3CNHA

Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
200
Chain Sequence
GMTIKALFWDIGGVLLTNGWDREQRADVAQRFGLDTDDFTERHRLAAPELELGRMTLAEYLEQVVFYQPRDFTPEDFRAVMEEQSQPRPEVLALARDLGQRYRMYSLNNEGRDLNEYRIRTFGLGEFLLAFFTSSALGVMKPNPAMYRLGLTLAQVRPEEAVMVDDRLQNVQAARAVGMHAVQCVDAAQLREELAALGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (NP_295428.1) from Deinococcus radiodurans at 1.66 A resolution
rcsb
source organism Deinococcus radiodurans r1
molecule tags Hydrolase
molecule keywords Hydrolase family protein
total genus 73
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3cnhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cnhA01
1ZOLA 3EWIA 5AI6A 3QXGA 2WF5A 5AI0A 3NASA 3OCYA 5AVZA 2G08A 5ALKA 3L8GA 2B82A 4EX6A 4J2TA 2BDUA 2GHQA 3WKAA 1WR8A 4NV0A 3D6JA 4Y2VA 5AI8A 2B8JA 5ALNA 5AKGA 5AVSA 4BBJA 3FZQA 3WK8A 1U7PA 2OM6A 1RQLA 4NAVA 3NANA 2YJ3A 3U13A 4I9GA 1T5SA 4YCLA 5AW0A 5AIAA 2GO7A 1IWOA 3NUQA 5AVWA 3WK7A 2FUEA 5AVRA 2AUTA 1XPJA 3QU2A 3PGVA 3A1EA 5ALLA 3S6JA 4CNQA 5AI4A 2WFAA 4L6CA 3SKYA 3SD7A 3UMCA 4XOUA 4ZEWA 4HGNA 1ZRMA 3U7FB 4YCNA 2QLTA 3L0YA 4PNHA 5ALTA 4QJBA 4CF3A 3PCTA 2WF6A 5AHXA 1RPZA 4KNWA 3GYGA 1S2OA 5AVQA 1L8OA 1K1EA 3UMBA 2FPSA 3AR7A 1L8LA 5AK6A 4YCMA 2HEGA 5AM4A 1CQZA 4Y2QA 3QLEA 5AM5A 2C9MA 1Z4MA 3I1YA 5AK4A 3QUCA 1Y8AA 2HO4A 3AR2A 4UW9A 3MC1A 1TE2A 3KD3A 5ALEA 4UM7A 4B6JA 4JB3A 1U7OA 1Q92A 4BEVA 2DQSA 3QU5A 1RLTA 2WM8A 2R8EA 2NO4A 4UAUA 4CF4A 2YMPA 2HF2A 3PGLA 2R8YA 1ZD5A 2EATA 1QQ7A 4IFTA 5ALIA 4Y2PA 4DFDA 1YJ5A 3ZI4A 1VFPA 1Z4IA 1YDFA 4JDPA 5AKEA 5FP0A 3QUBA 2ZG6A 2MU2A 3WK9A 2CFSA 1RC8A 2I34A 4ZEXA 3FM9A 3WGVA 4NWIA 3P96A 3SHQA 2YMMA 4AS2A 5ALOA 4GXTA 4HAIA 3VAYA 3SMVA 2YBDA 3N5KA 2C4NA 2GHTA 3ZVLA 4UMEA 3WK6A 1TJ5A 3RFUA 5A3SA 2P69A 1RQNA 1J8DA 4MUMA 2HI0A 5AVUA 1EK2A 5ALVA 3BA6A 3AR8A 3AR3A 4G9BA 2YJ5A 5AKJA 5AICA 2GMWA 2PR7A 2FPXA 3OCXA 1L7MA 1Z4PX 2YJ4A 4CF5A 2CN1A 4Y2TA 3L7YA 3L8EA 5AI9A 2PKEA 3ZWKA 3ZVNA 3ZX5A 5T41A 3M9LA 5AK5A 3ED5A 5JJBA 2I33A 5AW1A 3MN1A 2AMYA 2FPRA 1U02A 1YNSA 4ZEVA 3QX7A 4EENA 1WVIA 3SF0A 1PW5A 3KOOA 4RETA 4FE3A 2B8EA 3CZ4A 2OA0A 5ALRA 1YS9A 3QU4A 4MWOA 2C8KA 1VJ5A 1Z4OA 3IB6A 3U7HB 4CE6A 2JAWA 1SWWA 2IYEA 3E58A 5ALMA 4AS3A 2IOFK 5ALQA 4UATA 2P27A 1Q91A 3ZX4A 5ALHA 5AW5A 5ALWA 2RAVA 1AQ6A 3QNMA 1QYIA 2FDRA 1SU4A 1Z4QA 3R9KA 3B9RA 3L5KA 1TJ3A 2EARA 3HLTA 1RMTA 3K1ZA 3OCVA 3EF0A 3AR6A 5AIBA 4E88A 3ZU6A 4KYTA 5AKHA 2WF8A 5ALXA 3WKEA 4BX2A 3ZVMA 1NF2A 2JAOA 1U2SA 4GIBA 2GFHA 4XQ0A 1Z4NA 2Q4TA 1CR6A 3WK5A 4G63A 5ALDA 3DDHA 2FUCA 4DCCA 2C88A 2HCFA 4EX7A 2YN4A 4FYPA 2W11A 1QQ5A 3N8GA 3N1UA 4HGRA 4L6AA 4F71A 1RMYA 1RLOA 3W5DA 5AM2A 1ZD3A 2B30A 2CFTA 1ZD4A 3QU9A 4RESA 2BDEA 5A3QA 2D2VA 2RARA 3I76A 3PDWA 1N9KA 2AGVA 3U7GA 5AI5A 4KNVA 5AKZA 3ZTYA 2Q4RA 4Y2XA 3OCZA 3I28A 1EK1A 5AKYA 1F5SA 4KX5A 5ALGA 2G80A 4YH1A 4HGQA 2WHEA 3BWVA 3ZWDA 3OPXA 4BKMA 1LVHA 1KYTA 4DW8A 2ZXEA 1YMQA 3QYPA 3WKBA 5AW2A 2B1QA 4HGOA 2ZBGA 1TA0A 4KX3A 1WZCA 2B0CA 4OFZA 1T9ZA 4Y2UA 4YIHA 3QU7A 5AW4A 3RF6A 2ZBEA 2IOHA 1RLMA 1T5TA 5ALFA 1XVIA 3DNPA 1O08A 1MH9A 3UM9A 1L7NA 1RKUA 4DWOA 4BX3A 3ET5A 1N8NA 3SKXA 3FPSA 2C8LA 2YY6A 1NRWA 1TJ4A 4AP9A 4C4SA 3DV9A 3KC2A 2JARA 4NFLA 5AVVA 1ZD2P 3L0BA 2FEAA 4Y2SA 2MU1A 3OTQA 4OCZA 2ODAA 3UMGA 2BY4A 4OHFA 2HX1A 4I9FA 2ZOSA 1X42A 3U26A 2I55A 3WKDA 2FPWA 3E81A 4UMVA 5ALSA 4H1WA 2QYHA 4HGPA 4UARA 3TLMA 1WPGA 5ALJA 3NIWA 5AW9A 4KN8A 4QQFA 2I6XA 1SWVA 1J97A 3IJ5A 3DAOA 1Z5GA 5AW7A 3ZUPA 3B8EA 1RDFA 4Y2RA 2YJ6A 2G0AA 5AM3A 2YMQA 5ALUA 3A1DA 5AM1A 2ZBDA 1QH9A 2AH5A 3W5AA 2NYVA 4EZEA 3FPBA 3L1VA 4XPZA 1QQ6A 3OCWA 2EAUA 3WKCA 3MMZA 2HDOA 1Z4KA 2RB5A 2I7DA 5ALZA 5AESA 1FEZA 2OYCA 1NNLA 1VJRA 5AKXA 4UASA 2FI1A 4BNDB 1XP5A 2RBKA 3KBBA 2HF7A 5AVTA 1JUDA 2G06A 4XE5A 5IS2A 4C4RA 3J7TA 4EEKA 3KZXA 3B9BA 2I54A 3AR9A 3ET4A 3L1UA 3U7EB 4NABA 4Y2JA 3N07A 2G09A 4EELA 2B1RA 3W5BA 2VKQA 1YV9A 4BYGA 4UMFA 3ZW7A 2JAUA 1ZJJA 4C4TA 1Z4JA 4Y2YA 3CNHA 1RKQA 