3CNEA

Crystal structure of the putative protease i from bacteroides thetaiotaomicron
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
174
Chain Sequence
AKKVAVLAVNPVNGCGLFQYLEAFFENGISYKVFAVSDTKEIKTNSGMVLIVDDVIANLKGHEDEFDALVFSCGDAVPVFQQYANQPYNVDLMEVIKTFGEKGKMMIGHCAGAMMFDFTGITKGKKVAVHPLAKPAIQNGIATDEKSEIDGNFFTAQDENTIWTMLPKVIEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative protease I
publication title The crystal structure of the putative protease I from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 49
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cneA00
1VCOA 4D1YA 1I1QB 3P9PA 5SY6A 4MGHA 1FY2A 4MTCA 3ZJ5A 4UOZA 1U9CA 2LXNA 3ZJ4A 4P2GA 3TTUA 3TTVA 4UZSA 2W7TA 3NOVA 3UMMA 1Q2UA 3F71A 4Y1FA 1QWSA 3CZAA 1CS0B 3F5DA 4ZDKA 4I2NA 5LIRA 1I7QB 2OR3A 1Q7RA 2FEXA 4Y1RA 3BWEA 4ENUA 4UNIA 4B5KA 1C30B 1P7YA 3CNEA 3NVAA 1T0BA 1JVNA 1PE0A 1A9XB 4PXYA 1VHQA 1GPWB 4LRUA 4OIFA 2A9VA 2YWBA 4ENRA 3UGJA 4L8WB 1PDVA 4GUDA 1KEEB 2GHRA 4HCJA 4ENVA 3TTYA 2ZUVA 1QVZA 3B36A 3D54D 2D7JA 4GE3A 3R75A 1KWGA 3CZ9A 1QF7A 5JZMA 3L4EA 3UJNA 4L8YA 1FYEA 5SYAA 1PDWA 3EN0A 3PQ2A 1QVWA 4OQ4A 3EFEA 3BHNA 2R1TA 2GK3A 3EWNA 4K2HA 4MNTA 4OGGA 5SY4A 1GGKA 1OX5A 3B38A 3PQ3A 1IZYA 1OX6A 3PQ5A 4L78A 2ABWA 1P80A 4XLLA 4QYXA 1L9XA 1VCMA 1O1YA 2R1UA 3L7NA 1GGFA 1IZZA 4WINA 5DFAA 2ZUTA 4AUEA 1T3TA 4UCFA 1QVVA 3TTSA 2R1TB 1P7ZA 2VDJA 1K9VF 4AUMA 4B7AA 3CYFA 3N7TA 3L3BA 4ZDIA 4R7GA 4Y1RB 4AULA 4L8FA 3OT1A 2RK6A 2AB0A 1C3OB 4L95C 1N57A 1CE8B 2NV2B 4E5VA 1QDLB 1P5FA 3RHTA 2YWCA 1P81A 1BXRB 1KXJA 3B3AA 4GE0A 3NOQA 1GGHA 4AUNA 4P5PA 4UOQA 1PV2A 5K4AA 3TTWA 3OT1B 1OY1A 4LGYA 5SY9A 3TTXA 3NORA 1JDBC 2YWJA 5E9AA 3CY6A 3SF8A 4ZGGA 1KWKA 2IUFA 4ZDJA 2ZUSA 4OGFA 3EZGA 3PQ4A 1GG9A 4JQSA 4QYTA 2WJZB 2XF2A 3TTTA 3FIJA 1GGJA 1ONSA 2VPIA 1UCFA 2VXOA 4S0ZA 3SF8B 4B40A 1VCNA 4BIMA 4OJYA 5IP5A 3UOWA 4ADSG 1I7SB 1M6VB 4E08A 2H2WA 4RKYA 4OFWA 2ZUUA 3P9RA 3MIIA 1J42A 1OX4A 2RK3A 4Y0NA 3L18A 3TQIA 3PQ7A 3R76A 1GPMA 2YWDA 4I4NA 4L7QA 4AJ9A 4ENTA 4ENWA 2ZUWA 3R74A 3ER6A 4B31A 1GGEA 3MGKA 2R1VA 3SOZA 2NV0A 1CF9A 2RK4A 5JZOA 1OX4B 4N0MA 3ZR4B 4P34A 4Y1EA 4ENQA 3NONA 4P36A 3P9SA 3VU3A 3P9QA 1WL8A 2R1VB 1R9GA 4RKWA 1KA9H 2VRNA 1T36B 3WFZA 4BFLA 4ENPA 2V4UA 4Y1GA 3M3PA 3NOOA 4I46A 1SOAA 4B2YA 1S1MA 3GRAA 4WXYB 5BV2P 2AD5A 3FSEA 4ENSA 1IPHA 1G2IA 4N12A 3KKLA 4BTEA 3PQ8A 4P35A 3UK7A 2ISSD 3PQ6A 1SY7A 1OI4A 2VKTA 3EJ6A
chains in the Genus database with same CATH superfamily
4WK2B 1S1CA 1TB4A 4WZBA 4XSHA 4DCVA 4PY2A 1CJMA 2D8AA 1QWOA 4I1SA 4OU5A 3CGGA 4BUZA 4DPKA 4E4RA 5FRDA 1ZONA 4CU5A 1KI1A 4BRZA 3GFBA 4IIBA 1U98A 4IQ8A 3ZK7A 3V7FA 1HYEA 4RMJA 5F7ZA 2C2ZA 4ZTUB 2IQ5A 1L5WA 3HADA 2XNHA 2B5VA 3AGQA 4MOWA 1JJIA 2ZRIA 5SICE 1IOVA 4QQNA 3DMYA 2XJ4A 1QYRA 4JJ8A 1QNFA 1C8KA 2J5BA 4O33A 4ER5A 5AW1A 4YMLA 1R0CA 2MU1A 4A1FA 3Q3IA 1FNSA 4B3RB 3CZQA 1UKEA 3HH8A 3K15A 4R2LA 1T5LA 1HE8B 3OX1A 4WK4B 5TMEA 1KO7A 3NHPA 3D4LA 3R0IA 4TT3D 3A1VA 2VHCA 4ARAA 2YV2A 2DM6A 1DO2A 1ZZGA 2VDWB 4ML3A 4UBJA 5TARA 1FDIA 2FSSA 2O2GA 3BH6A 1U9JA 3SC2A 1BN6A 1NF9A 1DRJA 2WF5A 2CNBA 3ESYA 4LTNA 1NQWA 2YOGA 3CKLA 3TS1A 1GIAA 3P2KA 5IC4A 4OLAA 4LXXA 2J46A 1U3CA 3FG9A 4PO8A 1GZVA 1VPDA 3BK1A 4S0XA 3PSAA 5LQUA 4H7FA 2UUAB 1W5BA 2GFIA 4KH0A 3R5JA 2IYQA 4KUGA 4TMWA 3V6LA 3HDJA 1TTTA 4DMHA 3ZJYA 5FV7A 1EWRA 1CG6A 3WP0A 1BXGA 4A03A 2AMVA 3KVNA 1AZSC 3FCCA 2JVIA 2RSLA 1XLUA 4IHJF 1C9DB 2R4TA 1EWQA 3I9FA 1N3YA 2C9YA 3SFZA 2HFJA 4G1EB 4TN5A 2FE4A 4H08A 5ECYA 4FB5A 1K08A 2AZMA 1J2RA 1CRWG 2HDOA 4L5YA 3O9MA 5E0OA 3AINA 4FFDA 1R8QA 3P27A 5GVSA 4RD4A 4OK3A 2UUCB 1BHO1 1F14A 3PFGA 1SXQA 1V1RA 4US1R 4ZTBA 1B41A 5HHTA 1NW7A 5E2IA 4PRKA 1WHSB 5JU6A 1YFJA 4QZVA 3KQHA 3I5YA 4KXNA 5H9VA 1L7MA 5BV1A 2QAGB 1Y8RA 4YRLA 1JDTA 3U3RA 3TO5A 4IMRA 4L51A 1B2LA 4FMBB 1SHZA 2MYNA 1PEYA 2HMUA 1T9GS 1N5RA 3OKPA 4NL4H 3T95A 3KOZA 1AQLA 3OCWA 5JH7B 1G3QA 5LA6A 3KQWA 5FI0B 1DWUA 2I6SA 1PFKA 1QCZA 3HJAA 2DX7A 1NSTA 4DLWA 2Q45A 2QN2A 1IUPA 2PQ6A 3L9WA 4FINA 4DYVA 3H6KA 1OHHA 3O21A 3QXJA 1HDOA 1SOUA 4MARA 5BUCA 1I3CA 1OA0A 3KJHA 2XNSA 4IKOA 5DYNA 3CVVA 1FP7A 3NX4A 1E9EA 1U63A 5G53C 1FRQA 3AF5A 5HOQA 4LSGA 2G8LA 2IEGA 5BV2P 1BMTA 1ZIPA 3RTGA 4AIIA 3LYLA 4CWAA 2JW5A 5TGZA 2FG5A 2DZDA 2JCVA 1JUDA 3AX6A 5E8JA 1S89A 2TMGA 3QUSA 2PGXA 2WMOB 2YHBA 3HXPA 1AY0A 3VAZA 1I33A 3IEXA 4U7GA 5FH9A 4ZCSA 2OFPA 2D2XA 2DUMA 2UV8A 2ZRJA 3N2KA 3I9JA 1SC1A 2RC5A 4HH4A 4IS3A 5F2KA 3P9CA 2JBAA 2K5UA 3EPKA 1ZBDA 1YZVA 5EEGA 1I3MA 2IC5A 2VBFA 5DRTA 5FCDA 4C0JA 4D5GA 4QJ3A 3TMYA 2UZIR 3N2NA 4G36A 4NMWA 3LV8A 4Y1RA 1E5VA 1VXOA 1WXDA 1QH1A 4U3JB 5AXAA 3RADC 4NAVA 2YZKA 1P7YA 4FEAA 4PG8A 3H1PA 5KB3A 2CBZA 1VHQA 3ESXA 1WMAA 3BQMB 5LXTB 4HGOA 3O8BA 3OQJA 4GGMX 5I7WA 2OZLB 3P2YA 1C7EA 4RY2A 2FFRA 3TLKA 1V11B 2PTGA 2WYHA 1Y7PA 5B30A 2NU9A 3CH6A 1DIBA 4FBLA 4JP1A 3TKYA 4ZQCB 1JA0A 4FYKA 3TZEA 4DG9A 4WBXC 4LJ7A 2Q46A 1GEEA 3A9TA 4I0WB 5FWXB 4AJ4A 3SZMA 4LZWA 5DMHA 2GZSA 1H42A 3Q1KA 5IT9A 3L1IA 2XXBA 5E0KB 1YCFA 2IHYA 3WIVA 2NV6A 1EDZA 1VCMA 3THSA 1GZ7A 2EZ9A 1ZXXA 4BGDA 1JIQA 5B3LA 2OXIA 1QIMA 4XDGA 