3CNEA

Crystal structure of the putative protease i from bacteroides thetaiotaomicron
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
174
Chain Sequence
b'AKKVAVLAVNPVNGCGLFQYLEAFFENGISYKVFAVSDTKEIKTNSGMVLIVDDVIANLKGHEDEFDALVFSCGDAVPVFQQYANQPYNVDLMEVIKTFGEKGKMMIGHCAGAMMFDFTGITKGKKVAVHPLAKPAIQNGIATDEKSEIDGNFFTAQDENTIWTMLPKVIEALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative protease I
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron vpi-5482
publication title The crystal structure of the putative protease I from Bacteroides thetaiotaomicron.
rcsb
total genus 49
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cneA00
3CZAA 2YWBA 4MNTA 1A9XB 1C3OB 4GUDA 3TTVA 1R9GA 3VU3A 2LXNA 1OY1A 3EFEA 3ZJ5A 4P2GA 1P5FA 1BXRB 1QF7A 4Y0NA 4P35A 3TTTA 2XF2A 3EN0A 3BWEA 4P34A 4L78A 2OR3A 3P9PA 3TTSA 3SF8B 3MGKA 3R76A 2ZUSA 4ENQA 1GGHA 3NVAA 4ENSA 4K2HA 3PQ7A 4R7GA 1J42A 4OQ4A 4UOQA 2A9VA 1CS0B 2R1TA 5SY9A 1I7SB 1UCFA 1QVZA 1JVNA 2GK3A 2R1VA 3OT1A 4ZDIA 4UZSA 5SY4A 3SOZA 3TTXA 4QYXA 4ENUA 4E5VA 4L8YA 2W7TA 4Y1EA 4WXYB 4WINA 1GGEA 2RK3A 3RHTA 3B38A 3F71A 1S1MA 5BV2P 4L95C 3TTUA 3FSEA 1CE8B 4I2NA 3ZJ4A 3NONA 3PQ2A 4AUNA 4B5KA 3PQ8A 2WJZB 1T3TA 1N57A 1QVWA 3MIIA 1I1QB 4Y1GA 1VCOA 4GE0A 4ENRA 1IPHA 2NV2B 5E9AA 1PDWA 3D54D 1IZZA 2FEXA 3L4EA 3N7TA 1KA9H 2ISSD 4BTEA 1FYEA 3L7NA 1VCNA 5JZOA 4ADSG 4XLLA 1PE0A 1C30B 1OI4A 3EWNA 3P9QA 1L9XA 4RKWA 1OX6A 4MTCA 4I4NA 4B40A 4B31A 4B7AA 2RK4A 4ENTA 2NV0A 3NOQA 2R1VB 3OT1B 4HCJA 2YWJA 5SYAA 4QYTA 4BFLA 2R1UA 3TTWA 4ENVA 1G2IA 1PV2A 3CYFA 2AD5A 4S0ZA 4RKYA 2ZUTA 1T0BA 4JQSA 3NOVA 2AB0A 4E08A 2YWDA 3UK7A 2VPIA 1OX4A 5DFAA 3ZR4B 4LGYA 3B3AA 3PQ6A 3UMMA 1GG9A 1GGJA 3GRAA 1OX5A 1QDLB 3L18A 4MGHA 2VXOA 4AUEA 4GE3A 5K4AA 3CNEA 4D1YA 1SOAA 1SY7A 2V4UA 3CY6A 3KKLA 3NORA 1Q2UA 2ZUVA 4UNIA 1P81A 4UCFA 4Y1FA 3R75A 2VRNA 4ENWA 2ABWA 4N12A 1P80A 1VHQA 3L3BA 1O1YA 1ONSA 1GGKA 4P5PA 4ZDJA 3UJNA 3B36A 3FIJA 3NOOA 5LIRA 1OX4B 3TTYA 1KWGA 3UGJA 2IUFA 4BIMA 1T36B 1P7YA 4Y1RB 5JZMA 1PDVA 1KWKA 4OGGA 5IP5A 3P9SA 1WL8A 3CZ9A 3R74A 2R1TB 1QWSA 4ZGGA 1GPWB 1U9CA 2YWCA 3ER6A 2VDJA 3EZGA 4P36A 1IZYA 3SF8A 3WFZA 4ENPA 4Y1RA 2GHRA 4ZDKA 3F5DA 3M3PA 4L7QA 3P9RA 2H2WA 4OIFA 4OFWA 1KXJA 3TQIA 4UOZA 5SY6A 1GPMA 1K9VF 1P7ZA 1QVVA 3EJ6A 3PQ3A 1I7QB 3UOWA 4AJ9A 4OJYA 3PQ5A 3BHNA 4L8FA 1M6VB 1KEEB 2D7JA 2RK6A 4AUMA 2VKTA 4L8WB 1FY2A 1Q7RA 4B2YA 1VCMA 1CF9A 4N0MA 2ZUWA 4OGFA 2ZUUA 4PXYA 3PQ4A 4AULA 4LRUA 1GGFA 4I46A 1JDBC
chains in the Genus database with same CATH superfamily
3HBFA 3KOMA 2O3JA 1Y82A 4M89A 3PA8A 4DV0B 3PSHA 4I6GA 1T5SA 1XTSA 2W90A 3RK4A 1Q12A 1LVUA 1Z5WA 2GBIA 2Y1KA 1PJCA 2VSQA 1XZEA 5MN6A 1PLJA 1U6KA 1IULA 2VP2A 4QASA 4ZT3A 1ORWA 1JEYA 3HJFA 3L06A 1E2PA 1XTQA 3ZE6A 2OCBA 1K8XB 4FHCA 2H1LA 4E51A 1R8SA 2F1HA 4YMWA 4XR4A 4L5AA 1ZN7A 4BQFA 1U94A 1NUPA 2GNOA 3K5HA 4FJ2A 2WF6A 4U8HA 4H3VA 4XQ9A 1RP1A 4FBLA 1VCHA 1ZN9A 4KR9A 3E8SA 4MQEB 5TQ2A 1MN6A 3O93A 2HXGA 1SVSA 1GGVA 2FZVA 3V2GA 4HPWA 3AEYA 3N76A 1WF3A 4Q0MA 1VG9B 1UM9B 1M6HA 3I2FA 1E1QD 2PKQO 3EE6A 1CQWA 3BGDA 2HCJB 2FFRA 3PUZA 4C3OB 2REXB 2R8OA 4GAEA 1C2YA 2JHPA 1H69A 5AKLA 1MNAA 1GPNA 4HGNA 4PG4A 1AK9A 4IMRA 2BE9A 4QVGA 4BRWA 2OORC 2RB4A 3O31A 2DWCA 3GV0A 4I3HA 4E46A 3A2KA 1VB3A 1PK7A 1Y9AA 1KA9H 1FYEA 4OYRA 2A5YB 4G5XA 1KYZA 3IVAA 3S2IA 1BA2A 4JLDA 1W9HA 3ASYA 3E7DA 3N5CA 4M8IA 1DMSA 1VPWA 1GITA 1OXVA 1O54A 1QLJA 4OXRA 4BX8A 2W2TA 4Q7LA 2O7QA 1VC2A 3OPYI 1OLOA 3RS8A 4PNHA 4CM8B 1SUIA 4HEA6 1U0SY 2BEWB 2GNPA 2IOHA 2QTZA 1FFHA 4S1OA 4QEDA 5EWJB 5FWAA 5KTMA 4R6WA 1SBNE 1SB8A 3OE5A 1KK2A 3CISA 1BMTA 1B0PA 1MORA 1PQWA 2IHUA 2Q3EA 2W0MA 2YXEA 3FDJA 3RROA 3PFBA 3ZKWA 4OHVA 2Z98A 4RJKA 5K0JA 4CG1A 4W5RA 1IY9A 2WUGA 5DHFA 4DM7A 1Y7HA 2JPDA 4QDXA 3Q10A 4FCCA 2QQFA 1E4EA 2IYEA 5B3JC 1U1IA 1NRIA 3L3BA 1L5LA 3IAUA 3QZUA 2FZGA 2OL4A 2A30A 3C4QA 4X3CA 1LJLA 1TMKA 3B89A 4AWAA 2R84A 5KYGA 3O8CA 3B3JA 4PLTA 1P7YA 5K2OA 3MK31 3LXUX 1RPNA 3AF0A 1N2JA 3ZK7A 4AP5A 2IZ6A 4C06A 5CLGA 3OPNA 2QQGA 4B7UA 4DEXA 4DG5A 3IKJA 3IHLA 2O8NA 2PSEA 1P2BA 3DEIA 5K6AC 1A76A 2POQX 2HBZA 3N0RA 2F67A 1M0SA 1MJHA 3UMSA 2H3HA 2VJCA 3DMNA 3RV3A 3FVVA 2GF2A 2AJDA 4X6XA 4GR4A 5FD8A 4QOGA 2E48A 2QD5A 4AX4A 2BL4A 5JWHA 3AFMA 1ZM7A 4R1PA 4XRRA 3I5UA 2QM0A 3MFYA 4MQUA 3QXCA 4TTVA 5ALEA 5EG5A 4CU2A 1KKLA 2C4VA 3AY3A 4RPKA 4U7TB 4QTYA 5G3ZA 4R54A 2GBFA 3RAEC 5M3BA 2NU7A 5IYZA 1AZSC 1AURA 5C52B 2IIBA 3GZNB 4JLWA 1MV8A 2JEOA 4WZ6A 3TCNA 3DUWA 1FP4A 1HTTA 2B1JA 3DBLB 4NJOA 3TE7A 2GR9A 1S2GA 3AF1A 1JA1A 5HIMA 1Y7LA 2W98A 5T8KA 5I9LA 1ZAYA 2V1UA 3D6MA 4DR4B 3AY7A 3FMFA 2AN5A 4FD2A 4WL0A 1MD9A 3EBOA 3IUEA 3DC2A 3S1AA 2PLAA 1CERA 4I8XA 3VC3A 3U61B 1X8JA 4RUKA 1BD4A 3PTZA 3MQ2A 4O2AA 4DPKA 4DDWA 2R97A 5EQTA 3AR8A 2AFHE 3H05A 2YDXA 4IO0A 4OBWA 3EF1A 1L9KA 1YUNA 3HNPA 3PIRA 3D81A 2OBLA 2O6LA 4L5CA 3CX4A 2PS3A 5EJAA 1E2HA 2PK3A 3UKJA 1IAVA 5ALMA 5K99A 3QEMA 3GLGB 2Y66A 1XZNA 1FXUA 1WDMA 3VR5D 2FU5C 5BSEA 3BSFA 5JJ5A 4BDSA 1F9AA 1LX7A 1YZGA 2E4VA 2PANA 3A3YA 3O26A 3ZV3A 4B2PA 4Z54A 4Y9TA 4HXYA 2NU7B 1RP7A 1E1NA 3WKDA 3B5IA 1YJXA 5KU7A 