3RDIA 5HBAA 4MGZE 1RUC1 1V0AA 2AENA 4PHZA 5KWRA 4MXWA 5FY7A 1VBD2 4M3CE 5F5IA 3IAPA 3QH7A 2WSVA 3NWKA 3OPZA 2A70A 3KSCA 3NJXA 5BNNC 1J58A 1QXRA 2DU0A 4PBOA 3ACFA 2WZ8A 1S4CA 2O14A 1I5ZA 4MGQA 2XMLA 5BNNB 2D98A 4CPBA 4M0NA 3EQEA 3Q8FA 1G9CA 1HQWA 4XETA 1ZA7A 2J1SA 2WFPA 2X5IB 5CVRA 5FZEA 1MEC2 3PTRB 4YG0A 1JODA 3ST7A 5C33A 2J22A 2WSUA 2WZR2 5I0TA 1QDOA 2CDPA 4CTEA 4GB31 4XW3A 4LQRA 5GM0A 5LZ6A 3OPWA 2BPA2 2E53A 4L0PA 4CDXA 1O3RA 5I0RA 2QJVA 3UV9A 2Q1MA 3VDCA 2Q8EA 2D97A 5DN2A 4E4HA 5FR3A 1MS8A 3DYPA 3PJYA 1BBT3 2WS93 3OGVA 3OYWB 1SLLA 2KD7A 4IE5A 1XOYA 4MYEA 4PCRA 2OPWA 1YIFA 3G6JB 2ID4A 2VUDA 3WF2A 3WG4A 3VDAA 1RHI1 2HJIA 3GJBA 2VUAA 2GNBA 3A4UA 2XLGA 1DGWA 1XNAA 2VTFA 3RMYA 4LK6A 1VB4A 2R49A 4Q1RA 1PNFA 5FP7A 3K75B 1CESA 1F5FA 4QXBA 3SHRA 1POV0 1JN2P 3UK9A 1LRHA 3AP7A 1S0FA 3J9SA 2HWF2 2Z79A 4XVHA 5F3CA 2R32A 3ZFFC 1AR73 2JD9A 2VMGA 5DG1A 1LENA 2QQUA 5T50A 4A6SA 3DKQA 1QJX3 4XFGA 3E6CC 3LFIA 5FZHA 3LE0A 1UPIA 1ZBE3 4UFJA 1RITA 5FXZA 1HLCA 1JYCA 1KJLA 3GHMA 4QM8A 4BCUA 2AUYA 1LR5A 1OFSA 5F5CA 1R092 1BKZA 1FPN3 4YNIA 1W06A 3LOIA 3HNMA 5FKCA 2X53S 4AI3A 1H9PA 4P9LA 5ACA3 4JQRA 3HNBM 4QGNA 3DXUA 2VMFA 3FLPA 4NAMA 1MQTA 2CDOA 4NRQA 2ZGLA 4TWTA 1GANA 2HWC2 1XBFA 2I45A 5K8SA 1GP6A 2VW1A 4OHYA 2OW4A 1GU3A 1RVF1 3WW1A 4IE0A 1VR3A 3O7OA 2FMDA 3WDTA 3TAYA 4CRQA 1OOPA 4QX5A 3LEMA 2VTXA 2DUPA 1OA3A 2W1WA 2XPJA 1QKQA 2GC1A 3MV11 4IESA 4IEWA 4META 4U36A 4P00B 3WF3A 1QJX1 4OQ8A 5BNPB 2WQZC 3B93A 3THDA 1MEC1 3N9QA 3M3EA 2VQAA 2CWSA 2Y33A 4LLFA 1RL3A 3KCXA 5F32A 3THTA 4PI2A 1CONA 1YJKA 2EXHA 3PJQA 3R4DB 4JTOA 2UWCA 5A7WA 1BMV1 3I59B 3N3HA 1Z0HA 3KQRA 1RUC2 4DIQA 4XCBA 2WQ4A 2XVLA 1B35A 3LF7A 5EYXA 4V2WA 4QHBA 4NIAA 1H0BA 5IUQA 4CXWA 2GNMA 2IC1A 5CFCC 2WS91 3FE5A 3L9JT 2J1TA 4YVWB 2VNRA 3GCXA 1CR7A 5FUIA 2VZPA 1UY2A 2RS32 1E57A 1GWMA 5ANQA 3ZMNA 4OI4A 3AL5A 4RR3B 3VBUB 3WUCA 5C3OA 2WNVA 2MEV2 1MS3A 4KL1A 1LOAA 3ES4A 5JIAA 1NKGA 4P9GA 4TYSA 4AFMA 4Z8BA 1AR71 2YC0A 4AEDA 5A3WA 2UYBA 1UU4A 1UKGA 2VZOA 4FT8A 3VHRA 2XLAA 5FV3A 4HVQA 3B00A 3ILRA 1NXMA 2BTVC 4ASKA 1JHJA 2FDHA 2XJSA 5TSWA 5KXCA 4JGZC 3HPNA 1H30A 3DL3A 5JVVA 4A3XA 2JG9A 5HXMA 4PDWB 5JI9A 1WMEA 2IXCA 2ZGKA 1DGRN 5FP4A 3CJIC 3WOGA 1XNDA 1N3PA 3ZXDA 1UOFA 3RNSA 3CU7A 4GXLA 3VUOA 3NJYA 3EXUA 4P9YA 1A6CA 5IYYA 2Z42A 4K20A 1WD4A 2IXLA 2RDNA 1Q8PA 1PZ8A 1J3PA 2DVAA 3I3DA 3PVBB 1EV12 2VM9A 3D82A 4UBGA 4N53C 1NA1A 2VZ1A 3ZR5A 3ZFEC 4BHPA 4LHKA 3I49A 3OEBA 1NOVA 3IKWA 1VAVA 5FIXA 4HKWA 4XABA 1CIWA 4XUPA 1OLRA 1OLMA 3I2HA 5DAVA 5DAPA 3WG1A 1PO22 5H9SA 4AI1A 1R083 3U75A 1PK6B 1A3KA 1W39A 2JG9B 1MS1A 4GKXA 4Y1YA 4R52A 5ABJA 3KT7A 1RUH2 3DUIA 5IVFA 5JSRA 1IPKA 2BGOA 2GH8A 1W9YA 1SFPA 5FMDA 4LIVA 3N9LA 5GLTA 1PO11 2HEVF 3LZZA 1ODMA 1E5HA 5LA9A 3KM5A 5KBFA 1YNAA 2XBO1 2PXJA 1AUYA 4FOQA 4HMZA 5FYBA 3OGRA 3C7GA 5GLVA 1WWYA 5FY9A 4FVVA 3RS6A 1SLIA 3AMNA 2HYXA 2OQ6A 3RJ2X 4AK3A 3OD0A 1TME1 2HLEA 1DCSA 1XXNA 2D6NA 1QJY1 4DINB 1YRZA 1MS5A 2NMOA 5K0UA 1HRV3 5IVCA 4XJZA 5CU1A 2G9GA 