3A1CA 2YFYA 5AKIA 3E84A 3R09A 4UU1A 2W4MA 3FVVA 4Y3UA 4BNDA 4F72A 2OBBA 3WGUA 4UU0A 2YMLA 2X4DA 3L8FA 2O9JA 2HHLA 3A3YA 5ALYA 2HSZA 3ESQA 3NALA 3L0CA 5AK3A 2NO5A 2P9JA 5AKLA 3M1YA 1L6RA 1ZS9A 3I6BA 3ESRA 5AW6A 4O8CA 1U2TA 2PQ0A 5AKKA 4BX0A 2CFRA 2W43A 3NRJA 1L7OA 4UM5A 3EPRA 2R8ZA 2WF7A 3QGMA 1RMQA 4BEWA 4FFDA 3KDPA 3N28A 2WF9A 1LTQA 2Q5EA 4HYTA 3OCUA 2R8XA 3E8MA 4UAVA 3QUQA 2MSNA 4J03A 3MPOA 5E0OA 3U19A 3AR4A 4IG4A 3W5CA 2P11A 3F9RA 4OD0A 4UMDA 5IT0A 1O03A 5IT4A 3ZTWA 4YIKA 1Z88A 3WK4A 4YGYA 5AVYA 3QUTA 3NAMA 5A3RA 3ONNA 3IRUA 3SLRA 3L8HA 2O2XA 2HOQA 5AVXA 5ALPA 5AW8A 2FPUA 5AM0A 4L57A 3HYCA 2ZBFA 2IOFA 2IA5A 1ZRNA 1S8OA 2JGAA 3FGOA 1RKVA 1Z4LA 2G1AA 1Z5UA 3EF1A 5AW3A 3AR5A 1L7PA 1RRCA 2G07A 3R4CA
chains in the Genus database with same CATH superfamily
1JG2A 2BCRA 1TEHA 4PHEA 1OFGA 2A1AA 1YBAA 3GBSA 3IVRA 4QUAA 4TLAA 5IARA 4HNUA 2JD0A 1OI2A 3R3UA 3UAYA 3DMTC 1PVOA 4MV7A 1FB5A 1E3MA 4O2AB 4JX8A 3VV3A 1DEKA 1G5QA 2WD8A 4P92A 5AHWA 4ZXPA 4MFCA 1E5TA 1BIFA 3IUEA 4F9GA 4C21A 5IEJA 4MW1A 4C7KA 3T5KA 2EG5A 2LW7A 3DF9A 3L7NA 3WHKA 1W1UA 2R18A 1QDLB 3QLVC 5LQRA 3PPXA 1PVPA 3LAWA 4YTEA 1XVTA 2HJGA 1M75A 5K05A 4ED3A 4J9SA 1U0GA 2X7JA 1MORA 3OM1A 4LDNA 1LLFA 2FG6C 3FHJA 4YXWD 1GJRA 2JK0A 2ZWMA 4V3BA 3I4FA 3CM0A 4GI3A 2OVBA 1Z0UA 2DTEA 4FKZA 1IPHA 4LYGA 5DLFA 4MI3A 3VTZA 3KKEA 4PG6A 3QMPA 1OU0A 1NKSA 1RG6A 3IEUA 4UAGA 2EJTA 2XBLA 3I9MA 2HJHA 3KB6A 3QJ5A 2Q7OE 3VC1A 3JWGA 1X6IA 5C8YB 5K8LA 2IXBA 1ZL2A 4MI1A 2IEYA 1ZK3A 3SQDA 4EUEA 1T43A 2FHPA 2JRLA 1CQIA 1Y1QA 2WMYA 3H11A 3PZRA 4IQ4A 2QBYA 1E6WA 4XD2A 1SHLA 2J31A 2O0HA 4OQYA 5ALTA 3E27A 3SF8A 1SCDA 2N47A 3U4MA 3NXSA 3T7CA 1UA0A 1L8OA 1CY0A 1N0VC 1GPMA 1OYOA 3ZD8A 3H1BA 1OV6A 3NC1C 4GPTA 4Y0NA 3AF4A 3LXUX 2FLKA 4YROA 2IZ5A 3NIGB 1AZSC 3NV9A 1C8KA 3PEVA 4JBHA 4MGEA 4DWIA 4OL0A 3SSNA 1IOVA 4FYKA 5SYAA 3QLEA 1LFDB 2A1JA 2ZJ7A 3HFJA 4NCHA 8GPBA 4YCDA 3G85A 3P2JA 5CCBA 4ZQCB 1VP3A 4CMEC 4Z4HA 1S4QA 4HFMA 1N8SA 2DFTA 5F4ZA 4F11A 4JB3A 1U7OA 2G88A 2GNAA 2PYIA 2ZB8A 2PU5A 2WUFA 3HR7A 2Z5LA 2ZI4A 3CRNA 4RQTA 3GDXA 1D8AA 1W4AA 3DFZA 2R79A 3EEIA 3DL4A 2X7XA 4E12A 1BPDA 3W9YA 3PDHA 1AS3A 5TEVA 3ZWMA 1D09A 4MVJP 2H06A 4B6SA 3MUOA 1LSJA 1GTL1 3GAZA 3NGXA 1YZ7A 5DB7A 3PGKA 4F5RA 1KSHA 4BBAA 1Y6FA 3C4JA 3DKVA 3D2BA 1Z5NA 3VNRA 1AJEA 4ZQHA 1W8DA 4KE8A 1P2UA 3UUFA 1EI9A 3HC7A 4QOEA 4DT1B 1A04A 5D4BA 1NZFA 3KU4A 2GNPA 1PV1A 4KRFA 1Z74A 3VAAA 2O59A 5FP0A 3DMFA 5JISA 5BSUA 3S8MA 3SVLA 3A7EA 3TUIC 4PSKA 5BYJA 3AF6A 3FB1A 2P4HX 3R5HA 4EUKA 2HDHA 2E4AA 1USGA 4F8RA 1BQEA 1Z15A 2D7DA 3V4ZA 4N5NA 1OXXK 5KL8B 2K8BB 4L73A 3PDJA 3LZ6A 2XTJA 2IBTA 2FKAA 1UBKS 2QTBA 3D0OA 4MVJD 4KXWA 4ND4A 5DIFA 4GFDA 5F1YA 4AS2A 4CIXA 2F43B 2KJQA 4JAVC 1JIUA 4KW7A 2GN0A 1AQLA 3I83A 2AHRA 4FILA 4YMGA 4O3QA 3ILVA 1US8B 2GZDA 3KR1A 1CJCA 1SOAA 3LC0A 1HT1E 4PYQA 3BHJA 3D2NA 1FDTA 2ZTUA 3KTDA 8ICWA 3WYAA 4EHAA 3GJYA 4LYJA 4EJ2A 4DDVA 2PSSA 2UUCB 3LHFA 3M6LA 1EZ4A 1TZBA 1ISMA 2VK8A 2ZTSA 5GONA 1Z5WA 1MG0A 4B3FX 5K0BA 1KOGA 5JPCA 1DX4A 1AQIA 4OP2A 5DISB 3FLMA 5TXGA 3BKXA 5JC1A 4TV9B 5KSYA 2HHCA 2A0XA 2OC4A 3QF4B 5EMLA 4PYRA 1N75A 1NYQA 1YRBA 1DQSA 3HY6A 1VKOA 3IQGX 4MVJF 2JLXA 5C8DA 5JNLA 5CDUA 2ZTEA 2YB4A 2V3VA 1X7DA 2GXAA 4OSPA 4BX8A 5AJYA 3FYSA 1UOOA 1WHTB 1L7MA 4OOEA 3TI9A 4OQLA 1CFJA 1CYDA 1KDVA 4G0UA 1KRWA 4O6VA 5FOUA 3B3AA 2C3MA 2ZUDA 4AO7A 2HSJA 4C14A 4RDXA 5T41A 4NL9A 1YS1X 2G5PA 4EYOA 3TQOA 1ZXLA 3FBTA 3IP6A 3ZQKA 1PJZA 1JR3D 3KUDA 2R5NA 4ZEVA 3LJKA 2O8DA 1UWVA 5KFTA 4R1PA 4B47A 2KD1A 3IPAA 2PSDA 3R5XA 5FNZA 5HJ5A 4W5WA 1IHYA 1NYLA 1PX2A 2A9VA 5IC5A 4XEUA 1L5MA 1IULA 4RXTA 1BHO1 2BQRA 2LV8A 7ICJA 3EPKA 4ZV7A 3QWFA 4PG5A 2E7ZA 3VH3A 3SEIA 3TF5A 1P2SA 3BGVA 2W37A 4JVNA 4B3DA 4ZCMA 2B8EA 1EUQA 1TQHA 2ZRHA 4ALLA 7ICLA 2BJHA 4RQBA 4JVMA 2A94A 4GECA 5J58A 1VJ5A 1NZBA 1OX5A 3QOFA 3EEOA 1AKWA 1SXJB 4XIGS 4PGAA 4D6YA 4ME6A 1SWWA 3TPFA 1SPXA 1XAHA 4G85A 4O4LA 5ARBA 3MFHA 4Q9HA 1S3IA 5ICEA 