3CNEA

Crystal structure of the putative protease i from bacteroides thetaiotaomicron
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
174
Chain Sequence
AKKVAVLAVNPVNGCGLFQYLEAFFENGISYKVFAVSDTKEIKTNSGMVLIVDDVIANLKGHEDEFDALVFSCGDAVPVFQQYANQPYNVDLMEVIKTFGEKGKMMIGHCAGAMMFDFTGITKGKKVAVHPLAKPAIQNGIATDEKSEIDGNFFTAQDENTIWTMLPKVIEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative protease I
publication title The crystal structure of the putative protease I from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 49
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cneA00
2ZUSA 3ZR4B 5IP5A 1T0BA 3VU3A 3B36A 5JZMA 1P7ZA 1QVVA 1G2IA 5SY9A 3EJ6A 2RK3A 4HCJA 4QYXA 4MNTA 3L7NA 5E9AA 2R1TB 4E08A 2VRNA 1T3TA 1L9XA 2VDJA 3MIIA 4P2GA 3PQ2A 2VXOA 2YWJA 1U9CA 3KKLA 3CZAA 4RKWA 4UOZA 1QWSA 3M3PA 1PDVA 4I46A 3EWNA 4AUMA 1Q2UA 3UMMA 4ENVA 4I4NA 3CY6A 1J42A 3SF8A 4ENQA 4L7QA 4Y1RA 3NVAA 1SOAA 4Y1EA 4ENSA 3EN0A 3L18A 1OX6A 4K2HA 1FY2A 2RK6A 2VPIA 1BXRB 3SOZA 3PQ6A 4ADSG 1VCOA 1T36B 3UOWA 1PE0A 1GPMA 1GGFA 3TTSA 2RK4A 4ENPA 1VCMA 5SY4A 1KWKA 3L4EA 1PDWA 2AB0A 3P9RA 5SY6A 1S1MA 5SYAA 3UK7A 4OGFA 2R1UA 3PQ3A 3NONA 2GHRA 2V4UA 4PXYA 4OFWA 3R76A 4L8YA 1OY1A 4UZSA 3SF8B 4ZDKA 4Y1RB 4OJYA 4ZGGA 3B38A 3B3AA 1QF7A 1VHQA 1GGKA 3NORA 1R9GA 2IUFA 3N7TA 1O1YA 1KXJA 4N12A 1QVWA 4AUNA 5DFAA 4ENRA 1IZZA 3RHTA 3P9SA 3TTVA 5LIRA 3NOVA 4ENWA 1P7YA 2NV2B 2VKTA 2AD5A 2WJZB 1GPWB 4B40A 4ZDJA 3UGJA 1P5FA 4Y0NA 4P36A 4MGHA 4GUDA 3TTWA 2R1VA 4L95C 4BTEA 4ENTA 1CS0B 1IPHA 4LRUA 4Y1GA 1JVNA 2YWDA 1I1QB 1C30B 3R74A 1FYEA 4I2NA 4N0MA 4B7AA 4OGGA 4S0ZA 3OT1B 1GG9A 4MTCA 4GE0A 4XLLA 3EZGA 1P80A 4WXYB 3NOQA 1WL8A 4Y1FA 3CYFA 2NV0A 3FIJA 2YWCA 4P35A 1QDLB 3TTTA 3WFZA 4B2YA 4BIMA 4ENUA 2YWBA 4ZDIA 3OT1A 1M6VB 4UNIA 3CZ9A 3NOOA 4L8FA 1JDBC 3F71A 1GGHA 2W7TA 4R7GA 1UCFA 1ONSA 5BV2P 3L3BA 3F5DA 3MGKA 5JZOA 1GGJA 2R1VB 3PQ7A 1I7QB 3BWEA 2A9VA 2ZUVA 2ZUTA 3R75A 3ZJ5A 4AJ9A 4BFLA 1PV2A 3EFEA 4E5VA 2ZUWA 4RKYA 4AULA 1KA9H 3PQ4A 1OI4A 3P9QA 4OIFA 4B5KA 4JQSA 4L8WB 1QVZA 1Q7RA 4UCFA 1N57A 1C3OB 3TTXA 3PQ8A 1CE8B 1CF9A 2D7JA 2GK3A 1OX4B 3TQIA 3PQ5A 2LXNA 2ISSD 4LGYA 4P34A 2ABWA 1GGEA 2FEXA 1IZYA 3CNEA 4GE3A 1KEEB 1VCNA 4AUEA 3UJNA 2H2WA 3GRAA 2R1TA 1K9VF 1P81A 4P5PA 1OX4A 1A9XB 4L78A 3D54D 4D1YA 4WINA 4OQ4A 3FSEA 1OX5A 3ER6A 2ZUUA 3BHNA 5K4AA 3P9PA 4UOQA 4QYTA 1KWGA 3TTYA 2XF2A 4B31A 3ZJ4A 1I7SB 3TTUA 2OR3A 1SY7A
chains in the Genus database with same CATH superfamily
2FAXA 1BJKA 3I52A 3ASZA 2GN0A 3DEYX 4X6XA 3WHLA 3AEXA 4Y30A 3UENA 4BV2A 5J1SB 4J1TA 1LDMA 2VYVD 2ATCA 3LUJA 2VF2A 2VEOA 4Y98A 5AP9A 2GTHA 4ECEA 2RK3A 4HKTA 2HU7A 3U5TA 1E92A 5BRNA 2NU8A 1IU9A 1XELA 1D1PA 2X2PA 2Q5QA 1XKTA 4MNTA 2HRRA 3HP4A 4P2GA 4ZTZB 3T5MA 3IILA 1MX1A 3T3DA 4BKMA 1ORIA 4L08A 5EXPA 3RTGA 1JYFA 3KQTA 2OV3A 4F4FA 4N48A 1KF0A 1EB9A 4MYSA 2ZIUB 4HO1X 1KJIA 4KYVA 3ZY6A 1FMLA 2R4UA 4Q9KA 3V6LA 5F35A 1T6ZA 2V8BA 4RFSA 1KBQA 3AB3A 4GLLA 4Y9SA 1CY7A 3K2QA 4EY6A 5JZSA 3K0CA 4K03A 4XQGA 1VCOA 4G8DA 5I4CA 3ZDBA 2QD2A 1XEXB 2MSKA 3AI2A 4Z4QA 1G6HA 2AHRA 4A2QA 2AZDA 1CY8A 1E7MA 4M0MA 3D8RA 4X20B 5ALIA 2X4LA 2V6MA 3UK7A 4DCSA 2JIOA 1ZONA 3EGEA 2J9RA 3B78A 5DHQA 1E9AA 4BJ5A 1WUJS 2RHRA 3V4RA 2LIVA 3LSTA 3WL8A 1Z15A 2HBYA 5K8UA 1LA2A 3ZWAA 3PSHA 3K1AA 3F3SA 4H59A 1ZICA 3ZYZA 2X0NA 2WTMA 3BMQA 4X60A 4JC8A 1D04A 4GZLA 3UKDA 1RYMA 1AGXA 3D7RA 3Q2OA 4CMKA 5ADHA 1C7ZA 4RSGA 5ICCA 1RI1A 4FK8A 4U7HA 5CIWA 4YASA 1KDYA 3DOUA 4V3CA 3ZS9A 5KSYA 3HM9A 2WG2A 3GZNA 3H75A 3ZDRA 2ETXA 1Z74A 4NV0A 3E1GA 3R8CA 2XGOA 3UGTA 5L6LB 2MTBA 1L5YA 3UXEA 2OWDA 3FOWA 2VSXA 4F91B 5DP2A 3DMGA 4OQNA 1UPBA 1WZEA 4F8YA 3D4BA 3A14A 1UKBA 4EVSA 3JX9A 1KSHA 1IHYA 3FW1A 5B53A 1QNFA 2ENUA 2ZEJA 3P9CA 4L6IA 3S1SA 4PX3A 4IJWA 4DCTA 3DE0X 2X9VA 3L1IA 1KO7A 5DTQA 1T13A 3SC3A 3V97A 4H31A 3NV9A 2Q29A 1KARA 1YRYE 5COAA 3NVKI 2BH9A 4WLUA 4BOYA 5AVTA 1K8YB 2VSYA 4EENA 4Q4AA 1Y8CA 1YA8A 3CZ9A 1GPLA 2RBEA 2Y1KA 3VTKA 4H1WA 5C8XA 3ABRB 1MRSA 4TT8A 1BD4A 3ZDFA 2ZUVA 2ZUTA 3G6WA 3VO8A 1SN7A 4J0EA 2HMWA 3NWPA 2GEKA 1B0AA 2PUFA 3CR7A 4HZUA 1MAWA 3LXMA 4UNNA 1NV8A 5EMMA 1OX4B 1WWKA 3GV0A 4IHJB 3GCDA 3UJCA 1DKNA 3PDHA 4RD1A 3I9MA 4NK4A 3ZLTA 3EIQA 3ONNA 2YTZA 4K6HA 1OSNA 3GRKA 3BMOB 4JODA 1FP1D 2LPMA 4X97A 5JRZA 3FNHA 3KQNA 4EKGA 1RRCA 1Z4NA 5AO9A 4EL5A 1GVHA 5EIXA 5CA0B 4KOAA 3LZCA 4AJIA 1EM8B 4EHJA 5AUPB 1GSIA 1CUAA 1E3JA 3ANTA 3HBJA 2CUNA 2NU6B 3EVNA 3GEGA 2FZEA 4LSZA 2ILTA 3ZI0A 1Z6GA 4MV8A 1W93A 2PLFA 2P27A 2ZUSA 3AHFA 4ARBA 1I3MA 4YUXA 2O7SA 5TGZA 3EVZA 3BMXA 3F46A 5GV8A 3X1WA 5A9RA 5BNTA 1XEXA 3TI7A 1CU1A 2GS9A 2OAGA 4C08A 5DIFA 4UNRA 5C35A 3O8CA 2MYUA 2WJGA 3LGSA 6GPBA 1HDZA 3KKLA 1DG1G 1WMEA 4GMXA 1PR1A 4X20A 2QE7A 4ZVPA 3QEBZ 4HGZA 4HSEA 1VL8A 3RS7A 4B6QA 1EU1A 1SBTA 2YJ5A 4K40A 5FKJA 1ZGBA 1MX3A 1N3IA 4JITA 3FFBA 1U8XX 1JQDA 2F00A 1II9A 1PGQA 3C6QA 4OP2A 2CVZA 3AOEA 2V3WA 3TBHA 3TDKA 3UAWA 1UJ6A 2RK6A 3GGGA 5ES4B 1VRVA 2I1LA 3LNTA 3WNBA 5GIPE 2QZPA 3NMUF 3FOBA 2WUGA 3BH6A 1CDOA 1M1XB 4PTYA 1Z25A 4IHAA 5TGDA 2WMYA 4C5AA 1J2UA 2RJNA 2IZ7A 1M8JA 3WTCA 2QGFA 4LJYA 2GAJA 