4HANA 3C7FA 2PHTA 2ARAA 4AVVA 4Q0PA 5A33B 4JTNA 2FBEA 4PBPA 5GLZA 1VE0A 5FK8A 5FLHA 3FL7A 4RGAA 3UGFA 3RZZA 1AYM1 3I3EA 3WP6A 4IV3B 4E2QA 5JPNB 5C9AB 1OLQA 3CZUA 5GZDA 2B39A 3SCHA 5EP9A 3P6BA 3PL0A 5DDJ2 2H0BA 5C71A 2OIIA 4Q4Y2 3KCYA 2JKXA 4P5HA 4DY3A 4WVVA 3KT1A 1I5PA 2YC2A 2XJTA 1COV1 1SLBA 2PLV2 1GWLA 2ZTNA 3DN7A 5LB6A 5FZAA 3NKGA 5AC91 5J7MA 3KGZA 3I8TA 5HV4A 2BBAA 1HB3A 4LPLA 1HXS3 1I6XA 3ZN5A 4RFT0 5C3SA 4D6RA 4E9KA 5A3MA 2RS12 1HN1A 3GZEA 4ET7A 4TXWA 3KB5A 3H1MA 3VKNA 4B4RA 3VBRB 4H14A 1ZBA1 2DBNA 2VMDA 4Q2FA 1ZX5A 3SCFA 4EWAA 3IAQA 4ZONA 1K5MC 1VBC3 3VBHA 3SLIA 2BV4A 1C28A 3AKRA 1ULPA 1D4M2 5DMYA 2X09A 4L92A 1XU2A 4GWMA 5FZFA 5C6CA 2JDUA 2VVEA 1W6OA 4B1LA 4BMEA 1WMFA 5LRSA 3BTXA 4O61A 2WA4A 3EYPA 5FXVA 1WCUA 1DIWA 1FV2A 2VXRA 4I3PA 4LA2A 4OHZA 4N8MA 2XBO3 2RS11 1YCIA 1RINA 3POBA 5DUXA 4CCCA 4UFMA 2DUOA 2R0HA 2YMZA 3HN3A 3WCSA 4QMAA 4PLOA 5ERLA 4MGYE 3BPZA 4QQHA 3WSOA 2W46A 2VCMA 4QX1A 1COV2 3RJRA 4BWOA 3POWA 3UKNA 4LBQD 5BNNA 4LHLA 1VPHA 4BA6A 4QQPA 5FXWA 4AEDB 4AVCA 2HYKA 1V00A 3I2IA 2A6ZA 2DTYA 2IVIB 3JQWA 3E6DA 2Z5WA 3RPQA 3ZFEA 3NJVA 2Q8DA 1X7NA 2JECA 1AYM2 1ND3C 2CAUA 2D44A 2YFZA 3DPRA 4I0BA 4IEOA 1UX7A 4Q0SA 4QU2A 3CQOA 4LO4B 2UY8A 3I3QA 1UYYA 3IIAA 4AGRA 4AE2A 4YSFA 3WDUA 4BLIA 2BBVA 4XTPA 1K5MB 2XXZA 3OEAA 5CKMA 4M3CA 5HV0A 5FMOL 4ARXA 1AL23 1W04A 4KGQA 2Z4FA 3S5QA 3JB8A 2ARCA 1VMHA 1PIV2 2YXSA 4YM1A 1WW6A 3H1YA 4NHXA 4UW4A 2ENRA 5FCCA 1TME2 2C5DA 3IWZA 2GNTA 4NROA 3FBMA 4NO4A 3DYMA 3HBZA 2VBPA 1BYHA 3CDZB 4YM2A 4BQ5A 4AQ6A 2J42A 2W3JA 4OQ9A 3T4VA 2WZPP 1TMF1 1RUF2 3WNNA 3ZYGA 4AOCA 4KBBA 3ZXJA 2XVGA 4BQ2A 1HN0A 4CP1A 1OPMA 1M4WA 3AKPA 3O14A 4CP0A 4K1YA 3CBNA 1CX4A 2ARBA 3SC7X 2ZCWA 1ND3A 3N9NA 4R4ZA 4N43A 5C9AC 1O6UA 4XILA 3ZYIB 1HX6A 4AFDA 1MPXA 1T6GC 2IUWA 3MW2A 2E51A 2VZVA 3BCWA 5KHGA 4LBQA 4C0BA 2C24A 3RI9A 3QACA 4L99A 4XXAA 1CAUA 2Y64A 1KDKA 1WUVA 5FO7B 4U2AA 2RMU2 1EV11 1W6MA 4QPIA 5L7OA 4EWDA 4AGVA 4COYA 2D43A 3AMMA 3PUHA 3UJQA 5B2GB 1RVF3 5EFUA 2BVVA 3AMPA 1R1A3 3H42B 1DZRA 1C5IA 1A34A 4FP2A 4KWKA 1AXYA 1ACCA 3VD3A 1W6NA 5I91A 5D8AB 4LOSA 2D5HA 2XJUA 3VBOA 3QCWA 1VIWB 5GZGA 4JRAA 4FPHA 3CF6E 2AEYA 2YU2A 3HAGA 1C57A 5C3RA 3MDPA 2C6SA 1OPOA 3INAA 4W6XA 3IPVB 5AC93 3ASIA 3MW4A 1ZBE1 2ARXA 2QQMA 2I07B 2O8QA 4YZ5A 1XNKA 1S0IA 4N9HA 1OFNA 1RUD3 1Q8VA 2P34A 2R1DA 2PYTA 1NT0A 3J8F3 5CB7A 4FFGA 4GA9A 5LY2A 2BGCA 4YVSC 4EN9B 2WNVB 1H2LA 4FPJA 4DY5A 2MEV1 3MLKA 1JHNA 2Q8OA 3K48A 5KHHA 3GHNA 2XDVA 3RYPA 1L3JA 5B4XA 1H2NA 4MUVA 3BALA 1DF0A 2VBBA 4RS5C 4AVAA 1CVNA 2CTVA 3BODA 2WINB 4CUGA 2Y6HA 1W6MB 2DV9A 3CMGA 4OI1A 1IPSA 1PZ9A 2Y34A 3KHBA 3N7KA 4OUEA 4NVPA 2D5FA 2VOTA 2VQ0A 4IE4A 2RS51 3ZR6A 1CAXA 1KQRA 1QF3A 2J1RA 2MNGA 3TWIA 5B4NA 1IG0A 4CEYC 4BISA 3JD73 4Y5SA 3LIHA 1LNSA 1BMV2 1AJKA 1NCRB 4KU7A 5C3PA 4FPOB 4CCMA 1IQDC 2YGLA 4HETA 1DYPA 5JWPA 4PDWA 1V6NA 1UZ0A 3U11A 2ORXA 1W8HA 3I4IA 1LOEA 1RMU2 3SCGA 4E8CA 4F83A 3TRSB 5A3TA 1US3A 5E1RA 1DLCA 2WFF2 3RI8A 3T2PA 5IAVA 1VJ2A 2OXBA 4A44A 