3CNHA

Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
200
Chain Sequence
GMTIKALFWDIGGVLLTNGWDREQRADVAQRFGLDTDDFTERHRLAAPELELGRMTLAEYLEQVVFYQPRDFTPEDFRAVMEEQSQPRPEVLALARDLGQRYRMYSLNNEGRDLNEYRIRTFGLGEFLLAFFTSSALGVMKPNPAMYRLGLTLAQVRPEEAVMVDDRLQNVQAARAVGMHAVQCVDAAQLREELAALGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase family protein
publication title Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (NP_295428.1) from Deinococcus radiodurans at 1.66 A resolution
rcsb
source organism Deinococcus radiodurans r1
molecule tags Hydrolase
total genus 73
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3cnhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cnhA01
2W43A 2CFSA 2CFRA 3A1EA 1U7PA 2OYCA 1S2OA 2HF7A 2B1QA 3OCUA 2I55A 5AVXA 4FE3A 4NAVA 1ZD5A 1Z4PX 2DQSA 2ZBDA 4UASA 1L7OA 2PR7A 3ONNA 4KNVA 4O8CA 1YDFA 2P9JA 3W5DA 2WFAA 4F72A 5AW8A 5AM3A 1QQ7A 3ZW7A 2Q4RA 2I54A 3DAOA 5ALVA 5AI8A 1XPJA 5AVTA 3L8GA 3ZU6A 5AIAA 3BA6A 1XVIA 3W5BA 4BEVA 3SLRA 1S8OA 4GXTA 2PQ0A 4XPZA 3QXGA 5ALHA 2G1AA 2ZG6A 4KX5A 4XQ0A 2RB5A 3F9RA 1Z5GA 2ZBGA 3WK9A 4Y2YA 3W5AA 3UMBA 2GO7A 2HSZA 3KOOA 5AW3A 3MC1A 5ALUA 3WKCA 5AW0A 1NRWA 2YJ4A 4UM5A 3DNPA 2BDUA 4C4RA 5AK3A 2O9JA 1RQNA 5AICA 1WR8A 5ALXA 2HOQA 2R8EA 2YBDA 3N07A 2WF8A 3R09A 3N8GA 1Q92A 2PKEA 4BBJA 4BNDB 5AM2A 1L7NA 2FPWA 4RETA 3SKXA 5AIBA 2RARA 3U7HB 3U26A 2FPSA 3IJ5A 2G0AA 1O03A 3OCWA 2I7DA 1O08A 2IYEA 2RBKA 4DCCA 3L8HA 2B8EA 4PNHA 2AMYA 1TE2A 2JAWA 3WK5A 5AVZA 2JAOA 1Z4LA 3KBBA 2R8YA 4NV0A 4YIHA 4B6JA 2B1RA 5ALTA 3QUCA 4YIKA 1TJ3A 3I28A 2JGAA 2YY6A 1U2SA 2WM8A 3R4CA 4NWIA 2ZBFA 1VJ5A 2EATA 1NF2A 1WPGA 3B9BA 1L7MA 1F5SA 4H1WA 3R9KA 2YJ6A 3AR4A 3SHQA 3QUTA 3A1DA 3MPOA 4OCZA 3KD3A 2YJ3A 3NUQA 3L8FA 3OCZA 1K1EA 3VAYA 3FVVA 1AQ6A 4Y2SA 4Y2XA 2IOFK 2HF2A 2O2XA 4E88A 1Z4MA 4RESA 2MU1A 4KX3A 1MH9A 4CF3A 5A3SA 2QYHA 2GHQA 5IT4A 1NNLA 3U7FB 2D2VA 5AW5A 3ZWKA 2X4DA 4CF4A 4Y2VA 3L0BA 3MN1A 2B0CA 3N1UA 5AKJA 3BWVA 3SKYA 5JJBA 4HGRA 5AM1A 4Y2RA 3KC2A 4HGNA 2MU2A 4BKMA 5IT0A 2EARA 4UM7A 3PGVA 3TLMA 2WF6A 4I9FA 5AW9A 5ALOA 4UU1A 2YMLA 3WKBA 1RLTA 1QH9A 1RC8A 1RQLA 4BYGA 2YMPA 2C8LA 3E81A 2B8JA 1RKVA 3KZXA 4FYPA 2NO4A 1X42A 4JB3A 3M1YA 3NRJA 2P69A 2FDRA 5AKKA 5ALSA 1N9KA 2CN1A 3FGOA 3NANA 3S6JA 1ZOLA 2QLTA 1SWWA 4GIBA 3QNMA 3WK7A 5AVWA 4FFDA 4Y2QA 4AP9A 2WF5A 5ALEA 2EAUA 3ESQA 3SD7A 3QU9A 3ZVLA 4Y2TA 4NFLA 5AM5A 2GMWA 1YS9A 1J97A 4G63A 3RF6A 4YCMA 2R8ZA 3AR5A 4EELA 2HI0A 2FUEA 3ZVMA 2WF7A 3I1YA 2AGVA 4HGQA 4BEWA 5AW4A 1WZCA 4L6AA 1J8DA 3NIWA 4ZEVA 4F71A 5AVVA 5AW1A 3W5CA 2OBBA 2I34A 3QYPA 3PCTA 1QYIA 3RFUA 4G9BA 3WKEA 1JUDA 3NAMA 2B30A 3CNHA 3OTQA 2BDEA 4CE6A 3L8EA 2W11A 5IS2A 1YNSA 3ZWDA 3L5KA 2YJ5A 5ALMA 1TJ4A 1SWVA 2FI1A 1PW5A 1VJRA 4EZEA 5AVUA 3ZI4A 3WK4A 5A3RA 3OCVA 1Z5UA 2Q5EA 4DFDA 3KDPA 4YCLA 3QU4A 4EX6A 2GHTA 4OD0A 3U19A 3WK6A 5ALJA 5AKXA 2AH5A 1L8OA 3MMZA 5AK6A 4L6CA 3L0YA 2YMQA 5A3QA 4QQFA 5ALWA 2G09A 2NYVA 2I6XA 4AS2A 4UAVA 3A3YA 5AVRA 3QUBA 2WF9A 1RMTA 1Z4IA 3U7EB 4BX0A 2ZOSA 3ZVNA 3I6BA 2FPRA 5AI9A 5E0OA 1RMQA 3U13A 3AR3A 5AI0A 3DDHA 4XOUA 1VFPA 5AKZA 4UMVA 5AVQA 5ALZA 3DV9A 5T41A 3AR9A 1SU4A 3QX7A 3B8EA 5AVSA 5AK5A 3M9LA 1U2TA 4ZEXA 5AVYA 1Z88A 1RRCA 3ET4A 5AKIA 1LTQA 2FEAA 2YMMA 3AR7A 5AESA 3N28A 1RDFA 2HCFA 3QU7A 5ALRA 1T5SA 4YCNA 5ALLA 1Q91A 5FP0A 3NALA 5AKHA 4I9GA 3ZTWA 2RAVA 1Z4KA 2C4NA 4MWOA 3ED5A 1T5TA 4Y2JA 3OPXA 1WVIA 3WKAA 1RKQA 1N8NA 3E8MA 4Y2PA 2AUTA 4L57A 3WK8A 5ALIA 5AI5A 3ZTYA 2C9MA 3SMVA 3ESRA 1QQ6A 3QU5A 2HEGA 3HLTA 1L8LA 2Q4TA 1CR6A 3J7TA 2P27A 1ZRNA 1Z4OA 4Y3UA 3L0CA 1IWOA 2G06A 3OCXA 4IFTA 2G80A 3AR6A 3FM9A 2IOFA 4C4SA 3L1VA 3D6JA 2CFTA 5ALDA 5AKLA 3QU2A 2HHLA 3PGLA 5AKYA 3PDWA 2WHEA 3I76A 2OA0A 5AK4A 4AS3A 5AI6A 5AHXA 4C4TA 2HDOA 3SF0A 4UMFA 1CQZA 5AW2A 1RKUA 3FZQA 5AW7A 3B9RA 3GYGA 5AM0A 3A1CA 5AI4A 4KN8A 4UMDA 4ZEWA 4OHFA 2ZXEA 3E58A 2P11A 1Z4NA 2HX1A 1LVHA 2JARA 4HYTA 5AKGA 5ALNA 3ZX5A 3WGVA 4DWOA 2G08A 3UMGA 3CZ4A 3EF1A 3L7YA 2VKQA 2FUCA 4IG4A 1RMYA 5AKEA 1RLOA 5ALYA 3FPBA 3ET5A 1T9ZA 2FPXA 4J2TA 4YH1A 3WKDA 5ALPA 3IB6A 4J03A 1TA0A 4JDPA 2IOHA 1YMQA 3IRUA 3QGMA 4BX3A 3EWIA 3P96A 2I33A 1Z4JA 1ZRMA 1FEZA 5AW6A 3WGUA 4XE5A 4Y2UA 2MSNA 3K1ZA 3QLEA 1U02A 4NABA 4EEKA 4UATA 4HGOA 1KYTA 1ZS9A 3ZUPA 4DW8A 2C8KA 1TJ5A 1QQ5A 1ZJJA 5ALKA 2JAUA 3FPSA 3NASA 4MUMA 2G07A 2B82A 4EENA 4UAUA 3EPRA 2C88A 4UU0A 2IA5A 2YN4A 3U7GA 3QUQA 4HAIA 3AR2A 4YGYA 4UW9A 3N5KA 2W4MA 3AR8A 2NO5A 3UMCA 4BX2A 4KNWA 1ZD3A 3L1UA 4EX7A 5ALFA 4UARA 4CNQA 1L6RA 2YFYA 3E84A 1XP5A 1ZD4A 1YV9A 1YJ5A 5ALQA 3OCYA 1L7PA 2GFHA 1ZD2P 2BY4A 1Z4QA 1EK2A 4KYTA 2ZBEA 4CF5A 1EK1A 2ODAA 5ALGA 3ZX4A 1RPZA 2R8XA 4BNDA 1RLMA 1Y8AA 2OM6A 3UM9A 3HYCA 4QJBA 4UMEA 1U7OA 4OFZA 3EF0A 5AM4A 2HO4A 4HGPA 2FPUA
chains in the Genus database with same CATH superfamily