4JUCA 4H7PA 4N8EA 2V4UA 3WVNA 1K0UA 3SIRA 1J0AA 3CWZA 4F86A 1L4MA 3BRQA 4IDGA 1RBMA 3JAWB 4L0DA 4OQYA 2C54A 3COVA 5F1OA 4MICA 1VYUA 2Y9MB 3G0BA 3DH0A 2CLOB 4LYFA 4FQ7A 4HGOA 1GG2A 2YVUA 2B36A 2D00A 4H27A 4NV1A 3QX9A 5ALWA 3WYCA 3AR9A 3WGLA 2XCOA 5JPDA 1U9JA 3OTGA 1JL3A 4QKQA 2WFAA 3NWEA 2RC5A 2Y93A 1VPVA 3IBCA 3AB7A 3EC1A 1MXFA 5GWXA 3A4IA 3RYHB 4KIFA 4J1SA 4H3SA 1EEHA 1Q6ZA 4GF5A 3RVSA 3DW3X 1OT5A 3PRYA 4HMQA 4GX2A 4MEAA 3IPAA 4OI1A 3EUFA 3SIXA 4AMZA 2P9GA 5KTTA 3G59A 5ERXA 5D84A 4EY3A 3NU1A 4L9AA 4LXGA 4IHJA 2PXHA 3NTXA 1NBIA 1TPYA 4MLPA 1OH8A 1Q7TA 1T2AA 3U81A 1NBMD 4MKHA 2M32A 2REXB 3BMOA 3AJRA 1ZK2A 2HF7A 2WZQA 3CVJA 3EDRA 4UNIA 3IQXA 2AF4C 3EQZA 2Q9CA 4B6FA 2XRFA 3FRJA 1W44A 3NXSA 2V6FA 3CJQA 1U0EA 4RZIA 2PXCA 5CA0A 3WZLA 4LMRA 1EM8A 4XUGB 2D3TA 3M1AA 1A5BB 2NU6A 3MYYA 5LZ8A 3UAOA 2XNCA 3EZ9A 2R3SA 4DN6A 4AMUA 1G2PA 1IVYA 1D9XA 1L5HB 2NT3A 1QVZA 4CDMA 2C95A 5GONB 4K9PA 1J90A 4BMPB 1Y4DE 4FLMA 4X44A 3A4LA 3F4BA 3QVOA 4JI7B 4M1ZA 2XWBF 1EA5A 2R96A 5IVHA 1Y80A 1E3DA 2G6TA 1FQOA 4HXYA 4PNHA 3W2FA 1GQRA 3ZTWA 1JQLB 4DNPA 5JSQA 1ATZA 3DWIA 4MCHA 1TU0A 4JLOA 1G3IA 4M8SA 4AMBA 5ILQA 3L0CA 2TMDA 1KZYC 2A1IA 2ZRPA 1G5PA 3FFAA 4DUPA 1JIQA 3G2JA 4Z2AA 3RRMA 1XZJA 4G2TA 1VB5A 5HUQA 5EZ5A 1VL1A 1AX9A 2JVKA 3WWEA 5BPHA 4OATA 2F1KA 1FDRA 4RJ2A 1I0IA 2D0DA 4TQUS 3CUEF 1OXSC 2TMYA 3CWCA 3HEAA 3ITKA 3D5QA 3Q6NA 2O2CA 3R0VA 1YBHA 4IKEA 4P53A 3E8XA 3UC5A 3UJ7A 4AQDA 2ISCA 1X8XA 4B73A 5FX2A 4OF4A 4MO2A 2BUCA 2EQAA 4TZKA 3ZTYA 2O8VA 1WG8A 4XW2A 2O6LA 4G0MA 1NSYA 3UZUA 1OD6A 1ZO8A 4OQLA 5FWXA 4FFOA 4B7UA 5LQSA 3IQIX 2D59A 4HTAA 3VV2A 3JAWA 1L8OA 4XARA 1LDYA 4BNHA 3LOUA 3R77A 4C3VA 4PTZA 4GKBA 3TFOA 3R41A 3O7WA 5A62A 4LYAA 4PS0A 5K3DA 5C8DA 5JNTA 3AF6A 4LNHA 4A92A 2DH5A 1AQIA 1AKYA 1ZD3A 1QKJA 4R8LA 1XRRA 3ZBQA 2OZKA 2GETA 3PQ3A 5CVEA 3KB8A 4HB3A 3RYHA 1HNNA 4U1RA 1NKSA 2PEZA 2J7PD 621PA 1TU4A 1ZVJA 4JWTA 4RH0A 2Z9CA 2FE1A 2GAIA 1BMFD 2IUFA 4M60A 3VR4D 3ZLBA 1MBZA 1NHWA 3PTLA 5LXTB 2AN5A 9LDBA 3BIOA 3R0IA 2XMZA 1FRZA 1NN3A 1FP7A 2Y4NA 4Q7KA 3T9FA 3EIHA 2E21A 2Z6QA 1V8DA 2V9CA 4C7OA 4XYLA 4S35A 1JR4A 1PN3A 2BFNA 2N9UA 3RKUA 2OCIA 3K0AB 2ZIFA 3VHXB 4NNOA 1SHJA 5EKXA 3ZVMA 3DL2A 3ZCQA 3DZDA 2IDKA 2GMWA 5JD4A 5BN3B 1UWVA 3CC8A 1UK6A 2QT0A 2Z4RA 3BXPA 2R2GA 3D2CA 1R6BX 1UJBA 2QA5A 3JQDA 4LSGA 4OYLA 4NK5A 3LKBA 4FWIB 1UF9A 1L5HA 2H9IA 4XDHA 1MRZA 1ZGCA 4OP1A 3IODA 5GONA 1K7XB 1P80A 4D26A 1XEWX 3OPNA 1UM8A 4U2CA 1X1TA 1C30A 4UTOA 3W2IA 1XCGB 4BIMA 4QDXA 2XUGA 3MJCA 1QFJA 3ROPA 4U9HS 1RT9A 2V7XA 4X93A 2P2ZA 2RE8A 3IEUA 2PD6A 3HVUA 2H51A 5M2QA 4IHJF 4YXFA 3KAQA 3N2GB 1EUZA 4K9SA 4ZYXA 2QU7A 1I51A 3P20A 1P1CA 3PE4A 4MRPA 4UMVA 5GVSA 4EH1A 4CETA 2JKVA 1JP7A 4XYGA 3CHYA 4EG5A 2CLMB 3KKQA 4POAA 3ZQ6A 5I8PA 3PC8C 3TNLA 4C89A 2NU7B 2SICE 4HQ0A 1CHNA 1B42A 2IZ5A 3NVDA 4QPDA 1R9MA 1ZHHA 2XGMA 2XY4A 3WJAA 4K46A 4JB2A 2R0QC 1UP6A 4CLOB 2PS9A 3BM5A 3D0OA 5E7MA 3STUA 3FYCA 4H4EA 4L75A 2AUTA 1R1DA 2H2WA 3EPRA 4FBGA 2ZSAA 4J0QA 1P81A 1ZFNA 4MWZA 4X5OA 1A8PA 3IERA 3FYTA 1DWPA 5DMXA 2KE5A 4ZYWA 1Q1AA 2FLKA 3E58A 4NZ9A 5C9ZA 3ISJA 4KZKA 3ESDA 1NPTO 2A14A 1W8IA 1RJEA 2R8BA 2JKZA 2WG1A 1HNWB 5KCMA 3TSWA 2IYRA 2FCRA 3MTGA 3FTEA 2C4VA 3O8NA 4PCVA 1NMXA 2O06A 2SBTA 4XM2A 1U28C 5AVYA 2PYIA 1SHKA 3Q9UA 3TN7A 3O83A 1KYVA 2X1LA 4UVIA 3ZBUA 1M7BA 1EFTA 4JQCA 4FDMA 3WAKA 3BH0A 1JW9B 2ALJA 1W0KA 3TLEA 5K6AC 3K72B 3KYIB 4UAJA 5KDLA 4ZYTA 3ICCA 2XYGA 1N2JA 4AECA 2ADOA 1C8KA 1GUDA 5ALTA 2WF8A 5C32A 1U2PA 4G1EB 1SVWA 1ZD1A 2ZTVA 3OWOA 1D4FA 4NBUA 3HHEA 4JEMA 4R1QA 2G82A 4LGCA 1WHSB 1TTQB 2BPOA 5ED0A 4DE5A 2COEA 1NF8A 3L8HA 3ZU3A 2VQEB 2DUNA 2TYSB 4S1VA 4Q3DA 3CH7A 1YVEI 4O02B 3STXA 1QGAA 5BYAA 3OFJA 1HLDA 1FJ2A 4Q3AA 2D1QA 4QBKA 3HCCA 5LNK1 3MMZA 4ZYVA 1U7PA 3A6ZA 4L02A 5L95A 4DDTA 3F96A 5LXTA 3FPCA 4NBRA 1BX3A 1OZHA 2G4VA 1NJ8A 2P9CA 4OUKX 5IS2A 2H0AA 4ZVNA 2ZCJA 4P81A 1RWWA 3K0AA 4Q48A 3VHXA 3ND5A 2Q0QA 4A8JB 1WUHS 3AILA 2JEZA 3QKWA 4L22A 1WSAA 2B0JA 3HB5X 3PRHA 3IAFA 2AIRA 2YZGA 3AETB 3AUJB 4L8YA 5FD8A 3X1ZA 1FS6A 3PTAA 1AQLA 1V5GA 3M5WA 3ZE7A 3KYDB 3LHDA 4FM9A 2QN7A 3WNCA 4L50A 3H9JA 1EUCB 3Q3JB 2NYVA 3P9IA 5K3CA 3VVMA 3C85A 3DCNA 1WMDA 2VEDA 2UV8A 4D6YA 4XOUA 5EPUA 1JXQA 3TTVA 1T6BY 1HYQA 2PR2A 2WHYA 4BQNA 5KYUB 3COWA 5TVKA 4B40A 4EJ6A 4IV0A 4P31A 1WCWA 3K9HA 2R65A 4UW9A 5AXAA 4XVQA 5LWQA 5DULA 4HN2A 3TLMA 4BVEA 3N2GA 5KWJA 3GU3A 4FOPA 1P29A 3DM5A 3AYXB 3S44A 3LUHA 3ZIAD 1GU0A 4YJDA 4BFUA 3AW9A 3R2JA 4EJSB 1I14A 1NVVQ 1C7RA 2NU7A 4QYMA 4JEHA 2CVHA 5F51A 1Z12A 1NATA 3D1VA 4DARA 1SCJA 2R6GA 2ZT6A 4Y1FA 5E6SB 3RTAA 4X8LA 3S7ZA 1A9QA 4MVJM 1LNQA 2PA0A 5EP1A 3X2FA 5CNKA 4OX9Y 5JTTA 3ZTTA 1D0SA 2FXVA 4M86A 1G5IA 1RWQA 1SU4A 3BE4A 5GONF 4BLRA 1Z47A 3C3PA 2B78A 1DOZA 3M81A 2M98A 4P8RA 1BHO1 2ZJOA 1D6MA 4DIKA 2O3TA 1L4LA 1N6RA 1I32A 4MUNA 4G41A 1UMCB 4H7EA 2H5IA 2FWIA 2OORC 2DWCA 4NZMA 3PLAE 1C8VB 1U1FA 5ITVA 4QEKA 4ZHQB 3THWB 1Y3HA 2FNAA 2XW6A 4IJMA 4ZT2A 3CN7A 5G1NA 3A6PC 2WU1A 5A9TA 1M8GA 2V9ZA 3OCCA 1XA3A 1LEHA 2J45A 5EC8A 3R7NA 1WHSA 3GNLA 4E1AA 1D7AA 2I2CA 4E12A 2XRMA 1Z8DA 3ZHSA 1MJGA 3PITA 