4JWKA 2QW8A 4FPXA 1Q91A 1DBSA 1T7PA 5DYGA 4CLRA 3WE7A 1AY0A 4C4YA 2PA3A 1CFZA 1WF3A 3AETA 3KXPA 4P4NA 1NBOA 4UCXA 4F84A 1YB4A 1F8XA 1KY2A 2W7OA 1QHXA 3IPCA 2Q3LA 4G0QA 4KSCA 3A1SA 2Q3BA 4GVXA 5JLAA 3RC9A 1BU5A 2VQ3A 2RP5A 3JALB 3OD1A 3Q3GE 1U6IA 5J2TF 3Q8SB 2QX4A 3EC2A 3HGMA 3AR6A 3RARA 3UA3A 1RRVA 4AK9A 1CE8A 4O3NA 3M4YA 1QE3A 1X80A 2IYUA 3JPTA 3RR2A 2F3UA 3A3NA 4US1R 7ADHA 1E0DA 4E2WA 2NSLA 2EIHA 3QELA 4KE9A 4DQUA 2I6TA 4FDUA 3RB4A 1EEXB 2DKZA 2CWDA 4EPXA 2NV0A 2Q4TA 1T2EA 2O50A 2Z2KA 3TIIA 4C89A 5FQNA 5FBWB 1L7XA 5TMPA 1FBNA 1XD2A 4LG1A 4G63A 1ULBA 4YRDA 5AQ1A 4JASB 4CV1A 4UB6U 4QDTA 3DDHA 5CEHA 1W0JA 1ZZGA 1VGQA 3I4CA 1JA0A 1VA5A 1XTJA 1HBJA 2NADA 5KX5F 3X43A 2UUBB 4J9MA 2W11A 1JLSA 2Z6AA 1Z33A 3B6KA 4HQKA 5BSTA 4DLKA 4U2CA 4PLHA 2GJ8A 1P72A 3IPLA 3D7KA 3K32A 4MWCA 4MRRA 5F21A 4CDMA 1QZTA 4DCMA 1ZD3A 2QB1A 2QSZA 3PNPA 2EWMA 1VL0A 4GU5A 1O0CA 1LSOA 2H0QA 5EP4A 2JJYA 4ILEA 2IIQA 4Q7MB 4WH0A 5K3FA 5J47A 1J8FA 2FZ5A 1JHYA 4ZRMA 4ALMA 4LJRA 3LQ1A 1KJJA 3IEIA 6YASA 3GGOA 3TS1A 2K2QB 3TCNA 5BOSB 5BN1A 4QRIA 1OWNA 3EGCA 1KWGA 1I51A 5DK4A 4OHYA 2RCNA 3L4SO 2CUKA 1CERA 4GHWA 1XJCA 2QD1A 4JVSB 1K5OA 3I28A 4HCJA 1LTKA 1VBNA 4V0ME 1MGPA 5DGHA 5CVUA 3KVRA 1LDEA 1SA0A 2C0CA 4CL0A 1LPMA 2DG2A 4B0PA 2F55A 3K4QA 3X1XA 2B6GA 4YG2A 1D5WA 2JPDA 5KHLB 4DV4B 1O4WA 4IRDA 4J1TA 1JLLB 1NL3A 5ABPA 3LVVA 1HL3A 4JKOA 1G6Q1 1KQPA 1YMQA 4K26A 4RMJA 1WNTA 2ISQA 2B1QA 2P0YA 3SVZA 1ZXBA 4J16A 2FWPA 3SR0A 3QHPA 2FLWA 5DPMA 2A5JA 1M2KA 1R18A 3JWIA 4PN7A 4JSYA 2PMBA 4NPCA 1N2IA 1I4EB 4M4SA 4WASA 5FOTA 3TD2A 4UCFA 1T9ZA 3H5OA 4I3GA 4IIJF 2DSNA 1Y3AA 1NP7A 3WLRA 4H1TA 4ZI5A 5HHTA 4XUDA 2YV2A 3HBJA 3MS2A 4RTSA 4AQDA 4WZBE 1A9YA 2DE0X 2GF0A 1GKKA 1E92A 1FXSA 2IKSA 3ETNA 3D8BA 1ZSNA 2JFNA 2EJVA 1TVKA 4ZTBA 3AEZA 5G4KB 1L7NA 3MAAC 4Q39A 4FB4A 2FK7A 5DJ5A 2PMZF 5KOJB 1ZGJA 1IE3A 3D3QA 4JV5B 3C3BA 4OQXA 3HP6A 2OENG 4F5ZA 1NMXA 1YK1A 3NKFA 3UUEA 2WWTA 1JRPA 2EZ8A 3UXOA 1UKVY 4LUCA 5B1SA 3TTSA 3MS7A 3KAPA 2ZIWB 3PL1A 1XTVA 2TRSB 4DJAA 4TRNA 1K4MA 1UK8A 2P3OA 4H3VA 1TC2A 4X0EA 1KVQA 2OV3A 2WKWA 2M9MA 3KQOA 3RVDA 5CFMA 3U61B 1NC3A 1SKQA 1YVDA 2D6FC 1KVRA 1PQYA 1NPYA 2ZIUA 1NVKA 2YW2A 1CKEA 3HN7A 4RQMA 3Q3HA 3FCCA 3E81A 5FL7D 5K0TA 4XB6B 5B57C 3IE2A 4NONA 5FWXA 3VVBA 4UARA 4KYIB 4R1SA 1L5OA 4MAMA 5IAJA 5ALJA 3A6HA 4QUBA 1XXLA 4UB3A 3HI6A 2Q6IA 1O6ZA 2CCGA 2GUGA 4NFYA 3RHFA 3IHQB 4EEXA 4XUEA 4URUR 4PRLA 3PC8C 2IEDA 5AYVA 1U1CA 1KJWA 2O0JA 3WFZA 1R4NB 3DXYA 4LXIA 4QOFA 2C3UA 4KLQA 1TD9A 3ZIDA 2EBWA 3LUKA 3O4IA 3EK2A 5CA0B 2QORA 5DLGA 1TLTA 1VJ0A 3JRNA 1KWKA 3ZC3A 4GPZA 5ALUA 5CBKA 2WSIA 3A1DA 3NFRA 3L9WA 5A5EA 3WRYC 4PG4A 1Y7LA 3ENVA 1YDHA 5HG0A 3W5AA 3W9SA 5LYJB 1N0IA 1SM4A 1R8XA 1JEYA 2KSOB 5LR6A 4UNIA 3TXAA 3FPBA 4NPHA 1LI4A 1DWUA 1X38A 4Z7QB 3PQ6A 5AUOB 5CG2A 2G9VA 2C77A 3EARA 2PUJA 4NMHA 1QIDA 5SY6A 3G7UA 4WFKA 2PKXA 4RD4A 3H9QA 5CFNA 3T1TA 3A11A 4ZGBA 4N03A 4RO0A 2EZTA 1ZU5A 2OYCA 1RVV1 5DE3A 1R3UA 1FDVA 1NSTA 1T3HA 1U65A 1C7QA 3BDIA 3NHKA 4YDQA 3IAUA 4OJ5A 2VJBA 4BFWA 4IH4A 3FGZA 4YRPA 1M2WA 3DE4X 1U2DC 1ZPDA 2ACVA 2R96A 4O4LF 3NBAA 3QKTA 4YNBA 3VO2A 4JIGA 1DC7A 8ICHA 1A9OA 1CUGA 1N78A 5HHIA 1Z83A 3IBYA 4FZJA 2PI5A 1HDXA 2EP7A 3GIWA 2ASEA 4MYRA 1Q7RA 2ONYA 5DT9A 3V6LA 4D26A 2P66A 4KQEA 1X86B 3EXIA 3PYMA 3ICXA 4HZGA 4KO2S 2JLZA 4ZT5A 4DIBA 3OHSX 3GX1A 4I2AA 2WHPB 3MCAA 4YALA 1FFEA 1Q0TA 1J8MF 1HFWA 4L27A 5CXSA 4I6JA 5K6AC 1N62A 1CEXA 3ZWWA 2QWXA 5CEEA 3KTQA 3BXFA 4JY7A 3ZZUA 4H6VA 1GGKA 2B6HA 4OXXA 4KR2A 2WTFA 4KOAA 3U3MA 4JMLA 4JT2A 3AIIA 3TYXA 4A6DA 2X5NA 4W63A 3HU3A 2X0FA 2Y0SF 4OMUA 5HKAA 3NT5A 4A0RA 4ZN6A 1Y9DA 1PAUA 9ICNA 2QN8A 1PFGA 1S2GA 1FYDA 1N6RA 2ZFUA 3AFGA 1LJLA 3DKKA 3FETA 4KQ1A 3G2LA 2QQEA 3ISBA 1N5RA 4I19A 2W70A 2HHLA 3DDNA 2ZBQA 4X3PA 5IULC 5ALYA 1AK9A 2MSDB 3UOGA 3MJRA 4QDKA 4K9QA 3MCVA 1M2VB 3AXSA 4KDRA 4D9FA 4RQ1A 3VYSB 1FFAA 4RMGA 4RUAA 1ZS9A 3HP4A 3LVWA 4X3CA 4M0KA 4DC0A 5HKKD 1F7UA 3BJZA 5AW6A 