4OYLA 5CTAA 3M4ZA 3DDCA 3F7TA 4AF7A 4JOCA 2Y3IA 1KH1A 5AVXA 1AA6A 4DSLA 1JLLB 4ESOA 5A2GA 1GG2A 4RTRA 2ZR0A 4R0VA 5K2OA 4RVSA 2WWRA 3JQRA 3PUXA 1WSDA 4GXTA 5KX5B 2Z7JA 3JV7A 3ZDRA 2X2OA 3OOHA 3MC1A 3CRRA 1U7UA 1QO0A 3CYMA 3UV6A 1YSCA 3U4DA 1BD3A 3QLJA 1A2OA 5EZQA 3OQPA 4CHGA 5CCXA 3ROZA 3U7HB 1YE5A 1DRGA 2REXB 5A3JA 1V1MA 4DXHA 3I4FA 3PUHA 2V3WA 5FYDA 3QPUA 3SSAA 3KKMA 4LTNA 3I2FA 3FZYA 2JKYA 3UUWA 3L4BC 4N76A 3BGWA 2PS3A 2Q46A 4DQQA 2K89A 3N2GA 5B1DA 5EHGA 2EX4A 3W05A 4DS3A 3KD3A 2QMQA 4UOQA 1QVAA 4PYQA 4CM9A 1XMQB 4X6UA 1QPBA 2XY5A 2EEPA 5HIJA 3DZCA 5DNAA 4KN9S 4M60A 2HHVA 1YOVA 1KSHA 4BAGA 4BQPA 3E2IA 2FUKA 3CSUA 5HIIA 3SZMA 3TJMA 2C2KA 2QKQA 3DMNA 5IJ9B 4DV6B 4F4KA 4ND3A 2BFCA 2K7FA 1WXHA 9ICCA 1W87A 4P58A 3OOYA 5C0YA 1HT0A 4OTZA 2EDCA 1GU1A 2NO4A 3OECA 2C42A 1QRTA 3GL9A 1FRNA 2DT5A 3ZVLA 2WVAA 3C8HA 2OQRA 5GIOE 1U8TA 3BSSA 2Q9CA 1PFQA 1OV6A 5DXAA 2J0SA 3EXEA 3TW4A 1WZCA 4IUYA 5MGBA 2RMKA 1FBNA 1JJ7A 1K7YA 1CSEE 4GI2A 4LK2A 5DVZA 4B3GA 1DO2A 2CBZA 3GFVA 1YNSA 3JW8A 2GZRA 3DO6A 3M5PA 1OA1A 3HB0A 2O8BB 4R63A 2KHQA 5E7IA 3R76A 1PAUA 1MQ2A 1GL6A 3AL2A 2Q41A 2YX1A 1BMQA 3L0OA 2EFHB 2F9MA 1JHYA 1NUPA 3Q72A 4QYXA 4FDTA 4PBTA 4XB1A 4ALJA 3PGJA 1JNXX 5HKBA 3KFVA 5DLEA 2YV5A 3ENQA 3MERA 1I8TA 1ZRSA 4RF2A 1SU4A 1XZAA 4LRSB 1G5PA 3Q6IA 4BZXA 1UINA 4IUDS 3WMFA 1URPA 3TOXA 4D96A 4XZ3A 1A6SA 4GLLA 5JVDA 3LUFA 4H60A 4E46A 4Q4HA 3WHPA 2HK7A 2YIVX 5SZJA 3RB0A 3GCZA 4XVCA 1T3QA 4KGVA 2I67A 3QHPA 4EO7A 4Z4FA 3PJEA 4LC0A 4BFYA 4BO6A 4ZAYA 4MKHA 5FEMA 4E21A 3UXEA 1OXVA 2NTVA 4ZV4A 2HREA 3V3KA 7ADHA 4WK2B 5CT6A 2HZ7A 3FMOB 1T6ZA 2W3SA 1HE4A 4QGHA 1DAHA 2LKCA 2VSFA 3Q8SB 1VBMA 2JATA 4X3CA 2PTGA 5TPZA 2XB4A 2ZXEA 1XAJA 1UT5A 3W5VA 1E8MA 3VPXA 3G79A 3CZ4A 4A4DA 2HM7A 1WG8A 1TM4E 1GZ3A 2FMIA 4HFJA 5DNWA 4YRLA 4EG3A 2RKWA 4Z6EA 2D2FA 3QLVA 1A5BB 1M2EA 3LWBA 4Z7OB 3MK31 4XE5A 3HJUA 4FUTA 3BDPA 3DE5X 2CVZA 1NPYA 1Q1BA 1IMJA 5LWQA 1AGYA 4ND6A 4F38A 2COUA 1HT3A 4J0DA 4OMFG 1EFRA 1UKYA 4U2KA 2CLEB 2IHZA 4BZZA 5FPKA 1HURA 1JR3A 3WLRA 5KHOC 1J39A 4Q15A 4PLYA 2XKBA 1T3GA 1ULZA 3LY8A 4LDJA 2WAQF 1SKMA 2CJWB 4QOHA 3I9OA 3ZWCA 4ZDWA 1ZM4A 1RQGA 4LJ7A 1AQLA 5J9FA 4LNHA 4EHLA 4W4TA 3ROTA 2VYVD 4EI7A 1ZD5A 1LB2B 1JLHA 2IEGA 1CUUA 4D3FA 1VG8A 1YJXA 3NUGA 2PQ0A 3GLFB 3D4NA 3DCYA 3RRJA 1Z7BA 3F9RA 3K1TA 4JI5B 4HPXB 5LUAA 1TO6A 5C51B 1TAMA 4LFAB 1EUCA 3KT8A 1QMGA 1RKXA 1GXSA 2XCAA 4EBBA 1NMYA 3KWJA 5CFMA 2DTXA 4LRQA 2J09A 3FMPB 4KO1S 1FNBA 2QNIA 1CF9A 3MLAA 4ILEA 5B5EU 4GH5A 1NWHA 1M73E 3RSFA 3REGA 4GOOD 5E3IA 1S1MA 1TLLA 1T8RA 4MP8A 2IH5A 1KQQA 3VR6A 4YJ3B 2ODNA 5DMHA 1U5AA 1F60A 1E7RA 3NKLA 2R1VA 5KX5A 3BHJA 3OZVA 5B7GA 1THTA 3VYSB 1ZIXA 1MSWD 4ZVRA 1LFAA 2RHCA 5MN6A 4KMOA 4CHTA 4DV2B 2WPDD 3GXOA 1HG0A 2AZ4A 2C95A 1I24A 5ED0A 4WJZA 1U31A 4ZT7A 3FTNA 4FZJA 1YMVA 2XTAA 3EVFA 3CWQA 4J6EA 2AKEA 1PLLA 1IQPA 1E3WB 3C3JA 1K4YA 4BAUA 2J6SA 1F4VA 2PKRA 5BN5B 1SHUX 2AQ4A 4KIUA 4QUIA 5ISMA 2POCA 1MJGM 2BR4A 3P0IA 3R9XB 2RB4A 9ICHA 3L8CA 4AY4A 3GLIA 1JFSA 3OQ6A 1DRKA 5KWJA 4HDSA 1J8DA 4EG1A 3LYAA 2VRCD 4X6YA 2NTEA 4DL5A 1G6OA 2C5BA 3RTEA 1W0CA 3VKUA 3FSEA 2PUVA 3CNHA 1LLUA 2GQ0A 1E0JA 3E6AA 3JRWA 2ZCJA 1AQIA 2CVFA 3LPCA 1RAGA 4NCHA 2Z1NA 3IUEA 1SCUB 3EZXA 2HRDA 3OC6A 3ND9A 2ESRA 1DJQA 5JXHA 2BISA 2VF7A 1Z4IA 4J49A 2YVUA 4RX1A 3WGOA 2I3DA 4H7HA 1RBMA 1UPXA 2EJBA 2WK1A 5AKZA 3RJ9A 3TIXB 3A27A 2EFEB 3SS9X 1N48A 3R5TA 5TQVA 4IQ8A 4GO1A 1QK5A 1W93A 3I62A 2QD4A 2TMGA 4HQKA 3GC6A 4HL6A 1A71A 1LTHR 4JGGA 3AHCA 3NRWA 4IR1A 3UWOA 3KETA 3K3PA 4QW9A 4U7WA 3M4XA 1ZGHA 1W8DA 5K3EA 3WK8A 2ESEA 1ZVMA 3H2ZA 5IN5A 4CGZA 2HVIA 3GJ7A 1X14A 4QO8A 5F2KA 2O2EA 2BD0A 5A5VA 3BF7A 3DM9B 4BLPA 5GONF 3OWOA 2Q5CA 4N3CA 3DZDA 4FBTA 4FZVA 5IIMA 5BN4A 2AYZA 3CO0S 5LDHA 1C4KA 2C07A 3L04A 3LZDA 3ZCRA 1XQWA 1NVAA 1QHEA 3ZX5A 3K0CC 4AECA 1G9XA 3ISVA 2Z8XA 3RRHA 1Q19A 2O3TA 2G6BA 2WUDA 4IXNA 3JQ7A 3NHJA 4YCBA 4E30A 3KVOA 3C3BA 2OUKA 4NABA 13PKA 4BWYA 1UFVA 1NK8A 4FI3F 3OSZA 2FEKA 3IE2A 2ORVA 4ZPJA 1NI4A 3NASA 2I91A 4M9UA 2EGHA 2AE2A 1T34A 3EC7A 1ZSNA 4PC3A 5J4VA 1ECFA 1VRWA 1E3LA 4ZT2A 1KIAA 1N4DA 1UBTS 4REQA 1SAYA 1W4LA 1U1EA 2BONA 4OL9A 3VX4A 1MGOA 3EPHA 4OFZA 3OZFA 4OJKA 2B5WA 2YWGA 4MJXA 1TT5A 2ZB4A 2PX4A 1C7QA 4F9GA 3MUFA 1DC4A 1ZOIA 2WHPA 4NCIA 2H5IA 1GARA 4AMZA 3BIWA 4HNGA 4C7XA 2PPLA 2DFLA 1MNAA 3QFTA 1VHLA 1OWNA 3RS0A 1X1AA 2PXXA 2AX4A 4WEOA 5KSYA 2O2IA 3DFMA 2O7VA 1AUVA 1R8XA 4RZUA 3MFHA 3A4MA 5D6NA 3IV6A 2H4JA 3AUSA 2WSMA 3EGEA 2G28A 1NK4A 1XD8A 3AM4A 1BXZA 3TG8A 1WW3A 1KO8A 4G1CA 3BMQB 1MHPA 2XTJA 1S10A 1HUQA 1AC5A 1B93A 2J0QA 1GZHB 2ZBFA 2R4UA 2QY9A 3GLFA 3AH8A 3MJVA 2WVJA 3KHTA 3BS5B 2OWEA 1DNPA 3NHSA 1X40A 4FCCA 1QB8A 1T2CA 3OFVA 4PN7A 1IBLB 4L02A 2B3TA 2BCGY 2IYPA 4YY3B 4QA9A 3GD5A 3X1WA 4X45A 4CFZA 3KEOA 2W71A 3MN1A 2QP9X 1YVDA 3KJIA 1YZYA 5G53C 4YJ3A 1L5RA 2ZJ4A 3UYLA 1H0HA 2WZQA 4MVJE 4K6CA 3JS5A 2BMVA 3VU3A 3VQTA 2F3UA 2NZJA 4JNKA 2W4IA 4TMVA 2JK1A 1G8KA 2XB9A 1SXQA 2KSOB 2BQRA 3A10A 2JFNA 1EP3B 4GC7A 3EIQA 5UKDA 3D8UA 2IDMA 2V4ZA 1DTWA 2MSLA 4PRLA 2XNDD 2AK2A 4IDFA 2I1WA 3QVTA 4FFNA 4OHRA 3DD5A 1FLAA 3DNFA 3KUXA 3VSAA 4W5JA 1GILA 1CP2A 5KQMA 9LDTA 1WULS 3WV4A 1EUYA 1AKWA 3JQAB 4NXNB 1TL7C 4IXMA 2EAOA 4RLQA 4YMMA 2EWVA 5E38A 1D2RA 3V7WA 2J4DA 3MIIA 2YOHA 5A4IS 3PTLA 4HXEB 2FSVA 4U0KA 4TV8B 5DGIA 1MA7A 1CJBA 2ZBRA 2O3JA 1N5LA 4RGVA 3FUXA 5H02A 3BAFA 1FCJA 4PVCA 4JL6A 1G21A 1WX1A 3HCCA 