4QTXA 2DLCX 4GOMD 2P2GA 3RJ5A 1U9ZA 1DXYA 1RM3A 1UXIA 2RGCA 3N87A 3PX3A 3V1LA 4BB5A 4W63A 4DGSA 1KO1A 3NXKA 2GM4A 1PZEA 3NHBA 5HXAA 4FMCB 1ZI6A 3VOAA 5FEUA 2H3EA 2FUCA 1F6DA 1E6WA 3O0TA 2O1XA 5AK3A 5F76A 4BO6A 4PW0A 1RP1A 2G17A 3RC8A 4UDYX 1QGED 4HBZA 3M4JA 4JP3A 3TZQA 1NOKA 2QG9A 2QRZA 3RV4A 2W70A 1F4LA 4DLTA 5JTUA 3USCS 1RC8A 3C7AA 1OHHD 4A8JA 1ISRA 5CT9A 3GDOA 3SWWA 3AETA 2AZ4A 5I7RA 3KYDA 1NM5C 4L27A 3RM3A 3DO8A 2QDKA 1EUCA 4RKQA 3VHRA 4E3WA 5JIBA 3RKRA 2B7LA 3DHYA 4OA8A 5KYUA 4RLHA 3BREA 1SQ5A 3OZXA 4YAJA 4N40A 4O4LB 3FRIA 1QS0B 1XAJA 3OC0A 4JLBA 2GJAA 2L18A 2N42A 3HA2A 4EQZA 1FVHA 5C5CA 1ZNYA 5LXTF 2EFJA 4OQMA 4MQMA 4RESA 4L5IA 1Y3BE 4JI6B 1TD9A 3IJPA 3NWJA 2VK8A 1ZJWA 4ZK2A 4WY5A 3ELBA 1Z6AA 3LU1A 2B37A 4DG8A 4EJSA 5K05A 1GYQA 3H05A 3PLNA 1JG1A 3NRCA 3N7TA 1N6NA 2XMBA 1OYYA 3I37X 1FBNA 5E6SA 3T7KA 2JLVA 3CCFA 2JASA 2NSDA 3STYA 2I71A 3QPAA 5CCXA 1YZUA 1I4TD 3FUUA 4R01A 3CRW1 1EVZA 1E4EB 4UASA 1S2IA 1UODA 2N0SA 3E0XA 2GGSA 3SS9X 1TJPB 1QQBA 3KJZA 3E0QA 3P9NA 3F74A 4NDZA 3C6YA 2FFJA 2CXSA 1EVQA 3DMHA 3E7DA 4KIGA 2HGSA 1MABB 2A0WA 1O9BA 2A5FA 2X9QA 3HDHA 1Z6QA 1ILWA 2GXSA 3C3BA 3LUFA 1AXGA 1C2TA 2NIPA 3PD7A 4MVWA 1UMCA 2W4IA 1PI3A 5AHKA 3LMKA 4Q4JB 4BKOA 4NECA 1B7GO 1TFUA 1XQWA 3DMYA 3SJCA 5CA1B 1U1DA 4GMGA 4AU1A 3U62A 4EBFA 3THWA 3JS5A 3EVDA 3BIFA 2ZSEA 3CFYA 4WBSA 3COPA 1EUYA 3VR5H 2O7RA 1OWLA 1YUBA 2B4KA 4PYMA 4WX2B 5C3UA 1OFUX 1PGJA 3A31A 4Q7LA 2Z8ZA 2YY6A 2JLUA 2AR7A 2VQDA 3A2LA 3C98A 3AKCA 3LRXA 3BZWA 1FVFA 3T35A 4FMPA 1E20A 4TL7A 3DMPA 5EP2A 3CZ5A 2H1VA 3QRWA 2X8WA 3DKPA 4XTCS 3BCRA 3O92A 2PNJA 2OB2A 1VCNA 2EJTA 1RAEA 1YL7A 3LLVA 1L5NA 1WXDA 5LD2B 4YLEA 5EMNA 2HSDA 4JEIA 4N3AA 4YMTA 1U7UA 3PCTA 5DVZA 2F43B 2YXEA 2CHGA 1D6NA 4WFIA 3N8NA 5ADVA 5EKTA 1E62A 5DYNA 4LF7B 3WWYA 3ROXA 3AESA 3M4ZA 3IV6A 1WUIS 2MHCA 4MUKA 5PNTA 2QVBA 3UUGA 1JNXX 2JKYA 2R6ZA 3FNQA 1WAMA 1NE2A 3CONA 3EYWA 3DPSA 4GVLA 5C8ZA 2AG8A 2VBCA 4CG1A 4DBZA 1SY7A 1ZMTA 1NDUA 3TKLA 5HE8A 5BVGB 3HKBB 2H1FA 3TVTA 2O7NA 2QN8A 5JS6A 1JXAA 5EKUA 3H9CA 3PHHA 3FVRA 1ECLA 2P91A 3BE5A 4GR9A 4M1KA 4RV9A 1LBIA 3PL1A 4CR7A 4G09A 4Z1MD 1SULA 4J1NA 4FFNA 5C1PA 2G1KA 1RYNA 3CLSD 1E77A 2EW8A 3ICVA 1CIJA 3EIUA 3ESBA 3V8RA 3K71B 2EL9A 3TCNA 4O4LA 2BV3A 3BXEA 3M49A 2HA5A 1QS0A 1G5FA 3DCJA 4BNNA 3RH0A 1QHGA 1T3LA 3UATA 1AKNA 1FNBA 5C81A 1OC2A 3CY6A 2OLKA 1O6FA 1CLUA 1BKDR 1H8ED 4EYKA 5M7EA 4N7RA 1JKXA 2JARA 4HFNA 2FMHA 1LPSA 3EY9A 4LOLA 5B58C 3D6NB 2OOKA 2WT8A 2FUKA 4X1IB 4IDEA 1FU7A 1WCXA 5JCJD 3INRA 3RW9A 4YJGB 3K9QO 3JTMA 3R3YA 5DXFA 3PDCA 4NU0A 4IF6A 1N77A 2BMAA 1NNEA 4DJJA 4I66A 1KE2A 1A4RA 1E4EA 1SUFA 1T5IA 3CXRA 5G4LA 3OMXA 1HFEL 1J8QA 3OOYA 4M8NE 2HADA 4MGKR 1HPLA 3SZLA 4RTSA 2ZT5A 2G25A 3LIPA 1O8CA 4B2PA 1VHTA 2XZTA 3JVEA 4GXQA 4KDEA 4MPJA 4F11A 4LF6B 2FSHA 4YRSA 1TADA 1G4UR 1MABA 2DFDA 1SBIA 2WP0A 2WZBA 4HPWA 2I33A 2CJPA 2G1AA 1CIVA 1PZFA 3ND6A 3UMRA 5CR9A 3UIEA 4OLAA 1BRTA 3QU5A 4HQ6A 2EL7A 5DCWA 3NC4A 4Q4JA 1GR1A 1CSEE 4BEBA 3O4HA 2K7FA 1JI3A 2Q9UA 3QOWA 3N0XA 4FGLA 3UO8B 2QUKA 2W8BB 2HMSA 4MV7A 3Q2KA 4KK3A 2O8CB 3BS4A 3IQEA 3V4LA 3EGCA 3UK0A 2F8TA 2WHQA 3O8OB 3A0RB 1HY3A 2DP4E 2P8SA 6ADHA 4KKVA 3S1LA 1YHZA 2DCUA 4IMRA 1OTXA 2EJVA 1YK1A 3VGJA 1LC0A 4C0AC 1NTOA 5DSZA 2E55A 2O52A 1W2WB 2VHXA 2ZB2A 4J43A 4P4NA 3GPDG 3K15A 5AJZA 3SX4A 3ESYA 1QV6A 2WM8A 4BP3A 3X1JA 1ZJ5A 3T95A 4W1RA 5AICA 4ENUA 5BWBA 2YWBA 2X2EA 5B1IA 3ZU4A 1OBCA 3DO6A 1UZMA 2ET6A 4BNLA 3R3XA 2A33A 4OQEA 1FRFS 2G77B 2O07A 2DPHA 3FKQA 5KINB 4RK4A 4FDLA 2IHTA 4BZWA 1C29B 1TQDA 3RADC 1MC8A 4ZHQF 1W4ZA 4BKUA 1IOWA 1QHEA 4QO8A 1PZGA 5ALZA 1RYFA 5BVGA 1L5QA 1ODKA 2WNSA 5EIOA 4DZRA 3CLRD 4UUNA 2FB9A 3HKBA 4ASUA 2CCJA 4IGAA 5IMSA 2GXUA 3CLSC 4IJUA 2PUVA 5B4UA 3EH2A 3MD9A 3RUFA 1JDNA 3EXG2 4N54A 3S40A 3A9CA 5A4FS 1F48A 1IONA 4EO4A 3T5GA 4FMCF 3BQMB 2Q3EA 1SVIA 3AUSA 2IT1A 1COWD 5LL6P 4QU0A 4S0XA 5HRAA 4BFTA 1JR3E 1PJ4A 1BVHA 5FOTA 1NLZA 2QU8A 3GUYA 1XDSA 1LLFA 2I4NA 1FYXA 3LYAA 4YP0A 1XRLA 4MI3A 1YBVA 3M3HA 1M10A 4B76A 5HJ2A 3Q0EA 5AVVA 4X1IA 2IY8A 2HSZA 2OHHA 4MYTA 3WL6A 1CQXA 4YJGA 2EZUA 3AG6A 3E27A 4PPYA 1HZZC 2JIRA 4H6VA 5D85A 4KXYA 3ETEA 3KEQA 3UMVA 1I3KA 3BUSA 5JAPA 1YIOA 1PJQA 2OL4A 3SM3A 3EIXA 1CX9B 1S8OA 1YHYA 4XD2A 4BGEA 1MZVA 3F7MA 5BW8A 3O8BA 3QNMA 2OCBA 2W2NA 1HFKA 1OFTA 3BQ9A 3AIKA 2NW6A 3H2GA 3LQFA 4N9QA 1ZM9A 4L16A 4QU9A 4HB2A 3VX4A 2XNDA 3BSYA 4JNCA 3K9NA 4LZWA 3KQOA 2YJNA 1Z73A 4O4LF 5ALEA 3R1IA 4R2WA 1PFQA 1IZ8A 3I6IA 3OAAD 1B3BA 5CYPA 3ZWOA 3ZGXA 1WUYA 2VBFA 1RQ2A 5FUBA 1QCCA 1TIKA 1GN9A 2AC7A 2OBBA 1TVMA 2W8BA 2BGUA 4R51A 1PZXA 2C92A 2BD0A 4IX9A 4D8XA 4HNTA 5T3YA 2RH8A 1QRSA 2O8CA 3LUGA 4PTLA 3JWEA 1QU3A 3F5FA 4WERA 3BHIA 1SCQA 1QCYA 1N6IA 1KI9A 2FWNA 1P1FA 3FNGA 3KLNA 3D4NA 2IPLA 4CM9A 3OPVA 5E6UB 4E11A 3I2FA 1YJBA 5BMVB 1NVUQ 1JGTA 3KBOA 3HB0A 3SX0A 4C3OB 1IULA 1ODFA 2EARA 3S68A 2O8BB 3IFSA 4X1KB 5EEHA 5F21A 4BVFA 1J9EA 5GPBA 3KOZA 2B8TA 4EB8A 1O94A 2PQ0A 3E3NA 4O0MA 1KMQA 3VNBA 1ORVA 1SKMA 2CGEA 1FQJA 1KJZA 2XQFA 4LNUB 4IQ8A 3GJRA 3P9SA 4XGRA 5JJIA 3CBGA 2UZ3A 2ZJAA 3WGQA 3HNPA 3AVOA 2F3QA 2WC1A 