1BHSA 1PZNA 1JA9A 1XTIA 3BERA 4K8RB 2DVMA 4BP8A 5L3QB 1VHJA 5HP4A 4H6PA 5LKRA 1R4AA 2C61A 3ABQB 3V7FA 5IKXA 2H2HA 4R8KA 3K35A 5SV2A 3IDWA 3GUVA 3IQEA 5KCZA 1EP9A 3KPUA 2C22A 4IQWA 2PGLA 3GEDA 2QT0A 4NAHA 2GCOA 4AZ3A 3NPAA 2RGWA 4J9PA 5JASA 1DO8A 3H4BA 4A8JA 1C0EA 3QE3A 2Q5EA 3WNBA 1Q44A 4D8UA 1Y1TA 3AHFA 4WBNF 1TZKA 4AY6A 3RCBA 2X5KO 1CDZA 3JXEA 1I0LA 1KU0A 3OQVA 4J4BA 3HXOA 2ZSDA 3SZOA 2Q0HA 1OWMA 1Y8QA 3TVTA 3V3TA 4ZIRA 1VL5A 5DSTA 5EZ6B 1HDCA 3AR4A 4HB4A 4DA8A 5CDYA 5M04A 3QX3A 1XHFA 4YP3A 3E22B 1LPAB 3IUYA 4P3OA 1ZD1A 3A4MA 2JZCA 3PVSA 4RQUA 1XUOA 3SEAA 5IT4A 4YIKA 4QTYA 3IUPA 3B1WA 4B9LA 4F4WA 5DNEA 3W90A 4BUCA 5LXTF 1FZQA 1GNSA 4A2WA 3JPPA 4JBLA 1C0PA 3BMNA 2AB0A 2P40A 3KLMX 1B6TA 4MA4A 4HNTA 1QLNA 1SKBA 3LF1A 4TN1A 4NZMA 5C52B 3RU2A 3EH1A 1UMBB 2WLSA 1WXFA 3JQ7B 4AYTA 4EA6A 3UHFA 4EB3A 5DKFA 5D3MB 1YRAA 2FPIA 2WMDA 2Y1LA 2W6MA 3Q6MA 1CEZA 5DHAA 4DMRA 2R00C 1VSBA 5I9SA 2IOFA 1PJSA 4B4OA 4ND7A 3OHAA 2LCIA 2DBQA 3Q3JB 5E8JA 1BE8A 3ADKA 3BC1A 4C8MA 1SXIA 1PL7A 3RGGA 1BAPA 1CY8A 2KLBA 3K1TA 4M1EA 2B2NA 1PFVA 1XLWA 4NS1A 2PE5A 2IU4A 3TRKA 3AR5A 1J5XA 1A1VA 3P2KA 3GDHA 1H85A 1KO1A 3PFFA 1E5XA 1M33A 2WVHA 1IZ7A 4EB8A 4AF7A 3O3CA 1IM2A 1PG0A 1CR1A 5B6PA 2ETXA 1NV8A 4JLDA 2HJSA 3DM9B 3WDSA 1I94B 1E2DA 1Q2XA 1H4SA 1NP6A 1CF2O 1NUSA 3R2JA 1X0VA 1YIAA 1RP1A 3OT1A 4DR7B 9ICKA 2VYND 4ZGGA 1PBTA 4ZO4A 2D5AA 4OJOA 4F4YA 2JH1A 1X66A 2C95A 4K8OA 2ZIGA 4YAIA 3WK8A 2OM6A 4HX9A 1Q20A 2WJHA 3AV3A 3TJMA 2JLUA 2Y05A 4HSGA 1XALA 1I80A 3PFIA 3RJZA 4DLBA 1U2GA 1YRHA 4RY2A 1REQB 1C3XA 4BRZA 4C6RA 5HM6A 3EZYA 1JALA 5AVRA 4WESA 1NUUA 3E1SA 2BFAA 1IM4A 5CRXA 1V37A 4N3GA 4N5HX 2JFHA 2WQZA 5CPFA 2QB0A 5DM0A 4ZYWA 5IXYA 4NEHB 1KKXA 4MEXA 1KMHA 3DTVD 2JJMA 3UBMA 3IUQA 4NULA 2VRNA 4JQSA 4OQMA 3ZLTA 2F8MA 3S5JA 2VS1A 4D8YA 3ABZA 1ENZA 3TPCA 3PF8A 2XIQA 3RYCA 2GYUA 2HSGA 4U8HA 4YCNA 5JCPA 1NK6A 4J0EA 1JTVA 3DPUA 3FCUB 4LRQA 5TJ9A 1KOLA 4KGDA 4ZC1A 3O73A 3QBEA 4Q4AA 4MO2A 4IQUA 4F3KA 2WKPA 1OH5A 4NCAA 3AR7A 4HT3B 3LMKA 3ESBA 3QXHA 3RJFA 2JIQA 4M86A 1VXOA 3GB9A 2NZJA 1Q57A 2C9MA 1H1DA 2GDJA 3CZ9A 4IY1A 3WZMA 3MLBA 1Y8AA 2PZFA 1P0MA 4TQ9A 5NULA 2CLEB 3PQCA 1S3FA 1P17A 4CKEB 2FRVA 4JU8A 4AI6A 1JMKC 1BZYA 4UFPA 1HYHA 3SV3A 2RGXA 5TNXA 4P53A 1UOQA 2YDYA 1G66A 4X5VA 2IYZA 4PONA 3UWSA 2WP8J 1GL3A 2PKQO 2AFIE 5A6SB 3MS4A 5AXAA 4KN4A 1S2MA 4ZD6A 4DFMA 1ZD5A 2J9RA 2ZIVA 1KS9A 1QQ7A 3CTMA 1ZNZA 1JA1A 1H9BA 2XHEA 3RV3A 5JCJD 2V45A 1IN8A 2ZRAA 3CQ9A 2R84A 5I7WA 3KETA 1YR1A 3MINB 4Q7KA 3VNSA 2SECE 3PTZA 5A5DA 3RVQA 4EHJA 5IDQA 4CEHB 2VIXA 4O5KA 1Y4ZA 5JY6A 1WWVA 1NBWB 2ZG6A 1YGPA 3KWMA 5AR1A 3U6KA 1B8PA 1W36B 3GJ8A 4PSCA 4KWTA 5BNWA 3ABRB 4X95A 4IDFA 1Y6ZA 2H07A 3EJ6A 4J8PA 5HKOA 5AVJA 4Y9DA 2WIBA 3RTAA 1GNTA 4PIVA 2YIVX 3FVRA 1ZR4A 2DHDA 5D1HA 4GT1A 5BWOA 1DXQA 1R64A 4FR2A 2UVRA 1X87A 3LRPA 4A2CA 1O58A 2QKYA 1AZTA 3N59A 4Y30A 4D43A 5K9ZA 1Q0RA 2EQYA 3LDGA 4N3AA 1TDJA 1C2YA 2V6BA 2YBDA 4OHVA 1KGDA 2QLNA 5CIWA 3NORA 3AKCA 1DVRA 5EQJB 5DG8A 4Q9KA 2PUHA 4M88A 4D96A 2HU7A 3BIOA 3RB3A 2UVPA 5EKDA 3DPSA 4HMQA 2GWSA 5J4LA 4ZOLF 5CYFA 1DIOB 2J9XB 3CJQA 2IEAA 5CUQA 1JS1X 6GPBA 1CC1S 2WY2D 3AVXA 2FMTA 3JASA 1R9JA 1XO0A 2V7TA 1ZN2A 3PW2A 3W5SA 4QNRA 4UUNA 4PQGA 5DCLA 2PXXA 3AR8A 4I4IA 3G8BA 2X5OA 2D7JA 2PZLA 1DPGA 2W6IA 3COWA 3UXYA 2Y93A 5B3JC 4LV6A 4W7SA 4C8KA 3WV4A 4MS1A 1XNGA 4CMAA 2GMWA 2SNIE 2YJZA 1KDRA 2R4QA 4HNQA 3RPEA 2YXPX 1C1DB 1K6XA 1LFAA 1H0RA 1TPYA 3JQAA 2YJ4A 3H0MB 3AWDA 3BCRA 4ITRC 4NCXA 3INYA 2YVLA 3T1VA 3VDRA 4NNOA 5GJBA 2VDOB 3DFFA 3SEFA 2PX6A 5BOLA 1LPOA 5E3IA 1ND5A 3NATA 3IURA 4PO8A 1LZLA 4U3JA 3IS3A 3M9NB 3PRJA 5JS6A 1X7GA 5JJBA 3AFMA 3EXAA 2DECA 3GRZA 3VOAA 1NVDA 2WJPA 1U02A 2V1UA 2O3TA 1ZQXA 5TPWA 4JH0A 1EP1B 1BN6A 3NJ8A 4RVHA 5FLYA 3S1LA 4CCWA 1EEHA 5KFXA 2BEJA 2BM1A 1GFZA 2Q1SA 3DTVA 3IAAA 3K31A 4MNTA 4Y6QA 4A3SA 1QFMA 3FMFA 4IUDS 3M8RA 1M0WA 4Z51A 5CW1A 2HVIA 2O14A 3IEPA 1KI9A 2VSFA 1CUZA 3CF2A 3ESCA 3JZFA 