1SNYA 1XTBA 1XWLA 6Q21A 1M54A 3NPMA 3HVHA 3QE0A 1CEZA 1QYXA 2PI4A 3FWKA 1T6NA 2JLAA 3HCFA 2CRXA 1NUAA 3FUWA 2E8MA 3VTKA 5LP6B 1HFEL 1VLMA 3DT8A 1VGVA 1DQNA 2HYDA 4LGVA 1E1RD 3WMRA 4RV9A 5A62A 4KLTA 3GJ5A 4IHJA 4FKZA 1QNLA 1L5HA 3VGPA 5HCNA 2XBMA 4XFKA 4ZYZA 2ON6A 3ZHOA 3KUCA 2WLTA 1H5NA 2PBLA 5FLKA 1FP4A 4R2IA 1X8LA 3KB2A 3QOWA 5EE9A 2DRIA 3WGVA 1F14A 4G4JA 4P92A 1R6VA 4GSKA 3SR0A 1PKXA 1PBNA 4N5HX 4BX3A 2WKQA 3EWIA 1W59A 3D31A 4PSVA 5BSTA 3FGZA 1RAAA 3CUUA 4ZVQA 4Q1AA 3C5VA 3M81A 3DHVA 3OTHA 3WQHA 1Z8FA 4FFOA 3EPRA 3PQCA 5IINA 2PZJA 3FCCA 1L1EA 3W6OA 5LJIA 4B3HA 4HQFA 1ZD4A 2JIZA 2CYBA 3DTTA 3EGDB 1ID1A 4Y6OA 2WOOA 3ILSA 2N47A 4RM2A 2P30A 1KU0A 5B36A 3BD7A 4HYQA 5AUQA 3B12A 4UU8A 4N1AA 3PUWA 5HQJA 3FCYA 2ALZA 4RAQA 4I2CA 1TJPB 1KJ9A 2C5LA 3DQZA 4J0QA 1VLHA 4ZYUA 3TAUA 5CA0B 3RUAA 5IYZA 1VJ1A 4M9HA 4HTFB 2AG1A 3ITDA 3W9UA 4FYHA 3GOQA 4E5PA 3TG2A 2EW1A 1GCAA 3ESDA 1D0SA 1I1QB 1XLTA 1OE0A 4IV5A 4G0YA 1SM4A 1A77A 1UFRA 2PY6A 2ISPA 3WU2U 1ISMA 4YRDA 2HHCA 1AGRA 2QUKA 5DLDA 4Q01A 5KWSA 3RSCA 1GNVA 4HB3A 2R7LA 4L4YA 2AMYA 1RNLA 3WK5A 2BCSA 2V55B 2JC3A 1UP7A 2H3ZA 3NXKA 2PSDA 3FUVA 4TQSA 4P81A 1L7MA 3RG8A 3F67A 1QE3A 2ZP1A 1T6BY 1G98A 2WTEA 4L9SA 1T1IA 4JZKA 4V1CI 5D8DA 1VLQA 4MRVA 3EGCA 4C14A 2C2DA 4JBXA 1Y34E 3KVYA 5BWMA 2AXEA 1O9BA 1VJTA 3TZBA 1POXA 4Z9AA 2XOKD 4OXXA 4UJ5A 4Q3NA 3D5QA 3KC2A 4KIWA 5IXYA 1L3TA 2YMLA 1DQYA 2B7BA 1KVUA 3O1HB 3WZLA 2BEVA 2DL0A 1A50B 1JG3A 3BS5A 4DIUA 5I8PA 4LQCA 2VHTA 1B0PA 1LI5A 5FUWA 2XIQA 1BS1A 2HCBA 3MGGA 4ECUA 1TYAE 3PGA1 2L17A 3E05A 3V8EA 5JAZA 4X54A 5SZKB 2H29A 2C03A 1TK3A 4EMUA 2JZBB 3A14A 3GX1A 4MQ5A 1K8ZB 2W11A 2G5CA 5JO9A 1KDYA 1LPNA 4EPRA 4C6TB 4AURA 4AL4A 1H3EA 4KLJA 1L3VA 3GJ6A 4UBCA 1WTAA 1ZU5A 3VR3D 1X9SA 4UNQA 4TRMA 2LD4A 1UM8A 5DPMA 1X7GA 5KFSA 3BERA 5HHIA 1VC2A 1XYYA 2RGGA 1L5NA 1NK5A 4M8NE 4YGXB 4RIIA 3JPWA 3STUA 3T4UA 1E9BA 1HK7A 1IUNA 2XCOA 3HNRA 4UMVA 3NMUF 3UA3A 5D3ZA 1OBVA 4PPNA 2XMCA 4QFCA 2W9AA 1LTQA 4GLFA 3VSCA 4Q4LA 5ETJA 1PV2A 3HXMA 4NYIR 2HBZA 4JBNA 4ZOLB 5MN4A 8AT1A 1ESCA 2GZMA 1RHRA 4Q0MA 3BXPA 4FYWA 3TIIA 1HG1A 5U4XA 3T79A 1Y8RA 4YP1A 1RJFA 4IHAA 3OG9A 3T9FA 4OAQA 1DAOA 1BHO1 4KR2A 3GLGB 3KQLA 3I2YX 3ZDBA 3DYBA 4DFKA 3OCXA 3K30A 1C9EA 1ESZA 3E1SA 3FCXA 4DKXA 1YR6A 1DIOB 1SQGA 2R6JA 1TQ2A 3ZWXA 3UENA 1JR2A 4DV3B 3ZU5A 3EZGA 2FPIA 3HL4A 3FAZA 3H2YA 3E23A 2GZDA 3UK7A 5FWYA 4FYKA 5K05A 2PFOA 4MW0A 4O9MA 3PPVA 3DBLA 5ALNA 3KIPA 4I2AA 1WXFA 1KS9A 3OCCA 2X86A 4UREA 2H7VA 1ZH2A 4ZHQB 3DVQX 3TPZA 2ZU6A 1XG5A 4KXLA 2Q9UA 1J9ZA 1T13A 3B6MA 3LCRA 4EHDA 1XCOA 4YRJA 4PHDA 2R6AA 1SGGA 3CG4A 5DLPA 1HGXA 5FT9A 5EA2A 3TMYA 5LC1A 2H3IA 1FJHA 3DFIA 3EFBA 2GZ1A 2PGNA 3DV0A 4KCGA 4MVJD 3UMCA 2QRLA 5E6UB 4YAIA 4HYYA 4N41A 3Q8WA 4PX2A 2WAOA 2HHAA 2P9EA 1SXJC 1X7WA 4II7A 3TO5A 3ZE2B 2DEUA 4EHFA 4W6QA 1H2RS 3IG8A 2OM6A 5AQ1A 2ZRCA 3HHEA 3AY7A 1A8HA 2FEWB 4YXWD 3JALB 5F2NA 3IHWA 2FN4A 4C7JA 4NU5A 4YUVA 5EIEA 2XCLA 4B73A 5GJVC 4XB6B 2OZVA 3PMLA 4Q7JB 5AI8A 1LSJA 3KLPX 3NHBA 4D98A 2RHMA 3CG0A 3Q0IA 3CLVA 1K86A 1AS2A 2KHZA 5FL3A 2BE7A 2BFDA 4QATA 1TECE 4GZ3A 4XLZA 1H4TA 4BO4A 3EGDA 3FMIA 7ICNA 4ARUA 4TMXA 3W5IA 4ZN6A 1YZNA 5LYJB 3KLMX 4OLHA 4KMUA 1X80B 5DW3A 2HU8A 1IIBA 4ER0A 4DV4B 4X71A 4YTEA 5THQA 1O03A 3IA7A 1UAGA 5F7OA 6AT1A 3S8EA 2C2YA 4LDRA 1KDTA 2PGXA 1GZVA 4PLFA 3H1EA 4KEAA 2AOXA 2B1RA 3AJ8A 3E3MA 5B6PA 2NSHA 5CFLA 5EJ8A 1M0TA 2P90A 2NV3A 1OF1A 3OM8A 2OPBA 2XTMA 1VMDA 3SLGA 1G8HA 1PDOA 1FTGA 1SBNE 3AIKA 2BFWA 5EPOA 1RCFA 2PE5A 1MH9A 1KXJA 3KU1A 4LHZA 4I7EA 4ZYXA 2P2DA 2GHQA 5CFZA 1BRMA 1PFWA 1J0CA 3NVKI 4K05A 4Z51A 1XPOA 4X5OA 1U0BB 3KSAC 2RHHA 3NNNA 1OPRA 3LMKA 2VCYA 3T9DA 8ICUA 5DO9A 1LDNA 4GL4A 5HJ2A 3TLAA 1NLFA 3HI4A 5AXAA 1PYOA 3C8UA 4F4FA 2FDRA 3RROA 3THYB 4NQZA 2ZTCA 2XXJA 4D3ZA 1SWWA 2H5LA 2Z04A 2FZEA 3ZLBA 1IB0A 1TC1A 2O8DA 3KTQA 4HVAA 2KIVA 3GEEA 3ZGLA 2FUEA 3ZVMA 1TXGA 1PX2A 2I2CA 2R6FA 2OOSA 4EK9A 1JXOA 2UYQA 3TSOA 3WWPA 1U8ZA 2AWNA 1C8VB 1L7AA 1KSPA 4AZ3B 4AG5A 3WLAA 3SZUA 3WQBA 1BW9A 5CP8A 1KC3A 4N7RA 3R8FA 2ONKA 4UPEA 1DC5A 4D3DA 4DLRA 1Y48E 1E9RA 4YP3A 3H1GA 1KOFA 2UVPB 3DBHB 1ULSA 5KNBD 2IQIA 3PITA 1QIDA 3VNVA 3AEZA 5F9MA 4KFUA 2F76X 4TMKA 3EZ7A 2W2NA 5AXDA 3UMRA 1H3NA 3EYAA 3T7JA 3BRWA 1ZD9A 4XJTA 2AJQA 1WXGA 1KYXA 4Z4IA 2YZ2A 3M5DA 4P98A 1ST2A 4C6TA 4TKLA 4QXPA 4QM7A 5IC6A 1DJPA 1N2GA 2YQ4A 4EO4A 4AX4A 4C7VA 9ICEA 1SUBA 3K9WA 4BASA 3IOCA 5C5JA 1SUWA 3O9ZA 5CVJA 1MJNA 2PMDA 1U3WA 5FI3A 5KFIA 3LQ2A 4ZYVA 2FDXA 2O0HA 4IIJF 4MV1A 4UB8U 2HFJA 4FHDA 9ICOA 3KWLA 4OHXA 1NSTA 5AHXA 1NBEA 2RGYA 3V2GA 1MORA 5BSFA 4KBYA 4JVMA 2DBVO 4RCYA 1X8KA 5JUMA 5I9MA 1AA9A 4L9RA 3W2GA 3OOWA 4PLPA 5J5VA 2ASDA 1TKBA 2DPHA 4P0QB 1A27A 1A82A 3OJXA 4OGLA 2G0TA 1VB3A 5F52A 1YL7A 1N0WA 4X20B 1CD5A 3GHHA 2BCVA 1OVMA 1ZK3A 4Z0HO 4IRMA 2FKNA 4E12A 3W9SA 1PR0A 2C84A 1AROP 4UARA 3D8SA 1L3SA 5A0LA 2GN6A 2VPQA 2FX2A 4RT2A 3HUUA 4WCFB 4Q7MB 2YQEA 1SRQA 5EXTA 1LQ2A 2BFEB 3MINA 3M6WA 2YICA 3L7LA 4ZHQA 5DXJA 3JASA 2F43B 5C8DA 3AL0C 1E4EB 2YCLA 3ZCUA 4HAUA 1IXKA 4N5IX 3EF3A 4MI1A 2AEJA 1ZJZA 5ER9A 3BXHA 5AVTA 1NUTA 4QOFA 2XY4A 4ARSA 