3H2YA 2IHNA 3GJYA 3FSEA 2VYFA 1DFIA 2XOKA 3LLCA 4UVEA 5KAPA 3TAXA 3WGZA 1OXSC 2J7KA 1I2ZA 4I36A 3ZDRA 3S8YA 1QZUA 2QS9A 3N2YA 2D00A 2CK3D 4CEJB 3DYBA 4NONA 4TMVA 2QGFA 5FCDA 2H1OA 1A72A 3EEIA 5CRIA 4PYLA 3RJMA 1E0KA 1KAGA 2YL2A 3W5JA 1AKTA 1P5HA 2CDBA 1Z4NA 1XQXA 1HT1E 5TQ0A 1SHKA 3E4DA 4JKIA 3FJ1A 1WZCA 2P0EA 1GZVA 1DWUA 4L75A 4GLBA 2R1VB 5EXPA 4AF6A 5BN3B 2O8FA 3IELA 2P9TA 1I1NA 2CE2X 2E3JA 4Z1OA 1M6VA 3WRVA 2G7ZA 2PZFA 3D1VA 4G1CA 1ECFA 1LDGA 3M9XA 1UBLS 3KSZO 1OX4A 3TNJA 1MO2A 1K7CA 1Z0JA 3G8BA 1KGSA 1VZ3A 2ZI6A 2WK1A 2DSTA 4AKHA 2FP4A 2OD7A 4EF5A 1CHNA 4KC0A 3UHPA 4OYYA 3D6TB 3JPYA 4NAUA 4LAFA 3RSOA 4H7HA 5HCNA 3OFKA 3GHYA 4ISCA 1IUOA 4Y18A 4A91A 4C3VA 1W0JD 1J0AA 4OK5A 4PNPA 3T7KA 4I1PA 2AUMA 2GJKA 3V1KA 4QOFA 2ZIWB 4II7A 1V2HE 2MU1A 3LK6A 3VI3B 1KDVA 1XCJA 2P0AA 2R96A 4GXNA 5ICCA 1L4LA 1DIRA 1RE0A 2A84A 3H19A 1R0ZA 1PFGA 2ZZMA 3R5FA 3CVJA 3TKYA 3Q6NA 4JL5A 4LOLA 1X7XB 3HVHA 2PLNA 4XW2A 4DWJA 3BS4A 2J48A 4DC9A 1I2CA 1ECLA 3R6GA 1GTG1 4PZEA 1PNQA 4BRUA 2I4MA 1RFGE 1PYDA 2X8JA 3ENKA 5A06A 2QRUA 1S2OA 1NYTA 2EJBA 3CXUA 3V1MA 1QOZA 2PMEA 3RTBA 3T1QA 1LK0A 2JFGA 4KQ1A 4ND2A 3NIWA 2PPLA 1X38A 2R11A 4PZPA 3A9RA 4XR9A 3E7PA 1KYIA 3OIUA 4JP8A 1YL6A 221PA 1X42A 5DSXA 4B2YA 3F90A 1Y9DA 4JC0A 3PX7A 1WKBA 4BECA 3C98A 5TQ2B 3SKYA 3VA7A 2EW1A 2M6KA 1NR5A 2HGZA 1DWPA 3I64A 4WESA 1SUPA 3UAGA 3PTLA 3KXIA 2FZLA 4L7VA 3KKPA 2PUFA 3W5IA 4DLKA 5FWYA 3NHUA 1FZTA 2RG1A 4OI2A 3EIFA 5KTOA 2OB1A 4UVDA 4BATA 4Z9XA 5AUNB 3TLCA 3G2LA 5HWSA 4DBLC 2P5TB 3QE2A 4KMOA 5FB3A 1KAQA 4UATA 2XOEA 4FOPA 4DCMA 3G02A 1JMVA 4H15A 3DKVA 2ZBDA 4LHXA 1QJCA 3AR3A 4AX8A 2H1FA 4CUKA 1K86A 2DT5A 2M2IA 2AC4A 5EN4A 4D80A 5BN5A 1NXTA 2B5OA 4KYTA 4ENUA 1KAHA 3LBIA 4B4VA 4B3MB 4DWVA 3M4JA 1XRMA 2P4EA 1ZOIA 3F96A 5EEHA 3AZOA 3BYZA 2YX1A 2ANCA 5CGQB 4EMSA 5M2QA 4WCFB 3TE6A 4J90A 4IZOA 2UVDA 5IW8A 2ZYGA 4OHYA 3KZMA 4IIJF 2OCIA 1DT3A 2NV2B 1W5EA 3F5MA 1DGQA 1ZGCA 2WFZA 2QRQA 3DD5A 1L7DA 2O4CA 1US8B 3HPQA 2HHJA 4ZXPA 1E0SA 1C9MA 1A82A 1R6XA 4C6TB 5MF6A 3EWNA 2ATEA 3ECSA 2PRJA 3LP8A 3NHYA 4Q82A 1GFSA 5DMHA 1XJWA 1V1JA 1ZNQO 2HLHA 2JCBA 3H9GA 3LY5A 3KBOA 3OF5A 5AK6A 3OY7A 3L9XA 4IGEA 3VVMA 3PDHA 3TOCA 1TU3A 2C0CA 1GNTA 2OUIA 5CLQA 2J5BA 5BNIA 3OIWA 3J7TA 2Q7DA 4YCAA 1BO6A 4LHWA 1WZUA 3KSRA 2ZTUA 3SEQA 4HXGA 3SXPA 5IF9A 1IJBA 5FTMA 1I1OA 1FUKA 3TRIA 3Q2IA 1MABB 3K20A 3FMVA 3OCVA 3FLMA 3WY9A 2VP9A 1RYDA 1OGIA 1UKYA 4IICA 2QN8A 1Y6QA 1LS1A 1WCIA 2DP4E 2CHEA 2GX6A 2G67A 2JH8A 3FPLA 3R20A 2IIVA 3EWAA 3H2IA 4LYFA 3MCAA 4Q1EA 1P0QA 2M9MA 2QWXA 4PSAA 1GDTA 1TUEA 2Z4TA 4N39A 1ODLA 4ENWA 5FEMA 1K8QA 1OKKA 2DPGA 1P80A 4YREA 4AJIA 3SS9X 5I9SA 2SHKA 4Q4CA 1I4LD 1EWKA 4J1NA 1XXHB 1M8JA 4DLLA 3HXOA 4WKBA 2MMCA 1VG0B 5A5VA 4OHBA 3EY4A 1ZR4A 4KXXA 4A0RA 4PQYA 3ESRA 4QGFA 3LCJA 2IJGX 2OV4A 1H23A 2IDJA 2GN1A 2FG5A 3L7OA 5IX8A 1J70A 2LVBA 5D5HA 4PPYA 3IP8A 1XKLA 1Z4MA 3CEAA 4FZRA 4J0IA 2I4IA 4P3YA 4ZRNA 5REQB 3GPLA 2QDXA 5AXAA 1F7VA 1C0KA 2OZVA 3AJRA 1D07A 4U3JB 2WJ4A 2VQEB 4EJ2A 4ZKEA 1CSEE 3ILVA 4CM1A 2C97A 3MVEA 1EESA 1H0KA 4GXRA 4RDCA 3P20A 4N3GA 3IJPA 3V1YA 2PLRA 2ZJ7A 4MI6A 2IWRA 1PHPA 4UHHA 3WGHA 1ZJJA 2PL1A 1IK6A 1RQGA 4V0KA 1YZ3A 4FBMA 1ZC4A 5JU6A 3TW0A 3G2MA 4OTZA 4I14A 2OAQ1 3AJDA 5C35A 1CY7A 3G2HA 4TLAA 2A9QA 3W9YA 1HQYE 1TI7A 1XRLA 2JZCA 5HDBB 3H9EO 3PNOA 1SCDA 2H4YA 2YZMA 1V3TA 3KR1A 1H2YA 4QUHA 3N3AC 4DCJA 1YD7A 1A71A 1TMYA 3QITA 3UWMA 4YPFA 2ZBUA 4FHEA 1PJTA 4WLNA 2JGMA 4JOSA 1AUPA 2OCYC 3WGNA 3HCRA 3HHPA 1KO8A 3UJ7A 3RVOA 1BXKA 2UZAA 4L78A 3UK2A 1BDHA 1QH1B 4BE7B 3KFXA 16PKA 1PR0A 2FCAA 3IGFA 3VHXB 3N75A 1NA5A 3AUFA 4OQ4A 1EGHA 3PLNA 5I3ZA 4F8JA 4RJTA 3C5CA 2HB6A 3HO8A 3KKZA 4HGZA 3WLLA 4A8HA 3OT1A 3G2QA 2VSOA 2NLOA 3DFUA 4RESA 4YRMA 2VPYA 5J1SB 4YGYA 2IC5A 2XAAA 1TXGA 1ZD5A 5AOAA 3WLRA 3EZ6A 3EXIB 3ZIAD 2PD6A 1UMDB 2OAEA 1EE2A 3M3DA 3G2JA 1IY1A 4KO1S 5F5NA 1Z39A 1K9SA 3F49S 1JSZA 2VYNA 4BVKA 4BNKA 4JBNA 1OLUB 1TCCA 3FUUA 4IBOA 3V6MA 3CLRC 4ZCRA 7YASA 3M3HA 5ALFA 1E2BA 3HXLA 3H9QA 1KYTA 4BV9A 4EX7A 4LE2A 3RW9A 3LTNC 3H2ZA 1V5WA 2AJBA 4KOEC 1QB7A 3CB4A 4CR7A 1ZVKA 3JS5A 4CV1A 2OCKA 4UZFA 4X1OA 1E96A 3BL8A 4JIGA 2X0IA 4R84A 2JI7A 5KNCH 1XZDA 3Q8MA 1YZFA 5SYAA 2DH5A 3BGIA 3KJFA 1TQHA 3AEXA 1NQ5A 2NSDA 1P2GA 1ORHA 4R9VA 4BGVA 3CJQA 2YY6A 4IIEA 5AKZA 1XCOA 3BJRA 1S9HA 5JHHB 2G4VA 1AHIA 3BWCA 3AETB 4WOCA 4MZXA 5JVDA 3C8UA 1XB2A 4BV8A 2Y1GA 1SKYB 4FB5A 1BE6A 1GLVA 3DL2A 1A27A 3O1LA 3QVWA 1BHSA 4G67A 4NS4A 1KR5A 4X91A 1HYHA 4LBYA 4DLVA 4ZHSA 2IYLD 4ZYZA 4QARA 2OESA 5H7XA 4QJBA 2E37A 1SK9A 2EJUA 1OFHA 4YMSA 4A7PA 2WYWA 2FP4B 4NWIA 3CZMA 3LGAA 3H9UA 4TLBA 3KT0A 2OILA 4MGKR 1GGKA 3TNDA 1Y3HA 1ZUIA 1NUQA 1HDIA 1K08A 1W88A 3C4JA 3L7JA 5HUQA 1QGDA 4XYMA 4PFQA 4CT0A 1QOPB 4YUVA 4DREA 3CKKA 3UV7A 3CJTA 3Q6IA 3L7MA 5AYVA 3JZIA 4JR2A 4KLRA 5E2AA 2ZUCA 1GNQA 4QDTA 3U3RA 5TVGA 5HOEA 4CXMA 4HNHA 3UYLA 4DS3A 5EMLA 4KJXA 4ZCSA 1H2FA 3G0BA 5AUOB 1LXCA 1YIDA 4K2AA 1HX7A 2H11A 3KQYA 4UMFA 3I6IA 2QAGA 3TL6A 3W5BA 1TQ4A 4M1ZA 3SC4A 3LHDA 1G60A 5CCEA 3DOHA 5DB4A 2HMSA 2FKNA 1SCKA 1G9SA 2XEXA 4HSEA 4QTZA 2C57A 3X44A 5KO2A 1KOFA 