5E6UA 5J1TB 3G7NA 3OZDA 4MUXA 3QSYA 1U0RA 5FI5A 5KINB 2H2DA 3V8PA 3KV3O 4DTIA 5KYTA 2IBSA 3PXAA 2XQGA 4FZRA 4IIXA 3W6NA 4AKEA 4BXOB 3EF3A 5JXHA 8ICAA 3F90A 5KTNA 1YOVA 4CV0A 2NQTA 3V1KA 5LQDA 3ZD6A 4CMKA 4CDGA 2DOKA 3E82A 5EJ4A 1RADA 3HM2A 3J81j 9ICBA 2FEPA 5HRAA 2QMQA 5G0VA 2SCUA 4XQEA 2PO7A 2RRDA 2VJ5A 4YRBA 2IVZA 3QLUA 1QKJA 5CB4F 2AZDA 1QIEA 3T9BA 2D74A 2WNHA 2QTHA 2I8LA 3LXXA 4POOA 4EGCB 4KPYA 1PT7A 3UHPA 5CCEA 1T5LA 3B1ZA 2R6GA 1PLJA 1ZQCA 3JATA 1WDTA 3QFTA 2G82A 4D42A 1P33A 3K1AB 3R0JA 1CEEA 4QWWA 2W93A 2DCMA 4TXNA 4H7PA 5ALXA 3GDFA 2IH2A 1S01A 1GG5A 2VWPA 3LZDA 4ZZ1A 1T25A 4IIFA 5HHHA 4DNOA 1OBCA 1CU1A 2JIRA 4RY9A 3T5DA 5EP3A 1FK8A 5B3JA 2VJCA 3C8UA 4G1MB 3TQQA 1RXWA 1N63A 1H2YA 2OXEA 2WTAA 3F6CA 3GN1A 4JLNA 4UVIA 2BZ0A 3B3JA 2IYSA 4DNPA 2REQB 1H5NA 4UDXX 2HCFA 5KT5A 5CIYA 1U0HC 4F7DA 2HK7A 1FU8A 3MJCA 4JUFA 2BFWA 2Z3VA 4W82A 2OVFA 2RGNA 3EVDA 4V38A 4G41A 3OSZA 2ALZA 1RLOA 3BFXA 4INOA 3ZH9B 2F8LA 8ICZA 5KFKA 4R7ZA 3TZEA 3HL0A 1PR1A 1SVUA 4JJFA 4PBSA 2XWQA 2AK2A 3TCKA 1E66A 3ILHA 3ROZA 1OW5A 1KIFA 1VFNA 4DV5B 4C2BA 1YJ8A 5CH5A 5GONF 1UMCA 1DT3A 3RSQA 1L3CA 1JHXA 2ODBA 2OBXA 5LQUA 3ZIAD 1M6YA 3PWSA 3HCNA 3RYIB 1MJ5A 3V1MA 2RG1A 3CW2A 3C8MA 3QW4B 3HB0A 4KLZA 5DXAA 2DFLA 1JJBA 2V6FA 3URMA 4Y1EA 1WHSB 3ZHBA 2Q4RA 2JFFA 1V8DA 3A27A 3N0VA 4XYMA 5E3HA 1YB6A 2X2EA 3JQ9A 4YJGB 4Q7QA 4OI1A 3HP7A 3R41A 4HNSA 4M53A 4B6GA 1MKYA 3N7UA 2E55A 1YFJA 2C2XA 2FR8A 3AEKB 4N54A 2H3EA 4CN9A 4TSKA 3BULA 5E7QA 3RUHA 1CF9A 1PFKA 4M9XA 3L79A 3P9XA 3NCTA 1X0XA 3ODGA 4PG8A 4TS9A 4N0PA 4HXYA 3NJRA 2Q5FA 2NUPB 3UAWA 2IHZA 4BATA 3K9HA 5HS4A 1M0EA 4RNDB 1SBCA 2GK6A 4A16A 3ZCUA 1VHWA 5ICFA 4MR8A 4YBRA 1HSZA 1U90A 2AUMA 1BE6A 4AYBF 4J75A 4YHHB 3CRW1 3P0IA 3EUFA 4L75A 5GJCA 5LOVB 3IMKA 3CVXA 4BNJA 3O8QA 3QQ5A 2G67A 4RQ7A 2BGUA 2PFNA 9ICQA 4PXAA 3EEYA 5H3HA 4ERXA 5IJ0A 4OYYA 1DJMA 3SBOA 3F46A 4GYJA 1TVCA 2AYXA 5L7YA 3K09A 1Y1SA 3Q87B 2GTIA 1AMOA 4E1VA 1T8EA 3DZ8A 2ZM5A 1V0JA 3NRWA 1S2DA 2AXNA 1QV6A 1XSNA 1VLLA 2RGBA 5FLXA 1T8PA 1ZI9A 1KYVA 4RWZA 1CSEE 2VL7A 3HDHA 1F7VA 1AUPA 1VYHA 4Q9LA 1X7WA 1BC5A 3FYTA 1H5QA 4HPJB 4PSUA 2BMDA 5EQFA 1JYEA 3VPFA 5CIQA 5FUXA 2ZULA 3G2OA 4MRVA 2A3VA 3UPUA 4FC6A 3LT0A 3AKZA 3DOEA 2ZTHA 4UKDA 5DULA 4LF4B 2NXCA 4RK4A 1CUHA 3Q41A 4S1VA 1QC5B 4I9FA 1JWLA 2FPOA 4BLTA 5L3QA 4AZ0B 2QD3A 5IAAA 3WKDA 3R44A 1QH1A 2EERA 1GKLA 4XFKA 2O8CB 4GUAA 1JMYA 1I4OA 3EOZA 2QV0A 1U8YA 2GAOA 1AX9A 1BDBA 1I2BA 2XYVA 2P79A 1D6MA 3LYLA 3M81A 4XWTA 1QHYA 3BPSA 9ICPA 2W2KA 4L72A 4QQFA 2VT7A 4TXJA 4WLUA 2IPNA 2KPOA 2QTVB 2B1IA 2HDNB 5A05A 1AKQA 4NG4A 2E48A 3BF7A 4I2NA 1EAMA 2YWGA 3TEJA 2IUFA 3K9WA 3X1YA 3H8SA 2JKYA 2I66A 3DAGA 1EDOA 2KE7A 3HUFA 4JT8A 4OX9Y 4ZAWA 2D2XA 1FRVA 1T9BA 2WE8A 4LQCA 1Z29A 3OQJA 5T14A 3R6LA 1M34E 3KQVA 3F6RA 2PWBA 4NAUA 2ZRGA 5H9WA 1CJTC 3BTVA 3C4QA 5KMGA 5H68A 4R84A 2BI4A 1Y4DE 1N9GB 2JDID 2ZI7A 4CKBB 2H3VA 6ABPA 1E0AA 3B1VA 3BD6A 2PJDA 5TY0A 4EARA 4EWLA 1Z4KA 2XMBA 3BFVA 1FX0A 3A6LA 2YX8A 4HLUC 1EX7A 2QSYA 2GTPA 3DMRA 3NHJA 5DI3B 4EEZA 8LDHA 2HKIA 3PKZA 1FS6A 2V7QD 3LSYA 2JH8A 2X6TA 2HAEA 3L0IB 3CSSA 1YD7A 3VZRA 4M0LA 3AHIA 4ZODA 4US2R 1N1EA 3Q12A 1ZGCA 4X7PA 3O8OB 1DKUA 3MCTA 2EDCA 1B8NA 3JRXA 3LDAA 1WMSA 2WHYA 3PMLA 3MERA 4PQRA 1DG1G 4QTTB 3RIXA 1UKEA 3WGNA 4JJ8A 4EO9A 3B9BA 3HH8A 4Q3DA 2XUZA 1W87A 2D8AA 1WQ4A 2L82A 3F5FA 4P22A 4DR2B 5F3XB 1E3JA 4QZCA 1VMKA 2ORVA 2VHUA 4FP9A 2ZR9A 4QPJC 3B36A 4D4JA 2C9ZA 2CXHA 3RBEA 1B0UA 1YS7A 4TUYA 5DQHA 2YIMA 1YV9A 3ALRA 1YJXA 3BHMA 4WCVA 3IR7A 2PMZC 5EJMA 2W8BB 3AVUA 4L5JA 5DM70 3ADCA 1KZGB 4X92A 4FIZA 1UADA 3AQEA 1L5SA 3BILA 4QJIA 1SD2A 3GMTA 3SHVA 5KOIA 1MQSA 2QUZA 3UXPA 2JFYA 3P5BA 2D00A 3R3JA 4KLCA 1MC1A 4LV8B 1BNOA 1LX6A 2X0RA 4IQVA 4BNDA 4H7IA 5F64A 1SMKA 5EXSA 4F72A 3ZHQA 1ADYA 1IZZA 1W4RA 2F90A 3F1LA 2YMLA 3KOZA 4JEIA 1CZKA 5U1PA 1UJBA 4NS4A 4R9VA 3REQB 1KSPA 4AMYA 4BFLA 2RC6A 3DT9A 1JHRA 5G4LA 3EOBI 4TRRA 4HFRA 2RBGA 4D41A 4LPSA 