5DLEA 1UKZA 2QSJA 4NULA 3W7AA 5JI3E 3P8ZA 4YMGA 3VYUB 4KLRA 1M5UA 2E4WA 4GBED 2MMCA 1SUAA 1C9JA 4WECA 4M87A 1NWCA 3PGLA 1P75A 3FZNA 3Q8XB 3HYLA 4LFAB 5EL0A 1N2HA 3AWDA 3I01A 3ONEA 1SUBA 3ZWYA 3K6SB 4FKBA 1EJBA 4RVUA 3SKXA 4RNDB 4ZVTA 1RHUA 2BBOA 3CNQS 1GTVA 4E88A 1TKCA 1CULC 3C3PA 3N8NA 4Y2QA 3C39A 3UJ9A 4CUJA 1EJ2A 3HDQA 5CIQA 5K0GA 3LTNC 5BVHA 2R8EA 2H7YA 3EDQA 3VNBA 4RA9A 4ZDJA 3QH4A 2CLIB 2WMDA 5AJHA 3Q72A 3K4QA 2PKYX 4QYTA 3QE0A 1CY4A 1WRBA 2BGUA 2C2XA 4KXWA 5MGNA 3BD6A 4EUHA 3E0XA 1E8MA 1UANA 3K2IA 2F3PA 4HRVA 4DCMA 4EA8A 2CMKA 3T34A 1KK0A 1K8RA 2ZS8A 2PA0A 2WIBA 3FFAA 4FGWA 3EARA 1E3JA 5JJ5A 2P6PA 3TQIA 3GZNB 1LUAA 2A57A 3H1EA 3RU3A 1D2RA 2EHJA 3ETHA 3H9BA 5DTJA 1FS6A 1A8SA 5FWYB 1U94A 3FNQA 5DWQA 4BQQA 1HFKA 2BRUA 2B25A 3KLMX 1FX0B 4ACBA 1YUMA 1VM6A 3E7XA 2Z8YA 3EZ2A 3KXKA 2W2NA 3MJEA 1OTYA 1U0FA 1Y5RA 2GN4A 4XDYA 3V1KA 4CTOA 1RHMA 2BGKA 1W5AA 1H3FA 4JV5B 1OJ7A 1L5KA 3DOHA 4HSEA 3WHLA 3GEMA 2D8MA 2IPNA 2MSEB 3LS2A 5DGHA 4IWYA 4WZAA 2BFDA 4EPVA 3P2EA 4AJOA 4PEVA 4C2UA 5L3QB 5I7AA 4RCZA 2XDAA 2FR1A 2OAQ1 2QT0A 4WWHA 4B6RA 1XZHA 1YA4A 3LXUX 4I6EA 4KDRA 4YH1A 3P45A 5A62A 5EZYB 4HLNA 4OQNA 1ADGA 4Y6GB 2Q4RA 1ZS9A 2IEDA 5HDQA 4CBVA 4OXKA 2V1UA 2R7AA 2Z2ZA 2VKTA 3EZNA 3ULKA 3EVDA 1ZHOA 4HDNA 5EJEA 3JQ9C 4EO7A 1MC8A 3O84A 3CKKA 4ZVSA 5JS2A 2IVFA 1ZPDA 2COKA 2L18A 2CJXA 2XRMA 4C5AA 3K5HA 4KLNA 3EGDA 4QC2A 3WC4A 5BSWA 4IFEA 1QFSA 5FYQA 4ZPXA 4BZXA 1CERA 1U5BB 4DWVA 4RKEA 3TSYA 5IJ9A 1QQ6A 2P68A 2D62A 4A5OA 2Q3BA 3U49A 1V7QA 3MMZA 1YK0A 3SJZA 2VJLA 1OXSC 4LCJA 1JEJA 3AY3A 4Q9LA 4YV1A 3E1SA 2D06A 4YRSA 1IEVA 3ILYA 2FW9A 4D8TA 2HIAA 4LRWA 2R4UA 4PYIA 1WTAA 2QLBA 4KR0A 1SJ9A 5HEKA 1AHPA 3H9JA 3P26A 4WN9A 1QVZA 3JYQA 5KQPA 3WK5A 3ZDRA 3LWDA 3GLUA 1WF3A 3OOJA 2WRZA 1VMKA 4LJ6A 4NDAA 1G5PA 5DX8A 5C1DA 2WVHA 4PAMA 4PTZA 4GLFA 1YQ9A 2GA9A 3FSGA 1KBOA 3ROKA 2XD4A 2PLRA 3P5BA 3DMPA 4V0OA 2D0DA 4B9EA 3UCXA 3U2QA 1PHRA 4ETMA 3I1IA 4B3GA 2ZXUA 4PIVA 2F8MA 3DFFA 3U3MA 5T3UA 1CVLA 1XT6A 4ISBA 1BW9B 3KVYA 4LYHA 1L5OA 5AUQA 3RM3A 1E4VA 4NZ9A 2WU4A 3ZGZA 1CJVC 1YBVA 2NXNA 1P1BA 3IKJA 3RBZA 4AX8A 1N32B 2V4ZA 3VYTB 3KQKA 2PM8A 4IIJF 3Q2IA 3HMKA 5B36A 2VUIB 1GZ3A 4F97A 1AOXA 2DP4E 4KXXA 1KTIA 2V45A 2DRIA 2PNJA 2CNKA 4EA6A 3QLUC 5BWLA 2OHGA 1HTBA 4BRSA 5L6MB 2WB4A 1X1QA 4DIEA 1JHRA 1SCUA 5BWNA 3S55A 5I6DA 4JZYA 4HWOA 1BVYF 2HU5A 3EAGA 4P0TA 4Z1MD 2ZS9A 2HI0A 4IDEA 4B4UA 1EIWA 1QTQA 3AF1A 2GZMA 5BNIA 4X7MA 2OV8A 1VMIA 3PRHA 1JQJC 1V47A 2R44A 2VVTA 1T6NA 2CFTA 5F2EA 5T4HA 2DB3A 3BMQA 1ZVVA 2ONCA 3H5OA 5JHHB 5IM4A 1V1RB 1KI9A 1JKMA 2QTLA 4ITRC 4RIIA 1WU7A 3RUFA 3GLGE 3PLRA 2DOKA 3FDZA 4URVR 2XHZA 2IELA 4QFMA 2J7KA 3LP5A 2BE9A 4RQUA 3W3AD 4AMGA 2VPYA 1FQKA 4CDGA 3R3WA 3LDAA 1HDIA 1PL7A 1ZXBA 4MAMA 4YY3B 2ZQ5A 1ABBA 1SKUA 1VG0B 3DOFA 4O4JB 3P71T 3FE2A 2PVCA 1OB2A 3GPLA 1GCOA 1X7HA 4G4SO 2WC1A 4UU1A 1MO6A 1G9XA 1W47A 2UVPA 4RANA 1G4UR 4XTRA 2I7VA 3FCXA 3EUAA 4OM7A 1J07A 2QY9A 2H5JA 2A78A 4K6OA 4D8WA 3RKSA 4C7OA 5GJVC 4QVIA 1EK6A 1EHYA 3H17A 4LN1A 3V8MA 4XJVA 4G84A 3DBOB 1BQ4A 1NULA 4PO9A 4DDMA 2YNMC 1LY1A 3ELWA 3JVVA 2X0NA 1BD4A 4HGYA 4WOCA 5DHUA 5KYYA 4RMGA 2UZ0A 3UPDA 1IBSA 2C84A 3KPJA 1OLSA 3HR4A 4MS1A 2WPNA 1UM8A 4PINA 2JLYA 3COZA 1K68A 1XRSB 2XGMA 3I9KA 3KEGA 2BPOA 5FL7A 1AN0A 2GPBA 1RXIA 1U65A 4UFOA 1C3EA 3TH5A 4HDCA 1KIFA 5IH3A 2VK8A 1GFZA 1VLMA 2BH9A 5DTQA 5CCDA 2PUCA 4WNYA 3K96A 1AXEA 2GQ0A 2Q62A 1QH1B 3OX2A 3KT3A 2CC2A 4ZPJA 4EELA 1HE1C 1JZTA 1TU0A 2YS6A 5JEDA 3L8GA 1J56A 1PSZA 3FVQA 2RGAA 3P9NA 2O07A 1C2TA 2FUCA 3K32A 3AQ4A 3QI7A 4JXJA 4MCAA 4PICA 1UJ6A 4ZJZA 5IASA 4C78A 1CY7A 4R16A 3S1SA 2ZIFA 3OP4A 5DNCA 4RAOA 1X8KA 2OXCA 3HWWA 5FI3A 4ZAFA 3OLVA 2MSDB 3GFPA 4OHPA 3TW4A 4FEGA 4DJDC 3Q0IA 2C5BA 2RKOA 3ANLA 1ODFA 3F7NA 3FCAA 1EBFA 2DFLA 4LX8A 4Y9SA 4JLOA 2ZDQA 1M2OB 4JLWA 3FXAA 3ZOZA 3AI3A 1YDMA 2IXFA 3N70A 4FI3F 3FETA 5T41A 3UB2A 4CM3A 4DXAA 4EI7A 5I7VA 3U16A 3HTXA 4Q9NA 3TXAA 2WNIA 1S7CA 3CVXA 3GJYA 2ZDGA 2FUKA 2II6A 2YICA 4TQ9A 4EY7A 1OBOA 2C4WA 2YV5A 4KFSA 5FP0A 4DY4A 1I7DA 4FYWA 3HDVA 3RRNA 5CD1A 3JD4A 1PNRA 1WPQA 2JFPA 3RFTA 4EFMA 3B3AA 2CMGA 1NBOA 3BN3A 4DKJA 4YBZA 5DNAA 1ECPA 3WQSB 4DZRA 4N76A 3LKDA 1A0OA 1O03A 1LJ8A 1WDWB 1YJBA 4FZ3A 1CZNA 2HA6A 1UPBA 2FSUA 2V3WA 3O1IC 2NO6A 2O7QA 2P67A 1U99A 3NWOA 4JIMA 2JJMA 2BUAA 3CF4G 3O0TA 1XDWA 3FNHA 1NVGA 4PC3A 5IBPA 1QPGA 2B8TA 3HUDA 3DQQA 4FI3C 4M0FA 4YRAA 1WU8A 3A4NA 1U9ZA 5AR1A 1GGJA 2W43A 4RPHA 1DX4A 2B7BA 2IV2X 2FZEA 2QSYA 2X1MA 1V8FA 3GQVA 2IY8A 2RCNA 5BVHB 3OFJA 1JG3A 1GNSA 4OJMX 4RA9B 2P30A 4RS4A 5L40A 4AKIA 3I3OA 4PPQA 4KR2A 4XEUA 1LBIA 2QUAA 3HB1A 3SQMA 1RRKA 4EI2A 1KR5A 5J43A 2H1SA 2Z1DA 4H3SA 2NZ2A 3F8TA 2RAFA 3N8HA 2WWHA 4HFRA 1IONA 1CF9A 4KFRA 3UJ8A 5CLJA 1RI4A 5KSOA 3DAFA 3BWMA 4DA0A 2IIPA 4MKIA 4N0MA 5EXTA 4BMYA 3BIWA 2A67A 1JFTA 4HNAA 1U2DA 1RIIA 2XUZA 3KKQA 4RZIA 4WE3A 5L45A 4HYTA 4TWBA 4Q1FA 4IHQA 3IQDB 3N0RA 4MYHA 2HA2A 4DGSA 2Z43A 4FS3A 2OGZA 1OKKD 3CLRC 2BC9A 3I73A 5T3YA 1T0IA 2ZVQX 2FV8A 3GUUA 3MBIA 4KTTE 4YRMA 2OPHA 1CQIB 1EBUA 1OLUB 1MABA 2I71A 1VDZA 3S2YA 3NP9A 3ADCA 4H16A 4WZAB 