2BJHA 4BU0A 5AVUA 3DMGA 4BAGA 1NBAA 1S8FA 3LT0A 3M9WA 1XA4A 2F2TA 2CBXA 4GLFA 3B9PA 3ZDFA 2DR3A 4QDJA 4OF4A 3WMEA 4OHPA 3UKDA 3F3KA 3ZE7A 2QV7A 1M3SA 5LIPA 2WW8A 3D3EA 3TTTA 2HJVA 5EQFA 1V8FA 3KKQA 4FFBA 4MWSA 1CWUA 3GMTA 3QP9A 5DASA 3HXQA 2DLCX 4JBXA 2DUUA 1W34A 1TJ4A 1JQAA 2Z5FA 1DFHA 4PAWA 3HEMA 4KR6A 2D5CA 2HWWA 2AT1A 4G25A 4MUXA 3WLFA 1H85A 1NI5A 2R44A 4WZBA 1T9BA 3KV3O 1GY8A 1SD2A 2QD1A 3SC3A 4IW3B 1FMCA 1PNTA 3U7IA 1U2TA 4K03A 4XB6B 4CW7A 3TDKA 2R7MA 4G5HA 4XX0B 1CUEA 1RJEA 1JA0A 2HLNA 3CC8A 5D6OA 2CF6A 4R5MA 2W8ZA 2NU8A 4ED9A 1KEEA 5IG2A 5DTIA 4M8NE 5IT9A 1AHPA 2CZCA 1N2GA 3HRHA 2OP0A 4BFYA 1GCIA 2HO4A 5EIXA 2A7QA 3FTFA 4L02A 4GI7A 2YOGA 1ZM3A 7GPBA 3EARA 1DUVG 1O8BA 3OFVA 3D4NA 3OZDA 4PX3A 6REQB 2FPPB 1YJ5A 1RRFA 1YTLA 1XTUA 1VE5A 1WBDA 3GLFB 2R8ZA 3D0RA 4JT8A 5ALKA 5JMTA 2NO7A 4OMFG 3UK1A 1FDTA 3DVSX 1MVOA 3ZYZA 4CG0A 3K15A 4JBIA 4MR9B 5JCJA 4L1KA 4M0MA 2LDXA 3TN7A 3U5TA 3IB6A 3SQXA 3AFIA 1G3MA 2G71A 4B3RB 4KE7A 5G0UA 1GCOA 4K6OA 3V1TC 4QPJC 3LUAA 3MAGA 4BKUA 4YRDA 1ZGBA 4ENVA 1KGDA 2CVQA 4NXMB 3DZJA 2FDXA 4MWZA 2X77A 4C78A 1AV6A 5D7NA 3WMGA 1N6OA 4FFSA 4OKNA 1YR3A 3AKYA 3D2AA 2TMYA 4W5WA 1ORDA 4CLRA 3GLHB 2OV2A 1W5AA 1JAXA 5ALLA 1DKMA 2I2BA 3MBOA 5FI1B 2MDTA 4PU0A 2PT7A 1HE3A 4GOOD 1H2BA 2X5KO 5KMGA 3EFHA 4H7FA 1XMOB 1UKBA 4B4DA 4O4JA 3QEOA 3W6ZA 2FH5B 2OXTA 1XALA 13PKA 1LH0A 1MT0A 2ORYA 4F3RA 3O8OA 1JXMA 1PRYA 4ONEA 1JAYA 2HBYA 4IEEA 3ZWWA 2BTQB 3SP1A 2G9ZA 2FQWA 2G4CA 4NZ9A 2V4ZA 2C03A 4AURA 1KWGA 3GNQA 3CF0A 4PWYA 1K2WA 4OXYA 2ONJA 2ZBPA 4QBIA 3OWOA 3KXDA 4QICA 5E6UB 2PGAA 3ADPA 4LQDA 5K51A 3RARA 4CZ2A 3ND6A 4BFCA 1J25A 4FN4A 1OXMA 5K6AA 3KT6A 1AU9A 2H5EA 3S2GA 4ZCLA 4TMZA 3V2HA 4EPTA 1YSCA 1E5VA 2QXUA 2NVUB 5INTA 3R23A 3L4BA 5A4JA 5IVKA 2XNKA 1A5AB 1IDOA 4QG7A 4MVXA 3MHPA 4OJTA 3D5EA 3RBXA 3GFPA 4I4TA 1WA5A 5BQOA 4AJ9A 3F46A 4EQ6A 1ZBDA 2DQSA 3N5KA 1FYFA 3RBAA 1N2EA 2Z2IA 3ABOB 3E9ZA 3A2MA 2F9FA 2NT4A 3OOJA 4KBGA 1NF8A 2QL9A 4G0PA 4P5DA 4M2LA 3TVDA 2QMUA 2I33A 3TFQA 3LHIA 4O4HA 4EG7A 4EELA 3M1IA 4ZYUA 5EZYA 2VDNB 4KXMA 4L27A 4YVFA 4BQSA 4F72A 10MHA 3HCDA 2WY2D 3UW3A 1THMA 5B7QA 1J23A 1EJ2A 1UIMA 1XNJA 4URHA 4DSTA 2G40A 1C7RA 1QC5A 3LKZA 2PUTA 4PXAA 1YE8A 4KQWA 5EIAA 4BXOA 3HVRA 3R4CA 1IY0A 1W0KA 4MVYA 3P0HA 4KVFA 4LKOA 3QPUA 1SVOA 1T6NA 1M1YA 1P72A 3MTQA 3L0DA 4ZU6X 2WZCA 3D7NA 1S2DA 4GRIA 1TT5A 1YRWA 2HBRA 1N0VC 4LDNA 5DJ5A 3RAGA 4Q1VA 2JKZA 4ZI2A 2JGJA 5A7FA 2B7LA 2ERYA 3V9AA 3PE6A 4WKGA 2VF2A 5FV7A 1QZTA 2RHBA 2ZAYA 3IMEA 3MZ0A 4R83A 2AX3A 4F04A 1II8A 1MX3A 1PR1A 3OCJA 4KQIA 4KPFC 1E3WA 5C2JB 1CUUA 3BK1A 4LK3A 3JYHA 3BG5A 4LVNA 5A3SA 1RRMA 2EQ5A 2P9CA 5F3DA 5JT1A 5KC8A 1PEKE 3IFSA 4WRRA 3DTNA 3S7TA 1DBWA 4HB2A 5E6RA 1QRAA 3WFIA 3UB2A 3JQRA 3G68A 2RKBA 2KS6A 4X44A 4ARBA 3D31A 5CCDA 4AZ0A 1ZY2A 1N8SA 3CEJA 3QJYA 3RIEA 1LD3A 4PO8A 2BUBA 2Q1SA 3OQ1A 3HKCB 4JFRA 1I3OA 2ZGVA 2PX5A 4BVLA 4Q7KA 1T0UA 2CYAA 3E2IA 1DAEA 4TKVA 1FDVA 4ME6A 4QQKA 1USUA 1QFZA 1W4RA 2ZS7A 1DWOA 5LZ5A 4DZRA 5HTKA 1D8TA 1OE0A 1SMKA 4PZLA 4TYQA 1UDAA 2PO5A 2RJNA 5DBHX 4DDVA 5IDYA 4B80A 4LF4B 3DNFA 4IY1A 3EQ7A 2AQ8A 2BMAA 3PWKA 4K46A 4YA6A 1IN4A 1QFMA 2RSLA 4MCIA 3R75A 4MV4A 2ZJ2A 2R62A 1C3OA 4B83A 1E2UA 2HA3A 3U62A 4GL4A 4IH4A 2X0RA 3JATB 3WP0A 4TKVB 5I7OA 3M7IA 3QWFA 2IEBA 2Q50A 4TUYF 3UJNA 5T4FA 1OLXA 4RTJA 4JI2B 4CHGA 2NUPA 2B82A 1GTJ1 3NTOA 3D5QA 5ICGA 3ND9A 2O0JA 5ERXA 5K3OA 1ZXBA 3BN3A 3TL2A 3CZ9A 1UBCA 2BFAA 5K8LA 2ZSHA 3VNSA 2PE5A 2CNWD 2Y4NA 3MWLA 4YT8A 2HAEA 4LXQA 1V95A 1T2VA 2ZRGA 3PD0A 4RY0A 5H02A 3KQQA 2DFDA 3U1BA 4I1YA 4M9XA 5EJEA 2BGGA 3U4MA 2YWXA 4EKEA 3TMAA 1PR4A 1G6Q1 2W2QA 2F9LA 2PD4A 1EWRA 2PYZA 4P4GA 5TJ9A 2HMYB 3JQBC 2A0XA 4EO4A 4XD7A 3ZU2A 3U4QA 2DEUA 1XNQB 4DV6B 2Y6VA 3DXYA 1K8ZB 2WM8A 3QWBA 4BNGA 1TIKA 3PXCX 5ADWA 4JNCA 1R0WA 2Q9AA 1FP6A 3M6VA 3VPBA 1XMJA 5F33A 3SY8A 2NNWB 2V5UA 3G79A 5ED4A 1MABA 1ILWA 1R0RE 5BUQA 1J2YA 2DLNA 2H1HA 5EWLA 3UANA 3I0MA 2I7TA 3HN7A 4PHFA 4DJJA 4F45A 2PUHA 3EZFA 5ECDA 3OD1A 1R0XA 2AKAB 3BQNB 3KJGA 1PK8A 3IH5A 3DEJA 1KEPA 4EPWA 1NMXA 3G9TA 1UT8A 3FOCA 1I4TD 1EP3B 5JJBA 1UF9A 2RHDA 4E2ZA 4UEOA 4QBGB 3TR6A 2MMGA 1ECBA 3CUTA 5K6TA 3U1VA 1DZIA 1XJ0A 3DKKA 3TQQA 1FNMA 5AK3A 4Z9BA 1D9XA 2I2FA 2IXGA 5GM2A 4E21A 2BFDA 1G64A 2O2IA 4U63A 1OUMA 3MTBA 4Z49A 1UEIA 1TC1A 2HPZA 3D3NA 4QECA 5EMHA 4BQPA 4IXDA 2D2IA 4CKBA 5JDIC 1X7ZB 3WB9A 4DG9A 3GLGE 2X8LA 4QPNA 3EZYA 3FCCA 4EYGA 4PX5A 3RBZA 1X1QA 3HKDA 3VR3A 3GJ6A 4CI0B 1U9YA 2WJVA 2ZUEA 4DJFC 2EGUA 3U9TA 1VCOA 3QUSA 3A1VA 2YMQA 1SIWA 2JFOA 4IZHA 1J0XO 5EIFA 4DMUB 4TKLA 2FCRA 1P45A 1SN7A 1H6DA 4DLNA 4YMHA 1A9YA 4DSOA 1S8OA 3GPDG 1EG7A 1F8YA 2X7XA 3A9UA 2P2YA 3KT3A 4KQXA 5DNYB 5T3YA 3C3PA 3M1LA 2FPKA 1KDZA 2P40A 5AICA 4II2A 4RJJA 3UUGA 4ACAA 4RVFA 3ZHCA 2AYZA 3D6JA 3WJAA 4INAA 4LF7B 3U17A 3ZOKA 3KAKA 3TD2A 4IVRA 1TCAA 5AW9A 2XMPA 1XD9A 1UBSB 2P41A 3QLEA 1VLLA 3B1YA 2C2BA 3R3XA 4FS3A 1I5OA 1EUDA 1UFOA 4JLKA 4UE2A 1YZVA 1OXXK 2Y1EA 2D5LA 2XW6A 4WGGA 2HPVA 1YI8A 3CZQA 1V8DA 3HA2A 2CDNA 4TX1A 5G0VA 4Y30A 5JHGB 2VQ3A 2OV1A 3UK0A 2V7EA 3ST7A 3C3XA 3BDVA 1ZOOA 2I6UA 2EQBA 3F47A 3S1LA 