1KJRA 4LA3A 4FOVA 4TLFA 1J3QA 1W9FA 3GF6A 4XAAA 2WO7A 3WNLA 2NQYA 5C4WB 3EMRA 4R9AA 2VH9A 4OFGA 4DRRA 1LU1A 3KV6A 3K77A 4K21A 2HWC1 3OBAA 3A0KA 2W5FA 3HNYM 4QX0A 4DXTA 4PIYA 4XFHA 2P5BA 3LWCA 5C5UA 3WW3A 1QXPA 2FCTA 1PGL1 1BK1A 4XEZA 2ETEA 3J26N 4NOTA 4OI2A 4IEZA 5FO8B 4P9IA 1VRH1 5FZBA 3RRDA 2FCVA 1R091 1XYPA 3KV5A 3E1F1 4AQTA 4YGEA 2W52A 1CGPA 4SLIA 3MYXA 2WBKA 2A3XA 4B29A 2ZPXA 4D7TA 2HWE3 3AP5A 4GWJA 1AVBA 1S2EA 2GMEA 4A7KA 1RUE1 1ASJ1 1E5RA 1H1IA 2QVSB 4GJZA 4YG6A 3TYJA 4C1WA 3LQCA 1GMMA 1BLZA 3E5QA 4XUNA 3ZPYA 5BNOC 4BK4A 3R6SA 2SBAA 2WZR3 1GZWA 3OUIA 4IE6A 4NRPA 5GLWA 2WAAA 2QQPA 3D8CA 2FDKA 4EN7B 3WNPA 3O1OA 4N43C 1WW4A 3WF1A 3FWEA 3KVAA 4AI9A 4MH0E 2ES3A 4CUAA 1MZFA 1UY0A 3LA7A 1AJOA 4JX0A 3S30A 1X9PA 4ES8A 1WW7A 1I1EA 3JD71 3A21A 1VRH2 5AVAA 2HBUA 2ZEZA 3GNEA 3M8LA 4XBNA 1W2UA 4CUCA 5J37A 2VNGA 2WA3A 3UL2A 4BK5A 4QU1A 2W2IA 1OBNA 2R1BA 5EJ1B 4AG4A 4OVEA 1UD1A 3ZOIA 5FJHA 2RG4A 1ENRA 3ZSJA 3ZYPA 1TNRA 2OPKA 4YYOA 3LPFA 1K12A 2ET1A 4GMP1 1O8PA 4RHV3 5CIRA 1J1TA 2D93A 5EIYB 4OMDA 2GP3A 1YYNA 1FPN1 4RYDA 4FOWA 3M3IA 4XHXA 1EY2A 1NE6A 2WWUA 4R8HA 4MGKE 3ATGA 3PUQA 2WYFA 1DQ1A 4Q4V1 1VBA3 4HL0A 4LEJA 4RS5A 3T30A 1F4HA 2W08A 3OUHA 1LHOA 2D6KA 3J8F1 1LECA 4FPLA 4HLTA 4Y26A 4AWDA 4LR4A 2WNVC 2E6VA 4WM8A 4FFIA 1V9U3 2OUHA 3ZDVA 2ZGMA 3CL1A 5A7SA 2D7FA 2XUMA 4YGBA 4WZFA 3VHNA 2UU8A 4BMBA 5A32B 4QHOA 4OHXA 3O5SA 4QQ2A 5FZ4A 1RIRA 1TEIA 3BU7A 2VXJA 2QZ2A 1UAIA 3ITQA 3QOPA 2WN3A 4PJYA 1QNWA 1WMDA 2PAMA 3I3BA 2R6QA 5EHDA 4RGGA 4GD4A 2Y6JA 4YLZA 4D8MA 3KHCA 2D6MA 1V6OA 1WA6X 3O1TA 1RB8G 2HWC3 2BU9A 3ILFA 2VGDA 5FYHA 4WVWA 1J84A 1EUTA 4M0HA 4C1XA 5CNAA 1PO13 3M7AA 2RJLA 4AAPA 5I8YA 3J7MA 3T2TA 3G7DA 4COUA 1P8JA 3SH3A 2ZX3A 1V6IA 4B8EA 1U0AA 2DVGA 5HXVA 1ZVFA 3VKOA 4N7IA 3S7IA 4URAA 1HW5A 1ULEA 5LA0A 3ZSKA 3POSA 1SLTA 1FNYA 4XQWA 5F2WA 1AX0A 2FZ2A 2WUHA 4BQXA 2WO3A 4YW4A 3V0BB 4JVAA 1ASJ3 1F9KA 1VBB2 1MVQA 2A71A 2YC4A 3PVEA 3UETA 3DECA 3W5MA 5FRAA 3BN6A 3OF1A 3ZYBA 2A7AA 4W6YA 4I01A 3D3AA 3HJRA 3LDBA 4B7KA 1TMF3 3IDCB 1W8NA 3AP9A 4QDSA 3D6EA 3FMGA 1H4GA 3RZMA 5GKAC 5F39A 3QLQA 2Y6LA 3VKLA 1JZ8A 3ACIA 1X36A 3WF4A 2P2KA 4PDWC 4R9DA 4IETA 3RZHA 3C7HA 1AHSA 1QQP3 3IMNA 4ATFA 3SMHA 1MS4A 1NUKA 4DXRA 1GP4A 4O9GA 4Y20A 3BIEA 1RUNA 1RUJ2 3OOXA 2BWAA 3DKWA 3HD8B 4YVWA 3RFRA 2RMU1 3KMHA 4QXHA 4KU8A 4YPJA 2WZEA 1W2NA 3DPRB 3URFA 5A32A 3WNXA 1CAWB 2V4VA 2ADEA 5JZGB 2PQQA 5FZ7A 5FPAA 4NPRA 1JOBA 5APAA 3VBUC 2VPVA 4K1ZA 5K4LA 1S2KA 3WZ1A 2C9AA 3BTAA 4LBQB 5H9PA 1B09A 1UCXA 3ZXAC 2XHKA 4V1PA 4XDOA 4XFIA 2HWD3 1RUG1 4HXCA 4Y4YA 1RJ7A 2NP0A 1ZNPA 5F5AA 4K3UA 4XIOA 4Q8KA 3NNJA 4Y4RA 4LXLA 1NY72 3WDYA 1HB4A 3JCIA 5FWJA 2D6LX 1AR62 4HONA 4GWNA 4QKNA 1RUF1 3JZVA 2XG3A 4BIFA 1JH5A 1WD3A 1ZRIA 5DZFA 4F7ZA 1UZVA 1GQPA 2ZA9A 1AR92 2W0XA 1W8OA 2WAOA 2WNEA 2TUNA 5DG2A 1RUI2 1FV3A 4OYUA 4YZ2A 3BYWA 4CDUC 1PIV1 4RN5A 4WVZA 4G4FA 3TEXA 3VKFC 1DZTA 2P6CA 2VULA 4CZSA 3NV4A 5LASA 3QD6A 1A8MA 1G9FA 4Q4X2 2VY0A 3T2QA 1HV1A 4M01A 4WM7B 1YJLA 