1SCUA 4WVFA 2DHEA 3OU6A 5JFTA 3L3BA 3O1IC 2MSKA 4AIRA 2IOQA 1P62B 3CKMA 4HDSA 1ZIXA 4BX0A 4KGVA 1M67A 3VU3A 4L5CA 2QR3A 1LKYB 1JR3A 4MR7B 1ULUA 4NEGA 1R0BA 1DO2A 1GSIA 2QW1A 2WSMA 3OZWA 4W1QA 5L4NA 1ML4A 1RMQA 1OILA 4G0XA 4PL1A 3E7FA 2TYSB 5E7JA 3FPHA 3DKRA 1WDMA 2PX5A 2Z2JA 2W22A 1OREA 4C4ZA 2I6QA 2RBEA 2CVOA 1AB6A 2R2AA 4KLLA 2MDTA 4O4IA 1YFZA 1BXGB 2O2EA 3EOAI 5JI3E 1R7RA 1LVGA 1IEXA 1D8BA 3HW8A 1AKUA 2BGLA 3PXXA 2QT9A 3WG9A 2GK4A 3WNDA 1VJCA 4PF1A 1W44A 1T6BY 3DZDA 4JI1B 3VI3B 3VPHA 2R6FA 3WIEA 4FFOA 3RAPR 2A9FA 1CNMA 1IIRA 3BXOA 4DQQA 3FVQA 1WY7A 1DAIA 3O95A 2BJWA 3HA2A 4KJZA 1U8FO 2ZVQX 5AFSA 5JAIA 4YGYA 4X60A 1MR3F 5K6AA 4GXKA 1OVMA 3DV0B 1QCYA 1YTUA 4JJ4A 2QAJA 4WKGA 4ALKA 3UICA 2I7VA 2JGKA 2H9AA 1PZMA 3DONA 1SHZA 1MOPA 2W6JD 3OE5A 3P9YA 2CT8A 5ELLA 4P86A 4Q43A 2WWRA 2ZS9A 1YZLA 2E1PA 3SY8A 4EJFA 3V4VB 4E51A 1KRPA 4WOJA 5K3SA 5D7BA 1GUFA 1JDZA 5AT1A 5J5CA 4LN1A 4KTTE 3AN1A 4XDZA 1KEEB 1T9GR 1VGRA 3CH4B 5ER6A 3SNKA 4CR8A 1ZRNA 5KG3A 2J07A 2Z58A 3LXMA 4FMCB 4IGKA 4ZYTA 2JEGA 4BO9A 2HYDA 4ACBA 4RT2A 1I5EA 2P5UA 3PI7A 4ZP1A 1L5GB 4IS3A 2QK4A 4H1VA 4WV3A 1Q95A 4ED8A 1V26A 1KAHA 3FCYA 1JXLA 1SQSA 2VK2A 1DFHA 1FDIA 4MDHA 5EHGA 4DS3A 3LY5A 3R4CA 4XEHA 4BMDA 1UBNA 4R3UC 2YQ4A 4D4KA 5JQGA 1HYBA 4UPDA 1LJ8A 1E2QA 1OJLA 2J3IA 4IFIA 4F6CA 4KDEA 4JFAA 3OJSA 2GJKA 3SDBA 4Z4CA 3RANA 3D54D 3UBTA 5DQIA 2NOAA 2NSDA 1EHYA 1EWKA 3M3DA 3T54A 3WIOA 3CT4A 5CX1A 2XOXA 2Z5VA 4MV4A 3BORA 4C2TA 5C1PA 4EG4A 2UXDB 4R2LA 3CMMA 2CVFA 3PWZA 1LB1B 5KYWA 4C05A 1DOZA 1X7YB 4QBIA 2B6NA 2PLNA 3HGTA 3DLTA 5CLIA 2VUIB 4D3FA 4U7CA 1U80A 2M32A 4U2EA 4ZZ2A 4TT8A 3WWZA 2IU3A 4XD7A 2D2IA 4I9GA 1R6XA 2XOEA 3MWLA 4ZVUA 1AKTA 3FDSA 1NBEA 3C4VA 3GZNB 4MKHA 4ZKDA 1SH7A 2NRVA 3DMDA 4Y8VA 4QA9A 5J0WA 4XR4A 2O2HA 4J0HA 1TF7A 4D44A 2ICAA 4C8OA 1YQXA 3KLOA 5ECWA 4BLSA 4TUPA 2LPMA 4M1ZA 2PIAA 4AZSA 2PBFA 2GN2A 3L6BA 4A2PA 3QWIA 1QGAA 1E1LA 4L6CA 4WNIA 4E21A 2BKXA 4D5GA 1XZMA 1HQDA 3EGOA 3G0BA 4JQCA 3SD7A 5HZGA 2WG2A 1EJ0A 3LBHA 1YF3A 1I0ZA 2PA0A 2GDZA 3L0YA 3ILXA 4DSAA 4LE2A 1KBUA 5BSHA 4HOYA 2K7FA 5FBLB 2X1LA 3EIEA 1K7XB 1TM3E 1BCRB 2ZREA 2JFXA 2HRQA 1NATA 3OIWA 3MNFA 4NEQA 1EFVA 2X5XA 5ICMA 1ZNXA 2FX3A 3ISJA 2EFEB 1QGUB 3HJFA 5AK6A 2Z2XA 2BI7A 2H48A 2QUAA 5KC8A 5B5EU 1ZUD1 1I7PA 1P39A 4KQXA 4G6ZA 1EVLA 2FJ0A 3L7AA 3R77A 3AQ4A 1W6UA 1TE2A 3G2HA 5ALEA 2OXCA 3CUVA 4IGEA 3UMRA 2A7QA 4N7RA 1G3UA 2YV3A 2ZXFA 3T9CA 1H42A 3TLBA 3LY7A 1D2AA 3NAZA 2QYSA 2XKAA 3F4BA 1HA3A 1SR8A 4MHSA 4U1RA 5JYCA 1PKXA 4LJLA 4XLLA 2XMZA 3RH4A 1P8JA 1MIHA 1RLTA 2QNRA 3DZJA 4ZZIA 1ABEA 1SC3A 1ZO8A 2BN4A 2OBYA 3LK7A 4M2LA 4RFSB 3ND6A 4RQ0A 3TMKA 3WGHA 5HPYB 2XGJA 3K9GA 1XTPA 1KTVA 1JQLB 2WA1A 2XMSA 4PLZA 4GRDA 1SELA 4J16C 1VSUA 2PT7A 2XGOA 2EATA 5EI5A 3W9UA 3WGKA 4M1MA 2DKNA 4AWBA 3ZNNA 4Q19A 4E1AA 4PZCA 2EAOA 2HGZA 4QZIA 1JG3A 2XQVA 3MMXA 2NU9B 3REOA 3O8DA 3HZRA 3RK4A 5CLFA 4J7CA 4OXQA 2XT0A 3RRNA 1Z45A 2C2MA 2ROQA 2VP6A 1YRWA 5AKEA 2JCSA 3LY9A 2ECQA 2A67A 3WWOA 1D0SA 4S1NA 3FFWA 3MRTA 1VCIA 3CEPB 2VZLA 4NMWA 2ZB2A 2FMXA 2YHSA 1GP2A 1AQUA 4OJTA 4RZ3A 3UJ9A 3CR8A 4Q9DA 4DLSA 5BRAA 3TSWA 4LZPA 3E0QA 1PT8A 3E8SA 2R8IA 1R27A 5TMDA 3A9TA 3H8JA 1ORTA 1ZNYA 2GD1O 1Z8HA 1IN4A 1ZLXA 4UAZA 2XMCA 1H38A 1WUIS 3P20A 1ZI6A 4COKA 5E4FA 1QX3A 2OWEA 4X61A 5DTJA 1CZNA 3ZGOA 1V8BA 1O54A 3O4FA 4IEIA 5JUWA 4MKGA 3BAZA 2KICA 2NSYA 1VCNA 3MSXA 4OPMA 5ADWA 4LSWA 1ZU4A 2KBEA 5K0FA 4ZTZB 1K8YB 1V5WA 3A26A 1MQAA 3UUGA 1B93A 4D82A 5PGMA 2HOIA 1N5LA 2EKDA 2IQ5A 2NQ2C 3V9PA 4AQYB 4JOSA 3FNQA 2HI0A 1QG2A 2GX6A 3WLMA 4DMLA 2ZJOA 721PA 5HW0A 3WWYA 2BGJA 5HGXA 3BA6A 2C2DA 1M34B 4LOLA 3DBHB 3P9KA 2GASA 2BOVA 3PUXA 4A1FA 2NN3C 4M38A 3UQ2A 3ZDCA 1GQFA 1YSCA 2W2OA 2LPEA 1YRLA 2DY0A 2IYVA 1UT5A 2PR7A 2BFMA 2WIFA 1A76A 3QLJA 3QV2A 4Q1AA 1I6LA 3N2KA 3ZUGA 2H52A 3ZHOA 3KP1A 3V80A 1C2TA 2BM0A 1QIJA 2JAQA 2V97A 2ZSUA 3G49A 4U39A 1FYWA 2B5VA 4B9UA 3COZA 3MTDA 4UU7A 3I23A 3WBKA 1A96A 4CFYA 2GZ2A 