4EG8A 5BSRA 2RHJA 2WFLA 2VCYA 3TQFA 5BSGA 3P0IA 1IN1A 5A3QA 2IITA 4GX1A 4X1KA 4I5EA 4YMSA 1ODLA 3R9XA 1IY0A 2HF7A 5HG0A 2YNMA 5JO0A 3G0HA 5K09A 3RSGA 2EX0A 4DCUA 5IYZA 2Q5JA 1U3VA 3CS3A 4LDQA 4LDAA 1F2UA 1VYHA 1Q2UA 2X8JA 4MKHA 7YASA 4HDNB 3IEVA 5CMLA 1UBRS 1LDGA 5EIAA 4DR2B 4JLNA 1XZPA 3INRA 5IS2A 4H7IA 1H5UA 4QXOA 4W1RA 2DYKA 1EM8B 3KQOA 1GQFA 2VPTA 2JFUA 5E95A 3GEHA 5BYBA 4DVJA 1LJLA 1QFZA 1FFGA 1ZAKA 2GZ2A 2JFBA 2PYIA 3DSRA 3OFNA 1NMEA 1X2EA 2WV7A 2QRJA 3D7LA 2XZLA 4QPCA 4KE8A 1YH3A 5JMWA 4CR6A 3K8QA 3DZDA 6Q21A 2NZXA 3WMRA 2ZAYA 2XYQA 3L07A 3VA7A 2VUUA 4DCSA 4G9EA 4DMKA 5LLDA 4JOQA 2UYCA 4WN9B 1LLQA 3VR6D 3UXEA 4DJ5X 3F4KA 2W2LD 4S1PA 4KNWA 3R3VA 4ND6A 4INAA 5CVCA 4BLVA 1O9GA 1NM5C 1R6BX 5AM4A 2JKYA 2VPXA 5AESA 1V37A 1A5BB 1JHAA 1L5MA 3Q10A 2IZ1A 5JPDA 2ZIEA 2A30A 2XZTA 3EXAA 4H4CA 3N59A 4X9XA 5EERA 3RVPA 1FW8A 4TT8A 4ZRNA 3S8YA 2JFQA 3X1JA 2H1FA 3CW9A 1JR3D 2E21A 2J0EA 2PFKA 1N77A 3EBPA 1XB2A 1U9IC 2EC5A 3IEPA 5IJZA 1RU3A 3VTAA 4F45A 3SYKA 3BD7A 3DL0A 1N6PA 1Z5ZA 2A5GA 3GP3A 5JECA 3E03A 1KETA 3D81A 4U7WA 2VSYA 3H8JA 2XMDA 3VC1A 2C2BA 1U6JA 5DRYA 3ZIAA 2FXIA 5F1KA 4KE6A 4XM2A 3ZTYA 5IKPA 3NKLA 2XXAA 1ANKA 4XVHA 2WTMA 1C0LA 4XPZA 1QXSA 3MTBA 4GPTA 4DDUA 3L0CA 2BEVA 2PK3A 2IU3A 4IUDS 4KN8A 4TRNA 1SCUB 1J0BA 2OCIA 3EASA 3PXGA 3SS7X 1F0PA 3CXRA 3IMKA 3WSWA 1P5RA 2XTMA 4FYHA 4XDZA 5H7XA 1CUJA 3BJRA 3MGGA 1OLOA 3FHJA 2EKPA 1M0TA 1HPLA 5I3CA 3PDJA 2CKMA 2GKOA 3OE5A 1O6GA 1T9DA 3J81k 1DTEA 2Q9CA 5K8TA 4GR4A 1J0EA 4IQFA 4UEJA 1HZZA 4JJ6A 2OD7A 3PCRB 5IDYA 1XCBA 3P9SA 3RVJA 3L8CA 1ZEJA 4CKYA 4RVNA 5A5GA 1XTIA 2NNLD 4LOLA 4JSRA 4Q3EA 1L4GA 1N8NA 3ENKA 3FZQA 1F0NA 2ZIUB 4ER3A 2JG3A 2YINC 5EMMA 2PLWA 4GYWA 1HY3A 1NXWA 2FZKA 2PRZA 1VHDA 4HVTA 1XZDA 4MW7A 4P4SA 2R8BA 4WJZA 4Z9FA 3X44A 3OU6A 4QTXA 4BTEA 2A0XA 3M7IA 3CA8A 4HATA 3W2EA 3E22B 1IN6A 3VNQA 2R79A 5JUWA 1RXYA 1ZL0A 2IHTA 1V4VA 2UVPB 2A9QA 4CM9D 4LWOA 3VR3A 5K3EA 2RAUA 5FWAA 3V1MA 3ZJ5A 4P4TA 1VP3A 2Z2KA 1DCMA 2ZIAA 2H4FA 3KWMA 3MT8A 3V8PA 4BV9A 3PNBA 1I1NA 3ZWPA 4W9NC 1KXZA 1GRQA 5I4KA 3A6KA 3EGVA 3OX4A 3RTBA 1MAUA 5D6OA 2COEA 5JNSA 4ONEA 2MR5A 2ID8A 2C29D 2KE5A 4IO0A 4L0CA 3ZWAA 4BMOB 5AVXA 2C8LA 4N3CA 1WBBA 3WTCA 4J16C 1UWLA 1L8LA 1YBAA 3ZY5A 4MS1B 1OLSB 2JFHA 4LRUA 4UVDA 5BWBA 5CCEA 4FW9A 2GJSA 3CH7A 1BGWA 1KEEB 2JAWA 2W6JD 2CLMB 3D4OA 2R7MA 3LCUA 3ONVA 4NX2A 4UE6A 1OBHA 3CEPB 5FULA 4E5SA 4ENVA 1M2KA 3OBBA 4JT8A 3FPAA 4CDNA 4GKKB 3H4MA 2XYHA 3RE1A 1DKUA 4HZIA 5JD5A 2QK4A 3B7PA 4P0PB 1V26A 1NKTA 2A6PA 4IRUB 1W4ZA 1U7OA 2FPGB 2WSSD 1B8PA 2WICA 3C8ZA 3I0ZA 1R50A 1G8FA 2HA0A 5EIHA 1J5EB 2A1TS 1GT91 3ZDEA 2J3HA 3DAOA 2IBMA 1ZKDA 1NM5A 1LQTA 1Q0QA 1JG7A 1XDGA 1GL3A 4ZVVA 1JECA 2Q5HA 3W4IA 2O3SA 4LSZA 3CX6A 3NHRA 3URMA 5ALSA 2FW0A 3A3YA 1X7WA 4R83A 1I01A 1U0OC 2CXXA 3AZPA 1GY8A 3CPSA 3V1YA 2RHHA 4FMCF 4C76A 5B1DA 4PIMA 1NQOA 4TTAA 1AKWA 4FXPA 5CM8B 3RHTA 5AD1A 4CGZA 1BFDA 1O94A 2C5HA 4LZOA 4LVUA 1JHYA 3RSLA 6PFKA 2FFBA 3BDIA 2OG2A 3MUNA 1G5FA 4NY1A 1C8VB 4MEJA 1JDBC 1UH5A 2D5CA 3GFQA 4IP0A 4R7TA 2OYRA 3TL6A 4X95A 5K0SA 3V48A 1Z4PX 4II3A 2XI4A 4JDUA 4PM4A 1RAHA 1MNQA 4KDEA 3F6EX 3OECA 1QCCA 4X3PA 4X97A 2O20A 4EQ6B 4H31A 3FTNA 1NDQA 1JALA 3KB6A 5IULC 3HL4A 4JI7B 4MUEA 1USVA 2H4ZA 1K89A 3IA7A 5GONB 1EUDA 3DW1X 1N0VC 1Y9DA 2N9UA 3LGSA 2B0JA 1JKJA 1JKIA 2A59A 3WGVA 1ICIA 2EBUA 1NNLA 1Y3FE 3MIIA 1YB7A 3H5IA 3AUSA 3PXAA 4ZT5A 3WLMA 5MN5A 2GN9A 4C6SA 2QYSA 2HCFA 3I72A 3WX0A 2CK3A 3A9SA 3AEUB 1RC1A 4CCWA 4M1MA 5EIEA 2GPYA 2P0AA 2HB6A 3WADA 1PIWA 6LDHA 5B1HA 4MQ6A 5TC4A 4KQWA 2Z5LA 2RHCA 1QANA 2HGSA 1CC1S 4Y9DA 4AVYA 4JLPA 1CY8A 2INGX 3PPXA 1YS2X 2YDYA 4GR9A 2DBVO 3Q3HA 4P4LA 1T34A 2O5VA 3MCZA 3KJXA 3GD5A 4IH4A 5HIMA 5JVDF 5JYEA 5LIPA 1SQSA 4HNAB 4HR7A 1WSAA 1Y1TA 4W1QA 2YUTA 3T7DA 4BXOA 1ULUA 1SOVA 1G2IA 1PD1A 1ORIA 4UHKA 4X66B 1CUCA 4B0PA 2EQ5A 3BCHA 3GHHA 4IJ6A 3SQXA 4CKZA 3TI9A 2CDNA 2V9ZA 3A1DA 4O8ZA 3PU6A 4PHCA 2ZRKA 4JT9A 1A2OA 1QK3A 1PR3A 1SULA 1UBMS 2NQ2C 2VTVA 3ENWA 3HL0A 5TQ0A 2D6FA 4HAYA 3PD1A 4HYQA 5SV2A 4FE4A 2WFLB 4L57A 1T1JA 3MBOA 3ABQB 4LQLA 1CQPA 4KV9A 2FFQA 4X1KB 3ZCVA 1Z6GA 3U1BA 3R9XB 3H97A 1PJZA 2I2CA 4LOIA 3Q7PA 3FUUA 5FTMA 1AK9A 2JJ8A 3DVLA 4MUHA 4UMVA 3TLZA 5IYZB 2X13A 4G5QA 1AS0A 3KQYA 4J16A 4MW0A 3RK1A 2ONKA 4HHEA 1PUJA 4GECA 3VNSA 5ITZB 1Z28A 1ZW1A 2PX8A 2XW6A 4ZT4A 4B5LA 3M5DA 4N39A 3V1NA 1Y4DE 3NO4A 3IX7A 2VT6A 4KE9A 1ZRHA 1A8IA 4ZJUA 1VL2A 3SVTA 3FGNA 3H5NA 5C5DA 5ICFA 5AK0A 4NESA 1JR2A 5CJPA 1LRLA 1UINA 4ALJA 4EVQA 4H6WA 4MHTA 4P7GA 4X3CA 5C3UA 1NWHA 2P77A 5M29A 3HB4X 2ZSJA 4NAUA 1TVEA 3KTFA 3B38A 1UMCB 2BSAA 5HYVA 2EP7A 4U2GA 4BJ5A 1CSEE 3K8YA 1LKZA 1J8VA 4BNJA 4BVHA 3UCFA 4OBBA 4AUEA 5J58A 3M3HA 1VXRA 2DWQA 2FWMX 2VQDA 4Q1VA 1YVEI 2PZFA 2P2CA 2WM9B 1MA0A 1EPUA 1NI3A 1T29A 3DW3X 2I6GA 3M5WA 3T0IA 4PN7A 4OHXA 3UPUA 4I6GA 4Z4FA 1AZWA 1OH5A 1SUPA 1VE6A 4W1PA 1DAHA 1ENYA 4AIRA 3AV0B 3GQBA 3K94A 4JA2A 4I1YA 4J0FA 4X92A 1FYWA 4JFRA 4LRXA 2WMNB 1R6TA 2A3RA 3FPBA 4BN4A 5DXAA 2LR0A 5CEFA 1KDPA 1CK4A 3P2OA 4RXMA 3U39A 3IBCA 5F1OA 4AJJA 1E0KA 4K81B 1KIMA 4G41A 3QENA 4HTFA 1TAUA 