2A6XA 2JDYA 1C8M2 1JMUB 2CGNA 1QJY3 4XHBA 3RSJA 5CA6A 1FOD3 4QPIC 5IFTA 4LBNA 3DXTA 2PHUA 2YG0A 1A8DA 4CEWC 1QJZA 2UWAA 3H8RA 4A41A 5EWSA 3LEGA 1O8SA 2ZS6B 4C0HA 3HBKA 4DUVA 4OUSA 4JQTA 3I3MA 2B7YA 3JBG1 4UW5A 3CIHA 2B45X 3W20A 4D94A 2EVXA 2R062 1BEV1 1IQAA 2BP6A 4MLOA 4N53A 5FLIA 4Q1PA 4QAWA 1LOBA 2VU9A 1V6LA 2HEYF 3TN91 5FYUA 5LWBA 1CZVA 4HK8A 3KF3A 3V56A 5A1AA 5J48A 1N3QA 5CKQA 2TEPA 4MXVA 1OQDA 1R1A1 3SISA 3FN9A 1ENXA 3ZFGA 2GNDA 3APBA 4NIHA 1HRV2 5K0UB 4M4PA 4YM0A 4TZDA 1HRV1 4FTBA 1OC1A 1VAMA 2JDNA 1W6OB 1H6YA 2QQKA 2UURA 2WABA 4Y22B 1OLME 4K7JA 1R64A 2YB7A 1RHI3 4J1WA 1S0JA 2EA7A 1W6PA 1ZBA2 2R073 4A6OA 4L11A 5JPMB 2VCBA 1JZ3A 1LOCA 5ISLA 5FP3A 1B35C 1GQGA 4TN7A 1D2SA 2IVJA 2ILMA 4I0AA 1JZ4A 1SFNA 3N7JA 1BEV2 2VOWA 2ZGPA 2IXJA 5C3QA 3JBG2 4MO3M 5HCAA 2LRPA 3WVJA 5CG9A 3MIEA 3DPRC 3P3NA 4QB6A 5FYYA 3PIGA 5IAXA 5BNPA 3HWJA 1CN1A 3WNMA 3O0XA 2HBTA 2J1VA 2PFWA 3WNKA 1ZA4A 1TNFA 4KGGA 2BERA 5DDJ1 5FZLA 4F3JA 1GZCA 1WKYA 4LT5A 1MZEA 4JAAA 3F95A 1PM7A 5JMCA 5DUUA 2VUJA 4NN0A 1DQ5A 2CU5A 4Q29A 4RQPB 1W0OA 5KHKA 4H3WA 1SBDA 3AMHA 5FMBA 1NE4A 2GC3A 5F5QA 5C7GA 3PUAA 2DCTA 3IMMA 4ATEA 1UQXA 2DFBA 1WLTA 2G9FA 1X33A 5CEHA 3VBHB 5FPXA 2D3PA 1ZYBA 3ZYJB 3ZYRA 1LHVA 1FMD2 4Y24A 5FTTC 3UYJA 1GNZA 2X5IC 4AHWA 2NZ9A 3O1PA 5JOXA 2B8MA 1VBC1 4QKDA 1HB2A 1OQ1A 1RUI1 2DCYA 5T5JA 2VJXA 3LSDA 3W9AA 5JUVA 1QJU1 4QHZA 3K2OA 1GZWB 1UYZA 5DZEA 5EZWA 4DEVA 3SKJE 5C8CC 3POFA 2XBO2 1YEWA 3DCQA 1BCXA 1IHMA 1PM4A 3GALA 1GLHA 3VBHC 4N7UA 3JXSA 1SDDB 3AYDA 1QJEA 3CKHA 1L7LA 1OMIA 2ADDA 2PAEA 4EN8B 1H8TB 3AM2A 4KG0A 2ZHKA 1EPWA 1QNYA 3VN4A 1K42A 1DGWX 5FXXA 3LOBA 2P37A 1D2QA 2A3WA 3PTYA 1ENQA 1ULFA 4XUTA 4JGYA 3ZX7A 4TTGA 4YW1A 2HH9A 4OLLA 4I3GA 2BWCA 4A42A 4Q4W3 4HOOA 5GZCA 3VDDC 4BYYA 4RR3C 4RHV1 2QBXA 4JKLA 1AL22 1OI6A 2E31A 4CDWA 2A5ZA 1GZ9A 3J4UH 1EP0A 2W1QA 3OBTA 2EICA 4YVWC 2PHLA 2VMIA 3ZIXA 2A75A 3B9CA 1S2BA 4CP9A 2CYFA 1GP5A 4B4QA 2JXAA 5A6ZA 1KXGA 2BW8A 1U12A 2JEMA 2RJ2A 4XJWA 1ALYA 3SH5A 4ES9A 3NV2A 4PIZA 2EXKA 1V9U1 4FTEA 4BQWA 2J1EA 3AKTA 5CFDB 4LE3A 2C0ZA 1C3HA 1PK6A 1REEA 1W03A 2JDAA 2Y8KA 1EUUA 2D40A 3AJZA 3FZ3A 2F6BA 1UXZA 5FZOA 3UT0A 1AR72 2WWSA 4LULA 4B3NA 1DQ4A 1OA2A 1GKBA 2G9ZA 3AL6A 4BM8A 1G7YA 1OSGA 4CUBA 3NKTA 4BDVB 1W6PB 1CPNA 1PGW1 4GALA 3DV8A 2GN7A 2HWB3 1KDMA 5HCHA 1CIYA 1AYN1 4QX3A 2JWPA 1Y43B 1UYPA 1EV13 1FAYA 4MXWB 5GZEA 1W05A 2RS31 3OCPA 2BEOA 3FX3A 5G05L 4XFCA 3WG2A 1F8VA 2KR2A 3KF5A 1AYN3 1SCSA 3P3PA 4ZXEA 4G3YC 4P08A 1JYVA 1Q8QA 3HN1A 1URXA 5FFOC 1LTEA 2VNVA 1S0GA 3PNAA 4QXKA 4WBBA 3QBQA 3RQ0A 2AGSA 4PT6A 2Q8CA 5E16A 1HRI3 3KZ4C 3T08A 1U5YA 3VDDA 2Y0IA 4QB1A 2KA3A 1O4ZA 1VBE2 4MVTA 1CAUB 1WMXA 5K9YA 1W8WA 1O5UA 2I74A 3LCPA 4AFCA 1LOGA 3VD9A 1PZ7A 1WLDA 1RUG3 2HWD1 2E33A 2JG8A 3PU8A 4I0WB 1H9WA 1PHMA 2D3RA 3BU0A 5SV8A 3IPVA 2VL4A 4BQ4A 4JDNA 5A70A 1BZWA 4CA9A 4CCKA 3VZNA 5A3PA 3ZSEA 3ZN4A 4CDQB 1W6QB 4CCLA 4A4AA 2RV9A 4LIUA 5A3NA 5FBZA 4CCNA 4DPNA 3J8F2 4CYDA 1DG6A 2V72A 1XRUA 1NG0A 1BVVA 1Q43A 