3VKHA 2WG0A 4Q19A 2ZANA 3M4ZA 3TQTA 2J30A 4Y98A 1A2KC 4TYMA 3N53A 2HF9A 1FMTA 1GOTA 3FR7A 1YK0A 3B36A 3HJBA 2WJIA 4X71A 5CLIA 5ALNA 5HJ2A 3KR9A 1E62A 1NRXA 1V8PA 1B3RA 5IJ0B 1RAEA 1RC1A 3HCWA 3LFHA 3ND5A 2PTGA 4MX8A 1KVQA 4R41A 1GG2A 4N5DA 4NCXA 2JRCA 4G1FA 2C9BA 2A3NA 4OV6B 4E12A 1X7ZA 3BSYA 1DX6A 2BFOA 4CT4B 3D6NB 3PHCA 3H6GA 3HKDB 4UJ3A 4DGSA 1V8OA 3VDQA 2BGRA 2KLHA 1AS2A 1XWWA 3WB2A 1RJFA 1VMKA 1XZHA 3K73O 4HAUA 3I9JA 1AB5A 1M9NA 2BN4A 2X9VA 3I01A 2GAFA 4B4KA 4D5EA 3DTVD 4GDMA 4HLNA 4OXKA 5CJ2A 4MUIA 2JLVA 4UC0A 2X4DA 3W7AA 4F2GA 4Q18A 5ICEA 3H4VA 3NRJA 4C4TA 1B6RA 4EHBA 2P2GA 3KM0A 4R69A 1G4UR 4RL6A 3KAJA 4AJHA 4E5SA 1FLDA 2HWYA 2R6FA 2OXRA 2P91A 4EEZA 4IJUA 2VWGA 3EG5A 4JUBA 5EKXA 2CV0A 3FFWA 4D97A 1DLIA 2Q2WA 3CR7A 3TSYA 4CKCA 2VDVE 3E5MA 4MIOA 4CKXA 4XYBA 2PVCA 4JGBA 1UC9A 3AEQB 1XQYA 4TM8A 3QKRA 3CGWA 3LPMA 4IM7A 5DM4A 3WDLA 4IL5A 3MMNA 1CVIA 1TK9A 4R8RA 4WNAB 1QRSA 3BMOA 2PV0A 1T0JB 2FR1A 2Q9UA 3F67A 3TDNA 3DPUA 3W2HA 1RPAA 1XP8A 1VGRA 3DDSA 2Q8PA 4LJ5A 2XDYA 3AKZA 2AOWA 1TYZA 1W85B 2AOTB 5K3AA 4L95C 4QOIA 2PZBA 3OAAD 4G4IA 4PGMA 4A6DA 2WT4A 3TAHA 1I94B 1A96A 2HSGA 3I5YA 1Q20A 2RAUA 3UCEA 1JIUA 4V0QA 4PVDA 2WKRA 2N0SA 5BMVA 3V4FA 1EEXB 4D3XA 3F4KA 3X1KA 4KOAA 3QFFA 1E4VA 2FW1A 4G0MA 4B6GA 3RS3A 3IKTA 2EEZA 1O95C 1EK5A 2VJPA 4G23A 4QNNA 1HLDA 1TM7E 4BB6A 4ETWA 1Z63A 1B76A 1JSCA 1VBMA 3R7NA 1Y37A 4GR5A 4RY9A 1CLUA 4B6JA 1P39A 4QGHA 4A2QA 4Q9JA 2HRCA 3T8YA 3V55A 5EJ8A 4J49A 2B4QA 3ZGYA 1K2VN 1PZGA 3KUDA 3OE4A 1NHWA 1ZISA 1IZ7A 4YJHB 3WNVA 3DZBA 1GT6A 1WXHA 4DQKA 5JYDA 3U09A 2WHXA 1AKVA 4D0GA 4POAA 3COVA 3EULA 4YUWA 5IAOA 2FP3A 5CNJA 4B8YA 2VFAA 2I9PA 4L08A 4ZOCA 3ETLA 2QMHA 5HP4A 3H8WA 1QDLB 3LH5A 3ZDYB 2GK7A 5H59A 1HT0A 1T3GA 4NK4A 3T15A 3A1SA 5ENZA 2V4UA 2C5AA 1N0UA 3BJMA 4OAPA 4Z2AA 1MOQA 3SLGA 1NC1A 4B4WA 3QELA 2AFHB 2P6RA 1FYDA 4JH0A 2VCHA 1RBQA 4XGQA 3V9PA 3HZHA 2ROQA 4HYYA 4U7GA 4GT1A 1UBRS 2BRUA 3RKRA 3RLFA 2IXTA 5UKDA 1IAQA 3LC7O 2RKWA 4RO0A 1YCHA 4HZGA 3SDBA 2K2WA 1Z45A 2HADA 5J5AA 1UIRA 1L5KA 1LDNA 4PM4A 2O2JA 2LBPA 3KFLA 1I9GA 2ZT5A 4F6RB 1IHPA 1PG2A 2WD9A 2XR1A 3HXTA 2AV6A 3G8DA 2VATA 1WXFA 4N0PA 4Q7EA 5HYVA 4Z1MA 5E2IA 5F5LA 3HFRA 4ARUA 1P4RA 3DTVB 4P92A 2BDUA 2TRSB 4RLSA 1YVUA 3NYIA 1IQPA 1FDWA 3BDIA 1IUNA 1MRNA 4AXXA 2C2WA 2PRKA 3FAKA 3UBTA 4V1CB 4JI8B 1KY5A 1JYSA 3IALA 4U7HA 4RS4A 3SZRA 1O94C 1JQ3A 1XAIA 1A8SA 2HMTA 2HRRA 2P2ZA 1WY5A 2WSSA 2ZI9A 1XU7A 3LSYA 2JHCA 1C7QA 2I03A 2RGCA 2DAPA 2Q8QA 3H1FA 4DT1A 1GNRA 3TTXA 5LU8A 1SCQA 4UMDA 2O8DA 2JCXA 4N40A 4KB5A 1GADO 5C7LO 4MWTA 1NZFA 1ZRMA 5C34B 2J0QA 1BYUA 3W9BA 1BXRB 2JAUA 2R4TA 4Q9DA 1C3VA 2Z4SA 3GW8A 1MB3A 1H4VB 3QBDA 3VZDA 3ZWOA 5CIQA 2O7VA 1E2IA 3HI4A 3OX1A 4OLJA 2ACKA 1VYHA 1Q7GA 4QM7A 2WU4A 3DFKA 4L5YA 5EKSA 4UOQA 1KBOA 4EQ6B 3MELA 1PSDA 3WHIA 1IZ8A 1XWIA 4EYOA 3DT9A 5DW3A 3DZDA 3HU3A 3M5PA 5CK5A 3T06B 1I3NA 4XRGA 4QYXA 2YZ7A 4C89A 4CN8A 1K3FA 4DV4B 1L5RA 1UDXA 4KL8S 2RK3A 4GPZA 1TA4A 5AK0A 3SJ7A 3VSAA 4V1CA 2Y1FA 5A05A 1G5FA 2HBQA 2ILTA 4JJZA 1UKVY 3WP1B 1M1UA 3DL4A 5AOVA 3P2EA 2I6QA 2OSBA 2V96A 4R2XA 2YC2C 4XSVA 3AK4A 5C4GB 2AOUA 2H00A 4OMUA 2C2XA 2E5WA 1DUIA 2OT3B 1E3EA 2QZJA 5FI0B 3RTEA 2EDCA 4ADSG 5REQA 2AWOA 4DBVO 3LQRA 1W5FA 2R6CA 2XF8A 1P5ZB 3GRVA 3T3IA 5BYJA 5DX0A 4MUNA 2R6GA 4YJ2A 3CIFA 3T1HB 1C29B 1PL6A 1R3DA 1Y5LA 2WVAA 2YWGA 5FR1A 2GM4A 2EFEB 4QXRA 1DBRA 1L5ZA 1SXJC 4G24A 4NZZA 5EKDA 6NULA 2G77B 3TRHA 2BZSA 4HS9A 4C7KA 3DJFA 5KMGB 3DNPA 1Z12A 3KD2A 4K40A 1DBQA 4LYAA 5EZQA 3ZTTA 4UDYX 5I4CA 3UMMA 3L8HA 4DNFA 5JXJA 5E1DA 3O2NA 4X63A 3VI4B 2I2DA 1IEWA 4QPPA 5D5QA 3O3NB 3R9XB 1XYGA 1J20A 4EATA 3ULKA 4F4DA 1PL8A 1RRKA 1B8VA 3DF9A 2LP4Y 3BEDA 4LHEA 4Z9YA 5HKLA 1DCFA 4GLOA 3WL4A 4R8MA 4DCUA 1CZUA 1GLGA 1XCGB 3CA8A 5H68A 2OHJA 4MLDA 3E58A 4QGAA 4RSHA 2HRZA 1CZHA 4I50A 5AM3A 2D1TA 1XZJA 4MRAA 5E0OA 5TARA 1GQQA 4K9LA 5I8ZA 1HFKA 3WWDA 4AJOA 3ZCTA 5AI8A 8OHMA 4O4HF 1U9CA 2OG1A 2ZZNA 1P0IA 2VPXA 1Z29A 3KXPA 3MINB 4D02A 3F6SA 3A11A 2JBAB 4YV1A 1EFLA 3TZLA 5CVTA 2FMIA 2HDHA 3HN2A 3SMQA 3I6MA 1EUDB 4RZSA 2ZRLA 3QNUA 3MMZA 4HYTA 4URYR 5AUQA 5TC4A 4QU8A 2D5AA 3VTFA 1F06A 1GUYA 5JROA 4Q3CA 1E61A 3FG9A 5JISA 1XZIA 3OJ0A 1J2EA 1SCJA 2DZDA 2HYDA 1Q7TA 3ETNA 5CDFE 4R8LA 4A8JA 4BRZA 2VUSA 2EL9A 2WNHA 1DRKA 1OH6A 1KH1A 1E3TA 3LECA 4PZ0A 5C0OE 4ZEVA 2BE7A 2VJOA 3H4MA 3JQ6A 3BVPA 1MO4A 1SR8A 4M0LA 1CJKC 4QPZA 3UJ9A 5EJ6A 4G0WA 1JHXA 3ZJ5A 5AKYA 5BO5A 1UEXC 2CMDA 2COKA 2GHIA 4JI6B 3Q40A 1N1MA 1UK8A 5JAOA 5DNVA 3NTLA 1C2TA 3CUYA 3SZOA 1A8IA 2KQUA 2EX0A 3CQ9A 3LVFO 4XDHA 4MPJA 3VTKA 5CYPA 1G8GA 4IPTA 1EJ0A 1B15A 1V5EA 3CEHA 3PFKA 1UOOA 3QK7A 1CZLA 3PXAA 4LOHA 1UBEA 4RPGA 4ZQBA 5EJ2A 2YRWA 4IQ4A 1R15A 2HLPA 3L7BA 5H8WA 3TXAA 5B2ZA 1WUIS 1R66A 1BVYF 3GEIA 1VLZA 1F6BA 2DFLA 2ISCA 1BA3A 1OOEA 4JJIA 2V55B 3BD6A 2IZ0A 3IULA 1FQOA 4WXYB 4MUYA 4MTLA 1LGYA 4OKSA 1SUEA 3MPOA 1EAMA 3SVZA 4YMUA 3FZGA 1NWHA 4A16A 4NH4A 3T54A 3K8QA 2FR8A 1UQUA 2FY8A 3HYTA 1OWLA 2PV7A 2YV3A 4EDFA 1E3MA 3FRHA 4Y2PA 4X1IB 5K3CA 3R7BA 5K0CA 4R40A 4WCVA 3W06A 3SFTA 2NV6A 2QRGA 4BTEA 5AW4A 2VDUE 4N9WA 1KQOA 1C5KA 