4O4IB 1MC8A 2PMFA 1HSZA 3X1YA 1N5OX 3O83A 4D4LA 3FLMA 5HG0A 3NETA 4NX2A 3AUUA 4KLAA 2K87A 4YD2A 1N7HA 4QNRA 3MRSA 4IOLA 4TV8F 2HV8A 2RGNC 2A0KA 5KTQA 2QNBA 2WILA 5IX8A 1T0UA 3P4XA 3T1HB 1DAMA 4XIIA 3TSWA 1TKDA 1K2WA 2XDQB 4QU0A 4L8YA 2PVPA 4IXDA 1X7DA 2J30A 3RH0A 2GCNA 1J70A 1A8IA 3GLHE 1V3VA 2ZUBA 1JIXA 1W75A 3C6ZA 4KXWA 2QTCA 5LP6F 2VDQB 3RUEA 2J3IA 1XN1A 3EIFA 3VC3A 5DWDA 2ZVPX 4F0JA 1FTQA 4LPSA 1H66A 3KCNA 3FX2A 1R0KA 5ESWA 4GZ6A 3PV0A 4CV3A 2RJ3A 2KMDA 4JYCA 5ITWA 3ZY4A 3K5IA 4G5XA 3HCRA 5IBQA 4Y6PA 2DQYA 3UPUA 5CCEA 3EVGA 4MB2A 2NTJA 2ZRFA 2VXBA 2C2BA 3HSYA 1YCFA 4GQIA 3SBEA 4IDGA 2ODTX 3TOVA 3D6HA 4IIDA 2H07A 5KS2A 1UC9A 4A82A 1GEGA 4AI6A 4A2PA 1X1TA 5CIWA 2HXGA 5FA6A 3GDOA 4ZWNA 4MUXA 2ERXA 3ND8A 1V2GA 1LI4A 1OREA 3R7BA 3VSBA 1LS1A 3RYHB 3HILA 2XOEA 3G6WA 5BWCA 3H0EA 1SIWA 3WMEA 5YASA 4LXIA 1CB7A 4I14A 1ML3A 5BT9A 5TQ0A 2V5VA 4OBXA 1PW5A 1RQ7A 4F3CA 3PHGA 1BFDA 3STHA 4I6GA 3RHTA 3OD5A 2O4UX 3AM5A 2FQWA 1HDOA 1E64A 1OXUA 2VZLA 3T15A 1X6JA 5CA0F 1Q46A 3KO8A 4AKTA 3BL6A 4Q18A 1SD5A 1P1JA 4I99A 5DCYA 4KR9A 2ZIGA 1W0JD 1G4HA 5BPCA 1FJXA 3F2DA 3GVPA 2COEA 4C6RA 4Y8VA 1K7XB 5AESA 1VB5A 2B8NA 1QGUB 4KQKA 4MVXA 5MFPA 4X60A 3M3HA 1ODCA 1YMUA 2QZ9A 2LP4Y 2IHMA 4C0QC 2DF4B 3WKAA 3HJHA 3CRQA 3ADPA 4MUGA 2NN3C 2OG1A 4U1RA 3QEBZ 3QX3A 4MSUA 3ZV3A 1MIOA 2Y8EA 3WB2A 4IWXA 1EFHA 5AKLA 4DQVA 1ZX1A 7ICSA 3IJPA 1G8GA 5EY5B 5KJFA 5AK4A 1HA3A 7MHTA 3AJEA 4KBGA 5HNKA 4DS4A 2XGMA 5C9ZA 5CDYA 2NU7A 4NFHA 2ZSKA 2CB0A 5G3ZA 4XDZA 3UH1A 2XDAA 4DF4A 1V5EA 4TQUS 3A3KA 3KYDB 5J0RA 3SS7X 2KPOA 1G5RA 3SFVA 3OT1A 4P5EA 3HR4A 1WW8A 2ZYDA 4E3WA 3B7GA 2EL7A 2AR9A 4RUKA 2JFXA 4YT2A 5J4LA 2Z2XA 4GWGA 4RSMA 1W44A 1BEEA 4Z5XA 2ZRBA 4MCAA 5GONB 2I9KA 3G0BA 3DNMA 1W9HA 2OK8A 2ZIVB 3IT2A 1J56A 3DYVA 1IIRA 2DPLA 2PM8A 2TSYB 3OZGA 4OREX 1CY2A 3DH0A 2CL5A 2D5IA 2L82A 3TLGA 1R3DA 4E2ZA 1U11A 1YIDA 3OZCA 3ABIA 4P0QA 1SC1A 2XKAA 3KQWA 3TQCA 2WDPA 5BOMA 3KJXA 4O3QA 4A73A 1JVSA 1WAMA 3EDOA 4FBGA 1AGPA 2H2IA 3CB2A 3AF1A 1C3OB 4DRXA 3K0BA 1NRWA 3T3FA 2GNAA 4AMYA 1JAIA 4Y98A 5HF6A 3AFGA 4FWTA 3HKDA 4B8YA 2MRLA 3FR7A 4P84A 1XZHA 4CMIB 4N7BA 1CZUA 1JVNA 3M7IA 1ARZA 3MF4A 2MUTA 4YFVA 1SPBS 1FS6A 1VPLA 1UQTA 4ZOLF 4WXPA 1ORDA 2P2SA 2CMKA 4HJXA 3PYLA 2EWWA 1JJIA 4RD1A 3GDGA 3BMXA 3HRKA 10MHA 4EAAA 2Q3FA 3UC9A 4Q4CA 4FMCB 3ZLJA 4PO8A 1KEJA 3NUQA 4H27A 1ZJ6A 1DBSA 5KYUA 2P66A 2EHDA 2K8AA 1HORA 1QAQA 1M2WA 3FTEA 2OQIA 1XQVA 3SQMA 2VA3A 3NBFA 3TZKA 4DA7A 1TEZA 5K4GA 1DQZA 2YNMA 4L8LA 4DHEA 3E7XA 2O19A 2VHZA 1Y63A 5KJ1A 3I6YA 3NU1A 1G2OA 4S1PA 1KRHA 2IEAA 1TZ2A 4I5FA 4Q45A 4TZTA 3E5NA 3AZOA 2O7SA 3RUDA 1JXEA 2BBTA 2Q6OA 3D2SA 3TZLA 2ZJ0A 4LZJA 5DGCA 1L5LA 2E82A 2ZLBA 2FKAA 2DFDA 2OHGA 4XFDA 4PPQA 1XJ5A 1EEHA 4TWRA 2MT9A 3PDJA 4WKOA 4JUAA 3COYA 5IDYA 3C7CB 2IV3A 2PUCA 1YFLA 2EFDB 1N92A 3QUAA 4FW9A 3PEVA 3DOIA 1KBOA 2B2NA 3VC1A 4KFCA 4PYMA 3D2QA 1SXIA 3EQ6A 2FFAA 2EKPA 1WHTA 1KAMA 1BROA 1HF3A 1DRJA 2Q2QA 1OB2A 4DG8A 1JKJA 1HYGA 1NW3A 1ONPA 3LBNA 3O2SB 2WINI 3F4BA 5A71A 3D2NA 3RIEA 3ZOKA 4BQRA 3VR5A 4LYEA 2I71A 1R9GA 4A91A 4L7VA 1PQYA 4ZO8A 2Y68A 5LZ9A 3PXGA 3QPBA 1XQ1A 3ZTWA 2CVPA 2CXQA 2X5XA 5LYJF 1M72A 1TQ6A 1BA3A 2PEYA 4TXNA 3PSPA 3ROKA 1HUOA 2L0XA 3FFAA 1OYVA 5C2JB 2JVIA 2J5KA 3NAGA 5L7WA 4Z7JA 4BWMA 1XRRA 3D6NB 4GWLA 1J20A 3E5MA 5A5DA 3WLLA 3ZW9A 3AHGA 4OM8A 5JS7A 2OA0A 4MEJA 1P77A 3OMLA 3W8RA 3B9RA 3DUWA 1N3IA 1BFUA 2FEMA 4L5CA 4B35A 2GYYA 3VYWA 3EIWA 3R0IA 1TZJA 1ZJYA 1CYEA 4RK4A 1DOQA 1T9ZA 1UWVA 2REQB 1SVOA 4BTLA 3A2KA 1PQPA 4IVRA 2OGSA 3PL1A 2W9CB 4CKBA 4PYOA 5KWIA 4FXPA 6LDHA 2SKCA 3I4CA 2K2QB 3OSPA 4BLUA 3WB9A 1BDMA 1BCSB 2JB9A 3GI1A 5GADl 1N75A 3AR2A 5BQ3A 5IARA 3UUEA 1EHIA 3LLMA 4EYKA 1U0LA 2VPWA 4ENTA 1GRVA 4R31A 5BSGA 2X15A 3I2JA 1JEOA 1MBZA 3WQQA 3O94A 3UTDA 1F4PA 3ELBA 2LYHA 1DFIA 1Q0UA 1VA5A 1VYVA 3PEUA 3C3AA 1C7FA 3FJYA 2UXCB 4ZYWA 1X9HA 1X0XA 2PR7A 3LBIA 1ECJA 4R8UA 4ECTA 4DXAA 5TVKA 2I9GA 1J7JA 3K0EA 3W7BA 2KBFA 5GONA 1R4NA 3RSHA 5JIBA 3ULKA 1YCDA 2G1AA 2OUIA 3HKCA 4OOEA 4Z8YA 5EJ4A 1EBFA 3NNSA 3CWCA 1OXJA 2H3VA 2XMPA 2C3PA 4FLEA 2QIOA 3ZJ4A 3LKBA 3H5LA 4FYJA 1FMJA 2B34A 2QYSA 5JV5A 3DZGA 4WAUA 1XLWA 3O21A 2FYTA 1G291 3WLPA 1IUOA 2XQKA 3O1LA 4O4HB 5GJWC 1HDXA 2G1JA 2B35A 4EG4A 2XSZD 1IVYA 3TDNA 4GG1A 2K7ZA 4BU0A 1SOUA 1K98A 3G8CA 4KH0A 2R68A 3E18A 3K70D 3N58A 3FYCA 2O8EA 2Y1LA 4HFRA 3CF2A 1AHIA 2WIJA 4M0KA 3LKZA 3TQRA 1T1RA 5E1DA 4ED3A 5IC5A 2HTEA 6REQB 5AW5A 3KFUF 1E3QA 1VKZA 1TF7A 2B98A 1X66A 1K2VN 5ADWA 3CVJA 3QFFA 3WGJA 1XVTA 3WGZA 1WBDA 1N6HA 4L0QA 4AJPA 3GHYA 9ICIA 1E3MA 5HA5A 8ICVA 1XEXB 3MCAA 5JFOA 5EOVA 2PX8A 1OA0A 3KV1A 4H1UA 1KI9A 1N5WA 4D57A 4NCBA 3IPRA 3WGMA 2FEPA 4WZAA 5EUBA 5JSYA 2I3ZA 2EV9A 3H17A 2I4TA 3LY9A 4NCKA 1UH5A 3M9WA 5G3YA 1JUDA 3SR3A 3MWDA 5TF4A 1T5IA 3IHQB 1IFXA 3DZKA 3SYRA 2E4AA 4NHOA 1U9ZA 1DHRA 3DW1X 3LQ1A 1UZNA 3W7AA 4LTMA 1W2WB 1AHHA 3IEMA 2PO5A 4MR7B 2H1VA 1FYDA 2BL4A 1T4CB 3RREA 3FHJA 3G7SA 4KKXB 2ZOSA 3HUEA 3ORYA 4O4IF 3KEFA 2A67A 4EUKA 1FNMA 2Q5HA 2X42A 4OP3A 4OVKA 1N1GA 4TXMA 1JDBB 4C89A 4B7XA 4DYDA 1DO8A 3AG6A 3J81k 2BMEA 2IUTA 2RAVA 4C0KA 2FQQA 