3AFGA 3GZTB 3K51A 4HKOA 4RR3A 1ND2B 1R081 2EAAA 1XJAA 2BUKA 2IXHA 4ZS2A 4LBJA 1STMA 3T0BA 3UJOA 1OKQA 4XIKA 1GNHA 3AXEA 3I2JA 2EIDA 3H7YA 2QQNA 1PVXA 3E97A 3OBZA 4CP9B 3O1VA 2YROA 4LKEA 3HIFA 4Y20B 2GZWA 1EAH2 5C8CA 2X05A 4AEDC 3N7MA 5BYNA 2C26A 4I30A 3ORJA 3OY8A 1DGRA 4PF5A 1H1AA 4AFAA 5IVVA 1FYUA 1QGLA 4NAOA 1F4AA 4L97A 4Q4Y3 4LITA 3UKTA 5LEKA 4QX7A 2BFUL 1QH7A 4W4ZA 1XE0A 4AEMA 2OUJA 3JD72 4COVA 5BNOA 2PLV3 5FJKA 4XF9A 2KXLA 2RJKA 1QOOA 1ZZBA 4D69A 3O1UA 3F2ZA 3AB0A 1NYWA 1IPJA 4RL7A 4JCKA 4UW3A 4AGGA 1YFWA 3LPGA 2VE1A 1O91A 1H2KA 2D6OX 4GB33 2A3YA 2K9ZA 5JMOA 2OVUA 5E8AA 1CX1A 1GFF2 1LGBA 2XLFA 2A6WA 2VO5A 1D7PM 4UFHA 4NWVA 1POV3 3NO8A 4NHKA 5FYZA 2Q5TA 3T3YA 1SCRA 3J7HA 1RUE2 1Z7S3 4J6GA 4OCTA 2R7EB 5LY1A 2WO2A 3H1WA 4JC1A 1EYBA 1N1YA 3AZZA 4ISRA 5IWFA 4IV3A 2AZ5A 1JTZX 5EYYA 2GH2A 3E5XA 4XUOA 4Z82A 3MPPG 5FPLA 4ASMB 1Q3EA 4GJYA 4BZ4A 4AEJA 1YXWA 1K5MA 2ZAHA 3A0NA 1N1VA 3Q8AA 4IEUA 3NVCA 4W6WA 4KG8A 3USUB 1SZBA 3V0BA 1PGL2 5FY8A 4JGYB 1U5XA 3JUUA 4DRVA 4E2GA 4XBLA 1BK0A 2RM21 2KM2A 4O9EA 3NMBA 2JDZA 1YWKA 4H7LA 4XJUA 4OMCA 2LTNA 5HCBA 2W91A 3W21A 3ACGA 4YW6A 3ZMOA 2DVBA 1W28A 4PI0A 3AYCA 5A6XA 3POYA 3IM0A 4R9CA 3HR9A 2FDJA 1E5IA 2HWB1 3HVDA 5E6HA 5FZIA 2YBPA 1JYWA 2ZGTA 4DB5A 1G6NA 1PO23 4DXZA 1U5ZA 4RS5B 3TEYA 4JGYC 5FZGA 2WZR1 1MEC3 4Y1VA 3FLTA 2WFF1 1SBFA 3S7EA 1UOJA 2YFUA 3T2OA 1D0GA 1KS4A 1RUH3 5FOBB 2EXJA 3AZVA 4K8FA 3FLRA 1E5SA 4XQ4A 1OT5A 5FUNA 4FPYA 3VZLA 3ROUA 3ZVXA 1JYIA 4GH4C 3S5AA 5J36A 3NJZA 1VBD1 1RC6A 1Q56A 1Z78A 3O1SA 1GWKA 1UMZA 3U37A 2QTWB 1QDCA 2NMNA 4UAPA 3CLPA 1JYNA 5LK7B 1APNA 1QHDA 2B4KA 4K6BA 2RDRA 1A78A 3POEA 3FUOA 3I2DA 4RQPA 5FPBA 4UF0A 1BXHA 2QFEA 3MO4A 5IW0A 3K4AA 2Z69A 3BGAA 5F3IA 4YVSA 4HT1T 4FQZA 1I9RA 4YFWA 2DCZA 1H8TC 2VVFA 2ZX0A 4MV2A 5FMOS 5T5LA 5CZKA 2VC9A 5LRRA 1XNBA 4NR1A 2BYVE 3DF0A 2WJSA 2HWF3 1OH4A 4AYUA 3DYOA 5CAZA 2CGOA 4XACA 1DQ6A 1WZXA 3ZPOA 4N53B 1H1MA 4Q4V3 1POV1 1JZ2A 1XSRA 4D3WA 1WLWA 3PLQA 3ZLIA 4COWA 2ATFA 4E27A 1H6XA 3WXPA 4FCAA 4A3ZA 2ZGUA 2WWJA 3MUY1 1LOFC 4DS0A 1HQLA 3LDRA 1NZIA 1ZBE2 5CISA 4P14A 5FKBA 2H6CA 3PMSA 4IEQA 3TB0A 1WCDJ 2RMU3 1IKPA 2B46X 1JI6A 1LULA 5FZ9A 4AVTA 3AYAA 3OSDA 1QJFA 5ACA2 1NCQC 2WLPA 3MBWA 1ND2C 2VD7A 4N9IA 1XE8A 4AEKA 5FYSA 1QJU3 4GZ9A 2WLQA 3ZFGB 4JGZB 2YU1A 4Y1ZA 5JSPA 3VDBA 2Y60A 1JOJA 3MI8A 4LK7A 4X8PA 4BQ3A 4IGPA 5IVBA 5EV7A 3I97A 3OY8B 3B69A 3WLUA 3FJSA 1D4M3 2QQLA 3GZUC 2K0GA 2VOXA 4IV1B 4UOJA 1VLNA 3LKJA 2AR6A 2E63A 4QKBA 2DVDA 3CJXA 4LBOA 4BU2A 3NV1A 4AF9A 4QPGB 1W9WA 2NLRA 4HZFA 1DQ0A 1YUDA 5JXJA 1RUD2 5JCTA 4CDXB 3ZFGC 4GH4A 3FHAA 1W99A 5FZOB 3FUQA 3VBFC 2QKDA 2PELA 1SDWA 2QE3A 3WP3A 4FI9A 3WQ1A 2JICA 3KD4A 4Y33A 3CJIA 2JB4A 3MW3A 5FUPA 3J7LA 2BRTA 1O3TA 2NYYA 1QIQA 1MS0A 3LGRA 4XTMA 3RVHA 5FZDA 5T52A 2A6VA 4OHWA 3HQUA 5BNQA 3ZYHA 1UU6A 4JKMA 2QDRA 3KWVA 5BPXA 1QU0A 5JXGA 4WM7A 3IDBB 2WKKA 1SG3A 2C9KA 5K0UC 4YGCA 3W58A 2XL7A 1TMF2 3A23A 3D0SA 2RM22 3LA3A 1MR5A 1O4TA 2UWBA 3Q8BA 4FPCA 3VZKA 4P9JA 1XYOA 