1J7KA 2XPCA 4MP6A 3D7KA 3TAXA 3L0IB 3I1FA 1OT5A 4DLVA 3HU5A 3D2CA 4U1RA 4MCIA 2XVAA 1N2CA 4S0ZA 4EENA 1JLHA 1L1QA 3UK0A 5F9MA 2PQMA 5KJFA 3GFFA 2NZWA 3A70A 4LRTB 4RACA 1C2YA 3DUFA 5AKEA 5DTIA 3TJZA 1OA1A 1RYMA 1HMYA 3KU1A 3RSCA 4D8UA 1E3MA 1KFCB 2C4TA 3MJ4A 2FR8A 1S3FA 2QPTA 5HJ7A 4AI6A 5H83A 1XVVA 3NS7A 2CJWA 2NLOA 3O8NA 5A5VA 3PI7A 3ST7A 4DIDA 2GCPA 4LCBA 1ARZA 2X0RA 2NXCA 3T1YB 2R8RA 2WP8J 3V1LA 1T1SA 2XHEA 2ZJ4A 3W7BA 3O0DA 4Z4HA 4J1NA 4PYLA 4A6XA 1RZRA 1WABA 1VKNA 3A6HA 1ISIA 1J22A 2DUWA 3FJYA 4K9NA 1UQUA 3NGMA 4WKOA 5B1SA 5IAGA 2BLNA 3P20A 5FV4A 4S3MA 2BWJA 1VMEA 1TU4A 3DGFC 1VIVA 1HYHA 3M33A 3QHPA 4L0QA 1TF5A 2GF9A 4QU5A 5E7IA 4BNZA 3QBJA 2QDKA 5KIAA 2WUGA 4E30A 3GGPA 2QF7A 1R0LA 1EVJA 1QH0A 2IPAB 3ZDXB 3VR2D 1JR6A 1G64A 4M7WA 3DXZA 3ICVA 1G4HA 4GMFA 3W9UA 3PSHA 2R7NA 4EMUA 1ZW6A 4NAHA 5B7GA 4P4SB 4BX3A 2BYTA 3T9DA 3BF8A 3OQIA 2HPZA 1DG1G 1BG6A 4JASB 5AWFC 3ZGXA 1PN3A 5CURA 1Q1QA 1XSEA 4Y1FA 4GEGA 1LBSA 2I3ZA 3KPYA 2IPXA 3VTFA 2WQZA 1CDEA 2OR3A 1T4GA 2BF4A 3CUWA 4EHIA 4UPVA 1J99A 2DBYA 2JAOA 1GPAA 2QL9A 3IUYA 3WISA 2CKDA 1IUNA 3HCDA 4C7MA 1MPXA 3CE9A 5ED0A 3AKCA 1BDBA 1IL0A 3RNOA 2KQUA 4Y2XA 4ZEWA 3HCRA 2B35A 4YNBA 2B83A 2QAIA 1QF7A 5I8WA 1GU7A 2QJOA 1AB6A 3BXHA 3ICOA 5GIOE 2X40A 2ZVPX 1RCUA 3MGCA 2H1HA 4EITA 1KEVA 4O4HA 5TXGA 2BUBA 5CNJA 1AO0A 1IN5A 1XUOA 2XYVA 4AY2A 1UZMA 5KU7A 3FTQA 3JQEA 1J5PA 4URZR 1FTNA 3A2MA 2ANCA 4WZ6A 2YMQA 2NSJA 1P80A 3D4BA 3EFOA 2DH6A 2P9EA 3BBPA 5DLYA 3WMGA 1FE8A 3IQEA 1RJGA 3CU5A 3IVGA 1V2GA 4EYSA 5C51B 4PC2A 2BGGA 2Q3CA 3TCXB 4CEJA 3WOHA 2C4MA 2FWPA 1SGWA 3GFGA 1ULAA 3OM0A 4M1EA 4MCHA 4MVJF 5HUQA 4Y2UA 5T6MA 5AK5A 4NJEA 1G55A 1HOXA 3TLJA 2JGJA 4MUBA 1T43A 2DH5A 2F1RA 3TXXA 2CDAA 3VPAA 2JIRA 3IEKA 5A0TA 4YRQA 1BDMA 2O9JA 4E7PA 5IANA 3VVBA 5K4AA 1X7WB 5EJ4A 1UOQA 2GZ3A 3V1UA 3CF4A 2G0TA 4U7PB 1J24A 1X7ZA 3IUSA 3L46A 4PLPA 2C5EA 1V35A 3U81A 4ZAXA 5J40A 3A6PC 1IQUA 1ZD2P 1BMFA 2R7LA 1VKJA 3AEZA 4J9UE 5DO9A 2JC3A 4CMHA 1Y3AA 1MDFA 2BFEA 2GSWA 5ABPA 1J0CA 2V7XA 5ULLA 2VI5A 4IJVA 1QIEA 4YIHA 1NFFA 1JSRA 1AURA 5JG7A 3Q2OA 2W2VA 2WAOA 4UZFA 2GLTA 4BLPA 4YT8A 5AT1A 4Y2JA 2ZUWA 1QUFA 1R6DA 3R74A 3F8SA 1JKJB 3EVAA 2F9LA 2XTZA 1X8JA 2BM9A 5FUWA 1PV4A 3FYUC 1B3BA 3Q3JB 1GTJ1 1P3Y1 2GNOA 2VHUA 3BF7A 1KEZA 4DC9A 3PHIA 4OPMA 1JFVA 1GLVA 2HXYA 1BFKA 4PO3X 3OPYI 1Z37A 1LPNA 4O02B 2MDTA 2OO7A 2QX6A 1EGQA 4OY3A 1FJGB 1IHXA 4ARZB 4BHTA 4AW9A 3O75A 4RFVA 3TD2A 2QP9X 5HNKA 2PMFA 2QD2A 2XE6A 3E9NA 1R4ZA 3FSGD 3HP1A 4GKBA 4JBYA 5A4KA 1Y1QA 4ZEOA 2ODAA 3V6MA 4EFNA 4MV6A 2YZNA 2X8AA 5JTTA 1H6CA 4MVJH 2J08A 2EFHB 4CCSA 2LUOA 2P27A 1LK5A 1KJQA 2ZPUA 2WG1A 3EODA 4ILKA 4D9FA 1TZKA 4IUBS 4Q7LA 1FA9A 4QNRA 4CXMA 1CJCA 2V7GA 3FPKA 2C4VA 5D3MB 1XLTA 4M38A 1LXCA 5KQMA 1Z6TA 5JRDS 1ISPA 3CX3A 4MQFB 5B58T 2Q6KA 5TQ0B 4DZZA 1I2DA 3GPBA 3RBXA 1PFQA 3LFTA 4I81A 4RIEA 5BN3A 1XDBA 1KH2A 3GD7A 4LYAA 5TQ2A 5DISB 5B1YA 5IVHA 4HCJA 3SM9A 1I6MA 2BFNA 3PL5A 4LJAA 3L0ZA 5FX2A 2YBEA 4RS3A 1JQ3A 1V5GA 2WSYB 5FA8A 2I76A 3TZQA 1RPNA 1C9NA 3UBTA 4AB1A 2ZJ2A 4ZRMA 1EJ0A 3R9WA 2BM8A 2XUKA 3DXYA 1ZH6A 1KU0A 2QQ0A 5CX1A 3V55A 5EE9A 3ZE7A 2H65A 3H1TA 4CV2A 1HDZA 1M2HA 3LY9A 4J0DA 1E2NA 2G63A 3EMBA 3UEOA 3MHPA 5LP1A 4KQHA 1SU4A 1EFPB 4WXHA 2WF8A 1EP2B 4B45A 4Q3AA 4UCFA 2DBQA 5EJFA 2VYCA 1WXEA 1M67A 2ZSUA 2RGDA 5HVNA 4TSFD 4JEIA 4CNBA 2PUVA 1V9SA 2QGZA 3JQAA 2P2ZA 3RYTC 3RFUA 1FK8A 1E8DA 4QBHA 2QYTA 3H84A 4IHJB 1DEHA 1E62A 3M1AA 4W99A 1F4LA 2Q9BA 2GJKA 1QYWA 4I8DA 2CHQA 3LHDA 2EFDB 2GJ4A 4UUOA 4F6LA 4CLOA 3WBJA 2FDCA 3HUEA 3AVXA 3GQBB 4MIOA 1JSLA 1CEXA 5AM0A 1NXQA 2ZI9A 4IINA 3MCWA 4MLDA 4DDWA 2DR0A 4FNGA 1XMJA 2E89A 3HB9A 2HIHA 2POQX 4RUKA 5AVQA 5IX8A 5JY1A 3K09C 1BH2A 1NR5A 8LDHA 1YE8A 1VI2A 1P3JA 2JRCA 3NHWA 3KWFA 2GS9A 3PR1A 1QMGA 3U3ZA 5G1NA 3AB8A 2V8OA 3U4QA 2J9YB 5FNVB 4DL9A 1KOFA 4JI4B 1LNQA 4F56A 4Y0NA 1I0LA 4Z4QA 4X54A 1QTIA 3ZDAA 2GSDA 2GWRA 2ECOA 4MW1A 3B70A 3HNRA 4ZI3A 3RGWS 5G2OA 1U1DA 1HH4A 1JEDA 1YBHA 1SMKA 2RK4A 3DHVA 3DUFB 2BGNA 4XIJA 1B6SA 1Q44A 3IAFA 3IKLA 5FL7D 5TQVA 4BMZA 4YAIA 3QNMA 4N7BA 5B37A 3EFHA 1MH1A 4F3YA 2CJWB 1TUBA 5JCXA 3JASB 4JL5A 3IHKA 1EVLA 1C0IA 4OXNA 4QIHA 4US0R 1RW4A 3Q6NA 4D98A 4M0CA 4J3NA 1IXYA 2F43A 4L85A 2NUAA 3DH0A 1CV2A 1KAGA 4OOFA 3TGPA 1Z22A 1O97D 4P7JA 1K7FB 3GW8A 1E6WA 2YX1A 3KETA 4YO7A 3T1TA 4GPBA 3A32A 3QEMA 4IVQA 4REOA 4WKNA 2Y1FA 1HDEA 1YS6A 3D6HA 2D5IA 3W4JA 4CEHA 1C1YA 3GUYA 3UPTA 1R12A 2GEVA 2DAPA 3JPWA 3PFCA 4X1YA 1ZJ4A 4RPGA 1IE3A 2QLJA 4IGEA 2BUCA 2JFOA 3BIFA 3OQ6A 4DV7B 2Z83A 3AVQA 4GPEA 2VLIA 4YV2A 1Z0AA 1M1ZA 1P7PA 1N5DA 3LZ6A 2IOFK 3OQIB 3W6UA 2LDBA 2H4HA 4KWTA 1UEJA 4O08A 4Y6LA 3ZVRA 1NW9B 3BB4A 1ESEA 1SG6A 4HMQA 4BLWA 1P2GA 1QBGA 1RIFA 4C7BA 4A8PA 1YDWA 3HYSA 1D2GA 3T7SA 4L8LA 4BTLA 3MWJA 1SKAA 4EFKA 3EVGA 2QRVA 4JVNA 3FNGA 1CUGA 3S2GA 3TPZA 4QTZA 2C7QA 2QRPA 4CQNA 3R5XA 1YVRA 2QBYA 2GVZC 1YMUA 1T15A 5EA2A 3NBZC 4KJZA 1PSDA 2K7FA 3MRVA 3O2NA 3O90A 5AVYA 4MGIR 3V4ZA 5EKDA 3KJGA 4O2RA 1UT8A 2B61A 3B6ZA 4EKGA 3RJZA 1BHJA 2H54A 3RB8A 3CRQA 2QE7D 5IXJA 1DBSA 2JLUA 3WG9A 4HAOA 2XRZA 2O3TA 4KRGA 5BT8A 2G9ZA 