1WEKA 2P6UA 2YNMA 2ZB8A 3P2IA 3QU5A 4DRZA 2I6TA 4WOKA 2YRXA 5EYPA 3ELDA 4RPLA 2BZ0A 4QSMA 2VP0A 4RTKA 4BASA 5CW1A 1G0NA 1JFFA 2CDAA 2G5GX 3SLRA 4TV8F 2IS2A 2P4SA 4JBHA 4GQBA 1DAFA 3FCEA 3PJFA 1NY6A 3KV1A 1POWA 2FVXA 4F8EA 4EUSA 4ZC8A 4E08A 3KJQA 2FRVA 2JFQA 4K3UA 4RVDA 1RWPA 1DLJA 4D4LA 1SUCA 3ITEA 1SIUA 2QL7A 3DWEX 5AW1A 1RXEA 3EXHC 1PGJA 2IYYA 4GM1A 1GRQA 3NYQA 3BH7A 4W5HA 5JMPA 3AEZA 2UYQA 3F3MA 4OGLA 3R8CA 1XAHA 2JI8A 4J4TA 1UANA 5K03A 1ZMTA 3A6EA 3IV6A 3SEFA 4G6ZA 1Y6GA 2GAJA 4NCHA 1G8YA 1XHEA 3KOYA 3LX5A 4XQGA 2X13A 1QKKA 4DT1B 4LV8B 4M1MA 2JFYA 1GEGA 4XA8A 3TTYA 4AN1A 3GMDA 3KG2A 1JG1A 1P74A 1YR6A 3E1GA 4QIHA 3B52X 4JWTA 5ICMA 5KJFA 1D1QA 3FCOA 3LLSA 4A73A 5IHXA 3OBBA 1NAHA 3LHSA 3LC1O 4JB2A 5MN5A 3HACA 3TG8A 4IGFA 1LV7A 5ADVA 1N0IA 2A94A 1DXHA 3ZQ6A 1Z7BA 1YWGO 5BWNA 1T4DA 1JU3A 1XZGA 1AKNA 3FMOB 3IHTA 5B4VA 4Z9FA 1UQTA 2BAGA 1CD5A 3HB7A 4LYYA 5AHKA 1YR8A 2YCLA 5D5PA 5JRZA 3QEBZ 2OCAA 3IQWA 1ZXXA 3UOWA 4NABA 1L3CA 4ZMSA 1E6MA 2XUDA 1U9IC 5K0SA 2LWIA 1EFAA 1Y80A 1NMQA 4MDHA 2GLTA 1VRVA 3LQ4A 1C7JA 2CGEA 4ZV7A 1MMFB 3WDMA 3KDSE 4B4OA 5KYXB 3ZD7A 4RPCA 2DE0X 4RK0A 3WK9A 3NDIA 4PAMA 3HV2A 3DLPX 4DLBA 4RF3A 3FD8A 4QTUB 4NULA 1V8BA 2MSDB 1RJ9B 3LYLA 4UHEA 2V98A 1YBFA 3FPAA 4JCCA 5A7GA 1A04A 2HSJA 3CW9A 2Z57A 3DSRA 2O57A 2WEKA 1AMOA 4OFBA 4JBWA 2NQ8A 4EI9A 5K4HA 2V97A 4DG8A 2JJ2D 5CDYA 1VHWA 1NOIA 1M2KA 4HRVA 1KFEB 2IOYA 3DHEA 3Q0IA 2YIDA 3PQ7A 3TJRA 3G8YA 3GRPA 4X7BA 4BVGA 3V8RA 1YZLA 2MHCA 4L4XA 3U37A 2XHZA 1C7ZA 1QCZA 2H2HA 3CHYA 1KI7A 3PDIA 3V4SA 1W44A 1Z13A 5DCLA 1XELA 3VC7A 2VTBB 3K3PA 2MSNA 1J0EA 1G3RA 1UH5A 1U4OA 2AG6A 2IYNA 1Z2PX 4OJNA 5AJWA 3EVGA 4UXIA 2V3VA 3SPXA 2PVPA 2GLUA 3L92A 3OCWA 4B6OA 1AKQA 1M2EA 3EPRA 2AR7A 2H1WA 5BNFA 1Z0AA 4OLHA 3ACBA 4QYSA 4E0BA 4EIWA 2TMKA 2Y4OA 5EIWA 3A9WA 2WI8A 3ONVA 4ZZIA 1ISMA 1SKUA 3N0XA 4QXQA 3II6X 4AICA 1MZVA 1VFPA 1ZAKA 3LQ1A 3TEFA 1RJ9A 2RH9B 4R9NA 3UHJA 3FETA 4PGAA 3HG7A 3ZXSA 1AN0A 1EXVA 3VZCA 4IXTA 3WLSA 1PJ8A 2Y8EA 4RZ3A 4IUCS 1QPGA 3G7UA 2D1YA 3A04A 4DY6A 1NYLA 5IAEA 5KQPA 2WWYA 1S3IA 4RHCA 2ZJBA 1IPFA 5LOVF 1K7XB 1KQGA 1WCIB 2IT1A 1N3YA 3CYFA 1P9RA 4KO8A 4FYPA 3UJCA 1KQPA 1OAKA 1T9AA 4F06A 2RGAA 5ALVA 3BEOA 1IK4A 1G2OA 2JJ1D 3GBSA 3KZNA 2VVTA 2BLLA 4MK4A 1KE2A 3T0GA 5I6DA 1JALA 2CLFB 3KJIA 1DB3A 2GUWA 3UCFA 3BMQA 4Q3AA 3LRXA 1XDZA 3BJEA 2IPMA 5F7JA 5KREA 2C59A 3G9XA 4YROA 5AWFC 3NV9A 4YXWA 2QI9C 5B3JA 1OC4A 2D6FA 4ZQIA 3T38A 2ONKA 2Q5CA 1MJFA 2FMUA 3DB1A 4O4LF 4N6GA 2XA9A 3A36A 4F9GA 3RVQA 3P4XA 4IX1A 3ML1A 4U5XA 5ALOA 3PKJA 4G0QA 5LBTA 4E2FA 3AHEA 1HLFA 2F3PA 1E7WA 3O90A 5TPWA 1IBMB 4G0VA 1KNQA 3EGEA 2J9FB 4AK9A 2YIVX 4MKFA 1L1RA 1XK6A 4O4HB 3LCMA 4RM2A 3T52A 2CXRA 3TS1A 4C2BA 1U3UA 1V37A 1SVUA 3T41A 3GAZA 4JOQA 4NICA 2VF5X 4FFOA 5JNRA 4IIJA 4H7DA 1KYWA 1PTJA 3WGQA 1B8UA 1X92A 3OAAA 1II8B 2ZOSA 5AJHA 3ORYA 2XXAA 3HMQA 1WVIA 3GP5A 1E9BA 5JNVA 1UODA 1C7FA 2I4NA 3FCXA 1N1EA 2WJ6A 5ESWA 2B92A 2DHDA 3FH0A 1X14A 3JYOA 3TQFA 3V97A 1Z6QA 3AIKA 3ZV6A 4Z4IA 1T8RA 4OREX 2OQVA 1HZZC 4KLAA 4ZYVA 2QK4A 4PG6A 4RKQA 5A9SA 1OH8A 2X4LA 3BE5A 5CUQA 3EQ9A 2A3RA 4TL8A 1H5UA 1JG6A 2CJXA 1HR0B 1M1YB 1N5DA 4U8GA 2R7KA 2X2EA 2ZVPX 2ZJZA 3G0GA 4P3PA 5TX7A 4JLPA 2EERA 2H2FA 1SBTA 1C4XA 4JJAA 3LVQE 3NWEA 3ILXA 4CLHA 3ZY5A 4FLMA 4I66A 1KZYC 2Y1WA 1ESEA 4YRBA 7REQB 3NETA 3PYXA 3V4LA 5CB4A 4PLGA 2HLDA 2EFDB 1JTFA 1ZDMA 2PKRA 1DBIA 3EVEA 3P0FA 4HBZA 2DFKB 2X5OA 1OD6A 4L6IA 4OBXA 4A1OA 4BFVA 3RUEA 1B3BA 1M1NA 3HZOA 2J9YB 4MQBA 3U0VA 4B09A 4DQLA 4WKCA 4EVQA 5BWLA 3N8NA 3R7WA 3RVBA 1T2AA 1T9KA 2B34A 2OXEA 3KB8A 2GBGA 4MCHA 1SXPA 2EJVA 2XCOA 1Z5VA 1ZJ6A 3SSMA 2UYGA 3M2PA 4ZI3A 1YO6A 5ALTA 1CNMA 1U7XA 3P4UA 2HJGA 3GRCA 1ADJA 1NBIA 1NLFA 4OB7A 4GE0A 4LTMA 1M6NA 1QAQA 3AV3A 2I8AA 3LDUA 3S2YA 4OPMA 3VYVA 1UP4A 2H51A 3SE7A 2I1WA 2O05A 8LDHA 2P4HX 4L5IA 3BAZA 1IOZA 1N5RA 4PZYA 5FWNA 3M0EA 2UU9B 2AEFA 3BA6A 2VNHA 2BC9A 4X90A 4Q6BA 3R7AA 3QV1A 3GFRA 4JYAB 4IIJB 4P54A 2HEGA 1Z0UA 4BVEA 2E9SA 3CZRA 5JSFA 2V7UA 2UKDA 5JE8A 1ANKA 1Y3CE 2XSZA 4PTZA 1T1GA 2YVKA 2PUEA 3VNUA 2Y1LA 1FU8A 2FW9A 2J3IA 2J9GA 3IBGA 3X2SA 1SVIA 3M6AA 4JJ4A 1R6VA 4WXPA 1M2VA 5I9NA 4AT1A 1ECGA 4KACA 1EFKA 2YKGA 3COWA 5LYJA 1N4AA 3ZWKA 2QD4A 2BKEA 1D2MA 2H59A 2P3QA 3UMRA 4YV0A 1KMCA 1WMFA 4S04A 3URKA 3K1YA 5DNCA 1YDGA 1W4LA 5TT1A 3OM8A 3VNVA 2AN3A 3G3EA 4HFJA 2HRDA 4U5QA 3SN6A 4KLZA 1T3HA 1FFWA 1QH8A 3QW2A 1CP3A 2OKGA 4DCOA 3AUKA 4D0LB 2BEJA 3IIIA 1KI4A 3O2JA 1YZNA 3STXA 3SS7X 4DCCA 4LTNA 1TVCA 5IPFA 1EQAA 4GOXA 1U9ZA 4RIFA 1BROA 4R8SA 4PLVA 1BFDA 1FVOA 5G3YA 4NMLA 3BTOA 5FA6A 1E9RA 1RQXA 2DSNA 5AOBA 1N9GB 2FHPA 3SHFA 3W5SA 4FFDA 2XTJA 3G7NA 1E20A 1XMVA 1FFGA 2XWSA 3BXFA 3GFSA 3I04M 5ENVA 2DHCA 2YWHA 3KXLA 3Q15C 3UWSA 1PG5A 1O5OA 1PZHA 2VCEA 4R8VA 1S2MA 2QVCA 5CB4F 1OYOA 1E66A 4D82A 2H1VA 5J4YA 2JZOA 2VSXA 3PGVA 2GM5A 4IX9A 1L7VC 1AE1A 1CIVA 5BWBA 3UVEA 2UVPB 2GZ1A 3GAFA 3HGTA 1L7NA 3BB1A 3QKSA 3R7FA 1THZA 2JK1A 2VKTA 3PGMA 4B6FA 3GEGA 4CLDA 3RUAA 5IKPA 1KI8A 1GA6A 2AZ4A 3WIVA 1QKIA 3NC0C 2PXHA 3O4IA 2UAGA 3LPDA 3B2QA 1R5OA 2YWBA 5HM8A 3IDAA 1TL7C 2VJYA 2C54A 5B1SA 