5IK7A 3MIFA 5HPOA 1CAVA 5D8AA 4DQAA 3PU3A 3WV6A 2VR4A 2XGXA 1AR83 3PUSA 4XBQA 2RS33 3M4FA 2D3SA 4QPWA 1F5JA 4YZ4A 5LATA 5J1XA 2FDIA 1S0DA 1W9TA 4NRMA 3ETPA 3NRUA 3VKMA 1T2XA 3AZWA 3GGLA 2XH6A 4LOTA 2GC2A 1GYKA 1J1LA 3WEZA 4CEYB 2JIJA 3D0JA 2G4IA 2LUWA 1XB9A 2WFF3 2PAKA 3ZIWA 3TN93 5LBEA 5FP9A 2W87A 2OX0A 1RTVA 4EWEA 2EF6A 4BPZA 1XNCA 2UYAA 3EO6A 4XJ8A 3KCCA 1XSQA 2BFUS 2YDEA 3N4MA 4B4PA 1VMJA 1UZYA 2DYCA 2VMEA 2E26A 3O12A 5AVPA 4NHMA 3WQ7A 4AHXA 3VD7A 1KRIA 1UN1A 2JE9A 2RS53 2XQXA 5FZCA 2IWGB 1W0PA 1HV0A 1OQEA 3WHTA 3KGLA 4QKFA 1OF4A 1JOPA 4JDMA 1LCLA 1UL9A 4MGIE 5A3LA 3TOJA 2JX9A 3S57A 5FWEA 1CAVB 1VBD3 2ZMLA 4IDZA 4RGKA 5HI0A 5KR7A 5EXOA 4QGLA 3M2MA 4QQOA 4AVSA 1HB1A 4UT5A 2LW8A 1PVC2 2QDNA 4YZ3A 2A6YA 2VZ3A 3TBDA 1R082 2XWJB 1LEMA 1DYKA 3PUIA 1UX6A 1HIXA 1W2AX 1WBFA 5JOWA 1UOBA 3WD5A 4EQVA 4MOAA 4HSJA 4MADA 1K3IA 1PMJX 1O3SA 4WZCA 2CWMA 3RYKA 1CWPA 2XOMA 1GQHA 2HWE1 1SLCA 1ST8A 2ZEXA 4A2UA 1YFUA 3B02A 4Q27A 5AC92 1IS5A 1VRH3 3ALQA 2WNUC 3WHUA 3U4SA 3ZXLA 5I8TA 2BNOA 2BNNA 1GUIA 4MGTA 4Q4Y1 3WP5A 5L36A 2ZZQA 1DU3D 2E7AA 3LEIA 1GNYA 2DFCA 5H9QA 4GQ7A 1US2A 4QPYA 3E5UA 1MVEA 3IDEA 4Z92B 4XF4A 2V5DA 4DUWA 2ZGOA 2QQVA 2JG8C 1IG3A
chains in the Genus database with same CATH topology
4M3CB 4FPKA 1MQTB 5H9RA 4XMIA 4IEYA 1S0CA 4JRLA 4E2SA 3WR0A 2DF7A 4AQSA 1ZRDA 3M3CA 1X8EA 4CDXC 3VL9A 3ZFEB 3USSA 1LGNA 5KXBA 3MLLA 1S1AA 5DDJ3 3FC0A 2R041 1FT9A 4IV1C 4EJRA 1DZQA 4ITCA 3ELNA 1V9U2 1V70A 1HXS1 4IQPA 1LEDA 3MF6A 3CJIB 1DHKB 2DU1A 1R093 1TQ5A 3ZSMA 1FXZA 1KD7A 3V64A 4EN6B 5D1IA 5JIUA 1IKQA 3S0MA 4CDQC 3BB6A 1C5HA 4D7SA 1NA1C 2D6PA 2CGPA 3SXWA 2JJ6A 2R071 1VP6A 3VZOA 1PO21 2W68A 3ZXEA 1AL21 3AFKA 1DFQA 4OI0A 4YW3A 2V5YA 4LLOA 1F31A 3FFQA 4QM9A 2ZZJA 4AW7A 1BJQA 4DNYA 1GBGA 2RR12 4WM8C 3VZJA 2CNAA 5E88A 2H0VA 3WX5A 2FMYA 4GIQA 3VZMA 4F8AA 3B94A 3OTFA 3AMQA 4INDA 4FPEA 4A7YA 5J98B 2ZHMA 4Z07A 4QT6A 4BE3A 2JENA 1SMVA 2ZGNA 3AYEA 5FQ0A 5FQ0B 3ES1A 1N1TA 1COV3 2Y0OA 1XYNA 2BVBA 4LBLA 2R042 2ZKLA 1O5LA 5J3UA 5CFDC 3VDDB 3DGTA 1GSLA 3JQXA 1AYM3 1W6NB 1FMD1 3V0BB 1BVP1 4CP2A 5JOZA 1QH6A 1LHUA 1OA4A 3H50A 1H4HA 1NA1B 2MEV3 2WS92 1I3HA 4CEWB 3ACLA 1OD5A 1TME3 5IK4A 3ME2A 1SLAA 3VBRA 2WIIB 3ZFFB 3THPA 2IXKA 3H3ZA 4LUMA 1OHFA 2BQPA 4AHZA 3N7LA 3T1MA 2HEWF 3KLSA 3S6PA 1ZZ8A 1NCRA 3GYDA 3MFCA 2R30A 1OOPC 1QMJA 2PHWA 5I93A 2B9UA 5FREA 1QJX2 4ZKTB 1EPZA 1JW6A 4PQ9A 4Q26A 5JZGA 1PVC1 2EAKA 1MQTC 3RMXA 5A33A 3AP6A 4LBMA 4FXKB 4Q4X3 3VBUA 3H8UA 1AR81 3NSTA 4LUKA 1RVF2 5C8CB 3LB9A 1X50A 1R1A2 2QNKA 2P3IA 1ZREA 4XFBA 1S0BA 3VHRA 2VECA 2JG9C 1KFXL 2ZABA 3AKSA 4FAHA 3H9AA 5JAXA 1NXD1 1UIKA 3BOPA 4JDOA 5GJ6A 3PMEA 2CY6A 1LU2A 3NAPA 5AFBA 4BQ1A 2R0FA 3B9IA 3LSEA 4LO5B 1AL0G 4OULA 4UXAA 4UBHA 2XJVA 1GICA 4HFSA 4GKYA 1VB2A 1QY4A 4Q0UA 4YW2A 4YRDA 1YI9A 2DCJA 1IS6A 4CEYA 4XYXA 1QWRA 2GMMA 1C8M1 2PHDA 2HWF1 2E9QA 4AQ2A 5T54A 1HKDA 4IXLA 1CD3G 4X6QB 1ZRCA 2PHRA 4Q4X1 1SBEA 3ZFFA 1N1SA 3NW4A 1DLLA 1V6KA 5GLUA 1OOPB 1WCSA 1YFXA 3MIBA 3R05A 