3KJQA 4FDVA 2LYAA 3TB6A 3M9LA 4KG7A 5A7GA 1X1CA 1K88A 1DMRA 2V9PA 4U5QA 3H9UA 4Z7NB 4EHBA 5HQJA 4B3TB 1T4GA 1C30A 1I2DA 1P0QA 2JIZD 2W6NA 3PG5A 3QPWA 4RVGA 1R1DA 5AVOA 3WLPA 3OOEA 1PEYA 2WYIA 3FYUC 2ZWOA 4MVJM 4OJQA 4EJ6A 1EK5A 1N92A 3K0FB 1VL8A 1GSOA 1HORA 1LI7A 1QF7A 4QGAA 1EBBA 4RCVA 2W0MA 3I9OA 5IKOA 1Z37A 2XXAA 5JO9A 5JXJA 4HDRA 3SI7A 1BA2A 1QAMA 4ZZ3A 3N05A 3D1LA 3ER6A 1NKBA 1NGSA 3E9YA 4CF6A 2VSOA 3U44B 1JDBC 1B76A 3G0CA 4BFXA 4FWTA 3ELYA 3KFXA 3M9XA 4PJ0U 3MTBA 4NCNA 4D80A 5CDFA 3FCOA 1IIBA 4CE6A 1NN0A 1W5FA 1SCAA 3PA8A 3PNKA 4Q15A 2XXAB 4DL2A 3I8XA 1T4DA 3L7DA 1RACA 5SZIA 4F8YA 5L1LA 2OR3A 2IOFK 3CN9A 2P27A 4GL2A 5KO2A 3LT5A 2VSXA 3PUWA 3T3PB 3ZGYA 2XCQA 5JSZA 1B2RA 3A6JA 3T35A 5EZQA 2MOKA 2W3RA 1QONA 5DLDA 5T4EA 3Q3VA 4JGIA 1G20A 4J0QA 2KZZA 2IZOA 5KG5A 3R9KA 2Q3EA 3N86A 4OO3A 1ZIDA 3V55A 2EARA 4CM4B 3K1ZA 3MJTA 3EF0A 4DADA 3U1BA 1GR1A 5IJWA 1NZDA 2JZNA 2ZTVA 4E88A 4XM2A 2Q1TA 1LSUA 3EIHA 4KYTA 1K08A 5ECGC 4EYKA 2W9CB 2CV2A 4NZ9A 1B1CA 4I8DA 4DSNA 5BOVA 2WRZA 3N2KB 2P65A 2JJ2D 2RGRA 2O54A 3OJOA 3CWQA 4CUJA 4Q3OA 1UKBA 2AN9A 2QXTA 1F8FA 1PR6A 4U7JA 2ZRJA 2YVQA 1CR6A 4IO0A 4WXEA 1TK9A 3S7ZA 3L7BA 1XZGA 5IHXA 4ISCA 3IALA 1E98A 1FSZA 5DGXA 3ZY5A 1S7GA 1UWLA 1QNFA 4DCCA 5D46A 2JMGA 4MIYA 1CZRA 4F1JA 2VJMA 1XA0A 4ONEA 5A5FA 1XD9A 4GXQA 5LVAA 2X1VA 4A2QA 4B73A 5B36A 4IR7A 3KEFA 2IODA 2PXHA 8ICGA 1YT3A 3R5SA 4BO4A 4N3CA 4HNAB 3W0LB 3ZJ4A 3G6WA 3Q7TA 3T3IA 1W0KA 1X39A 1XK7A 2AOTA 3JQEA 4PICA 4M7OA 5LZ9A 3I32A 4G09A 5ES4B 3N7AA 3MGKA 4GP7A 3GCDA 3C7CB 1ZK2A 2DPIA 1XZKA 2WWHA 1QIHA 3K8YA 3Q11A 1IUPA 3CLHA 4QGSA 5AI5A 1EINA 1T4CA 4FFLA 1Q7EA 5D7NA 1TYAE 4EMTA 3B2QA 1FYEA 3ZZTA 8ICRA 1Y34E 3JZDA 4NTZA 3T5LA 3FRHA 1WA5A 4Z6EA 2CJFA 8ICUA 2X23A 1ZQRA 4MHOA 1KAEA 3JPRA 5LZ5A 4JI5B 4JI2B 1QBGA 4S24A 1ECBA 4DC1A 5G41A 3DW3X 5JLJA 4QT0A 1RI1A 1YE8A 2ETVA 2FMUA 2KMLA 3OP4A 5IN5A 3DT6A 3U39A 1Q0ZA 1UK9A 2HOFA 1KYTA 2W7TA 3JV7A 4C7YA 3D31A 4FCWA 4F38A 4QXMA 5TF4A 3R5JA 5FIUA 1G6KA 2RHHA 4RTMA 4RQ4A 2VYNA 1GYPA 4XX1A 1KORA 1NM5A 4QYIB 3CBGA 1D1SA 2XKJE 4ZT4A 3ZWAA 2G83A 2G25A 3Q2IA 4RFSA 1ORIA 4L5YA 4XR9A 3OE7D 4QOSA 3R74A 4EG8A 4FHDA 4QBFA 4LGYA 5KAMA 3KBOA 1LDYA 2ZBEA 1OU4A 4HRXA 5IH3A 2VA2A 2PS1A 4PX5A 1Q7CA 4CEIB 1PR2A 2DUJA 4MWDA 3DWGA 3QPCA 1ECLA 2IYNA 4W8OA 4F50A 5FA6A 1QPGA 2ILTA 1DRVA 3ZU3A 4ZI7A 4JXZA 4Z1OA 1IPFA 2FN4A 4BASA 4JYZA 2WYHA 2Y2VA 2I5HA 3SZUA 2J6IA 3PDIA 1J56A 2Z6VA 5BUZA 2A33A 7ICVA 1C3EA 3TOCA 1TJ4A 1LWNA 1CUEA 1WPQA 1C8LA 8ABPA 1U4OA 2YICA 2VPWA 4HQOA 2QQ5A 2FXVA 1KSFX 1L6NA 2HXYA 1G9XA 3DW1X 4MW2A 3N6RA 5DN9A 3L0BA 2HRCA 3ZEIA 3HXMA 1MAAA 1MN6A 1FY2A 2AOUA 3MWKA 4CIBA 1C29B 1GPLA 1FP6A 5C8VA 4QRDA 4FNGA 3NOOA 5EAIA 4FX5A 4RPJA 2IPMA 2A88A 3RFAA 3I6QA 4H1HA 1BGXT 2QGFA 4EFKA 4EB0A 5LIPA 2A3RA 2JANA 2LCFA 3BB3A 4C9BA 3LLSA 3EIQA 2C0PA 1G21A 1N25A 4OJNA 1Y9AA 3UK1A 2V0CA 3OT5A 2AG6A 5LDDC 4BBPA 2W4QA 2FV8A 3IBTA 4DWJA 2FEMA 2JGEA 2ECPA 4J7AA 4F86A 5CA1A 4Z2AA 4MHTA 1NE7A 4BO8A 3BD8A 1V7ZA 4C3ZA 4Y2RA 2YJ6A 4FFVA 2Q6VA 1T6NA 4N8EA 2NUAA 2GESA 3F5QA 4RAQA 5DTIA 4LOHA 2JHGA 1BJKA 4O1MA 3RWMB 1KI2A 5IINA 2Q1XA 3HXLA 1JZQA 3ZWYA 4TLLB 5BWNA 2NAPA 3TTVA 2AH5A 3LK9A 2IW3A 1F2DA 4ZJZA 2NTYC 1CS4C 4R1OA 3ZCVA 4PCAA 4I4NA 1XZHA 1EFHA 2PYDA 4LVCA 4EFNA 1RLIA 1R8SA 2W2XA 4Z0PA 1Z19A 4ELTA 4NYMR 4HJXA 1V1MB 2IYTA 1QQ6A 3OCWA 5ADUS 4ZRDA 2AXEA 5KTYA 3G6YA 1WP4A 4NSNA 1ZHHA 1ZMOA 1N2CE 4R2WA 2YUIA 4G5XA 3FA2A 1JEQB 5DM60 5JBIA 4DPLA 1NNLA 4NJ8A 3HKBB 4EI2A 4XWAA 2JA1A 5CFOA 8ICOA 3U17A 1T8YA 1YU6A 2P78A 3AJ9A 3B89A 1MX9A 3BFKA 1V97A 3KBBA 1JHVA 1BVSA 2H5LA 3DCJA 1PTKA 2VG8A 3PQDA 1W0KD 4M6WA 1A88A 4ZRNA 4TSFD 5LWHA 2ZUSA 3KALA 2PM8A 5AJTA 1CUBA 1ESDA 2X9QA 4HLCA 2UYHA 3OFJA 4NXNB 1BNCA 2DHCA 1SXGA 4OXRA 5IZCC 1T5DX 4KH0A 5LYJF 5GTDA 3CUEF 2IDMA 1NI4A 5KNLA 4E4TA 1XDDA 2V74B 3OGUA 3EGDB 3ZYCA 3C15C 1VPWA 3ZDFA 3FGPA 4LTMA 3P9CA 3NDBB 1WBJB 1ZRSA 1AKMA 1KRXA 3HXQA 4JUAA 3AH8A 1D6SA 