3EMVA 1F17A 4O4HB 4XQEA 4A8TA 8GPBA 3NCHA 3DOIA 4MMZB 1JLKA 1ZLYA 1ZI9A 4N54A 3LA8A 3QBDA 4O2BF 2C3UA 2VDUE 4I3HA 4IIVA 4W7IA 3EFOB 1R66A 3GLKA 1UP6A 4MVJI 5K8UA 1KAMA 5AI4A 1RBMA 1PJ4A 2VNJA 4HWPA 2NSDA 1XYVA 3ELUA 4DREA 4DARA 1NV9A 3E7DA 1KI4A 2HBQA 3ILVA 5E4JA 4ZEVA 5FPKA 2V03A 3FTFA 2NQ8A 4TM7A 3T5CA 3DF9A 4DLTA 3QU2A 3QYPA 5ITSA 2H0AA 2B92A 5MN4A 4IEFB 4KR3A 4PCUA 2IUFA 1P2SA 4QQ8A 1MRSA 3TR6A 1Q84A 3MA0A 2JH3A 4YJ2F 4YCBA 3FLMA 1X7ZB 2IU0A 1D2CA 1UJ2A 2X3YA 4X1OA 3FUCA 1RMQA 3JWHA 3E9EA 2XVMA 4V0ME 3STUA 3GDHA 2WNSA 3VDRA 5T64A 1FXUA 2R68A 3F7OA 3VH4A 4AS3A 3DB2A 4DT1B 4IGFA 3I61A 2BFEB 1AUPA 3BCRA 4UEKA 4JC8A 4ZCLA 5FOUA 2XE4A 3VUFA 2VJCA 2NX2A 5BMOA 4JUIA 4DAOA 4KKXB 1T36A 1XP8A 1VE3A 3X1MA 4BKUA 3HCEA 1UWVA 4BWYA 2GK6A 2WF7A 3LA6A 3KDSE 2PMBA 1VE5A 4RD6A 4NNPA 4C1BA 3HYRA 3ZBTA 5JSQA 1NATA 2BF7A 4HQNA 4MI9A 1P18A 4LY6A 5ENDA 2J31A 2C61A 1KPIA 4V38A 1TECE 4B3JA 2A94A 3EE6A 2A5JA 3DC2A 3HLYA 3EOZA 2YJ5A 1Q7EA 2O6LA 3PGKA 4MKZA 2ACVA 4QBFA 4D9GA 1O54A 1XX6A 2O5CA 4Y9RA 1W4BA 1ISSA 2ATCA 4LY0A 2FPLA 2O7SA 4Y2GA 2ISSD 4ZN6A 4J3FA 5FPPA 3H04A 1E3EA 3AEKB 4D6YA 3D8NA 5JJKA 1SHKA 3HJCA 4L5AA 2G9NA 1OOEA 1P1HA 1FMLA 4GNRA 3R0QA 5B6JA 3GG2A 4FGKA 4V0LA 1WVGA 1WVIA 3JD2A 4XVUA 4D9HA 5D8DA 2OXTA 2IIVA 1P9RA 4TYPA 1MQ8B 4JOSA 2FMTA 4K6KA 1MA3A 1YS1X 2DPGA 3PJDA 4D9JA 1SM4A 1SHTX 1K8YB 1O6BA 2X14A 3LT4A 4C3ZA 4JXZA 4CM1A 4Z4CA 1SBTA 5FUYA 2AI1A 4HZGA 4UVHA 1MFPA 3VHXA 2OCLA 2PWBA 1NV8A 5I47A 3U7QB 2OPBA 4DQ0A 1JAYA 3A1UA 2IF0A 3E6AA 1TQ8A 4C04A 1YQXA 2QMQA 3DVRX 4RJKA 4A27A 4E6EA 3G5MA 4GM1A 3TW8A 3O7MA 3ZIAD 4KYIB 5BN3B 4DR5B 3CUEF 1J2UA 5ALFA 2R8ZA 4M46A 4L8YA 2B4KA 4KYVA 5TQ2B 5BSTA 3ZZTA 4CL8A 4LWPA 4YECA 2WJWA 2ZBQA 2R6FA 3TMAA 2NO0A 1TVKA 3WWPA 3Q6MA 2O1XA 4F91B 5JDIC 2AC7A 3VJKA 3MD0A 4TS1A 3GEGA 1W25A 2ABWA 3H2IA 2Y1EA 3RS8A 1T4DA 4YCJA 5JCZA 4HNSA 2PBZA 1UFVA 2X1HA 4L76A 2GVDC 1C3OA 1XDSA 1A4XA 4QARA 4XIIA 1KSGA 4WV3A 1PJQA 4GH5A 4UHBA 3TBHA 1J21A 1EWVA 2GK4A 1QLWA 3A9UA 4X45A 3RVSA 1DKQA 1I30A 3O2QB 2PO5A 2P0YA 1KQPA 3HSSA 1H8HD 5ADWA 2GPWA 5GY7A 4DRXA 3C8MA 1L7AA 4BE7B 2P35A 4MGKR 5ISMA 3NJ4A 2CFRA 1ZGGA 3CF2A 2GXSA 3DMGA 3K0BA 3L4BA 1X13A 3EGOA 2I67A 4KH1A 1M6WA 2R25B 3ZY2A 4NQRA 1R4MA 3AYZB 5DX1A 5CT4A 3SMQA 1W44A 3W90A 3K92A 5B2ZA 4CLOB 1OWOA 1OYWA 5DHQA 4C2BA 4FFPA 1E3WA 1Q7GA 4COKA 4LVCA 3WXMA 1G63A 2IL1A 2V65A 2XGGA 2O2HA 5L6LB 3QI2A 5CBKA 1ZUHA 2RBEA 3VR3D 3NAMA 3QY9A 1UL1X 3VGJA 3W1EA 4HDAA 1R0RE 2Y0PA 3IILA 1JKFA 3P9RA 4UNPA 4BV2A 2CHVA 3TF5A 3BTSA 2VT3A 1GJRA 3R24A 1H6BA 1YONA 4NRDA 4P4NA 4R1QA 3RC9A 1MOQA 1VB3A 1X94A 1ZITA 2V7PA 3U4QB 2YZGA 3MTDA 1FDOA 4DG5A 4C7JA 4C3VA 4KVZA 4ZFNA 5EHGA 1K6JA 1V9LA 3WI7A 4F38A 1NY6A 1X77A 3ORFA 5LWQA 1OFVA 4JIGA 3DZKA 1VLJA 2O2EA 2X5OA 2G5PA 4NCIA 5CB4B 4H3VA 3VYWA 8MHTA 2GXAA 3W8RA 1WD5A 3H11A 3N9IA 4F85A 2A5YB 1O96A 3N2ZB 1HDCA 3UXYA 4JL6A 4BU0A 2YYZA 4UTNA 5HIIA 5EGSA 1ODCA 4O4IF 2ZRHA 1M54A 1U04A 2X23A 4WXPA 2CUTA 1IQ0A 1QFYA 2F43B 3K6JA 4JYBA 3VPHA 3W5AA 4C89A 2AI2A 3KR0A 4LV5B 4F9FA 2CEKA 1WXFA 1RE1A 3H8VA 4HN4B 2VAMA 4PONA 3TNDA 1F2DA 1P29A 2QRLA 1RZVA 3QEMB 4IFIA 3VDMA 4KRFA 3FVVA 1L5NA 1XTUA 4Q34A 5JNVA 4EHAA 1Q57A 1FXWF 3ZUGA 4X1YB 5EE5B 4F92B 3ZPXA 1DGQA 5IFLA 5AVRA 2ENUA 3BWCA 5HKKD 1J8DA 5KNCA 2YWEA 3MAJA 3RO7A 4ZICA 1RXWA 3GCDA 4AMYA 3LT5A 1O94D 3GH1A 4UUNA 3HACA 1VRVA 3IP8A 1JXOA 2EGHA 4L6CA 4BO4A 1UT5A 1YD7A 3FUXA 4ZYWA 2VTEA 2ZUBA 4AO6A 3AUJB 3B36A 2BSQA 3DXXA 3E7FA 2Q4EA 3STVA 1PVVA 5JNUA 4CG1A 4BUJA 2L2QA 1ZAYA 4COOA 4E14A 3L6BA 1PUXA 1W6RA 4DNPA 3QVGA 4J0CA 3THYB 4FE3A 4EKNB 5AOBA 1Z4IA 2LV8A 2GETA 2IP4A 6YASA 2RGNC 4D9MA 3R3XA 3W4KA 3B1WA 1OX5A 4Q9KA 4L78A 2F62A 3HBMA 4DQLA 2QBYB 4JZKA 2PNFA 1SIUA 1NJSA 4C7XA 2CNDA 1U3GA 2HV9A 3K1JA 4UE3S 1TYDE 3MSXA 3RUAA 4AUMA 4Z7JA 5I7RA 2CK3D 1Y5IA 2POCA 2ZCJA 3CO5A 4Q3NA 2Y76A 1Q91A 1VPWA 1ZWLA 4TVBA 4TL9A 3WB0A 3SYNA 3MFYA 3OCJA 3LWNA 1AHNA 2HUPA 1QKKA 4YONB 4IZOA 2BI4A 2HYDA 3G49A 3SK0A 4CMIA 3O3MB 2XIJA 3ZHXA 1AMNA 1KDYA 2Y2UA 4W5QA 4WNIA 1E9AA 1KZYC 3AJEA 2JK1A 1PDOA 5B6PA 5TY0A 1KWKA 5K7SA 1M34B 2EHDA 4L07A 2K2WA 2XZOA 4Q05A 1ZOIA 1TEHA 3V97A 3LH5A 1T26A 4G4GA 5AYVA 1BD3A 1VJCA 1QGOA 2ATXA 4PLZA 4BTVA 5J2TA 3DEJA 3K6SA 2C0QA 3GGOA 3F46A 3VR4A 2CXPA 4BP1A 4OFWA 4KYTA 4WFIA 4FDTA 2RK3A 1N75A 2GEBA 1MNAA 1Z4MA 5BMVF 4AJPA 2CXTA 1QHHA 1RPAA 5LBIA 1N4AA 4EPTA 1YGPA 2Q2VA 3JTMA 3PR2B 2OCBA 3H2BA 2RH4A 3AHJA 5MF6A 5FF9A 4DCNA 2NUBA 2Q5CA 4HEQA 2EBHX 1UDXA 4G1MB 4P84A 3SICE 1H2YA 4QXQA 2PEYA 1SCAA 1XRLA 3G23A 2RJNA 4EPYA 2XZPA 4Q9IA 3P9QA 2V6GA 3ANMA 4GLOA 3H2KA 4E70A 3E8SA 4R9UC 2VZEA 3TYXA 1T36B 3IEMA 2VP6A 3KEOA 4I46A 4IXNA 1E0SA 4EAAA 2GD0A 4LXHA 1PR5A 4CG0A 2Z3ZA 1NP7A 1K4KA 3FB1A 5K01A 3MCVA 4Z0PA 1SURA 1IHDA 4ZO8A 2AL7A 4IWNA 4OB8A 1KYIA 1L7OA 2OGWA 4R2JA 2EGGA 1O3YA 3U31A 2DHCA 1UEIA 1K8QA 2UYYA 3LPLA 3P9PA 3UGQA 4BZWA 5AICA 3EYAA 5H8WA 2QM3A 3TVDA 1EQUA 2PS9A 4QT0A 1N7GA 3M1YA 4AS2A 3PNLA 3C7CB 3K5WA 4DIOA 3BTOA 1NJ1A 4B4VA 1AKNA 1PHPA 4ARBA 4CQLA 5IJ0A 2C00A 1Z35A 1EP1B 2XUIA 3CLTD 3IEIA 4FW8A 4MVWA 4YUZA 3BWYA 5CVEA 