4DQXA 2C95A 4KPUB 4Z86A 4Q7JB 4DLXA 2XUIA 2I80A 2JL1A 4AYTA 5B36A 2UUPA 4RPIA 4B6QA 2EF0A 3A7EA 2J67A 1XZLA 5AH0A 4ZOLB 3GEDA 4HQLA 5B4UA 5JC8A 5KB3A 1H2ZA 1R1DA 4W99A 1PKEA 3C8MA 3H1BA 5EJMA 2AMYA 4EFNA 1R5JA 1B41A 3OTIA 2QQ5A 2G1UA 1NURA 1SUWA 3O73A 4XD7D 4JWKA 1JIKA 2C83A 2XCLA 4J7XA 3BREA 3NV7A 4UULA 1ZJWA 3PJDA 4LDJA 1Y33E 2ZCUA 3W6OA 3C5HA 1GXSB 1JG7A 2BM9A 3N39C 5CHYA 1V7PC 5AVKA 3KJXA 1ZH6A 1ZICA 4TQ9A 2CMHA 5LDDC 3GVPA 5P8WA 1E8MA 1Q1BA 2QMZA 5LUAA 2PBRA 2YHSA 2IODA 4RQAA 4WK6A 3V34A 4DC1A 5KKCA 1M34B 3E0QA 1IM5A 5L4LA 3OTHA 1M7HA 2AG0A 2HJWA 3VZPA 2R00A 5A0FA 4L6AA 3VR5A 1LBIA 4DA8A 1PFVA 3ME5A 1E9EA 3BJZA 4C0BA 4DANA 1FFBA 1LF5A 4YQYA 4BN0A 4Y6LA 2YFHA 2DVMA 4KN8A 4L9SA 1Q1GA 2FWIA 2QLTA 3BF8A 3QWHA 4CM4A 4DJEC 3C3BA 4KLCA 2FSFA 3HY6A 2GBLA 2NV0A 3DOJA 2HA5A 4ARAA 1X7WB 5HUHA 3HUTA 4XJSA 1I7LA 2C0PA 4HMPA 4BP9A 4EMBA 2EWMA 3BWDD 3A37A 1ONBA 2JLYA 3THRA 3FPJA 1N6NA 1QWOA 3PGA1 3TVYA 4DLRA 2C31A 1T1EA 3GN2A 4CCSA 4UPEA 4FJ1A 3LO5A 1R12A 2AI3A 3NKLA 3Q2KA 1CZOA 4ZOEA 2EW8A 1LWOA 4D44A 3ZVMA 3KJZA 3LNTA 4X3PA 3C1OA 5DI3A 4DDUA 4A10A 1FJGB 5DULA 3LKBA 4WE3A 1PO7A 4MO9A 2ABWA 4HJXA 5HS4A 4C1NA 2BPOA 1EUCB 1QH9A 1JFRA 1G59A 2D4AA 2GXUA 1SKAA 1CBUA 4NDNE 4XQCA 4U7PB 4YLEA 2RARA 5U4XA 3V33A 3LQYA 1TT7A 2NN3C 1DAPA 3G5TA 4XCQA 3W3ZB 3NMUF 3QVKA 1I30A 1GNVA 4UNRA 1Z5UA 2PVSA 3OPXA 2IYVA 1RBZA 3ZGOA 1NXXA 5J59A 1SIBE 1XRQA 2DHQA 2QE6A 1EP1B 4MYTA 4PQRA 1JQDA 5KVQA 4AIRA 1M1XB 2HA7A 1QIHA 1LSJA 2ZJ6A 2VYCA 3C85A 4O2RA 3WLMA 4UU7A 4ZIRA 3WFZA 2GPTA 3RS5A 4CNQA 4D6YA 5I45A 2E82A 2VHVA 4NU8X 2DWQA 4BNVA 3IURA 2BIFA 1NVGA 4P4SB 3K32A 4RL4A 3V46A 2I6FA 2VPTA 1JH8A 2J8ZA 4J0JA 1DZ3A 1EX6A 2YMPA 4NE7A 5LC1A 4BNHA 1A5TA 4BLPA 2DPMA 4UUNA 3EY9A 4BN4A 1MBZA 4P32A 3O3OB 4L73A 4L8FA 1G8HA 2ZI5A 4PSKA 3WWOA 2VBCA 4OO3A 4WECA 3WYBA 2NTNA 2IL1A 5JDCA 6Q21A 4ER6A 2A2ZA 1AO0A 3PC3A 4PR0A 4RC9A 4TSFD 3PRHA 1ST3A 5AKKA 5ABPA 4BCDA 4EAAA 4KE9A 8MHTA 3DD1A 4B3TB 1ZD2P 3IUJA 3FY4A 1YOVB 4JGGA 2R8PA 1GL3A 2FPLA 2X8AA 2GXSA 4R7ZA 4FYIA 4V03A 5DSZA 1F0YA 4HGRA 5EHXA 1XROA 2ZRQA 4I1RA 3GL9A 2C4UA 4CTNA 3MWEA 3H4TA 5EE3A 1SD1A 5EXDA 1QPBA 4WJZA 2H0RA 1LY1A 3DEHA 5EESA 3AI1A 3PF9A 1CS0B 4FWIB 4YXWD 3F6PA 5LQSA 1XZCA 2N9UA 1RKUA 3KJHA 2YC4C 3WLPA 4EEXA 4PWZA 1PWXA 2J3JA 4P1ZA 4HQFA 1Y8RB 1K0FA 2VH2A 4J1TA 4HUJA 5K8CA 2VZ0A 1KHHA 3ODPA 4NHOA 2AJLI 1SC1A 1SKYE 4E32A 2HMAA 3IMCA 3OQHA 4PGFA 3FRJA 4BO3A 4N03A 3T7CA 1CDOA 4CU5A 2ZJAA 4WA8A 4W6QA 4YUAA 1KDYA 1XQ6A 2WAOA 3DCJA 3I23A 4L3VA 4MVJH 4YLYA 4NEHB 2WQ7A 1T2EA 1WHTB 1MCZA 1M83A 2C4WA 3RSSA 1IXSB 2QUJA 3CKMA 3AVUA 3NCTA 2FUG1 5EUBA 5KCZA 1RAIA 5T6BA 4KQMA 1XMXA 1DPGA 1I6LA 2G5CA 3MT8A 3STUA 4YDHB 4EJFA 4DCVA 4DIKA 3K71B 1USIA 3S40A 4C05A 4OGKA 1MQAA 1N2SA 1THTA 2JKVA 4Z1MD 4DV5B 2R6ZA 1LPMA 5IWCA 1FU7A 4IAOA 1ZBQA 4B79A 2I2AA 3C14C 5JFGA 2GD0A 4M9RA 2GJ8A 1VBFA 3MSXA 4BFXA 4G2TA 5B6PA 2X0DA 4M8LA 3ZV5A 2AW5A 5CH3A 4QRDA 3VU1A 3ZLJA 2XTAA 3EW7A 1RI5A 3KTAA 4A2WA 3BHMA 5KS2A 1HKHA 1AA9A 1WMEA 3I5AA 5BUSA 5CM8B 5KJ1A 2JAOA 4IIHA 1WEHA 2BISA 3BD7A 3QIVA 3E7WA 2R4QA 4MVJE 5BVHA 1Q91A 3AEKB 2DHEA 3MB8A 4V0OA 1BU5A 5L8VA 2GFQA 2HX1A 1JT2A 2HFJA 1N4DA 1ISSA 1GSHA 1ZVMA 3DOEA 4G0ZA 4K26A 3WFJA 4YAFA 3FCAA 2YS7A 4EB6B 4C0WA 1XMPA 2QPOA 4O59O 3P94A 1NIJA 1ZITA 2CL0X 3WQSB 5JZMA 3F0TA 4EI2A 4RTNA 2FOIA 4AZWA 3ZTWA 3FBGA 5EIOA 1GPWB 3IAM1 4MS1A 4B74A 3I4CA 3AUUA 2GS9A 3D7MA 3DF7A 4Q3DA 2DXIA 1ICEA 2C9MA 5LUBA 1MB4A 4J4BA 1D2NA 5HA5A 4A4DA 4BEVA 4I6EA 3IERA 4RF5A 4CE6A 2D8MA 3OLCX 3R09A 4WJKB 2WB2A 2QTHA 5CB4B 1QVVA 2B30A 2HDWA 4N5LA 3AHGA 3VPAA 2EJCA 1K7SN 5M34A 1FUUA 4E4RA 2GEFA 2MSEB 4RA6B 1MOPA 3PK0A 5CXQA 5HK9A 3AO0B 1T1JA 1FFEA 2IZZA 1G19A 5LB4A 5LP1A 2VH5R 1Q83A 1VP3A 4CUZA 3MUNA 1RACA 2PR2A 2QYOA 3HWWA 2NO5A 5ULLA 1FEZA 4FHDA 3T3EA 5GONF 4AQYB 1J7JA 5EPUA 3V3KA 3PNMA 5E9WA 2LCIA 3LWDA 3WL8A 2QTMA 1PYGA 1MHTA 1QVAA 4QHSA 5LLDA 4TYYA 4RAQA 2ZSJA 3EIOA 5KYKA 3USCS 4FZJA 2IP2A 1HDCA 1PGQA 2BMFA 3HGMA 1TJNA 3NAGA 1SUAA 4DMGA 2YRFA 1VMEA 1X7DA 4PGGA 4YH1A 3GT7A 3BIWA 2QBYB 2CXHA 5L3VA 1MV5A 1DJOA 1VYTA 3DW1X 4D43A 1WQ3A 2HY7A 3LOUA 3U7RA 2YJ3A 5J43A 4WOJA 2CE7A 3A1CA 1NVVQ 1S4MA 3NHMA 3RAJA 3PV0A 5C8XA 1MEJA 1V3VA 3AIMA 5HF9A 1DEXA 3WLJA 4F38A 2QE7D 5B58C 3RKUA 1UFVA 4H1WA 4QVIA 3H1EA 3P27A 1E1DA 3PXBA 4DMFA 3GLHE 3M82A 4JL6A 3FNFA 5FA8A 2CHGA 3O1IC 2P5YA 2JFWA 2PJZA 4Q15A 2KPOA 4X3OA 1ODJA 3ZD9A 5SZKB 2R60A 5BSGA 1NVXQ 4I4TF 3KB1A 1DX4A 3GUZA 3H13A 3QJGA 1L7QA 5EZSA 3TXXA 4RV9A 2CNNA 2AEMA 4GLLA 1RM4A 2C2OA 2F9MA 1CG6A 3C74A 1LW7A 2BKUA 3ZBTA 5DWQA 1Y98A 4JMLA 4ZVPA 1JHDA 1K6IA 4MAAA 4GP6A 5IBRA 3VR2D 1T5LA 5KQMA 2ZTMA 3OLXA 3PDIB 2J7PD 4P58A 5E0KB 2QJFA 4BCBA 2XUZA 2WHRA 2XUOA 2REOA 1ZVQA 3GO4A 2R2GA 2JVKA 4FK8A 5CHEA 1GILA 1W0JA 3LKVA 3M4YA 2ZYVX 3B13B 4D0NA 3N2NA 1U2PA 4EBFA 1GZUA 3U80A 1DKUA 3FMIA 5IUKC 3THOA 2ICAA 3DT8A 2CLLB 3GLQA 1O6BA 3MYYA 3NAMA 1TK2A 1VSUA 3OHPA 3OLWA 4CGYA 5AW3A 1Z0FA 3I6BA 2CV1A 3KR0A 1KSFX 5C5CA 1V7QA 3F5QA 3Q88A 1L7XA 3N2GA 3FE2A 4G07A 2H6EA 2PRYA 4PHGA 1K63A 4RNCA 4F71A 1X0XA 5CTJA 4B43A 9ABPA 2I34A 2PSSA 