2V09A 2ZBJA 2YPJA 1RHI2 3LAGA 1AR91 4S2HA 1O3QA 1LOFA 2Y26A 1NQJA 1LODA 3VHPA 4XZPA 1N3OA 1NY71 4E4ZA 5CADA 5J09A 3VL8A 5L19A 4YW5A 5AFEA 1Q5OA 4LHNA 1JUIA 3MPBA 1HDKA 1J3RA 4YARA 4ZU4A 3WDXA 4GB32 3WW2A 1NLRA 5FDBA 1SQ4A 3GBFA 5EJ3A 1RUD1 4Z2WA 1LKNA 1O4YA 3PVOA 4HPKB 5SV5A 2RE9A 3NAPB 4CDUB 1AXZA 1YI7A 3WY6A 3VBSB 2JKBA 2W39A 2XWBB 4K40A 5FAXA 2LM3A 2R16A 4XFAA 4FOYA 1O7FA 3UKVA 3EHKA 2ZX2A 2WNUA 2EIGA 3M3QA 4WM7C 3HT2A 3WQ0A 3Q9OA 4Q8LA 3C3VA 2ZACA 3OYWA 1DDLA 4FQ4A 1RJ8A 3D4KA 4WM8B 2AH2A 4Q4W1 3L2HA 1REDA 4LE4A 4WVMA 1VBB1 3N35A 3D5OA 2VOVA 5JZGC 2CV6A 2TNFA 5BUVA 1Y3TA 3OBRA 2UY9A 5I0UA 1R1ZA 2O8OA 4D7YA 1XE7A 3WP4A 1MZ6A 4KWJA 5GZFA 2VOKA 1GV9A 4Q4W2 1AXKA 4G9SB 5CFCA 3U4XA 2Y38A 5K7PA 4W65A 1BBT2 1D4VB 1PIV3 3U10A 1QQP1 4EROA 1AF9A 2XJPA 4QGMA 5T5PA 3I7DA 3EJKA 2VG9A 4FPGA 4XF0A 1RUF3 3QH6A 4DOUA 3USUA 3OGJA 3RG0A 2XKPA 1NLSA 4BIOA 4HVOA 5ABJC 2YYOA 1ENSA 1FNZA 4CDUA 1IOAA 1ULCA 4Q0VA 1HQNA 4XF1A 1LGCA 3FHIB 5T3NA 3RWNA 3E6BA 3CNAA 4Q4V2 4HBNA 2OYZA 3ZXGA 5CBLA 2JG8B 2HWB2 1CPMA 2A73B 1BEV3 4GULA 3C2UA 4OHVA 2WT0A 4RQPC 1FPN2 4TSVA 4YGDA 1ZRFA 2YV8A 4BH9A 3W59A 3V0AB 2QCSB 2WNUB 1CJPA 1HRI1 4N90A 4ISQA 2PTMA 4XE9A 4XJ9A 2RS13 5KHIA 4XJAA 1WA4A 3BIWE 3VBSA 5F1RA 3MIDA 5L73A 4I09A 1WGPA 1RGSA 5BY5A 4LO7A 1B35B 3ZSLA 3R4UA 2DURA 2XKOA 5BXXA 1G86A 5CFCB 1FMD3 4OUMA 3ZXKA 3R4SA 5CG8A 2WT2A 3H0OA 3OGGA 4M00A 1ND2A 2V73A 2MHFA 1ASJ2 1VBB3 3U07A 3MEPA 1DQ2A 1VBA1 4LTAA 2CL2A 2VW2A 4P9WA 4CDQA 1H8VA 1FATA 3IBMA 3CEWA 4NHLA 2B42B 4LO8A 3M70A 1RUC3 3LA2A 4GMP3 3OD4A 2VNOA 4CEWA 2O0OA 4FPFA 4IV1A 5JI7A 1M06G 1GR3A 2QZ3A 4DFSA 2ZMNA 1WCKA 2DWRA 2VVDA 2XJQA 2GAUA 4H55A 2ZX4A 4AXOA 3GBGA 1XQNA 3HMYA 1EAH1 3WG3A 1AR82 4E4DX 1PNGA 2DTWA 4ZU7A 4XDQA 4QPIB 3ZXFA 3V65A 1N47A 5FO9B 3V0AA 5E89A 1H2MA 2XJRA 1ZZ6A 2N7GA 3EBRA 3MLJA 1W6QA 3HT1A 4YFZA 1V6MA 3N36A 3I59A 4OZXA 4XPVA 3MF9A 2ZAAA 2TBVA 4FO9A 3M1HA 1RMU1 1H8TA 4L9BA 3X29B 3VV1A 3ZN6A 1F2NA 3ILNA 4QQLA 2HWD2 4A7ZA 3WDWA 1AX1A 4N43B 4IERA 3BOWA 4XMAA 5KXDA 3VBOB 1VBE1 2ZMKA 5BNOB 4Y5Z0 1AR93 2E7QA 2RS52 3MICA 4URTA 1XU1A 2DCKA 3MIGA 1RUI3 1CAXB 4S2DA 2IXIA 5F9TA 4S2FA 4MX3A 5L7OB 2I2SA 1FI2A 3WT3A 4AVBA 5KXEA 2ZHNA 4P9XA 3VGIA 1WLCA 3VBFB 1DGLA 3HQXA 3AJYA 1AYN2 4DMIA 3GZAA 4JGZA 1PGW2 1FOD2 2PHXA 1Z7S1 5F6LB 1UU5A 1SFYA 2GDFA 2XVKA 3MFAA 3AX4A 1LJ7A 1WW5A 2Q0AA 3MIHA 1S0EA 4QD2A 2ZHLA 4C91A 5C4WC 3ZN6B 1PGSA 3MZHA 2H6BA 1FX5A 2X5IA 4HVRA 1Y9QA 1IZ3A 2F4PA 4I02A 2YY1A 1KITA 2GSYA 2R063 1NCQB 1CAWA 2EALA 1YIPA 4K9SA 4CDWB 5JLVA 1ZZ9A 3WCRA 2RR11 3IT8A 1CJDA 3KS7A 4WV8A 1YHFA 4ASLA 4E4SA 1UKRA 4RHV2 4HSLA 5DXDA 1JBCA 1CQ9A 4LBKA 1QXJA 1VALA 2YZ4A 3VBOC 5IK5A 2XL9A 2GMPA 3ZDSA 5J96B 4J1XA 1QOSA 1ZBA3 2R072 5C4WA 4HPKA 3ENRA 2IFWA 2E7TA 1LB2A 5L7OC 4X6RB 1ONAA 5FPZA 2P3KA 4EV0A 3AZXA 1X8MA 4ORFA 3M3OA 5CFDA 4KNCA 1ULGA 5KHJA 1HXS2 1YFYA 3TNQA 4HKLA 4Q0QA 4Z1VA 1C1FA 1ZRRA 1RMU3 4GH4B 4XF3A 4YVSB 4AI0A 3VBSC 3U0ZA 1AX2A 1QJU2 1NQDA 2ZKNA 1UF2C 5LK5A 1VBC2 1RUE3 