3ES9A 1NNSA 2VDMB 5AHWA 5IJXA 4M55A 5CA1F 5I45A 1YVRA 2JFUA 1NZFA 3F7OA 2ZJFA 3Q9NA 4D9EA 4B6PA 5EA2A 5KNCH 1X1DA 2BFDB 4F04A 4DAOA 5DLDA 4ZOEA 3WP1B 3MJHA 1QOPB 2FSGA 3V7FA 1T9ZA 2VAWA 3NDPA 2YV5A 4IUDS 2HYDA 4KV9A 1TXGA 1QRRA 4QASA 4U0JA 4OAPA 1Z7GA 2XTZA 3I6MA 1FDIA 1ZUD1 1UJCA 1C1XA 4MUAA 5EUMA 3DAFA 1ETHA 1SCDA 3A28A 5F3DA 3VH4A 5FDFA 1R0WA 1U2GA 3SYTA 1YB1A 1F6BA 3C2QA 3D6MA 1XL0A 3EFEA 4RULA 1M7GA 5H4HA 1T29A 4HYQA 3OKFA 2IV2X 2AN4A 3WLIA 3AY7A 3W9YA 1DUIA 2WM2A 4CF5A 2DB3A 1QHHB 3DFUA 1JLMA 3Q9LA 2IRWA 3GBSA 1MQAA 4MROA 3WSWA 3QU9A 3T3IA 4JWKA 5K0LA 4KQMA 2NO4A 1P1JA 4FBMA 4EDHA 3R3VA 1OFIA 3EUEA 2L42A 1E9RA 2C29D 4X24A 4N47A 3TMKA 3QPWA 2IYTA 4WVFA 5JZBA 1XPJA 1O6ZA 3NH9A 4ACBA 1MIHA 5KHLB 4GUAA 2GLTA 1EQ2A 1P0IA 4QQRA 4QDKA 3WYDA 1XN1A 1AB5A 3PGMA 1TRHA 2WJVA 2Q4DA 9ATCA 3BZBA 3UUEA 1YOBA 5F5XA 2G9VA 1GZVA 1PFYA 4NCKA 1SK8A 1Z6TA 1R4MB 5KQMA 1XU4A 4HC4A 1Y8AA 2B35A 3AFGA 4KXXA 5E2AA 3MINB 4WI1A 1P5ZB 2O1SA 1R0SA 1TM2A 3MD0A 2YY5A 1NG9A 4B79A 3HGMA 1B1CA 3N0TA 3ZCSA 1YV9A 3I4CA 2J7KA 1PS8A 2PRYA 5E6UA 4WASA 4IHKA 4Y9TA 5BMVA 5IX8A 3PZBA 3IH5A 4BV3A 1K8RA 1EWRA 2O8BA 1NI3A 4U6QA 1UBRS 4X1KA 5LP6B 3OOEA 1QANA 2W2XA 5AHOA 1VIMA 1E4VA 3Q72A 5K8LA 2YY7A 1RAFA 2ZYSA 3BGOS 3WYBA 4LNUA 4G65A 4YONB 2CXUA 3NBMA 4ENPA 1DI0A 2ZRIA 1NQTA 3K0CC 2HMAA 4MVJA 2BLNA 3G5TA 2VPXA 1KHTA 2V7GA 4EGAA 2FWPA 1QBKC 2IU3A 4JN6B 5A03A 4X62B 2QR3A 1I2BA 4QE3A 3ETLA 5TMBA 2R7NA 1J0DA 3C3AA 3FGPA 3X1DA 4MVYA 2BFDA 3QWFA 1Q5PA 4DW8A 4MS4A 2EDAA 2I7TA 4R84A 4TKZA 2EXXA 3TNDA 3RQSA 3T94A 1TM4E 2FN3A 3JQ9A 1Z5ZA 3E9MA 1B41A 1E1LA 5ARCA 2NN3C 1TOAA 1O6BA 1QKKA 2WJZB 2WPDA 3NHUA 3BKWA 4E2YA 3H19A 4IGFA 3VDQA 1AMUA 1QIIA 2GH1A 4GUDA 1JEEA 2CWDA 1K7SN 5A5FA 1TIBA 1L8QA 1SVLA 1JFFA 3KZVA 4TLLB 4HUQB 3QBEA 4EGSA 4FKZA 4LY0A 3JD4A 5DV9A 5JJ5A 2BFCB 1U2RA 3PFWO 3FSRA 4EB6B 1QHHA 4BGUA 2HK8A 3I9JA 3DE6X 2PTGA 3I6YA 1MGOA 1J0CA 2DFLA 3V8BA 1XVUA 3HB4X 4KQKA 4QA9A 2H11A 2FJUA 3NS7A 1R3DA 1RE0A 4BLSA 2B2NA 3ZWKA 4UDNA 3BWEA 2EKZA 2D2EA 1V1JA 2BF4A 2R44A 5DNYB 3THYB 1KFJB 4XFJA 1PGNA 3E7WA 4WOKA 1RLMA 2ATEA 4JC4A 4Q3CA 3L02A 5BO5A 3HL4A 1T2VA 3RI3A 1CIPA 3GAZA 4RPJA 1YBAA 3NBAA 3A6KA 3OURA 1R4MA 3QE0A 2OUKA 4BO1A 1I7NA 3BOSA 1EP2B 4LMBA 3UMCA 1PAUA 4WT7A 7GPBA 3MINA 2AXNA 2YNMD 4QOJA 1RBQA 3P94A 4DANA 1PV4A 3K4PA 3TFWA 1NLFA 3LX6A 1H5NA 3TRFA 1OREA 5A5EA 3MAAC 1HRDA 2EKLA 1JHQA 2IXTA 3LUAA 2IYNA 4GM4A 4OXKA 4PQFA 1NL3A 4UREA 1MV5A 4K6MA 3A2MA 1U3GA 4NONA 4Z54A 4YCAA 1UPTA 3QTTA 3PNQA 5EKSA 1OZFA 1V9CA 2C42A 2BDEA 1G3UA 2HUNA 5LP6A 2QDXA 1BOOA 1CR2A 3UKJA 4QTUB 3PVZA 2QVCA 4TM7A 5IKOA 1M54A 4PYJA 5ICMA 3B1KA 4I8XA 1KDZA 3RUPA 4OOEA 4AF7A 1ZSVA 1FZQA 1KP2A 1OLOA 4F9EA 4LUCA 2AX4A 3NHFA 3LA8A 4HX5A 1QB7A 5KQSA 1AUOA 2I6SA 3B9QA 5F1KA 5F77A 2GPNA 2V7TA 4QFCA 4G1CA 2ACWA 2BJHA 2PL5A 4C29A 4HWRA 4I81A 3MB8A 4G0QA 3VAAA 3ZJYA 4YYZA 1D2RA 2ODPA 1O03A 4CGYA 2VUSA 3QIAA 1PT6A 1IC6A 1W5SA 5ADUS 4G86A 2ZTHA 4PLGA 4OH1A 4XIIA 4DIFA 1YI8A 1YH3A 3UANA 1UKVY 1XL1A 2GI4A 1EK0A 1VP9A 3IEVA 1DPFA 2VUUA 1E1DA 4MYCA 1DEXA 4Z49A 1LNSA 1AGNA 1XMXA 3U31A 4R1MA 2QB5A 4RVOA 1NBOA 3MTEA 3QI2A 4RE5A 2RGYA 3VR0A 2IYQA 1USGA 4YYEA 3P0RA 5B1SA 3VISA 2OMEA 3A1SA 4U9IS 1PBTA 2H8GA 2XQVA 5TEVA 5B7NA 5CFNA 3CUUA 4IXMA 5LP1A 3LDFA 2H7YA 3LS2A 4J91A 4IYJA 4F7DA 1U8TA 1I0LA 4N39A 4HUQA 1A0OA 4X61A 4MVJF 5K0NA 4IDBA 3UAVA 1H3EA 2BFCA 2P9HA 2YN2A 4YACA 2FSFA 3THOA 4EB6A 4N49A 5B55A 1DZIA 3N2NA 2NACA 1JLLA 4RTLA 3PGLA 3UGKA 4NBKA 1KI6B 1M0SA 2VKQA 2ZBPA 2O3RA 3ICOA 4FR5A 2WF7A 4HDMB 1MDBA 1RHQA 2EJCA 3H0KA 3PQFA 4KO8A 5CPBA 3RC7A 4ALNA 4YQFA 1Z82A 3ZGZA 3OU2A 3RK4A 3RFXA 1LSSA 1H2YA 2R68A 3FGZA 4GGMX 4U2FA 3PNVA 4BVGA 3QYPA 4DLPA 3PFNA 5CDUA 1FNDA 1RPZA 5EHQA 4NHOA 4TTPA 3THYA 1XDWA 1AN0A 1EM6A 4X63A 3KXLA 3LLMA 4IVRA 4YQYA 1BWRA 2UYYA 4G4JA 2V45A 3OBBA 1T1SA 4AL4A 1VM6A 1SEVA 2LP4Y 3VJLA 3D7LA 3QE9Y 2GWRA 3CMMA 1ZN2A 4J4BA 4DC0A 3EG9B 1PHPA 5JMPA 1HV8A 3IP6A 1H2ZA 3BMCB 5BW5A 3B20A 1PEKE 3HPQA 1ONSA 1VXOA 4OQDA 1U7OA 5EMJA 5KX5B 1JMKC 2Z1DA 3MTJA 1U2EA 1I2ZA 2P2NA 3HJGA 4W5WA 5EERA 3UB3A 4BVHA 4DMUB 5JNRA 1UBCA 3CISA 2QJTA 5ECWA 2PLRA 2V74B 3RSLA 2SECE 3W5SA 4LXXA 5G0WA 3ZV6A 3EGWA 2EEZA 1GJRA 3BE6A 4N3GA 1VA4A 2DQ4A 3CH5A 2WINI 4GE3A 2IU4A 4BBZA 1AS3A 1C4WA 3BDVA 3LWZA 4JVMA 2I87A 3M0EA 2XWJI 1HNZB 4MAFA 5C37A 2GSDA 2GZ1A 1KFCB 2QLLA 5AMXA 5K4AA 4ZARA 4B3CA 3ZN2A 1ESDA 5CNMA 4O1IA 4CLRA 5FUQA 3B6ZA 4B31A 2QY6A 2VSFA 2BGMA 3L40A 4U7JA 3G0OA 4BRSA 1L7QA 3OLYA 2FY8A 2QTHA 2Z1MA 3JZAA 4UU8A 2XUAA 3HO1A 3DTNA 5JJBA 2ZI7A 4G1MB 4HWKA 1JS1X 3IUSA 1Z8NA 2PZBA 3VU9B 1RI3A 2IXFA 4IXNA 4CV3A 1T3TA 5I7FA 3T1HB 1F8XA 1QIJA 1KYWA 4ZT7A 2G0NA 1H8HD 4XVHA 3TOVA 1L1EA 2WSSD 4QXRA 3ME5A 2MSWA 4YX9A 3WRVA 1KP3A 4IDFA 5DM1A 1XT6A 3F6CA 1B14A 1R6TA 3TL2A 5C8YB 4Y8VA 4Y1EA 3FUXA 3H5WA 5K8VA 4WKNA 5ER9A 3HXPA 2H4JA 5DGIA 3CPJB 1QIFA 4EG0A 1EJ2A 2YVAA 5AKHA 3IUBA 2BWJA 3U0BA 1GPMA 1KI6A 5F73A 4HDMA 3M3DA 1Y7HA 1ESMA 4QBGB 5SY6A 2VJBA 1CXZA 1W35A 3SEFA 1WBBA 2YW2A 3ETGA 3A26A 5HNKA 2YN0A 2YYZA 4FGUA 1A5AB 3ODGA 4JR1A 3HDGA 1V6SA 2XDQA 3LFTA 