4IIGA 4OQEA 1ISJA 3G13A 3CLHA 4B0PA 1J39A 1PW7A 2XYPA 5DCYA 2CXNA 1MJNA 3A3NA 3KEFA 4DNXA 2CJPA 1E79D 1GSAA 4CIYA 1BWQA 3OZUA 4FUTA 5ES4B 2DETA 2FUNB 1R8JA 1UMCB 2MT9A 1UQRA 1MGOA 4UD6A 3RS2A 3T6KA 5JCXA 2VUUA 2XE7A 3AF2A 1DRJA 5FUWA 1XAGA 2OK8A 2HCTA 1MAAA 2W71A 5AKJA 1FP1D 2C7QA 2ZB7A 5P21A 1UWLA 2J6IA 2KHZA 1WTCA 1AC5A 2W4QA 3KO8A 4HDNB 4P84A 2J5KA 3SX2A 3ROGA 2Z2ZA 4MUHA 5EE1A 6CHYA 4LJKA 4C29A 5K8UA 4EUKA 4FE7A 1OBFO 2D2FA 5H0IA 4EHAA 1WB4A 2UZ3A 3TPCA 2A33A 4GM4A 1L8QA 2JI6A 3BPSA 4BFUA 1B00A 3HABA 2CFSA 3IDZA 2O19A 5AP9A 2OYRA 3KWLA 4P7KA 1DVRA 4DVGA 3DE3X 2A88A 3I73A 4FKMA 3L6OO 3X1DA 4NJMB 1F6DA 5AVQA 4FI3C 3IE0A 1SUBA 2QX4A 1B0AA 3KZCA 5J2UB 3CKYA 3A1DA 1ZM4A 1NMZA 1A50B 3T4PA 1ZIOA 5AQEA 5CIYA 4BMDA 3LP5A 3TI7A 1IIRA 3RYIA 4JVNA 5AK5A 1YU9A 3TLAA 1HNNA 5EJ7A 4QQ8A 2Q8NA 3GP3A 3DMTA 3EVBA 3IAS1 3TTSA 1GN9A 3OESA 8AT1A 4D25A 5BQPA 3U1TA 4AMBA 1DBPA 1H0SA 1VECA 3K0BA 1QO0D 4ZO4A 3SBXA 3F7NA 4PCVA 4HDNA 4XM1A 4NBLA 1VB5A 3ANSA 3MERA 2HJRA 3LW7A 4YRPA 3SYNA 3BB4A 1O95D 1X74A 1IM2A 3QX9A 2F1IA 1WXEA 2FZCA 4N8EA 3OQBA 4MICA 5JSZB 1NF9A 5EXSA 1VBKA 3CLRD 2SKCA 4M7PA 3TD9A 2QMOA 5BOSB 5JATA 1DQRA 2O52A 3DE0X 5BSUA 3R5KA 1EWQA 4J29A 1FRQA 5DWVA 1ZX1A 1D7AA 1J1IA 3BULA 4FR2A 5JS1A 2HJHA 2WSMA 7REQA 1FFXB 5C37A 2Y3IA 5I7SA 4UD2A 3TINA 3G1WA 3V2IA 2Q6IA 4DIUA 5DI3B 1BDJA 3OTGA 1IN6A 3OZ7A 4E5KA 4BKPA 2JARA 2BTOA 1RXIA 2JGFA 3KP1A 2RB5A 3TI9A 3ZWAA 5F7ZA 5BSHA 5BOVA 2JEZA 5JCJD 2WKSA 3MTGA 1QFSA 1C7EA 2BGTA 2IOFK 2IYTA 4JA0A 5FO1A 4FGLA 3TLBA 4D5GA 1CY0A 1ZSYA 4NV3A 4HWSA 1WE2A 2KSQA 3HKBB 4LYEA 1RWWA 5LD2C 2OHFA 3UK7A 4CTKA 3CBQA 3M9LA 4F6RA 5BT8A 2E4YA 4MCAA 3GLFE 2GA8A 2H57A 2PUCA 4CYMA 3QXJA 5F52A 1M2FA 1OX5A 3UZUA 5E4TA 1GYQA 1ZWLA 4JT4A 4CTMA 3WLQA 3R0IA 4JU9A 4LZJA 3RIXA 2HKIA 2Y2VA 1C8BA 3WXMA 2XUKA 2DBYA 3NZEA 2O2CA 1UZMA 4MW9A 4PAGA 4EL0A 2QJTA 1F9EA 1MPTA 1ZOSA 4K9NA 1KDRA 2GN2A 3DBRA 4TWRA 5EIBC 1B26A 4I9UA 1NJ2A 2DWOA 3HDYA 4A8JB 5D00A 5FBQB 3OQVA 3SYLA 5DNUA 1T9GS 1H9AA 4M4SA 5LP6F 1TD9A 5E2BA 1S7GA 4Z4GA 1T8SA 1Q0PA 1KKMA 1U7HA 4GPD1 5KQGA 2O2ZA 5B58T 2H63A 1Y8ZA 3BE8A 4EGCB 3F4LA 3LL7A 4H0NA 3FPEA 1WV0A 3NC1C 3BXGA 3NKVA 1SD5A 2BF7A 1YVPA 1MFPA 1OWOA 2CLCX 4WKPA 3OSZA 1HBJA 3OOYA 4N8DA 4BMOB 2XBMA 3RC3A 4KTTE 5IWAB 4UPDA 3OFJA 3U3DA 2KB0A 3BXZA 3C48A 3G5AA 2HNAA 3AHFA 3OHMA 4YJ2F 2N3ZA 1HE5A 1UJ4A 4TVOA 4JV5B 3IC5A 2RH5A 3B53X 3BM5A 4P53A 4BQRA 1M66A 3OJLA 1BH2A 3A4IA 1OILA 4LRWA 4QUGA 1XL1A 5HX7A 1NUTA 1GKYA 3KB6A 1JP7A 4OBBA 2WVJA 5ENDA 1WDKA 1RKXA 4ZYXA 1R0KA 1UT5A 1KTIA 2WAXA 2W6IA 1UMBB 4LMPA 4MQEA 2XZDA 1WPQA 3DMTC 1NASA 1MB9A 4MR9A 1LBSA 2Y92A 4RETA 3VR1A 4D3FA 3DULA 1QK4A 4M1QA 1R9GA 2AC2A 3WL5A 1AKRA 2WPDA 3GLFA 3UMFA 5IDWA 2G9RA 2P30A 4Q3LA 1A7KA 4GKBA 3R7LA 3ROTA 5HILA 3IXLA 4JYPA 5GTDA 2FZKA 3NHRA 4PVCA 1HV8A 1QE3A 3IKLA 3HMKA 2ZYDA 1O3YA 4TTSA 3DFIA 2C3PA 4MW4A 4MWBA 1LLUA 1M6EX 4RHFA 4COOA 2JLXA 1VXOA 4R1TA 4TMKA 4KZPA 3P9NA 3T5DA 3ZXXA 1LBHA 3IUQA 2P9QA 4Q4LA 3ORFA 1QYCA 1E59A 4PNEA 1YR7A 1Z3IX 4RYDA 5D01A 1TCUA 3KEMA 4WINA 1VIDA 3TB4A 1IXRC 3GYBA 1LRLA 1KVSA 3QWAA 4CCAA 1F3OA 4NJEA 4WY2A 2QN2A 1NW4A 3QHQA 4DM3A 2PGIA 1YR9A 1MOZA 5BVGB 1QVWA 1HFWA 3WLKX 4Y2SA 1G291 1E64A 3EVNA 4PYOA 4R2HA 2D54A 3TQCA 3U7GA 2KI5A 1VM6A 5AOCA 3ZEAA 4QLBA 4RVGA 3T3DA 1SU4A 2BSXA 1NVWQ 2KYRA 3GJSA 3HU2A 3SEZA 2AG5A 2RAVA 4AN4A 4BWVA 5BVHB 5J4HA 3S2ZA 5CXSA 3BK2A 2PQ2A 2B4AA 4DLPA 3ELWA 1H5QA 3GJ0A 4ZOLF 2HXYA 4ZCPA 4XWGA 4GLJA 1YS6A 4ZAXA 3AL0C 1WUTA 3ICVA 2UVQA 2R1UA 4KXFB 4C07A 1G41A 2NXEA 4XX1A 3T5GA 1QORA 1P31A 3Q7QA 5B1EA 3IIJA 4DCGA 1WX1A 1TUBA 1XWFA 3N1UA 2D13A 4ZQHA 1LI4A 2CNBA 4PLHA 4C2TA 1Z7WA 1Q11A 4KIWA 1U04A 2AHRA 4WLOA 5IKEA 4RVUA 5JH7F 5JMWA 3CUEF 4FW8A 1BRMA 4F6LA 3NFYA 5C32A 2QRZA 4I1IA 4DLUA 1U4NA 3H5RA 5EKUA 1EU1A 1SBYA 3ANYB 1NYRA 1U65A 4OK3A 4DR7B 4G3XA 3EA0A 2A4MA 1G9TA 1W52X 2IHYA 2XNJA 2WT8A 3VR4H 3IOMA 1EBUA 2DJ5A 4HSGA 4LJLA 5LQJA 2VDLB 1NX9A 1VFNA 2IQ5A 3CLUD 1QTQA 4MRRA 4P5PA 4IHJB 1JDTA 2XKJE 3FIJA 5B12A 1XF1A 1EQ2A 3H9CA 1D8AA 1ZMOA 3KJNA 1J56A 1E6WA 1JEDA 2G17A 4PPNA 4WN3A 3N6XA 1SH7A 1AS0A 4ND8B 3TSAA 4BNYA 2QTWB 4QLOA 421PA 1QUFA 1VGVA 1RWNA 3PKZA 3H5AA 1NVDA 2FI1A 3UMVA 5EJ9A 4IGAA 4YMVA 1IZYA 2QX9A 5EY5B 4BJ3A 3GEBA 5HOQA 3PNPA 1W46A 2O8EA 4C0HA 2PDAA 3I72A 4X6UA 4D96A 1C4KA 3GR6A 3QKWA 3GBPA 1NWCA 2W2KA 2ZUBA 1A5ZA 4V0ME 2WE8A 3H6HA 3AOEC 1FF9A 2Y77A 3VJLA 2RHWA 5AKHA 2BM0A 1W73A 1J2JA 2MOKA 3BCSA 3NHSA 1K75A 4M21A 2TSYB 3DEFA 3KDPA 3A2NA 4UHDA 2OXFA 4NPCA 4XUGB 1HETA 3DHYA 4UMEA 1XVTA 3MJTA 4FDAA 5EGSA 3CZAA 4DQVA 5C80A 2H5JA 2A5JA 5JH7A 5IKXA 1ZD4A 1P2DA 1XRSB 5HJEA 3L1JA 1P5FA 2F4VB 4Y9SA 4X8MA 3H9JA 3W5VA 4HX9A 2PGXA 4FZ3A 3SZGA 4HY3A 4L0QA 1PJQA 1MRZA 1NE7A 2F3RA 3WG9A 1CQIB 1J07A 4ZI7B 1A7JA 5GJVC 4K2HA 1HY3A 1WDTA 2G7MC 5DBIA 4CKEA 1BOOA 5AXDA 1INLA 1IEQA 4L28A 1Q3HA 3LRPA 4B87A 1MJ5A 1NZJA 2FLKA 2OAGA 3PGJA 4EENA 5AI5A 2PWBA 2Z2JA 1M1ZA 4WCDA 2RGRA 4PC2A 1R4NB 3JALB 5HKKD 1KK3A 1FFXA 4HUQA 3RHTA 3S8MA 3QQPA 4KMMA 4EPRA 2JLWA 4NYJR 5TGZA 1YF3A 1IY2A 1HEIA 2ZWOA 4FT4A 3AG6A 4X65B 2FPIB 3D8SA 