2YHSA 1KQOA 4IJQA 3KSAC 3E23A 3WQHA 3CONA 3OJOA 1Y1KE 3JU3A 4CN8A 3GBPA 1Y89A 3QNWA 5EYPA 1JF8A 1L5HA 3T3EA 3K71B 4PXYA 1S9DA 3KZ1E 1L3BA 4RYDA 1Y33E 1NDUA 2KHZA 1H93A 1U8XX 2V7QA 2EX4A 1JR3E 1TRHA 4HJRA 2JIQA 2ZRNA 4RK6A 3WSTA 1Y5LA 1TAQA 3LHFA 3KFLA 5C4GB 1RXEA 1WDMA 3EWIA 3UICA 4MWZA 3KAKA 3VHXB 4MUGA 1BOFA 3IBGA 1W29A 2PSHA 3F90A 3LW8A 1LX7A 2C9OA 4ETIA 2ZUFA 3O1LA 2P69A 2G5GX 2I80A 2PJUA 3EVFA 5AXCA 1A7JA 2SNIE 1CS4C 4JB3A 5L4NA 2BE7A 4KN5A 2WLTA 1NBAA 2DQYA 2R5NA 3JWPA 1JDNA 3SBXA 3TW8B 1EE9A 4BB5A 3RSOA 4AJHA 4M9CA 3SSAA 2JFNA 3GCZA 1OI2A 3G5UA 4UHDA 5FOQA 2F55A 1ZNQO 2O3JA 4D4LA 1TVKB 4H7JA 4KU4A 3KOWA 4BVAA 3E15A 1PWEA 2VDJA 5DM0A 3I2FA 1XGKA 3VR5A 3S7TA 1UWCA 3ZE8A 2PMEA 2LE0A 5CXQA 3DOJA 3OY7A 4MCJA 4R7GA 4RLSA 4P3PA 3DKVA 3VDQA 4IH1A 2YY7A 3JQCA 1C3OB 2JGFA 1G5IA 3FYDA 1IN8A 1TZMA 1PO7A 2ZRLA 3FGPA 3GUZA 3HKEA 3KLBA 3OJ0A 3NXSA 2P11A 5DM2A 3W5CA 2O8CA 2R87A 2A5FA 1IJFA 3TTWA 2Z57A 1ZUNA 4PHTA 1RBZA 2LRHA 4JEMA 4YUAA 3CZMA 4F8YA 1KR2A 3DE0X 3GRYA 4FC6A 4B6EA 4UNSA 3MERA 1PJTA 4G56A 3NV7A 5GADl 2JGDB 5A7GA 2C82A 2QRUA 3FFXA 2FW1A 5IC5A 4DHEA 1K4YA 1OXUA 1POWA 5YASA 5K0TA 2VYNA 4F3NA 1IMOA 3RYCA 1L0BA 4CU2A 1HF3A 3FWHA 3HS3A 1O6ZA 2VXBA 3EG5A 3PC8A 1E3WB 1R6AA 1EFVB 1JV2B 5EQDA 3OQVA 2ZIXB 5U9CA 2H5IA 2AE2A 3OFVA 3QP9A 2LIPA 5D5PA 4Z3KA 1JLRA 4BNYA 4WQMA 4V24A 4FDAA 2ZROA 3IAAA 3I6BA 3V3TA 1XCJA 5AJWA 1UZAA 1JE0A 3LCRA 4U63A 1JDVA 3QIAA 4BJHB 1NMYA 5CT8A 5I4BA 4IGIA 1TYZA 3H9GA 5B7PA 1SCKA 2FJUA 1P1KA 1SUSA 2Y1WA 3QYAA 4CETA 1FJHA 2KBEA 1QFXA 3CQ9A 1L2TA 1QFMA 1W9MA 4MKFA 5C1IA 5A1TA 3JCZA 4RE5A 4FGUA 5BYJA 3F97A 3L6OO 2ZKIA 1UQTA 4K2AA 2VDOB 4G1FA 2P5YA 3L0DA 3LC2O 3N05A 4DMMA 4CKBA 4E3WA 4NQZA 1IPHA 2R00C 4PGHA 4EJ0A 3BWXA 1N4DA 3QA3E 4F6CA 1CQWA 4NARA 1VL6A 5LYJF 1K8ZB 1XI2A 2BELA 3SNHA 4EB6B 1RXUA 3GZ4A 3RJ5A 5JT1A 3Q8KA 1ELOA 4MW6A 4RMIA 5TE9A 4BKQA 5E3JA 1B6RA 1P7CA 4RK7A 3W2FA 4LF7B 1OBCA 1EQAA 5CLHA 1AGYA 1A4IA 1ZD1A 4LHWA 1NR7A 4DB4A 3ZVMA 4L3OA 4TWZA 1Q2XA 3IDSA 4Q02A 3SLRA 4TMKA 2GBLA 3CBQA 1N2GA 4DLUA 3QEBZ 1Y5MA 4TTRA 3ANNA 3ZDZB 4BAZA 2RG1A 4HN9A 4KQMA 4QDZA 4GYKA 1JAHA 3ZQ4A 3BIOA 3KYIB 1QAOA 3BQNB 4P9NA 3BMXA 3CVWA 1II9A 3WGZA 3BM5A 3G1WA 5ELXA 3VO2A 4JWKA 4HQ0A 4DJTA 4CRWB 5K0EA 3K0CC 4G07A 2WHYA 1NVKA 4N9WA 4OXQA 4ZOLB 1O7JA 2PCJA 2IVZA 4BQPA 2WFMA 3JAKA 3N0TA 5EXPA 2R4QA 4C0AC 5KNBA 2F3TA 3EPRA 4QOJA 3CCCA 3NTQA 4R81A 4UKDA 4P2BA 1L5RA 2VHZA 3OTHA 1B0AA 5TLSA 1QGAA 1EVZA 2AK2A 5H82A 2ZUTA 5IZCC 1GCUA 3KTAA 3CT6A 1LWOA 4PNPA 3ABIA 3JYOA 4MJ3A 3V1TC 2JGMA 2KPOA 4JITA 3RIYA 1ICEA 3VV2A 1TO2E 1NYRA 1KZ4A 1P4RA 1R5OA 2HCBA 2HOQA 2QS9A 3P5SA 2FRDC 2P62A 3HFRA 3LLCA 3R0JA 4GL4A 4WOKA 5C8DA 3KL2A 1IPEA 1PGJA 4BFUA 5JISA 1CE8B 1M0WA 1IC6A 1QUEA 4WIAA 3HUTA 5LB4A 5KZMB 4KQ9A 3EQ9A 3EIUA 1GYPA 4S1NA 4EKDA 2PD3A 3LX4A 3ZKAA 4DUYB 3FYCA 4G0QA 4V03A 3QKUA 1XZMA 1B7GO 3NWJA 5DBGA 4BFVA 1OXKB 5H4HA 1K27A 3GA5A 3MWGA 2BKEA 3E5RA 4PLYA 3ZE2B 2V3CC 5K6TA 4MS3B 4OUKX 1GOTA 2D4AA 3NT2A 5GVRA 4CCYB 1GUBA 3GAMA 1JWAB 4P4UA 2P4QA 1JNYA 5HILA 4IDBA 2OB1A 5E9QA 1L5LA 1AKVA 2LDXA 4KVGA 3G8AA 2OM2A 1K2WA 1RWOA 2C7BA 2HJ9A 3HABA 4YIKA 2IOHA 2IOYA 4OQXA 4BKRA 1VHTA 1T3LA 2WKSA 5KNDA 2FEOA 2W2TA 4F4FA 5J2TB 2XXAB 5JO9A 3ETDA 3SHQA 5B12A 3LC7O 1GPUA 3QTBA 2O2CA 3DEFA 3IAXA 4EP1A 4Y2PA 4BLRA 3U5ZB 5F3RA 3KUUA 4H59A 1TM1E 3OTIA 2XVZA 4Q18A 4AZTA 4EJSC 5BQXA 4LV6A 4WSOA 2OC4A 2VAPA 2VHVA 3T99A 5AVUA 3IHLA 3SYTA 3QXXA 4CN9A 4CMAA 2FOXA 3LVBA 2GCEA 2WWGA 3ME5A 2ZB2A 4O63O 2PRJA 3UWKA 2JGAA 2Q0HA 4UU0A 4OMFG 4PW0A 4PCAA 1RKBA 1FU7A 1KZ7B 1NA5A 1SQ6A 4Y2TA 1FFHA 2BFWA 1EDBA 2DHEA 4LDRA 5LKAA 4UTXA 1YKFA 4G01B 5KSWB 3UMRA 4N6GA 1AB5A 3A14A 3G1TA 1DKNA 3FM9A 4UE2A 1V96A 3TZ6A 3HYNA 4PC7A 5CDFA 4OHRA 2IIBA 4TX1A 1QRSA 4JKIA 4MKGA 1I6KA 1N6HA 1EEHA 1YDEA 4X84A 3T3OA 2Z4TA 3H8SA 4WFQA 3S40A 1T3ZA 5DH9A 5ESDA 3W5HA 1AKEA 4E5YA 4UFPA 2OAEA 3I6IA 1MO4A 4H27A 4MRMA 3VR0A 4ZYVA 4Q1DA 3NDJA 2ZM6B 1LC3A 5CDHA 3AONB 1EMDA 4KQCA 1EFTA 2JZOA 2K4MA 5D7NA 1MU0A 3WNBA 3VC2A 5I9MA 2R1ZA 4XCQA 4CQLB 4H7DA 3OE7A 3HGQA 3P1JA 1KEKA 2G9VA 1XHEA 1J2TA 2Q0SA 5AHXA 5B1IA 5LYJA 5KUTA 3IR6A 1HX7A 6GPBA 5EYPB 4D4IA 1F7VA 1L5HB 5F51A 5FBQB 4K86A 1QZUA 4LJKA 1KY2A 1GQRA 2FHSA 2AC4A 3E8MA 5EESA 3RPEA 3QG5A 2OENG 4OGWA 2Q7XA 5CH5A 3WLFA 1MAHA 3DR5A 4AFNA 5CTJA 3OPNA 1HE5A 1PI3A 5IBQA 4CTNA 3BHNA 3D6VA 4ESOA 4AECA 4DHWA 1QZZA 4MAFA 4CIYA 2FMXA 5ICMA 3L93A 4FBGA 3KO8A 3I4FA 4MPTA 1NYQA 4N41A 2ZI7A 2A35A 4NDZA 3DWFA 1M1NB 3QFSA 3K9BA 3GELA 1J2YA 2QVXX 2QTTA 4Z0TA 3WMEA 3BQ9A 1D4AA 1W36B 3IPCA 3MN1A 4P3NA 5CCXA 1Z4JA 4PSVA 5FO0A 1WIWA 2XNDA 2C5LA 1SG9A 3VSBA 3DEAA 2FRDA 3MRSA 1DIAA 3OIGA 2IOQA 2I99A 4DM7A 1X92A 5A7FA 5LU9A 4TXLA 3EULA 2XH8A 3ORRA 4NABA 3GYBA 1Z9BA 1FEZA 5LQNA 5M2QA 3ZX5A 1IAVA 1Z33A 3NYIA 3QWHA 1NW8A 1TTQB 5DBIA 3E9ZA 3RLIA 1S8NA 4E21A 1LV7A 1NOJA 1PBTA 2CLSA 1PL8A 4HDKB 4CG2A 4BX2A 3CC8A 4M98A 1JMVA 3PUKA 4ZOEA 3X3HA 2CVHA 1ZUNB 3IT0A 3S1LA 3UMVA 1Y9JA 2ES4A 2IGBA 1YRWA 3GBSA 1H1DA 4N0EA 5IP5A 4BO8A 3HRHA 3WDLA 1MG5A 4L1KA 2HEIA 2RGBA 4CVNA 1CEQA 3ZI4A 3QUTA 1LS6A 