2IUSA 5LD2C 3RHSA 2HMSA 4UZFA 3GIMA 2PH7A 3ZTYA 4P9NA 3K9FC 1OROA 2P6PA 3N75A 5I45A 3L7AA 4RL4A 3BJZA 4ZVPA 1CK4A 1ELOA 1QYRA 1BS9A 1ZUNA 4CU2A 4RKQA 5IWCA 3MR2A 2GARA 2QW1A 1RQXA 3KTOA 4RTSA 4B3MB 4BB0A 4D43A 3QHQA 3T3NA 4XRHA 3FVRA 4UM8B 4DM7A 4BQQA 2VKQA 4IG4A 3D3QA 4CCYB 1J9GA 1J8QA 1OW3B 1YR7A 3AK4A 2IZ6A 3OLYA 1MOPA 2M6LA 2G83A 1QYDA 2ONCA 1JLLA 2IHYA 1W1WA 5GZ1A 2HEIA 1EFTA 2DWCA 2XKKA 1HFWA 4EB0A 3EZ2A 1O5IA 4KK4A 2WQ7A 2VHQA 4JFAA 4DKJA 3V4VB 4BE4A 3SNKA 1JMYA 3TSYA 3U9SA 5IT5A 1R1DA 3SE0A 1Z4QA 1EK2A 3DTVB 2VHUA 1M6WA 3A0RB 3BTUA 1G5FA 4PIMA 1K6MA 3H99A 5AJZA 4S1WA 1FSPA 3V7UA 3OIVA 3WTCA 2ZYHA 4FCVA 4O8CA 2Y0DA 2F77X 2JGLA 3A3NA 3PKZA 4G6ZA 1I4TD 1BCSA 2JIPA 2N75A 1K63A 2WJPA 4A3SA 2EW8A 5H0IA 1ZCZA 1SL0A 3ZLUA 1SHKA 4RZRA 1GAQA 1HKUA 1DXOA 4Z86A 2RARA 5TLSA 1JLSA 4N0QA 3M2PA 2IU4A 4DSEA 3V1YA 2Z6VA 5IJ9A 2PLRA 4BHTA 4YG2A 3U4AA 4NV0A 1C2YA 4HS9A 2QVZX 3JD4A 4FINA 3V7YA 1CJVC 3TN7A 2Z4SA 3QJGA 1P0QA 1JSXA 3GMSA 3H05A 3D7MA 3LS2A 3GD7A 2OXCA 1AURA 2XRFA 1K97A 2OORA 4E6PA 1QHHB 4EKDA 4E88A 3KJNA 4KXFB 3AKEA 4LSWA 4EYHB 1RCTE 1KDVA 2O2HA 3OQBA 2V65A 2XYRA 5F4ZA 4C06A 3G2OA 3LYHA 1O0SA 1YRYE 4G85A 2QLLA 3ABOB 2E5SA 3RWOA 2O8BA 2JAXA 2EARA 1N2CB 3OFND 5DBOA 3C1AA 2XE7A 4ZI3A 1U3GA 1BOFA 5HTKA 2R96A 4YFYA 1X1RA 1RAEA 4QUGA 3ESYA 5BMOA 1JAXA 2I4OA 4R2KA 1JHDA 3QKRB 5IUJC 2CFIA 3LW7A 3KAJA 4HV4A 1QBKC 6REQA 1W1IA 2RC5A 2EL9A 3W79A 5JARA 1KTQA 2YXBA 1ZEJA 3PCTA 1M2OB 3GDXA 1Q7CA 3WKEA 3CZMA 2FRDC 2ZCVA 1KTVA 2A1IA 4MUHA 4GT1A 2IPNA 1N2IA 3MTAA 1CQWA 3ZWWA 4CUKA 4G67A 3G0HA 2FFBA 1NASA 3GK3A 5KCZA 4LS3A 1E7MA 1JKMA 3L18A 1U8AA 3I23A 1JEAA 3HACA 3HEAA 5EJ5A 3SEZA 3PQ6A 3BWBA 1DJNA 5J58A 4JOSA 3F5DA 2Y1JA 3ZVNA 5FOXA 3AJAA 2QN8A 5F9NA 3QFCA 3AR9A 4KQ2A 4RKFA 5BMVB 2FFHA 7ICIA 2BWJA 3WGHA 4AP5A 4L76A 1YJAA 3Q3IA 5D1HA 3HYRA 4YR2A 1ZZGA 2Q7OE 3AF5A 4IOJA 2Y1GA 4MVJH 1DWPA 4WGFA 3RAPR 2EFJA 3FHLA 3QG5A 4MR7A 3SMVA 4F2GA 4TTQA 2H2FA 1D0IA 1G8JA 3CLTC 1JIJA 3LQYA 2W8LA 5DTJA 4IMRA 2Y2VA 2V0GA 2I8AA 3K8QA 4NOLA 5CNMA 3TADC 4D4HA 2HDOA 4AUMA 5JS8A 3SC3A 3FZQA 1D2NA 4FMCF 4JH0A 2JIMA 4G3XA 3CX3A 5AI4A 3WWCA 3K9HA 1XQ6A 1MABB 2Q4OA 3M3PA 1YOBA 5BW4A 1JEQB 2CJWA 2B2CA 1LB1B 3P7MA 2IHBA 3U3OA 3VYTB 3NC1C 3CNNA 3V7KA 1FNSA 5JS2A 4AYXA 1IY8A 3S2EA 5KJEA 3A1WA 1AKMA 4IIJB 1Y6QA 5C5CA 3RCBA 3ONDA 3GJ3A 4RYLA 2C57A 1EBBA 4KHZA 3COJA 4R1TA 2OGWA 1JJFA 4ZTZB 1F0PA 2DAPA 4BVLA 4KPGA 5K20A 1NBAA 3A9SA 2IV7A 3I2KA 1CZOA 4TTVA 4CCYA 2ZFUA 3WP0A 2R79A 4R1SA 3PNSA 1Z8HA 3GFFA 2GZ3A 4YT5A 3HW8A 2JIQA 3C74A 1S3IA 2XVXA 3CT4A 1UIRA 3FH0A 1E7SA 1Z35A 4ZU1X 1Y3AA 3V8MA 4B31A 1P5HA 3S40A 4TX1A 1ZZEA 4X8LA 4JT4A 5IKXA 4FHGA 1JXQA 5K3DA 5IF3A 4OFWA 4ISCA 1RCUA 5B55A 3N70A 5ES3A 1ZNWA 3FSGA 4US1R 1F20A 1NQXA 3RVDA 4CKYA 4CTJA 1TADA 1X1EA 4GICA 4WERA 4CIYA 5KTMA 3IP3A 1WPXA 4NBVA 2OFXA 1TT7A 3REFA 1X9GA 3U9TA 1E3WA 3H1PA 4YI5A 4E51A 1T1SA 5H82A 1OHHA 4DUGA 1H8EA 4QJFB 3COSA 5DBBA 2ZUDA 5BN5A 2VOEA 4G8BA 3AN1A 3PJFA 2WTAA 4DY4A 3R9XA 1M5UA 2ECPA 3BA1A 5DHFA 5E8RA 2JJMA 1A8PA 1C7ZA 5DIZA 1P2UA 1GTVA 3H1AA 1WDLA 1L4HA 4CF3A 2RHJA 4MMXB 3BCHA 2IS4A 1FRVA 3TANA 3RH4A 4ZGWA 3LPNA 1NNI1 4YAWA 1JDJA 3B6ZA 5KNBH 1CF2O 3KKPA 5J0YA 1GTZA 1TU4A 1QFZA 1ZUIA 2Q6LA 2VRWA 4ZQHA 1ZOOA 2PA3A 1U99A 4G37A 3LTNC 3ZZNA 1SCUA 5KFEA 1Z9BA 1GPMA 1JLMA 2REBA 1KEUA 2BGRA 1UJMA 5ADHA 2WKRA 5F64A 2GWSA 3ILXA 3ESZA 3ED1A 1QKJA 1QDLB 5KAMA 3R0QA 3RVLA 1MG0A 1C20A 3D6AA 3N2YA 1FLNA 3SICE 3UUGA 5LLSA 4G9BA 2Q0SA 5A4DA 3A11A 1UQVA 2R6CA 3OHBA 2OC9A 1N34B 2RKOA 4H7PA 3I5AA 4JELA 4ZVNA 5DHSA 2OM2A 2HGSA 5KO2A 1GFWA 1N2XA 3PSIA 5COAA 1KYWA 5IAOA 4PGXA 4OAPA 3U9LA 4AJ1A 2Z3ZA 2R5WA 3LJKA 4H18A 1QKKA 1OIVA 3SZ2A 1RD4A 3BK1A 4DFMA 4A8PA 2Q3MA 3QYJA 1XQ9A 2VH2A 2RH9B 5JSKA 1ZH4A 5GV7A 1OFHA 2IIPA 2VUIB 3CONA 3TRJA 1GQYA 3H1BA 4B6PA 1EJ0A 2KJ5A 4LW8A 4L57A 4N49A 1FE8A 4JJ6A 3PDCA 2BPCA 2QGZA 1L8LA 2QRKA 3D8HA 4X66B 1L4UA 2X0RA 4O4HF 2RHDA 4ER5A 1V11B 3AHIA 4WA7A 5CVDA 1YK0A 1T1EA 9ICWA 3LY5A 4LDQA 1U5BB 4MOWA 7ICVA 3V55A 4P4NA 1XSNA 1JSZA 2P9GA 4X6LA 1HDZA 2ORED 2ROQA 3KZNA 1XJWA 2V0NA 4CTKA 3NVMB 4YMIA 5JTTA 3PA8A 4X0EA 2PGJA 4F4ZA 3HO1A 4UTXA 5D84A 2GPAA 5FFMA 4D9HA 3S1AB 4BNKA 1FVHA 1T3NA 4D99A 5BYAA 2ZSIA 4N5MA 2HUPA 2WSLA 4AIIA 1WDTA 2ZK7A 1V16B 3U4GA 2ZITA 1F38A 1QFMA 4D82A 3OIYA 3TXXA 2PQ6A 4DCTA 4KXUA 4LOIA 1Q7BA 4ZARA 3JZDA 4UB4A 1TUIA 1XP5A 5ED4A 4GLOA 1BMDA 4UXHA 4FOPA 4OXIA 3VZQA 5IXSA 3H04A 1TK5A 7ICLA 4K9DA 5JCOA 1HUZA 4P7FA 5EXDA 3L07A 1ZKDA 3BMQA 2BGJA 3VNQA 1XO0A 1DK2A 1NZBA 3D64A 4TYPA 5IWAB 3DOUA 3NH9A 3K05A 1YE8A 4Q1EA 2R48A 4IIJA 1F6WA 1KMCA 2QK4A 2DFNA 2J5XA 3ENKA 2C20A 3MTDA 1Q3TA 3MDAA 2PL5A 2VP0A 1N2SA 3ZIUA 1IZ0A 5FTWA 4Z2YA 2O9JA 2PXIA 1CHNA 3D5EA 1E20A 1ORWA 1QHFA 4J29A 1DLIA 2GVDC 5EJIA 1S5PA 4MWGA 5BSHA 3UO8B 3GEHA 1U3UA 3N2LA 1B42A 4QKQA 1YVRA 1IBRA 2WG1A 3DZIA 2Q8PA 2IYAA 1DBPA 4DLEA 3FYTA 3AILA 1IK6A 2X23A 4CM7A 2FW7A 5B3AA 5C80A 3IMGA 3HGQA 4NBKA 4MO9A 4HWOA 5CVCA 5MF6A 5K0FA 2KSOA 1OFIA 4U7GA 1AQ6A 4FOSA 1CDZA 7YASA 5J0TA 5EIWA 4GMKA 3ROPA 3NWJA 1UXIA 4O0IA 3FYUC 3LVFO 7ICHA 5AKJA 3R6WA 