5CW2A 1OZ0A 5KSPA 1I4EB 4U2EA 3UQZA 4B3IA 2JFQA 2XA9A 2VQSA 3UGQA 3E23A 3WBFA 2WIFA 1VMEA 4TL8A 4DOMA 3QXCA 4HYYA 5KNBD 3N3AC 3G2QA 1QRAA 1XTIA 2JI4A 3BBLA 2DWQA 2IXEA 4OUDA 5L6MB 3D8TA 1FU4A 1MA3A 1OV4A 1DIBA 2QQEA 5KJFA 2CE2X 1EXVA 4REOA 4H1VA 3DEZA 1YHNA 3D6UA 2PZGA 5CH8A 3CRVA 2OXFA 3EG9A 3WL4A 3BMCA 4E32A 1VI5A 2RKBA 3QE3A 1JE0A 3QU4A 3FPEA 3TX2A 4YV2A 3AM1A 5KX5A 3KT3A 4NBNA 3WNZA 3TL6A 4OLBA 1BHQ1 5E8RA 4MCJA 4P86A 3K8ZA 4QEDA 1CZHA 4K9LA 4RMHA 3VU0A 3IA7A 1B6GA 2O0LA 3Q3IA 3NIWA 1EE9A 4QPPA 5EJ2A 4DTIA 5G1OA 3ZG6A 3D64A 4BNUA 4P35A 4EY4A 4GGPA 3B9BA 1ABFA 4LVUA 2R8ZA 3OT1A 2H5EA 1UKCA 4M9XA 1C7IA 5AKEA 1JQ3A 4R7GA 5EXXA 4ZVQA 1MH9A 5J59A 2LKCA 3OTQA 4GIBA 4XTRA 5E2BA 5FUVA 4EA7A 1B8OA 2AQHA 2VRCA 1RRGA 2O23A 5CEFA 4LFBB 2VR1A 1G2OA 3A7DA 4MKFA 1BAPA 2ACEA 3CZ4A 5FFFA 2AVNA 2QSYA 1EG7A 3AR4A 4HXFB 4YTEA 1RCTE 3TEJA 4B43A 4HWPA 1X7XB 4ITRC 5A0FA 4LVOA 1IJEA 3GQBB 4FB5A 4D9CA 1V8OA 2Q0HA 3VU9A 2O5RA 1DTSA 2OHOA 1ATIA 4UM9D 5AIBA 2ETVA 2HCTA 4E2WA 2VL7A 3N8GA 2JGJA 3FZQA 4BPBA 4AJEA 1UK9A 5FTNA 4Q9JA 1ADFA 4H6WA 5IASA 3EC7A 1ZX1A 5AVRA 3OZ7A 3N76A 5C8YA 5FO1A 2ZP1A 2VJDA 1TZKA 4L5BA 5C1OA 1SQSA 2H1OA 1M8KA 1RXIA 3OZFA 4PFKA 3HB1A 3ADOA 2F48A 3K5PA 3S0JA 3D4IA 1U8ZA 2XGGA 2Y1WA 4BYMA 5JG7A 1P9OA 3SZUA 5DM4A 1GWNA 4LOJA 4XJTA 3WYNA 2OV1A 5FBQB 1NRJB 3STWA 4EHAA 1DC3A 3EZ6A 1FJXA 1A8UA 8ADHA 4EHNA 4CXMA 3KQPA 3ST7A 2QI9C 3COSA 4WPGA 4ZCRA 4KP7A 1J24A 2MSDB 4K3UA 3TM5A 1ZBQA 2DQSA 3H2BA 2YVQA 2Z2YA 3DM9B 4GW3A 1TQ2A 3T3OA 4MGYR 3WRWA 4DLBA 3QEJA 4CU5A 2IA5A 4KZPA 1TCVA 1Y3IA 2BI4A 1XNGA 2PFSA 5HFNA 3ZHZA 2ID8A 4BP9A 1D0VA 1ZMBA 2QN3A 2YDYA 3IOYA 3BEOA 4FS3A 4M0LA 2QMEA 3WIDA 3ZUPA 4MWTA 5EXDA 1P17A 3RVLA 2C7GA 1MX5A 2LE0A 3VVLA 1XXLA 1YDGA 3G2MA 4IRUB 2PKQP 3GG2A 2CL0X 3A1TA 2OCLA 1JH9A 4HFRA 4D9GA 5H68A 5A3JA 3C4JA 4O4HB 5KTKA 1OH6A 1LTQA 2QUAA 4G0NA 4HEQA 4MPPA 4XQCA 4G8BA 2WD7B 2AJCA 3A6HA 4Q05A 4AUNA 1PZMA 5JADA 2OLJA 4MJ7A 1QYIA 1TK3A 3CF4G 4KYIB 4L5JA 1XVVA 3F6PA 3OEYA 3PDIB 4NAUA 2F8MA 4IMIB 2PT5A 3DYBA 4GO1A 3R5XA 2WIDA 4O25A 4PZZA 3JAMA 1YB6A 1QC5B 2DPXA 3JQBC 1HYEA 3FDJA 3ANXA 1NW8A 3KR9A 3NOXA 1CZKA 1VDZA 1XX6A 3HP7A 3OEED 1F9EA 3HPRA 2B83A 4QODA 2E1RA 4DLKA 4Q1BA 3G7UA 4GRIA 5EZQA 1Z63A 1X7XA 1TGVA 3DZHA 5KX5F 4L3WA 1CY4A 4KITB 5KTRA 1IH8A 3GQBA 5B3KA 4B35A 3PENA 3S70A 5C8VA 4E7OA 2HJRA 4RAQA 4B3GA 1HL7A 5TSDA 2J3KA 3B1YA 4MITA 1UCFA 3IVCA 4HQFA 2QLFA 4MUHA 2O0KA 2XYPA 5TX7A 3I34X 4G85A 4W5RA 1M6VA 3F2VA 4M22A 1NFRA 4N5DA 4DBLC 5H59A 5L4NA 1Z6XA 2ZVPX 3O5AA 1LDGA 1Y82A 3REFA 3KM0A 1T10A 2RHHA 2BTQB 4QUGA 1Z34A 3FCUB 3WGMA 4JKOA 1MOPA 4LE2A 4WRRA 1Q20A 4IM7A 3OQVA 2AXPA 1S3FA 2I4MA 1P2FA 1UBLS 5HJ7A 4DLLA 2MU1A 2GJKA 4W1PA 3RVQA 1E2NA 2DUWA 4D1YA 4G89A 1C4XA 3K9CA 4RF3A 1JFRA 4GL4A 2VLIA 1XNHA 4K28A 2H1WA 1I3NA 1NUSA 4QYTA 1AQUA 2BP7A 2XMCA 3REQB 3S7TA 3H18A 2JIDA 3IHKA 2XOKA 3OE5A 5TQ2B 1XFAA 4Q19A 3VU3A 1TE2A 3MUNA 1HG1A 3U7HB 1EFRA 1GTJ1 4YDSA 3SFVA 4G56A 5EY5B 5F7OA 4J0HA 5D3QA 3FHOA 5C8YF 4EHIA 3EK2A 1HEUA 3PQ2A 1ZVVA 3I4FA 1IQUA 4QC2A 3OZAA 2M1ZA 3ZXIA 4RFLA 5AI5A 4BBPA 1TW2A 3OQIB 3WXMA 2WEKA 4X92A 1Y37A 3KUCA 2C9DA 1SELA 4XQ0A 4H16A 3H9UA 2OFPA 2G6BA 3F2IA 4FR2A 3MCWA 2WJWA 4HDOB 4N6OA 1Q7BA 4O4HA 5IYZB 2WD7A 4G5QA 2GPBA 1W4RA 1PW5A 2EX0A 5DTRA 3RCBA 3HBNA 4EUFA 5AQ1A 3HJTA 3LVBA 4US0R 3BXGA 3PDIA 4LZAA 1KWKA 2HT1A 3E53A 3IO3A 1WTAA 2GPWA 5M34A 2ZZMA 4CEIB 4O5AA 3H8WA 5C4MA 4Z4HA 3W5DA 3KQVA 3U7QB 5L3VA 1QC5A 7MHTA 2VP5A 2Y8EA 1MGPA 3H16A 2NPFA 4WACA 3K31A 3SLGA 1G55A 1ULZA 1UUFA 5C3MA 3HCFA 3G5LA 4Y3UA 4ZGGA 4ZICA 4C2UA 4KWHA 5GVRA 1RQXA 3B3AA 3UMBA 4UPEA 3K0FB 2Y1XA 3MGGA 3ZHBA 1OXTA 3UHOA 5JAQA 4CTJA 5JO0A 4KMMA 2FW8A 5F98A 1CRPA 3PFBA 4EJSC 3TNJA 4FUTA 3T0FA 2D5LA 3RYFB 4C03A 4R8RA 3SYNA 2JHFA 2BGJA 5AJHA 4B6JA 3T1VA 2IYWA 2GFHA 3C8HA 3KCQA 1PL8A 2BRUC 4RGVA 4GL2A 1LLDA 3GLGB 1E6CA 3CG0A 1Y1LA 3HNRA 4JLVA 2FE4A 1O9HA 1UDCA 3OIGA 1ZIDA 4X8HA 4RXMA 2WAMA 1NMZA 3A6LA 3BBPA 3UVEA 3PD0A 4DIOA 1TB4A 3MJTA 1J99A 1SC6A 2BTQA 4JL8A 3GP3A 3BB1A 3TDMA 3NOQA 4LYGA 4G1VA 2R6DA 2XNSA 1VE6A 1ST3A 2G9RA 4Y67A 1G8KA 3EGOA 3U19A 1ZSYA 3HYSA 1I6WA 5LC1A 1XDZA 1I5EA 2C58A 3I9FA 3T7CA 2BHNA 3I1IA 1RADA 4L57A 5EUQB 2YOGA 1JXMA 3FOCA 2ZJ8A 4HAUA 4OXIA 3D1JA 4QDJA 2N1BA 2GZMA 3MGAA 2OZLB 1PQUA 1GPUA 2CHUA 2I6UA 2OCPA 2W43A 3GYGA 3REQA 3P9QA 4LJRA 1OBVA 1FUEA 2QWXA 5LQAA 2CJXA 5TQ2A 3TMYA 13PKA 3ZDXB 3OZGA 3IE1A 1JG3A 2LCIA 4TSFA 1QR2A 1UDAA 4FINA 3USES 2WDPA 3GJZA 1SUDA 3Q41A 4GMDA 1BN6A 2WD8A 3DLCA 3C1OA 4Q03A 1LBEA 4F2PA 5AKGA 4OGLA 1FP2A 1EJBA 4L6AA 3F9CA 2Z30A 1NPDA 2LWIA 1E2UA 1E9EA 2AXQA 2WABA 3QJ5A 3VOTA 3BRWA 3OQIA 2E85A 3OI7A 1ZRSA 5EPOA 4BQRA 1IE3A 1DRKA 1HT2E 1OAKA 1PRYA 2PMKA 1AO0A 4RIIA 5L3QB 4Y9DA 3UJBA 8OHMA 1L5OA 2ZSIA 1A97A 4X1OA 4Q1VA 4ZVMA 5IYZA 4O59O 5BXQC 2VWGA 5J5CA 1FXWA 1TRKA 5C7LO 4YAWA 1US8B 3IHTA 1KEKA 2F8SA 3B70A 1SD1A 1BE6A 3EA4A 3PUWA 1Q57A 1PBNA 4M54A 3GJTA 5EIFA 3W5VA 3GVPA 4CEIA 2UZAA 3U7QA 1X38A 5CB4B 1RQRA 3NT2A 4Q4HB 3ZQJA 1KFEB 5IFKA 4AJ2A 2XCSB 1E61A 4BO5A 5KWIA 1E79D 2BHSA 4H4DA 4F4IA 3DLHA 1T8UA 