3DMNA 1X2BA 3O1JC 4MUJA 3ZHSA 3AK4A 1OIWA 3RYCB 2DLDA 3OTGA 3S81A 2IODA 3TINA 1EE2A 4Q3CA 4UJ5A 3CLVA 1E1RA 2QRKA 4OXXA 3R6WA 4F4HA 221PA 3AESB 5H3CA 4HEA6 1ZGHA 3RV3A 4EBFA 2AEJA 2XQJA 4KNVA 4FFLA 4PYRA 3TCNA 4P81A 3RU7A 3VH1A 3F7TA 1ECBA 3L0SA 2HJWA 4F60A 2D0PB 3EZYA 1T3GA 3NOOA 4GM4A 2BAGA 2ASEA 1YI8A 4ZVPA 1JBQA 4DV4B 4DSZA 1G2QA 1MV5A 3V4SA 3AFNA 3GLRA 1JPUA 2FX3A 4DXHA 1TCVA 3Q2KA 3HU1A 1G8HA 5TJHA 1IU9A 4EYEA 1N1MA 5HF8A 2YQ4A 1Y1RA 1E1CA 3DTVB 4EHBA 1DRUA 1QOZA 3ASZA 3J81A 1EUYA 1ML3A 1NVVQ 4L5IA 1DXOA 1U7DA 4O2LA 5ER6A 4BQEA 2HSGA 2F9MA 3EF1A 4U0JA 4EB8A 3MGBA 1I51A 2EBWA 3VRHA 3M6MD 4KXUA 1SUWA 1XNJA 1NLFA 1G8GA 1FRFS 3AETA 4HBZA 4ZCPA 1IG3A 3TR0A 2C59A 3IOBA 1PUIA 3ICPA 4KITB 4KC0A 3FDJA 3THRA 3W9YA 3LUCA 4H4EA 4J1TC 4DUPA 4F3CA 4UM9B 3FPSA 3RS9A 1QU3A 1X7XA 1NHWA 1XWFA 2J9FA 3FI9A 4GI5A 4UHHA 3FOBA 5AJUA 2ZU6A 2PJZA 3FJ1A 3SFTA 4V1CI 2Y1DA 4WZAE 4F9TA 3JQFC 4W8HA 3EPLA 1HT0A 2Z2XA 3DCYA 2O0KA 3CNHA 3PX7A 2WHRA 5DPMA 1O8BA 2HHCA 4C14A 1L1RA 2X5JO 1G5TA 4I50F 3TNYA 2EWVA 2ILVA 3KC2A 3VVLA 2AI3A 4E15A 4ZIRA 5TNXA 3IT3A 5HK9A 2WE8A 3IUPA 3RS4A 4B74A 4CM7A 4XCXA 1ONBA 4OIMA 3PVSA 1R0BA 3WZLA 2FMUA 3AVTA 5IUKC 4EVSA 3KTAB 3IQIX 3BXXA 4K28A 1ILWA 3LU1A 2W2KA 3CUSA 1E4YA 3WO1A 3RT9A 3T3PB 4DQXA 3MJVA 4BP9A 5A03A 3DT8A 1GZDA 1Z56C 2PS0A 4JKOA 2XUAA 5GJBA 2IYZA 1Q3KA 2C54A 3CLSD 4RHYA 2GFHA 4I66A 4QNMA 3LRXA 1DAIA 3V7UA 5DNUA 3PUZA 4Z5XA 1EUQA 4FZ5A 2C2WA 1RKQA 4ZMRA 3HCCA 4WKCA 4KAJA 4QG7A 1I36A 4D02A 3QHAA 3ZYZA 4ADSG 4HLUC 4B3MB 1SVOA 1AQ6A 3SIXA 4B4OA 2I3DA 5DLDA 4LE0A 3LQRA 4U7HA 4AJ9A 2VRCD 4ENTA 5JAMA 5IDWA 2QX9A 2JBHA 2BM1A 3ZIDA 2G17A 1BJKA 1ISMA 1XDUA 2Q9UA 4TVOA 3T15A 1VIAA 2VT2A 1C1XA 2JAUA 4RTNA 3EPPA 3W6ZA 4NS4A 3PD7A 5ES4B 1Z25A 2NAPA 4JMPA 1L8XA 3BXPA 1VMDA 4LDZA 1NF3A 3DMFA 1P39A 4GPIB 1QYXA 4GZMA 4BFSA 2ICAA 9LDBA 1KYVA 3CX8A 5EUCA 1TMOA 1U8YA 1XQ6A 2DTEA 3LHKA 3QVSA 3S7ZA 4PGMA 2B8NA 2JAPA 1LNZA 4FDMA 1JJVA 5LB2A 1EK2A 1WPXA 2IYWA 3NNSA 2YN2A 3ZC3A 4BATA 3RFXA 4D79A 1EXVA 3U60B 1ORDA 1L4YA 3OJFA 1M2VA 1FDVA 2PT9A 3PQFA 3ZNOA 3FLBA 4OHBA 2P2DA 4ZCMA 3KYDA 4UOZA 2Y1LA 2R86A 2PBFA 2YIMA 4I9NA 3CURA 4WBSA 3UTDA 3KSRA 4IMPA 2I6FA 4NNOA 4Q9AA 1BVHA 2PIDA 4RSRA 2J0QA 2ZM5A 1V5FA 4AC9A 3GLGA 3BK7A 2FB9A 2P6MA 4F3RA 5IEBA 3U7GA 5A3VA 4E1AA 1SHLA 1U7ZA 1OCEA 4MWDA 1FUIA 4O0LA 1X80A 2ZJ1A 2ZT5A 5MFZA 2YHIA 2QMYA 1TADA 3EF0A 2EKDA 2H57A 4K9RA 4N3AA 4RQAA 2PY6A 3KB2A 4K6FA 3C41J 3O4FA 1Q5PA 5JY6A 3THWA 1H05A 2YJNA 3UENA 1VPLA 3W05A 1PLJA 1V1MA 1L7VC 1NMSA 3PE4A 1V6SA 2YRWA 4EMBA 4S05A 3QWAA 3HR7A 3IALA 1U0NA 4LSWA 2ODNA 3ZXSA 3A4YA 5IJXA 1A8UA 9ABPA 3I8OA 3OOSA 1MB9A 1IEQA 3IT1A 1HK7A 3ADKA 1XA0A 1QR6A 1UFOA 2GPNA 2W0SA 4V0NA 2C0PA 4JI2B 3HJTA 3DP9A 1DDGA 4I9FA 1IG0A 3PHCA 1I5EA 3REFA 1OFGA 4RZSA 5DFAA 2RKWA 1Q1GA 2QD4A 3CF6R 4XXHA 1SXGA 2F8TA 1YNSA 3KHKA 3MNFA 1RKUA 1Z2DA 4IVRA 3SEAA 4B7UA 5C8ZA 5M04A 1AZTA 1XTQA 4GPZA 3GEPA 3PFKA 4R8RA 2R6DA 1D0IA 4N3BA 1DXYA 1NBIA 4X85A 4ZOBA 2HT1A 2AMYA 3QX7A 3T38A 5EJMA 1P6QA 3HWX1 1LSSA 2C3OA 2R9VA 3T1OA 4BVLA 2QUKA 5K0JA 2AMJA 1ZJ5A 4GDMA 5G0WA 4ESVA 1A9OA 1XFAA 4ZVOA 1KSHA 3ESZA 1B2RA 4KP7A 4WESB 3B53X 3ADBA 3FJOA 1BAPA 3CY6A 2GUWA 2JJYA 4O1HA 3R6LA 5CT5A 4HQOA 3U37A 1N36B 2P75A 4XB2A 2NU8B 3FTCA 1GSIA 1Z4KA 4XQGA 5KSPA 4KPFC 3WGMA 3GMSA 1M75A 4WAUA 4BMDA 3N86A 4KCGA 3M5PA 4GQAA 4BFZA 2PZ8A 3H4IA 5EUMA 1H94A 1KJJA 2E55A 3DLIA 3KQUA 3NHYA 3PQEA 4KOAA 4IIYA 1IHYA 2JFFA 2YVKA 1JB1A 2ODEA 1WDKA 2YWFA 3C24A 3RVOA 3NDBB 3V8RA 4MIKA 4JI8B 3BB3A 1KVTA 4Z54A 2IYSA 2B94A 2JD1A 1GGEA 2JJ1D 3EQZA 3EQ7A 4H1WA 4K40A 4WY2A 4DMCA 2FLKA 3EXIA 5CGZA 4AF7A 4HB3A 1KYWA 3O4VA 4MICA 1X6VA 4R5MA 4H60A 4ENQA 1A50B 2AH5A 1YR9A 2O1SA 2Y6VA 3TIVA 1WL8A 1T0PA 5JQGA 3B1YA 1LF0A 2RHRA 1Q11A 3MRTA 2I9PA 1R37A 2Y0EA 3I62A 2FZWA 1O2DA 1L5YA 2WK1A 4MQEA 2IZ6A 2JHFA 3QXSA 1EHCA 1S2GA 1GRVA 1KMHA 1GKIA 2RBGA 2CYAA 3AJAA 1CVIA 3L92A 3LKVA 2FQXA 4U9UA 4ETNA 5LMCA 1AKYA 1D1TA 3WBKA 1Q6ZA 1HYQA 3PEVA 1FIUA 2NPIA 4HBGA 1XEAA 2VUTA 3AM3A 4GSKA 5CUQA 5G4KA 4NC9A 5U4QA 3EPHA 4OHZA 5AK6A 3I05A 4N3GA 2WYVA 3H18A 1SXJE 4F93B 5K6AC 1T4BA 1ZMRA 5LLSA 1N0UA 3PRJA 3UJHA 1AGPA 4IOJA 3PUWA 3DMTC 2PGDA 1E1CB 3ED5A 3C74A 4ENUA 2B4TO 2EAUA 3MCTA 2CXRA 2ZQYA 5CYOA 2B69A 1EZ1A 5CAEA 4XGRA 4ZU1X 1NVUQ 4GYYA 3ZXYA 2QZ9A 3R0VA 5HR5A 3GJ5A 3HBNA 1NVAA 3GVXA 2OOKA 2FMKA 2VF4X 2ZRGA 3K1AA 2M6KA 5A2GA 1LDNA 5DWVA 1C9YA 1M8JA 4QBKA 3C7DB 4FOSA 3AETB 1H2RS 1YE3A 5FA5A 3A3PA 4QECA 4PSAA 3MYYA 3WNQA 4IL5A 3L1KA 3VSEA 1OIXA 4TL6A 2VXCA 2J9FB 3PNKA 1ATIA 3VJLA 1KMMA 4D4HA 1TYEB 1K2VN 2ODBA 3BRSA 3TTYA 1ZM9A 1YXMA 3U1TA 3CUUA 1ZSNA 5I7HA 2XMCA 3HFSA 4LIPD 4Q21A 1RKXA 4S1WA 1ISGA 1G7RA 1O1YA 1R8YA 4RK1A 2AXQA 3EY4A 3GA7A 4TKVA 4QICA 3AOEC 2G9QA 1ACMA 2YFKA 2ZSKA 1QFJA 4L9RA 5JYDA 4OATA 1TLTA 6NULA 5DHAA 2FNAA 1R10A 2OV4A 1CPYA 4GNKA 3ZE1B 4ZIRB 3OHSX 1DXHA 2OBBA 2Q99A 4F11A 4BN5A 1EHIA 2W42A 4EF4A 3MLBA 3V8NA 1E0DA 2ZWVA 1T0UA 1WQ4A 3A3NA 4ZQHA 4RTOA 1Z0FA 4DR1B 2B20A 4CFYA 3VU1A 2QNBA 4JK3A 1H9AA 1JPVA 2YWJA 2H1CA 1BJTA 3AMVA 3EZ9A 2A9OA 1TDJA 2QUBA 1CJUC 1J8FA 