1Z7S2 1FOD1 1X82A 1IS3A 2ZOEB 3MGUA 4FXGB 4RSUA 1BQPA 3B3QE 3O0VA 2OZ6A 4E2QA 1WBLA 2VW0A 3OJBA 4H7MA 1ULDA 1V6JA 3VLBB 4DZGA 4RA0A 4JV4A 2YHJA 4KWLA 1ZM1A 4ZU5A 3PHMA 5LEJA 4YM3A 2PA7A 3PVNA 3IN9A 4I2OA 1NCQA 1TE1B 4XXPA 3WINE 1G9DA 5KC5A 2ZGQA 4IEVA 2PN5A 4B7EA 4L2NA 2HWE2 5JOYA 1NZCA 1ZZCA 2BNMA 3SNMA 4FP3A 5KC6A 1RUOA 2FQPA 4ONUA 1LHNA 3NL1A 4AFBA 2R043 2IFRA 2WC2A 2ZGRA 2GALA 3FBYA 3L2YA 5C8WA 1MZ5A 4X8NA 3ECQA 2Q30A 2ZX1A 3O0WA 1RUJ3 3AXDA 1UPSA 4L8QA 4IEPA 2AREA 3T1LA 1J59A 2VMHA 4RD7A 5I8SA 1D4M1 2YUEA 5DUWA 2AYHA 4PLNA 1DBNA 4Y1XA 3AKQA 4HK9A 4SBVA 1JUHA 1QOTA 2WT1A 3TN92 3ETQA 5T5OA 3H7JA 3WDVA 1LHWA 4HN0A 1PK6C 4PLMA 4M3CF 4UW6A 3SITA 3JU9A 2R061 1Q8OA 1U5IA 2FZ1A 1Q8SA 2JE7A 2PLV1 1AR63 5ABJB 2Q4SA 1ZZ7A 1SEFA 1ND3B 2LALA 2NM1A 1G9AA 3I54A 2X8KA 1VBA2 2NN8A 4HN1A 2ERFA 1IGOA 2PHFA 4KQ7A 2CAVA 4CDWC 2RHPA 1YO8A 4MSVA 4QPGA 4Y1UA 5C9AA 3VBFA 2QUOA 3AZYA 2OA2A 1PVC3 4AI2A 4PIXA 4QPGC 3ZO0B 1IS4A 3WUDA 1C8M3 1QJY2 1Y7BA 5JSOA 3B5LB 1C4RA 1SACA 4AHYA 4BOWA 1MACA 4KH9A 1NCRC 1MS9A 5IT6A 4LO6B 5FOJB 1G9BA 4NWWA 3H3UA 1HRI2 4BLJA 3WW4A 4XQDA 1AR61 1PO12 2Z2SB 1VBE3 2MPFA 4MZUA 4LNVA 1UIJA 3AK0A 2GC0A 2GN3A 2YGMA 1RUH1 5GALA 1RUG2 1JXNA 1VAKA 2NPIA 2K2SA 4IV3C 3VBRC 1YLLA 2P17A 3SH4A 5I0SA 1S55A 3CO2A 3B7MA 2EXIA 3VHOA 2DVFA 1LESA 4R9BA 4GMP0 1PMIA 2ZJCA 4YG3A 5JR7B 5BV6A 1C8NA 5DUVA 2OZJA 3GBWA 1RUJ1 1AZDA 1EAH3 2RM23 2IZWA 2XB6C 5IK8A 2FHRA 1QQP2 2ET7A 4EN0A 4FAGA 5BNPC 1UZZA 2B5HA 3KT4A 4COZA 2JD4A 2O1QA 1D0HA 5ACA1 1BBT1 4C90A 4YZ1A 5D8AC 4AI8A 3JBG3 5JDBA 3FFZA 4IEXA 4R4XA 4FSJA 3AP4A 3TNPB 1UW8A 2WL1A 4FTSA 1G8WA 4ZXKA 5HCFA 4IL7A 3NAPC 4WVMB 2HKXA 2P3JA 3NV3A 4FBFA 3R0RA 2X29A 2ZGSA 4XOGA 1KS5A 5DZGA 5F6KA 1KFUL 2GU9A 5T55A 1REFA 1C1LA 2DUQA 2Q1ZB 4S2GA 4Y22A 3JB4C 2SLIA 2C1FA 3B01A 3RYRA 4XFFA 2RR13 3RDIA 5HBAA 4MGZE 1RUC1 2AENA 5KWRA 4MXWA 1VBD2 4M3CE 3QH7A 2WSVA 3NWKA 3OPZA 2A70A 3KSCA 5BNNC 1J58A 1QXRA 2DU0A 4PBOA 1I5ZA 5BNNB 2D98A 4M0NA 3EQEA 1G9CA 1HQWA 4XETA 2WFPA 2X5IB 5CVRA 1MEC2 4YG0A 3ST7A 5C33A 2WSUA 2WZR2 5I0TA 1QDOA 4CTEA 4GB31 4XW3A 5GM0A 2BPA2 2E53A 4CDXA 1O3RA 5I0RA 2QJVA 3UV9A 2Q1MA 2D97A 1MS8A 3PJYA 1BBT3 2WS93 4MYEA 3OYWB 1SLLA 4PCRA 1YIFA 3G6JB 3WG4A 1RHI1 2HJIA 2VUAA 2GNBA 3A4UA 2XLGA 1DGWA 3RMYA 1VB4A 2R49A 4Q1RA 1PNFA 1CESA 1F5FA 3SHRA 1POV0 1JN2P 3UK9A 1LRHA 3AP7A 1S0FA 3J9SA 2HWF2 2Z79A 2R32A 3ZFFC 1AR73 2VMGA 5DG1A 1LENA 5T50A 4XFGA 1QJX3 3E6CC 1UPIA 1ZBE3 1RITA 1HLCA 1JYCA 1KJLA 3GHMA 4QM8A 4BCUA 2AUYA 1LR5A 1OFSA 1R092 1BKZA 1FPN3 4YNIA 3LOIA 4AI3A 2X53S 1H9PA 4P9LA 5ACA3 4JQRA 4QGNA 3FLPA 1MQTA 2ZGLA 4TWTA 1GANA 2HWC2 2I45A 5K8SA 2VW1A 4OHYA 2OW4A 1RVF1 3WW1A 1VR3A 3O7OA 2FMDA 3WDTA 3TAYA 4CRQA 1OOPA 4QX5A 2DUPA 1OA3A 2XPJA 1QKQA 2GC1A 4IESA 4IEWA 4META 4U36A 1QJX1 5BNPB 3B93A 2WQZC 1MEC1 3M3EA 2VQAA 2CWSA 4LLFA 1RL3A 3KCXA 3THTA 1CONA 1YJKA 2EXHA 3PJQA 3R4DB 4JTOA 2UWCA 1BMV1 3I59B 3N3HA 1Z0HA 3KQRA 1RUC2 2WQ4A 2XVLA 1B35A 5EYXA 4QHBA 1H0BA 5IUQA 2GNMA 2IC1A