2WVHA 3FNEA 4HDCA 5LQUA 1V35A 5JC1A 4OQQA 1T0IA 2GN4A 3K0FA 4OU5A 4UBIA 3R7FA 1Y5RA 1GNRA 1RQNA 5JCOC 2C61A 4FYVA 3CKLA 4GYWA 5I3CA 5E3JA 4WCFC 1B00A 3RYFA 3CNHA 4CT4B 1CUHA 4ALIA 1ZAYA 4YRNA 5T5QA 4BLOA 1E6LA 1U3WA 2YC4C 4O4HF 2I4LA 3GLGA 4I19A 1WV1A 1FTGA 2ISQA 3ZEAA 3HJBA 4FXPA 2WV7A 5KPDA 1RR6A 4W1QA 4I3GA 4W5NA 1LQ2A 1WXHA 1E8MA 3GX1A 3IAAA 3DOJA 4EZBA 4OJYA 3CW9A 3JWGA 4M2LA 1ZH2A 5H3LA 3DOFA 2CF5A 2X1HA 3VJRA 1FX0B 2K5UA 2C5BA 4GSYA 1RQLA 1OTHA 1ZD2P 3LZDA 4E6EA 3GVXA 4X7BA 2C4NA 2JPDA 4N0QA 1Q84A 1RWKA 4FYYA 5BYKA 4DRXB 3EASA 4DMFA 5KMGB 1L4NA 2XNDD 4G2NA 3Q7SA 1D03A 1Y5IA 2JAXA 1Z2AA 5FTLA 3TXAA 1Y3DE 4OX9B 2HWYA 2Y99A 5JMWA 3A8TA 1NMQA 2OZLA 1Z5VA 4ENTA 5H83A 5J5AA 3R6WA 3KKOA 2WA1A 2VWPA 3A3OA 3B6KA 4EZIA 2YW9A 3JQ6A 4XOIA 1NXPA 2JLSA 3F6BX 4KAFA 4TMWA 5A4KA 4HWTA 5BSKA 4OQXA 3L41A 1GFWA 1T2FA 3GG9A 4W9MC 4XX0B 3UJ6A 3KETA 4UUMA 4PZ9A 5BYBA 3RS9A 3UYKA 1QDLB 3JYPA 3UAYA 4RTNA 1KIAA 2LW7A 1UZLA 5L53A 1NYTA 4DQDA 1C50A 4RO0A 1B2LA 2P11A 3AHIA 1WMBA 4NG4A 4MVJH 1X7GA 2IE8A 3R4CA 2HQSA 4BFLA 5BUSA 1R8JA 1PGPA 1JEOA 4ESOA 2MDTA 4FPXA 1UIRA 3MLAA 5CTJA 4ZV7A 4OY3A 1COZA 3OM8A 2JFOA 4JQSA 1TMKA 2Z43A 4P3XA 3TAHA 5AUNB 2PRZA 2ZQZA 1Z88A 1U2QA 3BIJA 3NJ8A 4I9HA 2X1VA 5L3QA 2Y4OA 4J0FA 4RHFA 4GWLA 4MP8A 4ZOAA 3FX2A 3P2KA 1G8HA 2DQKA 1A5ZA 1S01A 1PS9A 1BN7A 3GELA 3R5HA 5AKJA 4M1EA 2GFIA 1SQ0A 1US8A 3QLVA 4TTJA 1IHUA 5EJMA 4IZOA 1QFYA 1DQYA 1L1QA 1P0MA 4CVNA 2J6BA 5DM60 2G70A 4BPRA 2PZ8A 4FYIA 4Y2YA 3LCVB 3WKAA 1E9DA 2CVQA 4LXIA 4Q4HA 1O5OA 4UNQA 8MHTA 1GUAA 1MB3A 2ST1A 1F8GA 1C5KA 2RHBA 3D7SA 3KFVA 4ZODA 4MRSA 4EHLA 2C07A 5HPYB 4D8TA 5I9TA 1JWLA 4QVIA 2C59A 2CXHA 2DKOA 4PSCA 4X41A 5LDGA 1M2NA 1YRAA 3CJRA 1GPJA 4HDRB 4LW8A 4E4RA 4RDXA 5EESA 4D9JA 3ZS8A 1FLDA 1JHYA 2INGX 3VQTA 5AM0A 3LX5A 1RRPA 4PC3A 1NRIA 4YRAA 3ELYA 1QDEA 4IAOA 1HE8B 2L19A 4WADA 2VQFB 1WUTA 2VA9A 5IYZF 1P4GA 1B23P 1FXWF 1J9GA 2GRAA 4JY7A 1S7CA 3TGPA 3UAGA 1E3LA 2BUBA 2HIMA 3PNBA 2WKRA 3KLBA 4KQJA 3O93A 4OHBA 4OSEA 2NTYC 4OXYA 3L7DA 4CI0B 2XCTB 4JI3B 1FX0A 1K4YA 4FFBB 1Y4UA 2ZRAA 3ITDA 4XB6B 5DM70 5A71A 2GYYA 5AYVA 4RPKA 1MDFA 1R2QA 2H6EA 1R64A 3MYRA 5AH0A 3WZ2A 4CF4A 4DRXA 3IEKA 1N2GA 5KMGA 5GINE 4KRFA 3WB0A 5CVJA 1QYDA 5CT4A 2MMGA 3A4TA 4X66B 1V9SA 1F51E 4XSGA 2QTNA 2PUJA 1X8JA 3MGCA 3IEIA 3R7WB 3ZWCA 4WY8A 5BV0A 1I7PA 3ZK7A 2PLNA 3HXTA 3QV1A 5IARA 4BTVA 2UYHA 3B38A 3L0PA 2BCGY 4ZCMA 1DLIA 3LC1O 4G5RA 2IUYA 3H5IA 5CAEB 1UBEA 4DRYA 4HGYA 5LQNA 4RQAA 4ZEOA 5BN1A 1S7GA 3EC2A 4XX0A 1SMKA 4OKNA 4I1IA 4TROA 3AJEA 3G8AA 1QHYA 1ZISA 1P6XA 2RMKA 3EDOA 3GLIA 3DZKA 4ENWA 1O94C 1VI2A 2XA2A 1J20A 2IYYA 3ZDZB 4HYTA 2FW0A 3MQ4A 4B48A 2C9ZA 1PG5A 1F38A 3DPIA 3TTWA 1ZK0A 3K1JA 3TINA 5KYTA 3M5DA 1DDOA 1D2HA 2V54A 2W6MA 3HLTA 5JS1A 1ISPA 1D1QA 1M2VB 1EDEA 1NXWA 3B2NA 3DV2A 4QFMA 3VR2A 4ID3A 1IHPA 5JS2A 5DNWA 3WB1A 2F62A 5LUBA 1NXTA 4JLMA 4A91A 1JQEA 1LB1B 2R8OA 3DZJA 4WESB 3WL7A 2AG1A 1LTHR 2F4NA 4RZXA 1HWYA 2WILA 2BLLA 3VSAA 2HKIA 1L6RA 3CH4B 1T2NA 3PGVA 4I14A 4Q3KA 2QR2A 3UUWA 3WSVA 2GARA 4RZ3A 5JY6A 2V0CA 5E9QA 3UN1A 1KA9H 4IFBA 4B5KA 5K0CA 5I7AA 2QTFA 2WPDD 1N2OA 4DV5B 2VNAA 5JUWA 4TS4A 3GBVA 1KJ8A 1U2GC 1QOZA 2E9SA 2HFJA 3PGXA 4OP3A 3ROFA 1DBVO 1S8AA 4AWBA 1FUYB 1IOZA 2P35A 3N6VA 3LL4A 4HDRA 4MQUA 1HEYA 2HTEA 3DSRA 4RLQA 5DT2A 4I08A 4MW0A 4BQPA 1IK6A 2PMWB 3GCZA 3P0JA 1C8LA 2ARKA 3LT5A 3QE4A 1K92A 1DOAA 1ZH8A 3OWHA 1PK7A 1SBCA 5G02A 4YV1A 1SUIA 4Q16A 4L3OA 4RGQA 5A05A 5C5DA 5H9WA 3HU3A 4WZZA 2BJWA 2X0KA 5H5JA 2VA8A 1UT5A 2AEFA 2GZAA 4NIMA 1S3SA 3IDAA 4EZEA 4UJ3A 1SD2A 2H63A 2Q21A 3E9ZA 3VNAA 2HH9A 3H1EA 5BORA 1GQSA 4KYUA 5H8WA 2G83A 4FFBA 4A4DA 3C7DB 1SIOA 5CB4F 4ROTA 2QMQA 1CT9A 3DTVD 3LBAA 3PD1A 5FHRA 3GXOA 1YAJA 2VDJA 1U8EA 2XE8A 2UXCB 2Q9AA 4R1OA 4YRTA 3NGMA 1RM5A 5J4HA 3JPWA 2OYCA 2F67A 4RZ2A 2B3DA 1I1HA 3ZK9A 2O2DA 4JLJA 4EGJA 2RGAA 4DV4B 4AKHA 2P79A 3T7EA 2J0UB 2C88A 3QLUA 5FTKA 5JARA 3H2HA 1SOAA 1JIVA 1XLTC 1OXXK 4C4YA 4RENA 3JWJA 3FCOA 4TT3D 4HLCA 2PEYA 4DY4A 5CAEA 1G21E 1KZ7B 3TB4A 1X1SA 3U1BA 4HF7A 4KLRA 2X4DA 4KQ1A 4X00A 4DMGA 5C1DA 1K2VN 4QDOA 1T9CA 1VCHA 1W4LA 3L7IA 2VZ9A 3OPYI 1YZ3A 1XZHA 4KPFC 4TWRA 2JD2A 1IPFA 4PLWA 1H5QA 1Z7EA 2GN9A 1Y6QA 1EFPB 3L1HA 4I55B 2VQ3A 2J87A 4FDTA 4KC0A 5AKIA 1LF0A 2Q4EA 1OY1A 3IAM6 1BX0A 4S3MA 2ZE7A 2WRZA 1AK1A 1PUXA 3ICWA 1BQEA 3OT5A 1M2VA 1QF7A 4ZYYA 5EXTA 3RS0A 4ZGWA 1RPAA 5J2UA 4FE3A 3G5MA 3DVRX 4KFUA 3IBSA 3I73A 3HDYA 1R7RA 2YWFA 1H2EA 4WESA 1ZMXA 4REMA 3H86A 4TWIA 1AU9A 4RELA 3RFTA 3TBFA 2RB4A 4YJKA 3K0HA 1Y6GA 1QGUB 1E96A 2BYTA 3GL9A 4ZJUA 4B4OA 1JQAA 2GM3A 2Q07A 1T9GS 2HU2A 1P4SA 3GGOA 1J8YF 4FHZA 1MB4A 4EMSA 5BSMA 5DYTA 4DILA 4Z4GA 3HR8A 4MVJE 4R2XA 3X2EA 4LS3A 3PRKE 4G0XA 5I8WA 3O26A 2ZDGA 1PIWA 4NNPA 1W5FA 4GPAA 6PFKA 1Q1GA 4LHZA 2QJRA 4LDJA 1X13A 3C15C 4IQ4A 2E5LB 1RHJA 5JZ9A 1KO8A 2NUBA 3VR6A 1FBTA 2DCMA 5LZ2A 1JEYA 3L0SA 3UCFA 1MB2A 2AJTA 4WZ6A 2ZVDA 3WV4A 3FDIA 2YV4A 3IXLA 3QENA 3P2MA 1AM4D 1SC4A 3MJFA 4HPJB 1QUFA 4GI1A 4KVZA 1KY5A 1YS9A 2C9MA 4W6QA 4WLFA 3TQQA 2YCBA 4EPTA 4XXHA 1MW9X 2X0JA 4FCVA 4FI3F 5CTAA 4A23A 3MWDB 