1CR6A 1U0OC 2IK8A 2ODNA 2RGDA 3LJKA 1P2SA 3ICWA 3ILHA 4OG2A 4E14A 5ESDA 3MJFA 3WBJA 4CLOA 2W2OA 1ST2A 3G88A 4TWZA 3K0HA 3DW3X 3ZZ0A 4DLAA 3M6UA 3AVQA 4HWKA 1KMHB 3C5EA 1N5LA 3MJEA 2JIQA 4RQBA 4RVNA 3W90A 1KKUA 5LXTB 1RRCA 1W1IA 3RSLA 3HP7A 2ASEA 5CFQA 4QPDA 2QI9F 2GJ9A 4RKWA 5CT5A 5FI5A 1LI5A 2A6PA 3OF3A 4DA9A 1IXYA 4BFLA 3HP4A 4PS0A 5A3JA 2CUTA 3N9IA 3SC6A 2XT6A 2XDAA 3HYSA 2KW5A 1BX3A 1YZUA 1SGWA 1YT5A 3BMCA 2JHFA 3N6RA 4FLFA 4LVCA 1T5TA 4IHKA 2CEAA 1XEWY 1YQUA 3EXIA 4X94A 1G9XA 2E5FA 2GZMA 3TLEA 1KP9A 1E0JA 1XI2A 2KLBA 4DPMA 5FXMA 4JOBA 1EFPB 4RA9B 2DX7A 2MSLA 4M1SA 4XJVA 1HDZA 1VL8A 3F6YA 3TX6A 1CYEA 1DNPA 1ZMRA 3BICA 1NP3A 3HADA 3T5PA 4TRJA 2XMGA 3RVRA 3VX4A 5AHOA 3FNQA 4ZAVA 4XYLA 4CT5A 3C3CA 3LO8A 3H11B 3CRZA 2C2YA 1XCLA 1WP9A 2IYAA 1W47A 1K06A 4KYVA 3ER9A 2V8OA 3IEPA 3ZWMA 4D9MA 2GTIA 3MD9A 5BN4A 1GFIA 1MW9X 3E5HA 3C45A 1KFKB 5A6SA 1Z8HA 4UM5A 3Q8KA 4J0QA 2C4MA 4J8PA 3NATA 3ER6A 4Y7DA 3RSZA 4GWKA 1IB6A 5DBGA 3UGKA 5CA1F 2ECPA 3QJ5A 4LYJA 4GMDA 4OBEA 1BGVA 1DJLA 3WI7A 1T9GR 1U8ZA 1S7CA 2Q5QA 5IC4A 3AVXA 3KEQA 1GM5A 5EMKA 2QB5A 3GLTA 3TJZA 3WBFA 5I7AA 4K9MA 2OBXA 1CJVC 2GAAA 1K6XA 3L4SO 5BR1A 3GJ5A 3KNZA 4JVMA 5EERA 3T3MB 3KSAC 4M22A 5F77A 4RBNA 1HH4A 3KSMA 2VHJA 3F9IA 1ZNXA 1N7IA 4HLUA 5LZ7A 3AFOA 5DT9A 4DIDA 4O4IB 4V38A 3ZWCA 5KQLA 4MNTA 1D2GA 3TG2A 2BSAA 3IT3A 5FPSA 2GDJA 1Q92A 3NHLA 1JKMA 2I66A 3JQAA 1T2DA 4YJDA 1UINA 1Q0UA 2OV6A 2CVFA 2UV8A 3L1VA 1O97D 1JLSA 4GSYA 4P33A 4WBNA 4RK6A 1HO3A 3BE6A 2BYTA 1J33A 4RLFA 3RFCA 2C7OA 3DWIA 4D9CA 2VLIA 3MEQA 1U0BB 3HFJA 3JQGB 3KT8A 4M9ZA 5C4MA 2WFLA 2XYQA 4TS3A 5AW0A 5HIAA 1EVEA 4LJAA 2X8WA 4MWOA 1VZ2A 4D4KA 1CUYA 1AHHA 4KODA 3U4HA 3ZCXA 2B7BA 2IHBA 4FINA 4DB4A 1RZ3A 2PWZA 3H9BA 2A5GA 2XLBA 1A9TA 4YP0A 5KX5B 1HI9A 4UFPA 1PTKA 3PFHA 4B4UA 4CL3A 5CDGA 4D79A 3U6BA 1B7GO 2XRYA 2DFNA 2RHCA 4N7JA 1E6EA 1BEEA 3CBGA 4GMHA 2H9AA 4D4GA 1IQRA 4EFLA 4C1BA 3VX3A 3Q7RA 2QRMA 1RZVA 3ZV7A 1BXRA 4GP9A 1T2NA 1OIVA 2RONA 3R3WA 5JZOA 1OVGA 2H1SA 5LU9A 2GD2A 1NQTA 1KEWA 3MGBA 3P8ZA 1N1GA 4X20A 1LFDB 2JIZD 3X1MA 1UPUA 1EE1A 1VE6A 2VT7A 5ES3A 5I5GA 1SBQA 2OBBA 3V4OA 4TZ6A 4QKQA 2E6UX 1S3GA 4MB6A 3FHOA 5FBKA 4D46A 2VTBA 4YONB 1XA0A 2XA1A 4O3MA 3RO7A 5JSQA 1J8VA 3IOYA 3K05A 3QE3A 5AW6A 1BCRB 2DKOA 1Q50A 2K7FA 3ZDXB 2ZT7A 4C4PA 1O0BA 3GGDA 1GG8A 2QUHA 2W6CX 4EKNB 1QP7A 3EPHA 4GYWA 4QHYA 3WV5A 1H8HA 2WFAA 4GPTA 4EBBA 4R01A 2GETA 5T41A 2KWIA 1YC2A 4ZYTA 3D2BA 1EFUA 1PFUA 5K4AA 1F7UA 5IF3A 1QHIA 3CY6A 3PXEA 2CNWA 1MVLA 4MWCA 4R1MA 4RMIA 3QY0A 4MKIA 1MIOA 4BP8A 1LWNA 1JEEA 1SJ9A 3EVTA 1W4ZA 2QSYA 4HKTA 3RRJA 1XNRB 3AHCA 2H48A 1G8FA 2W6JD 3CFYA 3NEAA 1YHYA 4YAWA 3ZY4A 2WA2A 5AXCA 4BNTA 4ZGBA 3B8HA 1R9NA 3H5TA 4P9NA 4B7XA 3ROKA 1ZCJA 4MVCA 1N36B 5JBIA 3JD2A 3P9SA 5TQJA 3G6KA 3SZLA 2ZJYA 3Q9UA 1FSPA 2GK4A 2NYRA 4Z7QB 3UHOA 1HF3A 3EWIA 3VHLB 3EXEA 3WGOA 4NMHA 1GQRA 2G1AA 4XWWA 4Q4HB 4FKZA 1ODSA 3A6GA 3C3WA 2G1KA 1KQ3A 3PT5A 3A58B 5J2TF 4HFMA 1VQ1A 2W70A 3R44A 4YWJA 1BH6A 3GX1A 3QLUC 1JFFB 1ZPDA 2FMFA 1BZYA 3IO3A 3I32A 3SYKA 4U2EA 2QX8A 1FS5A 1GZSA 3EVDA 4CJXA 4FIDA 3RKSA 2AQIA 2REQA 1HE8B 1R8YA 4D3DA 3HCEA 1OYWA 2DUWA 2F90A 2Q5IA 4G0XA 2EKLA 3Q85A 2J59A 1ZHFA 4X66B 4FGWA 2F8LA 2GEUA 2Z43A 1IOWA 3ZGLA 1LC3A 4HDOB 3GP8A 1XZMA 2NU6A 2IUSA 1OB2A 3FWYA 5FF9A 1H2HA 4B3SB 2GFHA 3FMGA 4AL4A 1EDZA 3DFMA 4RHEA 2BCJQ 3SK0A 3EG9B 4G97A 2VA9A 5TXGA 4D4JA 2WSYB 3K9GA 3SEAA 3L84A 4ENQA 2JBAA 1SG9A 3U4QB 2DTEA 1VLJA 2A0FA 2UZ1B 3D8HA 3ZE2B 2QX7A 2Z1MA 3GU3A 3FDIA 1D7OA 3NGMA 2A58A 5KOJB 3NDBB 3HU5A 1O5IA 2AGVA 2IYWA 3NU1A 4BO1A 1JBKA 3L05A 4BZWA 2DFPA 1FE8A 3SIWA 3AJ9A 4NH0A 2BEKA 5E4JA 1ZMXA 4URZR 4F4IA 1W9MA 5AKIA 4KXYA 4OQNA 3W9UA 2P9ZA 4KGVA 2GERA 2WIAA 1JKXA 3C7AA 2GN9A 4RCYA 5BP7A 2VJNA 2XKBA 3AQIA 3NCHA 1O9GA 3CLTD 1T35A 2C84A 1KO4A 4EO7A 2XUHA 1ZK3A 1XTIA 3D54D 5J4VA 1P4HA 2VF4X 2E89A 2NOAA 2NG1A 2VYND 4GMGA 4H2DA 4JZKA 4L72A 4CQMA 5J5VA 4RZHA 4KCGA 2HIGA 2O0HA 1ISHA 2V03A 4QT4A 2ZYSA 2PT6A 3OC6A 4MS4B 4QJ4A 3GG2A 3C7TA 4AJ2A 1EVKA 3F73A 1U0GA 2ZETA 2PNFA 3JQBA 4D3YA 2ESRA 3WNQA 3D2CA 2AB0A 2XWBF 3GPCA 1WM1A 2ATIA 4Q4JA 1Q44A 1MXFA 2YYSA 1DRVA 1JTVA 2FEPA 1RHJA 2CJFA 1ZRSA 2W6MA 3HKCA 4R9RA 2YHBA 3HB9A 2H7VA 5C46F 4QNRA 3SX4A 2IDZA 1P1BA 4MLPA 5AHXA 1TX4B 2F64A 2NO0A 1IRIA 2PR7A 4WUTA 1FSSA 3C3AA 1MO3A 2QOEA 4PLCA 3VH4A 2GBPA 3HDVA 4H6WA 3RVPA 5IMSA 3MA0A 5FUMA 3ZC3A 4BYGA 1U8YA 1BW9A 4O08A 4JBLA 5EWMB 5F4ZA 4CR6A 1B14A 6ABPA 1NM5C 1C1DB 5TR9A 2EX4A 3U56A 1A4IA 3GCZA 5A4FS 2G6BA 3GIDA 2Z2YA 2R6JA 1USVA 2XWPA 2ACWA 4LMBA 3KTOA 3IPAA 2G9NA 1KWKA 2CC2A 3N2EA 5E7JA 1REQA 2V3WA 3PCTA 5D1HA 4EZEA 1GUAA 1RW4A 4KQJA 1AX9A 3A3PA 3PUVA 4V3BA 4GWLA 2WWGA 3OURA 1W96A 4P83A 3IPCA 3TLKA 3IP5A 3PNQA 4FYXA 1DAOA 1SHTX 4J2TA 1JA9A 3A6JA 4HL6A 5LQKA 1G55A 5CA0B 1Z5GA 4LS3A 5L3QB 4LDQA 2ZRKA 1NL3A 3DYVA 3HUFA 3KHUA 4I5FA 2NQ2C 1PX2A 1UJCA 3RT7A 3W5UA 4O4IA 8ABPA 5HFJA 1SZJG 2PRIA 2WU0A 4GNRA 4GBED 2BTQA 4B35A 4MKZA 4YC7A 2GXQA 5MFZA 4IHQA 1OT5A 4UKDA 3TUZC 4QELA 3DXZA 3TM4A 2OWDA 2XIJA 2YIMA 2FPGA 3GI1A 3GUCA 3LV8A 2XYGA 1J9GA 2YHUA 3TOZA 2ZR0A 5JFOA 1KORA