1V6SA 2W58A 2HW8A 4LNUB 3K09A 2NRTA 2VWGA 4ENVA 1XAIA 3JQAA 4BYGA 2FN9A 4B1FA 3PDUA 4HVLA 4C0XA 1I6WA 5ALSA 4QWDA 2PRJA 4JSRA 1XDGA 1Z8DA 2H9YA 3DMGA 1HLGA 4YT4A 4V3CA 1EG2A 4TV8A 4WK4B 3QZ7A 5I7VA 4P36A 1PFKA 4D41A 3C97A 4EELA 4FIZA 4CWAA 1JDNA 1G2IA 1KO5A 3RJHA 5BV2P 5D86A 5FBQB 4TYMA 4M22A 2JHCA 2EFYA 3G89A 4O5KA 2NIPA 3Q8XB 4MRRA 2Q5JA 1LU9A 2WJIA 3FCAA 3PNYA 2QTHA 4RKRA 3V8NA 4LDAA 4GBGA 3N6XA 3AQEA 2C29D 1GPAA 4M38A 5LP6A 1PJZA 4RJKA 2FMKA 1NI3A 1BD4A 1H5QA 3QA9A 5IKEA 1RI1A 2JCXA 3TL2A 1S7CA 2UVQA 3BGSA 4UNIA 4Z6FA 2QL9A 5F1OA 4M7PA 1CT9A 2JHDA 3CF6R 1MLDA 1IRIA 1U1GA 4YP7A 1DTEA 4JXZA 2D2EA 2WMYA 1NZPA 3BD9A 4ZZ0A 2IHUA 4XVQA 4EUNA 4TLDA 4RY0A 1EI9A 3H87A 3M6KA 1ZU4A 4X3OA 1R5BA 2R2GA 3F90A 5J47A 2O7RA 3NHZA 4OQFA 5FPSA 4CCAA 4DSUA 4F1JA 3ICXA 3IAXA 1KDZA 2R1ZA 2G80A 3E9DA 3ESCA 4EG7A 8GPBA 3LZCA 4UQOA 4F60A 1EX6A 4TWJA 3BIOA 4NLZA 4CV0A 4TLEA 4GZLA 3TFRA 4L51A 4X64B 1Z4NA 2GPNA 1BYIA 4URYR 2NSJA 4ICAA 4RK0A 2QM0A 2QM8A 1PVVA 3H2JA 4KLHA 1ANKA 3F6RA 1FFCA 3W78A 4BQEA 4U3JB 3ZXUB 4D45A 1WUIS 3MR6A 4C0BA 5CA0A 1LPMA 3KZKA 2B5VA 1TZCA 4HTFA 2H57A 4E2FA 1VL5A 2A5YB 3LD9A 2EAPA 1XKLA 4QBIA 3A4LA 4BX2A 3I1JA 4IQUA 1PVQA 1Z6ZA 4FBLA 2CDRA 1YR3A 4LRXA 3E9ZA 3KQTA 3CJTA 1E59A 2CHVA 3PDIB 8ICSA 3C4QA 4ZCQA 5JS6A 2QTMA 4CDRA 4CXMA 3ZGYA 4LYFA 4IP0A 1E96A 1AF4A 4AUEA 2CFOA 1KRXA 1FIQA 5FBKA 1OLOA 4WA8A 3RW9A 5CMLA 1ZAKA 2YTUA 1KK0A 1Y80A 4YQFA 2GS9A 2UXBB 3DE1X 1FJ2A 4B7ZA 1ZN2A 3R77A 2HRQA 2P4QA 4BNGA 4MUFA 3MUOA 4HLNA 2R8HA 2XT6A 3DTNA 4IBOA 2QAJA 5B7QA 2XGPA 2H2HA 5BRAA 4OHYA 2MWMA 1JV2B 5BMVF 1SUFA 1L7RA 3CZ5A 3VMMA 2A59A 2NO7A 3DCNA 2EJCA 1HDGO 8ADHA 5H4HA 1DCFA 2AI1A 1Y1SA 5FOUA 2BI7A 3V48A 2JI8A 4B4KA 5H4GA 2F4NA 3GUYA 2CXRA 3IPXA 2Y1CA 1J90A 1PVRA 3PUZA 3IP5A 1F9AA 2UUCB 2WRZA 4JIGA 4K8OA 4OCZA 3EAQA 4YRIA 3PJRA 1KZHA 2O1WA 2GEUA 4M37A 3A0HU 4M2LA 3SU8A 3K53A 2QYHA 2BGWA 1DIAA 1KEEB 5C32A 2JZBA 1P0CA 3CRW1 5C8VA 5JSZB 3LDHA 1U2PA 1I36A 1YR2A 4UM7A 2CHEA 4TOIA 2BM8A 1BMFA 4WDRA 4EY7A 4FR0A 2C31A 4QBTA 2YFHA 1B4FA 2Y0EA 5GTDA 1DKNA 2HPHA 1P1RA 4JL8A 3RVOA 1LK0A 3NAQA 1HM5A 4MW4A 5I4IA 2VUUA 3TR0A 4C22A 3L9XA 3LUGA 4C0ZA 4RW0A 1G3IA 2E87A 1NUQA 3LECA 2Z09A 1NTOA 4URWR 3W2FA 4RVNA 1MNQA 2F6RA 1ORHA 2A33A 3PXAA 1PJAA 1PTJA 2IUEA 3C7TA 2V7XA 4ZOLA 5KUTA 3NGXA 4BJ6A 1OX4B 4P4SB 2OYSA 4KZPA 5CEFA 3V4SA 3IEXA 1GLGA 3CH6A 3P9SA 2B5OA 1KETA 4YRBA 4U7HA 3MWKA 4DSZA 3KT6A 3EEQA 4RTLA 3GLGA 5BV1A 1WCYA 5LB4A 3VV3A 7ABPA 1F6BA 3VHXB 3DBVO 3A6DA 4Z6CA 1VDZA 3ONEA 4H0FA 1LDYA 1L3CA 4YV7A 5I5GA 5FL7A 4F6CA 2F1KA 4MTLA 3QWFA 2WE7A 1U04A 3B38A 1GYPA 2JR5A 2WYIA 4Z2AA 2FJ0A 2G7ZA 3GB9A 3EY4A 2YIMA 1S2NA 7ICGA 3INGA 3GF4A 2X13A 1QP8A 5SYNA 2F8MA 3CE6A 1P4SA 3RTVA 5LMCA 4V2UA 5KVQA 1VDVA 3L0CA 3UXYA 4ZYLA 1TEHA 1E3IA 5F51A 3Q8MA 1ZIDA 2HDWA 4MW2A 2BMDA 4ETIA 3ASVA 4C4TA 5E6UA 2I2XB 2VEOA 2VIIA 1DJOA 2G70A 1FSSA 3DLTA 4CMGA 5DWVA 1R7RA 1TQ8A 4ZPXA 3TPCA 1FY2A 4BJ5A 4KVFA 3R8XA 5F76A 1RLOA 4MJ7A 4XCQA 2O1SA 1JJBA 3JALA 4E4YA 2IOHA 3QVKA 2V4UA 3PWKA 4MHSA 2BZFA 4UATA 1JFTA 1AGNA 1J33A 5JCXA 3LBYA 5FJJA 2QTFA 3Q3EA 3BD8A 2Q6VA 2WT9A 3HMKA 1TJYA 4DLXA 2XCQA 4UU0A 1X2IA 1NF9A 2EZ9A 1DIGA 2ZRKA 4JYMA 1IRXA 1VSVA 1LW7A 4JYAB 5HIMA 3E7WA 2J6BA 3FYSA 2V7TA 4YONB 1PUJA 4GI5A 4E70A 3WYDA 2IJGX 3QVJA 4UHCA 5LYJA 1X80A 5M34A 3V5NA 1Y1QA 1RI3A 1UK8A 4Z9BA 3KYCB 1UEXC 2J3EA 2IRWA 1T0JB 3HB1A 1W4RA 1PJSA 4R05A 1RXSA 1MTZA 4HX9A 1AU9A 1DUSA 2VYNA 3ASYA 4B3XA 4ER3A 4MDYA 2YQ5A 3JQFA 2XHZA 2BF4A 3LQRA 4F84A 2VP2A 1AKUA 3ZXIA 5J2KA 3SZ3A 3E9QA 2VJCA 4HH1A 2IX9A 2AW5A 1ILEA 4WY2A 1N77A 4Q05A 4R0NA 1Z37A 4GP7A 2FZLA 3EZ6A 3UJNA 4OJQA 3R6TA 3UEOA 5IASA 3MB8A 5KTKA 2Q3HA 2QZZA 3BWXA 2GJ9A 4DSIA 4D0NA 4QSHA 1AKVA 5TJ9A 4J2OA 1CERA 1VKJA 3JWEA 5J0SA 2BFPA 1UCFA 5SZHB 4Y9RA 3IQGX 3MHPA 3THYA 1NLUA 5FUBA 1QVRA 3SG0A 4EGAA 1P1KA 4YMOA 3D4IA 1CUXA 1LPAB 5JJ5A 3JWPA 2JLBA 4DBZA 4DR4B 5FUVA 3DONA 3PC6A 3I30X 3R41A 5TISU 4NCJA 3OOSA 1N33B 4PAOA 1Y1KE 4KI0A 4AZ3A 4EJSC 4HSEA 1ZONA 5AM1A 4DF3A 3OT5A 3JU3A 5EUQB 5KU7A 4FOOA 2VAMA 2ID9A 4NIMA 4HNAB 4MUKA 1Y3DE 2OV1A 3EXIB 5A4FS 2UVPA 3OE5A 3DBHA 4Z3KA 2IPXA 4L7QA 2QAGC 5I47A 1IN1A 1D0VA 1NYQA 1X6IA 4L6AA 2EGUA 4DUZB 2ZSJA 5FTLA 1ZVVA 3AVXA 3IE0A 2B30A 1R37A 1J2EA 1L4EA 5CGQB 4DNXA 5JRTA 4H7DA 1ZOSA 2FF7A 3OEYA 1L8OA 1MRZA 1X7YB 4LHXA 4G97A 1JSCA 3LE8A 1Z47A 1NI5A 5JDCA 2VQEB 4QTXA 5KFBA 3H0LB 3AUFA 4FZRA 5AVKA 5BVGB 1TM5E 3BXGA 1X9WA 4DA4A 2PUDA 4JLMA 5F23A 1ZG3A 2VNSA 3OE4A 5T41A 4Q47A 3MT7A 3WIEA 1Z88A 2V03A 3OAAA 1QQTA 1HZJA 3I64A 3I6ZA 4EKIA 2PZBA 3N28A 4P4GA 3NJRA 4XQGA 1OX4A 1R6TA 3CNLA 4D0LB 4KITB 2G9RA 4JZYA 4YRNA 3GQBB 5EZYB 4BVHA 5CFNA 3WJ7A 3LLVA 3VNUA 1PEYA 4QNLA 4X20A 3AP2A 1WMFA 3VI3B 4DR7B 2JZCA 2E2WA 5DBEX 1SXEA 4EUSA 5K3CA 2X5NA 4ECWA 1XYGA 4WX2B 3FOZA 1H8HA 5LU9A 3I92A 4WCFA 4B2PA 3D81A 1NP3A 1TMKA 2YRFA 4ZVOA 2XYHA 2BFEA 1H0KA 4UUNA 2F43A 1E1QA 5IM5A 1E4EA 2Q3BA 5LMZA 1KVQA 5JJLA 2HNBA 1NTRA 3RTCA 4HK4A 1T9BA 2ET6A 3ABQB 4O4IA 2HF8A 1I3KA 3ICCA 2D59A 1REQB 1B74A 5E4FA 5JZ9A 3UKOA 3N5KA 1LBIA 4MDFA 1DT5A 3RC9A 1GRRA 1W76A 3NDRA 