4R69A 1RJDA 3B8EA 1PLLA 4Y0AA 1UXOA 1KDTA 3E22A 3WJ2A 3PTZA 1RKBA 3QIVA 4XKJA 1Y34E 2J08A 2OOSA 3DFZA 4IQGA 4N82A 4DR6B 1Y7LA 5IC4A 2CEAA 5ERGB 5JSKA 1AZTA 2XYRA 3HCOA 1N0VC 3TUIC 4YY3B 3A1CA 3V8PA 4EF5A 2ZS8A 4JJKA 2JLYA 4DDUA 1U0BB 3AHJA 1H2RS 4HMPA 2XADA 4N0DA 3U0VA 2XBMA 1TEZA 1DIAA 2W2KB 3GJ3A 2D3WA 4DWOA 2EJUA 3VKGA 2I4OA 2J0UA 3O38A 3V1TC 3GC6A 5HSGA 2A0UA 3MS4A 1P1KA 1ZM2A 4AP6A 3PEFA 3FPGA 4HN9A 4I7EA 3D4OA 4KNVA 2ZIZA 2OXEA 4COKA 3SVLA 4LMAA 4GQIA 2Y67A 4NH4A 3RVBA 4AN0A 1A72A 1WX1A 3RG8A 3KLMX 3WTBA 5BN4B 4BYGA 1DBWA 5LP6C 3T5CA 4B71A 4PBTA 5AIAA 2IITA 2HNBA 3I83A 4FFVA 2IPMA 1BH2A 1GUYA 4MB6A 1TKCA 4OV6B 5BQFA 1L4EA 5IDXA 5EEGA 4I55A 1EFPA 1R8XA 3DC7A 2W2VA 3KB2A 4RD4A 1O57A 1PG2A 2VUIB 4YI3A 5AOVA 4JI5B 1NRXA 3VSEA 1KGDA 5DRTA 1YVUA 4PCLA 2EGUA 1FQKA 1M1NB 3DONA 3MC1A 1QZXA 2P3SA 3QHPA 4CV0A 1Z4QA 2XZOA 3ULKA 2C7QA 4OJNA 1VG0B 3QSGA 3DOOA 3ZY4A 5E3HA 1JA0A 1YMVA 1J39A 3TRKA 3S8YA 3IBYA 1OIWA 3EMDA 4YAOA 3P9RA 5E2IA 2CYBA 1KK3A 1PWHA 1QGUA 3QF4B 2B4AA 3KYCB 4V0NA 5FOQA 2PU5A 2VRBA 2NVOA 3P0EA 1BXGB 2GN2A 2EZ4A 1YSCA 1U6JA 3Q2IA 5AM3A 4YAIA 4YP1A 3JATB 4HTFA 4XGKA 5D6OA 1UKEA 1LRKA 2AEEA 2VF7A 2AZXA 2BEJA 3EVTA 4IRMA 1HDRA 4ED9A 1UBUS 4F9TA 1EDOA 2FEPA 2ORYA 3KPJA 4FN5A 4C0HA 4KSYA 4LXTA 1LNZA 4INPA 2NSYA 2PSFA 3NLLA 5GOZA 1ZI8A 3D2BA 4MLDA 3TD9A 3UA3A 2EQBA 1UFQA 1FK8A 1CS0B 4V24A 1A7KA 1Y8RB 1W46A 2ZRFA 3LBYA 3IR7A 1XTVA 4Q37A 1R8SA 1O96B 4V02A 4ZI5A 4C21A 1O54A 2F64A 3NNDA 1UBGA 3MWDA 1KJQA 4OGGA 1U99A 4XR4A 2ZZNA 2ZYGA 4RD2A 3EGIA 2IW1A 3KIPA 3HC7A 5DNVA 3O31A 1E5LA 1A50B 3LCRA 2PS0A 2O2HA 1VYTA 4OB7A 1X94A 1GILA 2DBYA 2WTEA 3H9GA 1E64A 4LBVA 5CVDA 2JVIA 5KAPA 4AY3A 3P71T 4FFWA 3CUYA 4C30A 5LLDA 4PNZA 4ABYA 3F97A 1A2BA 1NUAA 2H0RA 3FG9A 3OE1A 3KT8A 1AHNA 4J0KA 1F2TB 1DQPA 1G7CA 2WWFA 4CHTA 3AVXA 3JWHA 3BGSA 1SZCA 1HURA 4KXWA 5DW0A 3W9BA 2PUHA 4BQQA 1Q0LA 4BLPA 1CETA 3DO5A 2XEXA 4FZ5A 1N3BA 2VYNA 3J7TA 2YIJA 3TKAA 1K1EA 3GFTA 5T6MA 3DVLA 2GX6A 3P9ZA 4FWTA 4A0GA 2CHEA 4LWOA 3MCVA 3BYZA 3T8YA 2C0QA 4N7MA 3KSDO 4IDNA 5BN4A 3CA8A 1TAHA 1FTWA 4KGZA 4KH0A 1WB9A 3SYRA 2QRUA 2BN4A 2HX1A 2MSLA 2PZJA 1RTTA 4IJ6A 4JIGA 3OZCA 4YGYA 5K51A 1KWGA 1YZLA 1UL1X 1X70A 3HZOA 2YXPX 1TA4A 1E6KA 3AI1A 4OHXA 2CVFA 2ZWAA 4HD8A 1YDMA 4Z4CA 4QUAA 3HM2A 3OJLA 4UMEA 3D3NA 3AR3A 4YJ3F 4CGZA 2WU0A 3AB8A 4U7TB 4ESEA 1QRUA 1BIFA 3PC2A 2P9FA 5K0GA 1Z56C 4K9QA 4LG1A 1OE0A 3ETDA 4E08A 2H5JA 1P4AA 4KJZA 4OL9A 1G8MA 3CF6R 1ARZA 5JRDS 4D0NA 5FPTA 3MELA 3VR5D 3OY2A 1GR0A 6LDHA 4BVAA 3QF4A 1LD3A 4H7IA 4KGXA 1GY8A 3KYCA 5EIBD 4K9OA 5IRCD 1GSOA 4RNCA 1C7FA 1BXGA 2QIPA 2BFFB 2WV9A 3JATA 4MA0A 1X39A 4KQ9A 3HA3A 2ZAOA 4HSGA 5FOXA 2GEVA 1Q15A 5KDOA 2B7BA 1JV2B 3H3FA 4I55F 4NABA 3GJ5A 1GGMA 1RQ7A 3IRVA 4K8OA 5DBFA 3WHKA 3NEPX 2E4ZA 4XDYA 3PGJA 2D06A 4JLAA 1CJSA 1VCIA 4PO9A 1Z37A 3H4IA 4IDAA 3OOSA 5TQJA 1OWPA 3K32A 2LCQA 4J94A 3TZHA 2PH5A 4X9XA 1M1YB 4EPYA 1DC6A 1CS0A 2J0EA 4H1TA 1Y8RA 2JFNA 4KSCA 1O96A 2AQKA 3AFNA 4Y1RB 1HTTA 1W48A 3WGTA 4MA5A 4BEJA 1EXWA 2B5VA 3QMMA 4ZQGA 1Z4OA 5I9MA 4FX2A 2JGRA 3T3NA 1N6KA 2FCAA 4Y2SA 3E1KA 5I6DA 2B8JA 2REOA 2WJ4A 1RC0A 2BH2A 2VWQA 4O33A 2GNOA 4RIEA 5H3HA 2RDMA 3AI7A 4LK2A 4LISA 4NL4H 2I66A 1N5JA 2Q3HA 4CDNA 4P98A 2VXCA 4ND6A 1XCJA 3NYWA 1ODTC 3BWMA 3LPAA 1MG5A 4KQCA 3I9V6 3CKMA 4RU1A 2BEVB 4IIJB 4ARSA 4ALLA 1XF9A 2NNLD 2C04A 2YWDA 2GCOB 2HEGA 3BF7A 1F2TA 2X2OA 4ZFNA 4C4ZA 4MTCA 4US1R 1QLWA 3FHJA 4GE0A 1NJSA 1WP9A 3QFSA 4KXUA 1PVDA 1L7NA 4HQRA 3ZHTA 2Z5VA 3MUEA 3IIEA 3IRUA 3SOPA 5FUWA 3AKZA 3SHTA 5F33A 2ODTX 3HV0A 2VDWB 4MW9A 3KV1A 3KPWA 3SBEA 1TMYA 1MMFB 1ORDA 2PZMA 3HJNA 3ZHRA 4GT1A 4KQIA 2D8MA 2J6HA 5CGZA 2FX3A 1REQB 3QBDA 3GRFA 4X3PA 4Y0VA 2JK0A 4PPNA 4A7PA 2VZ0A 1FSPA 5I51A 3R9XB 2ZW9A 5T64A 3HWSA 1Q95A 1CQZA 2BKEA 2DHQA 3N28A 1B0UA 1YJQA 2W98A 3T52A 4AJOA 2DWOA 1NW9B 5C53B 2AYYA 2CV1A 4QZVA 4QICA 3DZCA 3EZNA 4KEAA 5DK4A 4BO2A 4RD3A 1UC9A 4YT2A 4P4SA 1GSAA 3RRJA 1GYPA 4EDFA 1T25A 5EWMB 2WUWE 5BWOA 1R9JA 2GWHA 3BTVA 3HMKA 4K9NA 3NO4A 4JZKA 3FNIA 3VAZA 3DMDA 3O4GA 4MUGA 1L8AA 1PTJA 5F5LA 2FJPA 1YI0A 2ODBA 3D8NA 3GEDA 4OH7A 2IU0A 4I6GA 4D44A 2P2LA 4FFPA 4GBJA 2Z56A 4HNSA 2EFHB 1A76A 2C96A 2MWMA 2BFFA 3ZKWB 3PUXA 4NJOA 4NZYA 3QWHA 3BFJA 4Z0HO 3GLFE 1V48A 3H2ZA 3BG5A 1XAGA 2QW0X 1WQ4A 3D4PA 3IJEB 3UG6A 5A4DA 2CNNA 5JD5A 4Q66C 1MVLA 1P1IA 3LCUA 5LQKA 1ZG3A 4DWJA 1TUBB 2DSTA 1WMAA 2GCNA 2PL9A 2ZATA 3N2YA 3S5UA 4KNYA 3K5HA 1Y9DA 2I8CA 1QIKA 3BEDA 2H7CA 5EJGA 4E70A 2CDBA 2XV1A 4UARA 3WKBA 1SZDA 1PJZA 3LKDA 5LZ5A 1IG3A 3S4YA 4DNFA 1M1YA 2YL2A 4J6FA 4YDQA 4H3KB 3ZVNA 3KVYA 1ODIA 4HB0A 1BFDA 4GMKA 1CB7A 3GLSA 5TV2A 5AW6A 4P3NA 1MHTA 4Y1RA 3QVGB 4B75A 5CDSA 3SSOA 1VZ2A 1GUBA 1Q91A 2ZT7A 1BXRB 5IKPA 2RC6A 1V43A 1K6JA 1RCUA 5EJ4A 1JIIA 4GMHA 1O5IA 1XTKA 2CV2A 1E2HA 1PE0A 2FQQA 3HB9A 1FXSA 1GGFA 1KSJA 1MEEA 4OBXA 5CM2Z 5FBKA 5LWHA 2XOKD 3AKEA 5BR8B 2VPTA 2ZYVX 4F93B 4KMOA 2DVMA 2YOFA 1T36A 1GP2A 1EFRD 3EIOA 4YEDA 4D5EA 1KVUA 5GZ6A 2BEVA 4KE6A 1N7IA 4IIJA 2V6BA 1PT9A 3DDOA 3SF8B 1WV0A 1L4KA 2GCOA 2CLCX 3R4VA 3LCJA 4A5OA 2AXEA 3RB8A 4R2KA 5I7VA 5LPNA 