1I7PA 1XZIA 2CB0A 4CIAA 3ZTWA 4KXVA 2AD1A 1K0UA 1K5GA 1Y6QA 2I1QA 2EZ8A 2Q21A 2VK4A 3ISJA 5GV7A 1FC0A 4ZOQI 2VPIA 3ADPA 3PUXA 3BUSA 1SBYA 3HHPA 1EA7A 4DG8A 3MB8A 1XEWX 2ZI3A 1DEAA 2ZR9A 4JS0A 4RJIA 1DBRA 4FJ1A 3OZVA 3R2JA 4JVOA 4MUKA 2C96A 4IDCA 2VXYA 3LOQA 5H1YA 1FSZA 2E18A 3LWZA 2QWXA 4I08A 4YLYA 4IIUA 5JXHA 1LNSA 2IUYA 2HRCA 1RQLA 3AOGA 3W34A 4F1KA 3ILXA 2B1JA 4DLRA 5C53B 1WCIA 3N6XA 2HRQA 3ZY4A 3RW9A 3CJRA 3RUEA 1YC5A 5I3ZA 2QRGA 5LUBA 3SDSA 3W5SA 1NTRA 1ZN7A 4DZTA 3R0XA 4AYXA 4KGXA 5ICSA 4PR3A 3A6JA 3O8QA 4NBKA 4OM8A 5C8YF 1C1XB 1JW9B 2FWRA 4OI4A 1LZLA 1N3BA 2O2IA 2X3UA 4PANA 4UUAA 3VZDA 4LF5B 4QJ5A 3IUMA 4TQGA 1S02A 3D7MA 2XEDA 3KYJB 2J8ZA 2M32A 1C3JA 1DBWA 3RODA 16PKA 3LT2A 3PEWA 3CFYA 3NYRA 5FUMA 1W36D 5KINB 4FZVA 2QHXA 1V95A 1YACA 3PQCA 3C16C 3M4NA 4E12A 5HQ3B 5JSUA 5F5XA 3DA8A 2HQOA 4DA9A 4UAJA 1DQPA 3DC7A 3I53A 5BQ3A 4K8OA 3EZFA 3DDSA 2BMWA 2D2IA 3PNQA 4JGBA 2W7TA 1XLWA 3S3TA 3WDMA 4A0QA 1NF2A 1GSAA 2JIMA 3UT5A 3LQ4A 4X3OA 2OBLA 3VR5D 4CR8A 2NZVG 3DMTA 3NUQA 4UARA 1ZM2A 1A8HA 3KYDB 1DRVA 3WR5A 2A88A 3O8RA 3IL2A 3EX7C 4OHWA 6AT1A 5ANRB 4BMPB 3K0HA 1FCJA 3CG4A 1KSFX 4INPA 1LPSA 2GYYA 2GMWA 4JJAA 4Y67A 2A9VA 1FTSA 4GBJA 3B3FA 2ONYA 1J2EA 2D2FA 2AN1A 3IBTA 3NBXX 3UJBA 1ZOLA 1ZLXA 2AGVA 4CM6A 1X80B 2DR2A 2YHIB 3Q9UA 4YRTA 2Q3DA 3IUEA 1KOJA 2K7ZA 3R9IA 3VPCA 1R9NA 1B73A 1U5AA 1YRQA 2TMDA 4GD3Q 5AVJA 4YREA 2D5BA 2OVBA 2P5TB 3THWB 4NPAA 4C4TA 2VYND 3V2IA 4L4RA 2EIHA 3ZWKA 5LM3A 3U3KA 4GUAA 4NMLA 2BD0A 1SCBA 4MLPA 2FRVA 3D8BA 3WOVA 2P7HA 3L7NA 3R40A 4P3YA 4JAVC 3JZIA 5AK3A 4J6FA 5ERXA 3NASA 1UJCA 3N75A 2QPOA 3LBIA 1XTTA 3JATA 3AOEA 2NPOA 1W4CA 3WQQA 1TMYA 2DF8A 1Z7WA 4E5NA 4AKEA 2QQGA 3A31A 4GAEA 2O2DA 4E2FA 1OZHA 4G1CA 3HNPA 2DPYA 3ZCSA 5K8JB 2VP9A 4J4HA 4RPIA 1V8BA 1SCIA 2RHDA 3TTXA 1GL6A 3AG6A 2P9QA 5IABA 3DVAB 3GJXC 1DQRA 4DLAA 3DTVD 3RR2A 2ZUSA 3AUXA 1ZJYA 3NFRA 4AURA 3HLTA 2IU4A 5CYGA 4N5MA 1MENA 5IKMA 1QBKC 2NZ8A 4MDEA 3IC5A 4YLGA 2X0DA 2H29A 1LCIA 4CKCB 1CUWA 1JS1X 1MGPA 4Y2HA 4ED9A 4ND2A 3RC8A 1D2HA 3BJMA 4GXTA 2ATEA 4EY3A 5FOVA 5ILGA 5AW0A 1H1LB 3E48A 1Z83A 2EG5A 2N1MA 3NH9A 4Q39A 2H8KA 2NM0A 2NSLA 5KSYA 4PNZA 3TZLA 1X74A 1PT8A 3RDPA 1UJ4A 2XV1A 1AA9A 2WD8A 2VDVE 1U2TA 2J4CA 3AHCA 4UM9D 4ZI2A 1UBTS 1YR8A 5KOJA 1V71A 4ZVMA 1IVYA 5JZOA 2PU7A 4MDFA 1UPFA 2NOAA 4XD2A 3T1NA 3T4UA 3TL2A 3JW8A 4UTPA 2FZ4A 1Q3HA 3L0OA 5C4MA 1M5RA 2FCRA 4KJXA 2GTPA 1OIVA 1KSJA 2P3LA 3FBWA 5HOEA 1GU0A 2IYNA 2OBMA 2V96A 4AJEA 2ARKA 4L16A 3EXIB 5ECGC 2Z1NA 3RBAA 3GY0A 3DJFA 4HQRA 1E1LA 3FPJA 2VG8A 4QUEA 4RZXA 3TI7A 2OV1A 1TGVA 3BRQA 3VNAA 3N8KA 2C42A 4KIWA 3B2NA 5JQGB 2PH3A 4ZC8A 4G63A 5F1YA 4F4UA 3O8CA 3B85A 3GU3A 3IAM6 2W37A 5KNBD 3ZBUA 2CD7A 4ZHQA 3L8DA 4MQEB 4NBLA 5KVQA 4JI6B 5AOCA 2CB9A 4C2AA 1KMHB 5SY6A 5J4KA 5BW4A 3I1JA 3SEZA 3UVEA 3ASVA 2OSBA 4H9GA 1NQTA 2HRZA 4P5EA 1NW4A 5KVVA 2XECA 2Q4DA 3DQPA 3R5TA 3EXHC 5L3SA 3QVTA 2BKXA 2W5UA 4FLMA 4UAVA 2ADMA 4JU8A 2VBGA 4ZJYA 4OJTA 5AKJA 4XYGA 3TDNA 4GICA 4D43A 1A4RA 1T9CA 3SR3A 2J6BA 2XDYA 1PWZA 1MPTA 1DL5A 1QO9A 4OK5A 5EJGA 3T9BA 6ADHA 4K0KB 4IJKA 4PYKA 3I9V6 2VWHA 4HAXA 5ALEA 4UD2A 3NJRA 4LFBB 2OQVA 4GE3A 3OIFA 3ZEAA 3K0AA 2C04A 4X6LA 5CAEB 4V3BA 3ZU3A 1IWOA 1MB3A 1NPYA 2YW2A 1ORRA 1P1FA 3M4ZA 3SF0A 1X39A 3CGWA 3K1AB 2HO5A 5LZ5A 1V5EA 2DPMA 1TVCA 3NDIA 2MT9A 1I2CA 2ODTX 4I55F 1RAGA 1WSBA 4IRXA 4OQ4A 4DCCA 3ECAA 4TTIA 1EAMA 1XRRA 1R5NA 2EG9A 1W5FA 3AL2A 4N03A 2QD3A 4OB6A 1KE2A 3WV4A 5KKNB 4WEOA 4QAQA 2UXCB 4RY0A 1Q20A 3BYZA 4CLDA 4KQ2A 4IZIA 4FOOA 2X9NA 5BSFA 4A8JC 5H3LA 5JPIA 2G08A 2NTYC 4FUTA 1A2QA 1NBHA 1W5SA 3LPAA 5CNMA 1I0IA 1JXMA 3D3JA 1Q6YA 3H83A 3VFDA 2C94A 2I2WA 4NZOA 5EMNA 4Q4HA 1U2SA 1VKHA 5L9AA 1T6ZA 4X44A 3VVCA 1ORWA 2H00A 2RHWA 3ZKWB 4WCFA 1BHQ1 2ZTUA 3DZ8A 2QT1A 3WKBA 3ESQA 2OCKA 4XM0A 5KKAA 5IUNC 1FF9A 1M7HA 1WR8A 4PPGA 4OHFA 1BS1A 3S2IA 2IZOA 4FSDA 4DV6B 5ITVA 1QS0A 3F9CA 3I5AA 3W5VA 5F7OA 1CDZA 5K3OA 3MJDA 1XRQA 3ZNNA 1IOWA 3EDYA 1WCWA 2PD6A 1DV1A 3KHUA 2QYOA 1LF5A 4L27A 4HYEA 4O2AA 4BWGA 1HKUA 1EWYA 2SBTA 1D09A 3MT7A 3VO8A 4DNXA 3OLWA 5H02A 1M8PA 5HP4A 5U4XA 3L1UA 2EJCA 2WU0A 3P9IA 2AG1A 5H68A 2OGTA 3QTLA 2JGKA 4G89A 3LLUA 4MR9A 2ERXA 4C43A 2XY4A 3OBIA 5KREA 1K7XB 1TJ3A 1Y3HA 3HFGA 3TEJA 2G0NA 3SCZA 2G7ZA 3OPMA 1UC5B 4K9LA 3TZKA 3T8YA 1GNPA 1GFIA 1ORTA 4Y1EA 1DHRA 5AKLA 2I5PO 1JG4A 3GCGA 5EJ2A 5DKFA 1S8OA 2WUEA 3EDCA 3G79A 2EFYA 2ONZA 3OE7D 3PFNA 3KJFA 4LXGA 4R6XA 5I9TA 1AU9A 1U0BB 1KERA 2ADOA 2YJTD 5DYYA 2V5VA 3UWDA 4TYWA 1KIAA 1P1CA 4Q4JA 3DZGA 3DL4A 1QHGA 1GUAA 2CJFA 4BEJA 4EPXA 2CNWD 3ELDA 7ADHA 2VJPA 1HNWB 4D42A 4YDRA 4MKRA 1A9ZA 2XLBA 1LQ2A 1VJDA 3S2ZA 1L7BA 1U1CA 2C5SA 2QQEA 2D1FA 1QVRA 3GUVA 1L4EA 1HT2E 4HRYA 4ZZ3A 2H5LA 4ID3A 3MEQA 1S2IA 1ZOOA 2O6HA 2DXIA 1DWPA 4X7BA 1CHNA 2LW7A 2PRIA 3RSZA 2PWPA 4BKPA 5J2UB 5BPHA 2XNDD 1EK0A 1EJ6A 3EXHA 3AJ9A 5CNKA 5TQJA 2GD1O 5ENVA 2ZE7A 4RH3A 1TD1A 4CIVA 4IJ5A 2XCIA 1C80A 4WNAA 4BZQA 1ATZA 4CHGA 5G41A 3ZWXA 2X22A 3CWCA 3ES9A 4PQRA 2DPXA 5KC9A 2DQ4A 1CZKA 3KE8A 5AQEA 2X1VA 2I2AA 3V8EA 2D1QA 4I9HA 1JB9A 4R51A 4TXNA 2PUEA 1G7SA 2E4XA 1MQ9A