3OSUA 2WHYA 3WL8A 2AQKA 2XITA 1BN7A 1D2CA 3RRMA 3LKDA 4TYYA 2E4ZA 1JWLA 1CJKC 1YU9A 2MSCB 2IYTA 4QECA 4TL8A 3WYAA 2XDQA 4J0FA 3RODA 1DLJA 1YRBA 4MPRA 2EG9A 5L1LA 1ADFA 3EWAA 2OCYC 2R5NA 2AOUB 4AULA 1KRPA 5DM1A 4TSFA 1NW4A 4DMRA 4PCAA 3WA6A 4KFTA 3T5DA 1QB7A 5B66U 3NHRA 2R85A 4HKTA 5IBRA 2B6HA 3DF9A 1THGA 4C8KA 1NJXA 5KFCA 4CMJA 3C7KA 2LBPA 5DU2A 1JHUA 1WCLA 1A1SA 5AM2A 2ENWA 4BCBA 1XZNA 2C96A 2VHJA 3R3XA 5FPQA 2WG2A 2R7MA 4PGGA 1T43A 3IP4B 2IY9A 1OUMA 2TMYA 4X95A 1A1VA 3TLKA 4O1IA 5ALTA 1I2MA 3N7AA 4TKUB 5KT3A 4OMDA 4C03A 1Z0UA 2UVWA 1RPLA 4P32A 4I28A 3QK7A 4E1BA 3O6VA 5B53A 4KSYA 3FWPA 1WY5A 2ASVA 3WSWA 3SYKA 4N9QA 3QFRA 3BQ9A 1IY2A 2GDZA 2PDAA 2C9YA 1FZTA 3GPIA 2H1HA 2HF2A 1CY7A 1QFYA 4RESA 1PL7A 1V5GA 4JITA 1ORIA 4GVXA 1DPFA 4ZU3A 1ZH6A 5IT4A 3LVVA 1T9GS 3RYHA 2NRZA 1OUQA 2TRSB 2B1IA 2VT2A 4MA0A 2NXJA 3W34A 3RSOA 1NXSA 5DX0A 5TX7A 2DSTA 3BVPA 2BELA 3NVYA 1CUKA 1NY6A 1A9XB 1UKEA 5ANRB 2OHOA 3G2NA 4EZ9A 3WDKA 5KVAA 4DN6A 3M9MB 3F7NA 3ZQKA 2JGNA 1NC3A 5KWEA 3E22B 1KGSA 2DPIA 3MBKA 5FCDA 4MDHA 1KE1A 3KPJA 3MT9A 4RHFA 2B1JA 2MOKA 5C4IA 1KEPA 4X7MA 1IU9A 1XQYA 4G1FA 5AVVA 4DLYA 2FZKA 1M66A 5BNTA 1PJBA 1QGUA 2QUHA 1ZUD1 2YN2A 1F8YA 5JUWA 4RYDA 4U02A 3HA2A 1P2DA 2OBYA 2XUQA 4Z8XA 1RADA 3E53A 1U4BA 3E7FA 3E9YA 2UYOA 4NNPA 4M8LA 4F3TA 1T3TA 2BJHA 5LXTB 3SQOA 1CDDA 1AV6A 1CCWA 3HVJA 4IDDA 4U5XA 2G09A 3PUYA 2CCJA 2VLIA 4OYHA 4RVFA 4RWEA 2HC9A 4AG6A 3M70A 2WWTA 2ZB7A 1I5RA 3ZCSA 4R9SA 3O7MA 5IKOA 1WETA 4ZDJA 1FU7A 4HAVA 2GJ8A 4DLUA 3Q3GE 5AKIA 4YRFA 4DQ0A 1Q0QA 2KJ9A 1WCXA 4QE3A 1N5IA 2CF6A 3BB1A 4MKZA 3KYDA 4L5YA 4NZYA 2HRRA 1WB6A 1ZLYA 5EL0A 5CH5A 4FFVA 3TB4A 3WL4A 1G5TA 3JQCA 1T3SA 1IJKA 2BZGA 4Q43A 1V7QA 2ZIVA 1P3JA 2X9GA 4E5YA 3V9AA 5KQRA 4D42A 2W00A 3HBFA 1Q7TA 1YZ6A 2ZREA 1RS0A 1N4AA 1ZD1A 3WYBA 3HZHA 4KG7A 5EGNA 3WTBA 3OJCA 4NBLA 1Z3IX 3FOFC 3E58A 2I9PA 4INAA 3KJFA 1WQ3A 1IXRA 1LX7A 3SMQA 1QF6A 3KLOA 4UEJA 2O5CA 2FCRA 4PAWA 1HEUA 4MZDA 1QLHA 1D4OA 2XWPA 2O8NA 1G5HA 1M5TA 3K1JA 4H1VA 1GN8A 1P1IA 1S2MA 5K8JB 1KYTA 1FFSA 4J07A 1SG9A 2PSFA 2FGJA 2XT9A 1C3OA 3KALA 4EJ0A 4TRNA 3HV2A 1UEJA 2DY1A 1U3TA 1X2BA 5FRDA 4YJGB 5CTJA 3OP4A 4N0PA 2W2QA 2GFIA 2QTAA 4F4WA 4JY7A 1Y6JA 1KAQA 4KVGA 4BJQA 4CMIA 4MYSA 1X0VA 3D6TB 2OYCA 3T0GA 2QGNA 4UASA 5TGTA 2HNKA 2FZVA 1NKEA 4JHXA 1OMOA 4QSMA 5DE3A 4TV9B 3C2QA 1JN0A 3EYWA 3W5BA 3SFTA 5NLLA 3A1VA 4M1QA 2I66A 1SL1A 3DE4X 5BNWA 1F06A 1H9BA 1AIPA 3S2ZA 1B00A 1QJ4A 5ICEA 4WY5A 2CLFB 4J9PA 2HHQA 3WISA 2EWMA 1VL2A 4LMAA 1C7JA 4FZNA 4KUGA 1BOOA 2CLMB 2BEUB 4EVIA 3KZVA 3EE6A 4LJYA 1U0JA 3ZE9A 1J22A 4FX5A 1RIFA 3Q3HA 4PBSA 2JJYA 1EQUA 1GDTA 2BKVA 4OI0A 2A6PA 4PHHA 2BCRA 4HNUA 2GN1A 1GITA 2F1HA 4HBZA 2AF4C 1T8PA 4IJWA 3ZIAA 2WM8A 2ZPAA 1SFRA 3ZDQA 3ZHYA 5DX8A 1V7ZA 2KZ3A 3MJEA 4FHFA 4BV8A 1G3QA 1I3CA 4NAHA 1LJ8A 3AR4A 2XMBA 1IM2A 2Q0QA 2ZRPA 3VR0A 2BMJA 4EFNA 4RHCA 2VZEA 4ZQCB 1KO1A 2OHHA 1UODA 4LJRA 5A3SA 1QP4A 3EUB2 3NDJA 1V3UA 4GE0A 1ZUWA 4IO1A 4DCPA 3EBOA 3MMSA 2BQ3A 4YUXA 1R15A 4EA9A 5EZSA 3P5BA 4UUMA 4NHEA 3NBXX 1TPZA 4M9ZA 1U0EA 1VHQA 4TKUA 2NX2A 2IXDA 1K66A 4CUJA 1E69A 1YVPA 3V1MA 3OA0A 4JB3A 3ZK7A 4EW3A 3VPCA 4W82A 4DY6A 1Q50A 2EIXA 1GPUA 4X1OA 1ZQBA 5EPUA 5BWOA 2WF5A 3MABA 3ZBTA 2HA0A 1NDUA 3WLOA 4UNPA 1QJCA 2C8JA 5K09A 4W7HA 1PVDA 2ISSD 4B4WA 3AP3A 5BQPA 4Y1FA 3UWMA 2P7IA 3D4LA 4MVJM 4FM9A 4R7TA 1S96A 2BOVA 5LQJA 2CHUA 2PLAA 5FA8A 2HJSA 4CG2A 4Z4HA 1YC5A 4CCSA 1OWLA 1L7QA 1NJWA 2IKQA 1KK2A 3OTOB 1E1LA 4X7RA 1AB6A 2QLNA 3I6BA 5HSGA 4FO6A 1XJ0A 3IVXA 3H9JA 4LE2A 2I4RA 5KSZA 3W2HA 4RY9A 5AXBA 2Z5LA 2QP4A 2YHBA 3F2IA 2PZLA 1II9A 3U3KA 2ECKA 5LYYA 4HXGA 4LVSA 2FSUA 3QP9A 4E5SA 2Y92A 2REQA 2GNPA 3PE4A 4JBIA 4MHVA 4RKYA 2W9CA 5E6SB 2C9MA 1HE8B 4IH9A 4IQWA 4DREA 4F93B 1X15A 1RYHA 2PKYX 2A1JB 5JXJA 3AVYA 1VL8A 4O25A 3PKIA 3BH7A 4HN4B 2OV3A 3ZJ5A 1O6GA 5CDGA 3RC8A 4J0EA 3QE3A 4G2NA 5ECYA 1R5NA 1PR9A 4LRTB 1Z13A 4H0CA 1O95C 3ZHRA 1F2UB 1JJAA 3QTLA 1R66A 3FROA 3OX4A 1GL7A 2P9QA 3CVWA 3KJHA 5DGHA 4TRJA 2PZAA 2CNWD 5BT8A 3A4IA 4Y6QA 2ZE6A 5DQHA 5JI2E 4FLMA 1N5XA 4LF7B 2P5UA 4EFDA 3VTFA 1S5LU 1IOVA 2PWZA 3BF8A 4N48A 2VHCA 4EMBA 3IM1A 4OFBA 3J81j 4L1KA 2XMSA 1O96B 2OV8A 2D00A 4II2A 2LXNA 4RV4A 2BH9A 2CCKA 5D46A 3EPPA 5CBKA 4N7MA 2Q7DA 2VJAA 4O4HA 1RWXA 4HWPA 4W9RA 1T5HX 2C00A 2AD1A 4GZ5A 1WDKA 4HFNA 3CMMA 3OU6A 1VIAA 2Z6QA 2Y67A 3ROXA 3OWXA 3RH6A 4C3ZA 1Z0SA 1EA5A 1AUOA 2ZBGA 4HI0E 1PUXA 2HSZA 1LKYB 3AVTA 5CLIA 1EE1A 4FX2A 1HYEA 5FO1A 2I7XA 4UQGA 3KB6A 3OEHD 2QRQA 1TYCA 3NV9A 1H1DA 2FY8A 3IIIA 3UQZA 2ERCA 5HRAA 4GE3A 1TB4A 3UFXB 1LKZA 3OPYB 3P20A 1Q2UA 5J4KA 4B46A 4B87A 2IYEA 4JKYA 4BO9A 4I5EA 4M1ZA 4EF6A 4UEOA 3O38A 2GWHA 1SB3C 4U6PA 4J9MA 1DVRA 5K51A 4UFPA 5J2AA 3KXKA 2B4AA 3DL7A 4Q3EA 2KJQA 3CZAA 3QZUA 5KFNA 2RK3A 2EXXA 4PSUA 2NG1A 4MEAA 4YK7A 1XEXA 1OC2A 5EZYF 2OGZA 4RQTA 1XU4A 4J1NA 4JXKA 4NZZA 3DAFA 2V45A 2GTHA 3JZIA 2JI4A 3FWHA 2BEUA 1KL9A 1A0OA 1V1JA 4GPZA 1CZLA 3SV4A 4J16C 3MELA 3ADKA 3QNUA 5JYDA 3BZWA 2WBLC 2X4IA 3MQ2A 1AKTA 3IQEA 1ZQHA 2X1LA 1CQPA 5M3BA 4URHA 2GCPA 3HJGA 1ZGBA 3B1ZA 4LQDA 1V95A 3Q12A 5HIKA 1XCPA 3JD3A 3A7EA 