1TZBA 2JJ8A 1G6Q1 2XNJA 2KJQA 3OVMA 3G9XA 2IX9A 1M0TA 3AKYA 4XIYA 1EBBA 1JWAB 4UXJA 1E3MA 1P39A 4GGOA 4UHDA 4UQOA 5KNDH 4RS3A 2VTBB 1J8VA 3ZE2B 4XYEA 4KE9A 5D7NA 1YULA 2VDWA 1UWLA 5TS2A 4D3DA 1OPXA 1TCAA 4PPGA 5KQLA 2WB4A 1Q77A 4BTEA 1REQA 2J09A 4C87A 5FAXA 3DBOB 2IYVA 5JWHA 1V1MB 2AV6A 1ELOA 2AFRA 1VJ0A 3ZHQA 1DXOA 1XCMA 3MJSA 5BWMA 3ACCA 1BEEA 4YIHA 1R6UA 1ZN8A 4JXXA 2ZJ0A 2REQB 2I67A 4PR0A 4QLOA 1GZ5A 2BZSA 2PVSA 4B2YA 3RSGA 3RC1A 4F5WA 5EWMA 1RJWA 2O3SA 3NC0C 5IAJA 5G40A 4CQLB 5JAUA 3GD7A 3FY4A 1GV1A 5HIMA 3QPVA 4JEUA 4DPLA 1UK7A 2DLDA 2I99A 3IAHA 1YQUA 4ZO8A 1U7ZA 3CW8X 3GLTA 4FNMA 1J21A 1HDOA 2JGNA 3I53A 4XB1A 5KJ6A 3IEMA 3PF9A 3PWKA 2I6FA 4RSRA 2B30A 3ZKWA 5JECA 1DFIA 4HEHA 3PQ5A 4QJ5A 3K2EA 5TPZA 5BNIA 1SG9A 3G8DA 4FMDB 2A5YB 3AT1A 1Z9BA 3KOUA 1N6HA 1TUBA 2B21A 4I4IA 2AK2A 3GUHA 2K87A 2H7VA 2O8FB 1EK1A 4BRWA 4ARAA 1K3TA 4UM5A 4CF7A 2X6RA 2D5AA 2EJBA 3VZPA 2W2LA 3HUDA 1EDBA 5IAEA 1Z45A 3CLVA 4IWYA 4QAJA 3K3PA 1P0CA 4AWXA 2I6XA 1I7SB 5KNCD 1T4GA 4EFKA 4TTAA 3LYHA 3QVGA 1KI2A 1E2BA 4RVGA 1JI0A 2ZULA 2H1LA 2HLDD 3L1KA 4QGHA 1BXRA 4PQEA 4JB3A 3A58B 3IR6A 1SCAA 2GLXA 4I3FA 3TE6A 3MIIA 3V80A 2GYVA 4MUJA 2QP9X 2PSSA 5DHFA 1XZFA 2JGFA 1IXRC 3RC2A 2RFLA 4WZBB 3JV7A 1ESEA 5JMTA 1W36B 3HY4A 9LDTA 1BKSB 1SM4A 1I30A 1C14A 1WF6A 2V98A 3E7PA 3N39C 3SF8A 2NZ2A 2A86A 3FWKA 2C4TA 3MILA 3MPOA 4K6GA 4KO3S 4QREA 3SVTA 3MWEB 1IXYA 3C6MA 3UHFA 1L3BA 4DCMA 4RY9A 1UFKA 3VOSA 4RZUA 1UADA 1FVXA 1T15A 5SYNA 4M9UA 5AM1A 1Q1QA 3KJGA 1Q0UA 3B53X 3N8DA 5FP0A 4G23A 4AO8A 4EL0A 1TD1A 4IGEA 2VTBA 1PT5A 3AHGA 2QP4A 2E1PA 3OIVA 4J0DA 4CCYA 4D6XA 4IDCA 2GN8A 3B1WA 2BVNA 1OXMA 1XRSB 2GT1A 3L01A 4HHEA 1WPRA 4RVHA 4QNNA 1ST2A 3F7TA 3E03A 1J33A 4MMXB 1QM5A 5IJ9A 3KQQA 2OHVA 4TXJA 1C4OA 1G64A 4BZPA 4F6RB 1XPOA 3FKSA 4ENRA 4IV5A 5K3EA 3M6FA 1FYVA 4FYWA 3PR2B 1ADGA 1WDKA 1JPVA 4X3OA 1HZJA 1IB0A 4TLDA 4B7ZA 4CQLA 4YUAA 4YCLA 1V8PA 3P0HA 5DU2A 3QLJA 2PGXA 1SVSA 1Y98A 3PNYA 4WH0A 5IDVA 3O8LA 2WKWA 1J7KA 3FI0A 3UICA 3X3HA 5BSTA 1LJUA 1U0JA 2JH3A 3QMVA 4GYKA 1PYGA 1G20B 4PHCA 3UMYA 4YWHA 1TQ6A 4TOIA 4HFJA 1K2WA 2BR3A 5C31A 1PD0A 3L4SO 2H2IA 2ZDHA 3OEHA 3QH4A 2D7CA 4M99A 2IVZA 4YP9A 1ZCFA 5EP3A 4WD3A 3WLAA 1K5DA 2H48A 1ZZEA 4D25A 3HZRA 5IH3A 5ALJA 2PKWA 2Y27A 3ECSA 1UFRA 5FT9A 1CZUA 3DL7A 2XUHA 2VXBA 2O8FA 1F1JA 3CN9A 3HYTA 5JYDA 4EG7A 4DDWA 3OECA 3QFTA 1QVRA 4NKRA 3RROA 3ZJ5A 2O8EA 1IL0A 3GUVA 3VUEA 1H3FA 3UWMA 3ZOZA 1BOFA 4ZC1A 2CW5A 1JH8A 4M37A 2P75A 3PQDA 4IWNA 3ABSB 5HBGA 2A5JA 2JBAB 3LFHA 4PX9A 5F7JA 1CUZA 3O1IC 1Z33A 1TLTA 2KLBA 1V11B 2WYUA 3FSGD 4LGYA 4M9RA 3NHJA 5ALNA 1P2TA 2EHDA 1FRNA 1VSUA 1SU6A 2RGDA 2VNSA 4D9BA 1GCAA 2CB9A 3QTBA 1FPQA 4TWZA 4C9BA 2O59A 1SG0A 1PWXA 1KNXA 1X14A 5LKAA 4LXHA 2FFAA 1XK7A 3EOAI 3QXGA 4ID9A 4WZBA 3VPHA 4D46A 3KOWA 3WLOA 1SPBS 1EUQA 1HQCA 1MAAA 1UJMA 1UMKA 4UOQA 3OQOA 2VC2B 1MC5A 2CK3A 4YI5A 5H4GA 3NHWA 2AT1A 1XVLA 2OYSA 1H85A 2PH1A 1C0IA 4PC6A 4WLNA 3MWEA 1H0SA 3AEKB 1SXGA 2BHRA 3FMOB 4HI0E 4K7JA 4E09A 3EIWA 1BFKA 2ZE8A 3CEJA 1MO6A 4PANA 1EX6A 4LXUA 1TM7E 2D6FA 4BVLA 5EYPB 1YQQA 3L7NA 5DX8A 2ZB4A 2VRNA 3FCSB 1U5BB 3HVIA 3NFRA 4KLAA 2X0FA 2Y05A 4BX2A 2C8LA 1Z18A 3R23A 2F4VB 2QSZA 3KYBA 4FSXA 3W34A 1ANKA 1DC5A 2W0SA 2XKJE 4H17A 4LRYA 4TYQA 2JHPA 4AIIA 3BSFA 3ZNOA 5HDBB 5JI2E 2J4DA 4RVSA 3VKHA 3DUFB 2Y0DA 3KK0A 3OX3A 4DBLE 3M6XA 3M6VA 4WDRA 5INTA 3P9KA 2IF0A 3DAYA 3MBKA 3PV0A 1XTQA 2BFBB 1DIHA 1E58A 2R87A 4GR5A 4F6RA 1IY0A 4OYRA 1TW3A 1WVGA 1QONA 2H4HA 1BU5A 1V5WA 2JGEA 4ZO9A 3VYRB 5TNXA 1IB6A 3WY9A 2CLDX 4FYXA 4LYHA 4UHCA 3W5CA 2A4KA 4X3CA 1KZ4A 4OJTA 4PAQA 1DRJA 1KR2A 1GARA 3ET5A 1K8ZB 5TF4A 2HA4A 2Y6UA 3CSSA 3WDKA 1FL9A 3P0IA 3AW8A 3RTCA 4CFYA 1T5OA 2AC2A 2OBFA 1H2BA 1VJ5A 2EDCA 1G20A 3KR2A 2Q3DA 4X6LA 3E9NA 1U0TA 1Z4PX 1Y4AE 3NORA 1E98A 2PBRA 4BMSA 3I39X 5BURA 2XPCA 1F4VA 2XHEA 4PGFA 5MHTA 3GCWA 3CRQA 3DS8A 4YMWA 1IK4A 1DNPA 1P7YA 2GZSA 1USUA 4HOYA 4YHBA 1Q0TA 3NETA 3AYZB 1VPDA 2YXLA 4JVNA 5FL7A 4JI8B 1VPTA 3TM4A 4PNPA 4DIBA 2WKQA 1K27A 1DU4A 3FVWA 2JBAA 1Z6ZA 3K8OE 3GLGE 1JIXA 4RMJA 1SCIA 2W48A 3DW1X 3Q11A 4Q7JB 3OQMA 2AS0A 1Z68A 4KPUB 3H7IA 3V8EA 5CITA 4GAEA 2FDXA 3VTAA 1Y8ZA 3KWLA 4AG3A 2JAWA 3AVQA 3ESCA 1DEHA 1ONPA 3JQ8B 4NBTA 4GPTA 1UXKA 4AN1A 4KPYA 1XZBA 2UYGA 4C4SA 1IJKA 4MUMA 1SC3A 2X6TA 2FA9A 4ZEVA 2RHGB 4X85A 4KXVA 2QX6A 1YDWA 3TD6A 4FMDF 2HRBA 3PFHA 3K1YA 4TTVA 4DVJA 4V0RA 2GTIA 5KVQA 3AEKA 3JSAA 3L8GA 5KYGA 1KKUA 1XWFA 1RE1A 3PXUA 3RNLA 3TUJC 1WXFA 5EYPA 5TXGA 4EB0A 4NMLA 1NU6A 1X1AA 1U5BA 1WXWA 3OZUA 1GPH1 2WYIA 4J9UE 3GEHA 3OSZA 3V9AA 3LBIA 1P60A 3ZCRA 4N03A 2DSNA 1MOQA 2HN9A 3FNRA 3D2AA 3QLVC 4NJMB 2F90A 3A70A 4R9NA 2R2AA 2UZIR 2YRXA 3GRCA 3U26A 1XDBA 1MNQA 1CFZA 3L06A 2J4FA 5HTKA 3W9SA 4X8MA 1I7LA 2JCVA 5CFQA 5AVXA 2BFBA 5ES3A 1H4VB 1EH5A 5E8JA 4M7PA 1P7ZA 3IOCA 3X1MA 5KQPA 1W96A 1B8UA 1RZ3A 4NCJA 4JDUA 3HADA 4D2IA 4IY1A 3ENWA 4RDHA 4EHFA 1MTZA 4V0LA 3O47A 2VXOA 4J0GA 4JVLA 3VR6H 4YR9A 2Q1XA 5DHTA 3H11B 1U8CB 5ULLA 5BQOA 1T3ZA 3CIFA 1XLUA 5SICE 3NHYA 5T4EA 1M2FA 4KQEA 2UU9B 5A5GA 2DOKA 3PFCA 1EE2A 4FCCA 4FGZA 3V2GA 3D8BA