3KXLA 4OP2A 4B09A 4QOGA 3UT6A 4KXNA 1LBEA 1PWHA 2X4GA 2NZUG 5AKKA 3HB4X 4USAA 5CH3A 3EEOA 4LOHA 1QTQA 3HM2A 5E9JA 4DR6B 4WJKB 1T4CA 5BWNA 4WL0A 3ORFA 1O8CA 3UAXA 1ZITA 5IG2A 1RP7A 4I2IA 1HZZC 1QGED 4HB0A 4S12A 3TVDA 5DISB 2AEFA 4BE7B 2VBGA 3NDPA 1SBYA 1S4QA 4MLZA 2PNJA 2P9TA 3C28A 3PHCA 2JG3A 2V3CC 2ODQA 3LKVA 2A1AA 2XUHA 3N53A 3X1MA 3R44A 1TUGA 5JDIA 4QLBA 1JZTA 4Z54A 1BWRA 4PLCA 4NYIQ 1MW9X 4RLFA 5KNIA 1SWVA 1XMOB 3NRZA 3TR6A 2C97A 5P21A 1JROA 3KQNA 3EC1A 4ASUD 1YS2X 2D0IA 3P0JA 3QENA 3IXMA 1JFFB 4FFBB 1J2MA 1QZ3A 5KFDA 3L05A 2YXNA 3QE2A 3FETA 2GCOB 1JPVA 5LQCA 3RT7A 1W36B 3T4PA 4HX5A 3WX0A 3EJ6A 4BDTA 4DLGA 3UQ0A 3MAAC 3E9EA 3FCOA 1BQ3A 1HTWA 3FDZB 1NM5A 5FTJA 3FF1A 4F3YA 3KWMA 1GIAA 1I5OA 1N2EA 4BMXA 3GEBA 4YMTA 4V0MA 2XECA 4A0FA 3C6QA 4H6WA 5FTNA 1A9ZA 2ZXIA 2G04A 4AC9A 2RHBA 1W4BA 1WMSA 4U7PB 4OLAA 3UQYS 5LLTA 5J1TB 4IIHA 1WMAA 5HQTA 3DTVA 5AKGA 4G01B 2FUCA 1JIHA 1Y9AA 2RIPA 3D5TA 1GTG1 1YIOA 3DXXA 1NXWA 4HXYA 2JI9A 3KAQA 3TUZC 4RTPA 2NZYA 4QZGA 2GZAA 1VSBA 2QNRA 1TK2A 2ZXUA 3VTAA 4RPXA 1RYUA 3ZDAA 3IVMA 1RRKA 4D1YA 5BV8A 2DVMA 5JFGA 3GZ4A 5EQDA 2RHWA 4WY8A 3RYTC 4HZUB 1EMDA 4TT8A 1DTSA 1HTBA 2IL1A 4HDNB 1D2GA 4ZOQI 2ZSAA 3UJ8A 4DLBA 1NR1A 2C5GA 2DBZA 4UPVA 2DP4E 2W43A 1V2HE 1ZAYA 4I2FA 2IYOA 3B6JA 3H8WA 2I03A 1P0IA 5G1NA 4JK1A 5I7SA 5KREA 2VYCA 4X97A 4BC1A 5K0ZA 4KWIA 3WZMA 1C29B 3HV0A 4YXMA 4BYMA 5J5AA 3UK1A 2ORWA 2NLOA 2VJNA 4QHYA 5LXTF 1JDTA 3TACB 4EMSA 2ZSBA 5KINB 4URVR 1VRCA 5AW3A 2JCSA 1BH2A 1CRLA 1QHHA 4MRSA 1W47A 2JFPA 1Q21A 5T14A 1Q92A 2H16A 3X2EA 3KTFA 3V6LA 2V4RA 4GP9A 3OF2A 1TU3A 1J8VA 3TLYA 5FQNA 3G5UA 4MIOA 3X1DA 4J75A 3A1SA 3A1TA 3TTYA 1TYZA 3O0TA 5CAEB 1L7XA 1N2CA 1UDRA 1B0AA 1TMGE 2R4QA 1TDJA 1TIPA 3BBPA 3ZHUA 4R7ZA 4GR5A 1M0EA 5K3OA 4L5BA 1YJBA 3QKRA 1JDPA 4M46A 3VU8A 4P93A 3T99A 3MGAA 5FBHA 1OXXK 4B34A 1BEUB 1Z0FA 1FDSA 1M2OA 3NHAA 1C9JA 1CJCA 3U7RA 2ABWA 1MO6A 1JBQA 4JLKA 1EQAA 1JTVA 4HVCA 2O7QA 1J1IA 1MVLA 5EIBD 4ZOCA 3B3GA 2FW9A 1J9EA 1NK0A 3P52A 1JAHA 2P6MA 3EGXB 3ICWA 4I5DA 5ICSA 2AC2A 4IDPA 4GPIB 4AMGA 1FU4A 3DHNA 2AN9A 4WNYA 2RHRA 2WTXA 1BDBA 1A9QA 1D7OA 2MINB 1YHZA 5BMVA 1JPNA 3JQPA 3N8DA 3R3JA 2GLUA 2Z6AA 4P5DA 3WRYC 3CJQA 2GAAA 3HU1A 4QFMA 3PC7A 4M3NA 5JNSA 4B2LA 1DKQA 4NL9C 3ZI4A 2W8KA 4RD3A 4BTEA 3A2LA 2WV9A 2H51A 3WLJA 1RI4A 3JD1A 1VOTA 2J5QA 1OYYA 1BKDR 2R47A 3I1IA 4I4LA 5TMPA 4TV9F 5DBGA 4HDAA 4Z6DA 3WFJA 2D8CA 2G3YA 4DDHA 2VT7A 3BBLA 3HP4A 5HBRA 3RFTA 2FR1A 1K68A 1QGAA 2QVXX 4CVNA 1MABA 2JFBA 5A1TA 1JEQA 2INGX 2I5PO 3W1WA 3OJWA 3HWSA 5E3JA 5A06A 5I4CA 4TWBA 2Q2VA 3RPEA 2MYNA 2Z8YM 3AHFA 5IIOA 2EQ5A 2P0EA 4D81A 2YRXA 1E1NA 3BS4A 1XN4A 1MPXA 1B8PA 1Y3IA 1G8YA 2GCOA 2DUNA 3ZZ1A 4MCHA 2WHRA 2FG7C 4TLLB 1F1BA 3DFKA 2VJYA 2O2CA 4FFPA 1L9XA 1A8QA 2GF2A 1HYHA 2WWVD 3N0TA 3VHRA 1JHOA 3EVEA 3W4KA 3S27A 5KNCD 5EHNA 3MCTA 4LJ9A 2B1GA 4INJA 4G26A 3M8SA 2ZVJA 4N0MA 1NC1A 3RSQA 3PHJA 3PVSA 2CE2X 3FCSB 1RWVA 2NACA 4CDGA 2ZIZA 3AIOA 1XAGA 3QXHA 3ZV7A 4PO9A 5ILGA 1JJVA 1QX4A 5FKJA 3SHOA 1RJWA 1G66A 4RS3A 3IMKA 3MXTA 5LDGA 2LUOA 4AJEA 3AY6A 5JMOA 3N2NA 2R8XA 1ZBDA 4ZXFA 4FDVA 1M2GA 3N4MB 1VZ3A 5T3YA 5A1JA 5KQLA 3IP8A 4GM0A 2WFAA 3I5XA 3BQ2A 1PWXA 2V59A 2FH5B 4NMLA 1KY5A 5J43A 3MCZA 3HZOA 3KQYA 1TAQA 1QK3A 4ALKA 2GBLA 5ALHA 8ICWA 2XB8A 1TJNA 1DEOA 1EP2B 2ONYA 2JKZA 1N63A 2D3WA 2NVOA 1HPLA 1V5IA 5DQIA 4MJLA 3H0KA 1IZ9A 2NNLD 2QXYA 3VTZA 1SKBA 2ZBQA 4RPIA 4U2CA 2DMRA 4Q7KA 5EGSA 1D6JA 1T8YA 5BW8A 4IDEA 3INNA 1ENZA 3M1IA 2WUFA 2N3ZA 4PHEA 3A1UA 4J0GA 5L1IA 4AF6A 3U81A 5CVTA 2WG0A 4Q3AA 4DMFA 3M6ZA 1VJ5A 3L4PA 2CXTA 3T9CA 3H0RB 3OFSA 3RJGA 4YCAA 4EKGA 5FWAA 1ZM7A 5GOTA 4MUNA 4A2WA 2XUAA 2OP1A 3DKRA 1JWBB 4NCNA 4OH7A 4I29A 2J6IA 3TWOA 5CB4F 4J1TA 2BKXA 4PPFA 1NLZA 3CPJB 3SS8A 1L5KA 1NRJB 3GIJA 3K9QO 1Z6AA 1WNTA 4FU0A 5JAIA 4IICA 2R8GA 4I81A 4AYTA 4ITVA 3KKLA 1RM0A 5B3JA 2PL9A 1VBNA 3FHTA 3UWKA 3B52X 3O1JC 3M33A 3P71T 1X42A 5HK8A 5JQGB 1IN4A 3TYXA 2J0VA 5IW8A 1G5IA 1XEWX 3QLVC 2QVBA 4Y2QA 4QPDA 3S5UA 4FTWA 4D8VA 5BO5A 2Y2UA 2JGJA 2BTQB 2PMZC 3CZPA 3T1TA 1YZTA 4KKVA 2WICA 2NUPB 1YI8A 2BJVA 4B6SA 5EIFA 4CQMD 1CWUA 5EFZA 2H1OA 3LXXA 2B7CA 2YWHA 1BPBA 3PRHA 2CMFA 1OH8A 3NAMA 5LBUA 2GEDA 1NJZA 4OM7A 4H3KB 1SV0A 4KQXA 1K7FB 3AY3A 4MVJP 5KNLA 2PZGA 2FXIA 3BJIC 4QU5A 4E3ZA 5B58T 1V45E 3V4RA 4XSGA 1COKA 2PZFA 1LNQA 1VHDA 3T7AA 4F5NA 3NQ41 1V11A 3SSNA 2MINA 4C5BA 1VSQA 1U5BA 8ICZA 1TCCA 3QEJA 4M9CA 3HXTA 1H2BA 1NMXA 3V1KA 1E0SA 5I9LA 4DUPA 1K1SA 2SCUB 3UPTA 2G1KA 5A4JA 3L6OO 4IGKA 2PFSA 3E0FA 2IODA 1F48A 4CMAA 3DW3X 4ZMSA 3S1AA 2QX8A 4OY3A 3TFOA 3ZV6A 1VLBA 4LJ4A 1EHCA 4WOJA 3TDMA 4C80A 3V4ZA 1LNSA 5KNDA 2VUSA 1UDCA 4OJYA 1V16A 3ZOZA 2WHEA 1DBRA 4N4AA 1L1RA 3MEQA 1ODSA 1E2EA 3RS4A 2JFUA 3BS7A 1EFDN 2ZI9A 1D03A 1GU7A 1XFDA 3T94A 3A1CA 2GF0A 2JLYA 4HUQB 2I87A 2HB6A 1T9GR 5FADA 1BQ4A 1E9SA 3NTQA 4MWTA 1VE5A 3DZ8A 1SZCA 5JWOA 3AC0A 1MN6A 3IB6A 1S1CA 2C7OA 1A95A 3W6ZA 4ZJYA 8ICBA 3QLEA 4IX9A 3KPWA 4I46A 5EWGA 7ICQA 4MI6A 3C3EA 3W2EA 3LPDA 2XYPA 4RHUA 4FFRA 1K9VF 3T9EA 1ORRA 3ANTA 1QVVA 1Z6GA 1HOTA 1KJQA 5JMTA 2YFQA 2FMQA 3RBVA 2GCIA 3ETRA 2ATIA