2R11A 3FNRA 3FYHA 1SKYB 2ZYTX 3K2IA 2GB4A 2QTWB 3IXMA 1RAGA 4IIDA 3Q7PA 4R16A 5T3UA 2QRPA 4OKSA 3IDOA 3KCNA 3RUDA 3U7QA 1ONNA 1UDWA 3AVPA 3E84A 2VRBA 3N70A 1MO3A 5EINA 2BLLA 2O7VA 2OBBA 4MEBA 3RVPA 4K2HA 4ZVMA 2I4OA 4BO1A 2VYVA 1ZVJA 4J9NA 1H6BA 1U5BA 2CJWA 2ZJBA 3FN4A 4LMBA 1SJ9A 4O4IB 3ZIUA 3ZHRA 4CODB 4LNAA 3CS3A 4PHCA 4Z8YA 1TCUA 3ZWNA 1EZ1A 1FS4A 4LPKA 4G67A 4WK0B 1A6SA 3T7TA 5JZSA 1X77A 2W9BA 1O95D 3DL0A 1E9CA 2NP7A 4KUHA 2X13A 4FGLA 3RVJA 4ZJYA 4C07A 5EP2A 1GGMA 2GQ0A 2PQ0A 4E6EA 5GZ3A 1BFDA 1UM9A 2QRHA 3AHEA 4UOEA 4NCKA 5KFSA 4RPYA 3WHPA 5TF0A 2AI1A 2BD0A 3KHHA 3QGMA 4DIDA 5KWEA 4MMYB 1XN1A 3F6SA 3ID6C 4YXWA 4BEWA 4MJ7A 4XXHA 3A7DA 2CNWA 4FJ2A 8ICNA 4F1KA 2JFBA 5CCDA 5I7OA 2PPVA 2IS6A 3BWBA 3GROA 1RCUA 4CPDA 3TSOA 2EZZA 1S9DA 3E8MA 4NICA 1F2TA 2MSNA 3D8NA 1XQ1A 2FG7C 4P84A 3REQA 4CG0A 5IYZB 4F5YA 5JJ5A 1KC3A 2QJTA 4BP9A 3A58B 3OURA 2VZ0A 4YWJA 1IXSB 3FMPB 4I6EA 1MHTA 2ZE5A 1Q1AA 1KK2A 3GK3A 5KPJA 2BEVB 3AKYA 4TX1A 2EZUA 3I1IA 1XPOA 1DOQA 4DG5A 4HYEA 5G5GA 2BT4A 1MDBA 3Q5DA 2PWZA 3Q4GA 1RYUA 1Z5ZA 3NBQA 4BJ6A 2MMGA 3SLRA 4DRXA 1CB7A 1TAQA 3MHPA 3GI1A 3N0TA 1PZFA 5KFHA 4M04A 2VATA 2FCAA 2WSYB 2E4VA 2RAUA 3I9V6 3DYBA 3JAKA 4OA5A 4RADA 3W9BA 5LDHA 2FWRA 4HMPA 1SRRA 2X19A 3VR1A 3ECCA 1HNXB 2AIRA 4B79A 5IWAB 4L57A 1AMNA 2G9UA 2H0RA 1DRKA 1S8OA 3SC3A 5JFGA 3LWBA 3D43A 3MILA 1Y6RA 3Q8PB 4I2GA 2AEEA 2BUBA 4DJFC 3JQCA 4JIMA 2H57A 3RRYA 1YL7A 2MYTA 1ULTA 2FQYA 4J4HA 4JLWA 1M7GA 4LW8A 3G2QA 3AX6A 2GK3A 3SNHA 1QYVA 1A9TA 1CUFA 1UPFA 1FX0B 1OAOA 2NVWA 4MQ4A 3UHOA 4MH0R 1KO7A 4Z3OA 2IQIA 5AXBA 5EIBC 2VZEA 1N9GA 1UANA 1ONPA 2XTZA 4TXLA 4FO6A 4EW3A 1ECCA 1UP6A 3KB2A 1XWLA 4EX6A 2J09A 3PTAA 1Q77A 4DJJA 4TPKA 4NMXB 1ODKA 1JLKA 1DELA 5HKLA 4LX8A 5D5PA 2GLUA 4BE9A 4WBNA 1JXEA 2P4SA 2J67A 3WIBA 2YWXA 3VJMA 3RJHA 5HF9A 1B6RA 1I7NA 5B1HA 3GPDG 1U7PA 3VOSA 1W5EA 2O6HA 1E58A 5JXWA 3WFIA 3IC5A 3BH7A 1JEEA 2JG3A 1WW2A 4B33A 3L43A 5BNIA 2JL1A 2G1UA 3F2BA 3VTKA 2GRJA 2OAQ1 5LLSA 1N2ZA 5KKCA 4QPNA 2W2KB 5AVWA 5IASA 1YNOA 3M4ZA 3I62A 5CFZA 4XIIA 1ODTC 5EOZA 5COBA 2ZYAA 3BS5B 4Q1EA 4YMIA 2W90A 1U2QA 4IGAA 1IG6A 1QH1B 4YT4A 4WLEA 4B6OA 2PUBA 4NBTA 4AYXA 4BP1A 4BRUA 2Y3IA 4AZ0A 3I12A 1DIAA 2ZR8A 2IX3A 1NYTA 3JWPA 3C2LA 1GT91 3GHHA 3N8KA 4MV9A 3WJAA 1YGYA 4C29A 3U7FB 1ZQQA 2IP2A 1SPBS 1MCZA 2FLLA 5DHTA 3V1UA 1EFRD 4HTAA 2AWOA 3AP1A 4Z49A 2SICE 5IYZF 5AVQA 3Q2OA 2IOYA 3IELA 1K63A 4LDAA 1EVJA 2BP7A 1RXSA 1XL1A 4GOJA 4J0DA 4KO4S 3RJJA 4NNPA 1IV8A 4L78A 2XITA 4UE2A 9ICRA 1K3UB 2HYIC 3L6RA 3L1IA 5DDIP 2PX3A 3MGAA 2QVCA 3JQFA 3RQIA 3VNUA 1YUNA 3ELUA 3G88A 1DOAA 3R7FA 3FHTA 3P0RA 4JYMA 3OESA 1DTSA 1B4FA 1ZONA 2H4HA 3K8QA 4LOKA 3SYMA 4HQLA 4BB0A 5JH7F 5L9AA 4B3SB 2R44A 2BGGA 1TAMA 5D84A 1DRJA 2O8EB 2UDPA 2UYGA 3PSHA 5H80A 4CMBA 4BEVA 3L8ZA 1BMTA 1ZWKA 3F8WA 4P31A 4PCLA 4AZTA 3O91A 2WM8A 3K20A 4ECWA 1RHJA 4UAUA 5JSHA 1BROA 1JHZA 4ZVPA 1HOXA 1Z3EB 5C5JA 2NUPA 3PGLA 2PRZA 3VISA 2H4YA 2JEJA 3CLRD 1YRQA 3K5IA 4MUFA 4BJHB 5IC4A 3R0ZA 4CLOA 3ZZ1A 1UBUS 1QM5A 3M8SA 3BK1A 221PA 3FIUA 1JXOA 1G1AA 4MCAA 4Q16A 2P2LA 4B75A 1YZVA 3IT1A 2V9WA 4AC9A 3IKTA 4ZAZA 1EUCB 2R25B 4IP0A 5NLLA 2QTGA 3RRFA 2OESA 5BPCA 4OJKA 4X1YA 9ICWA 4KVAA 4MROA 4F3RA 5B12A 2AK3A 2IHUA 4PZ0A 1ODIA 1ZOSA 1TTTA 1O57A 2A86A 3LUCA 2BM9A 4KUGA 1U49A 1UUFA 2DLCX 3SXPA 3KEOA 1T1EA 4ZCQA 3KQSA 5F33A 4Q4LA 4QATA 4HTFA 1C9MA 4RJKA 3H7IA 1L4MA 2B1GA 1X1EA 1P61B 2EDAA 4JENA 3QEMA 3P2EA 1T2AA 4URYR 4GSYA 1AN0A 1UBLS 2LYHA 1GNLA 1SB9A 4HAIA 1AOXA 3EY4A 1NPTO 5I4CA 2XODA 3WU2U 1KR5A 5KTPA 2B4RO 2XKBA 4KQKA 3U4CA 1V4NA 3ICPA 2E18A 4ZOCA 3WHIA 5I7RA 2ATEA 4TKLA 5K3EA 1BEEA 3SDSA 1FP7A 5K3AA 2HHSA 3A6FA 5GVSA 1TKAA 3IVAA 4L85A 5B66U 2V7GA 3E9NA 4MUAA 4ZQEA 4BVGA 1RYMA 5KFQA 4ZQGA 1M6NA 2C5BA 2XWPA 4HP8A 2ZT8A 3AVWA 1EVZA 1EXNA 1KDTA 1T6XA 2RGUA 3D81A 4XDHA 5INTA 4E0DA 3E7PA 4BGUA 1JAYA 2H1LA 3CIFA 1P2FA 3CCCA 1FUYB 1WP9A 2A30A 2YDXA 5EHNA 2VPYA 1U99A 4UJ5A 1VLQA 1W0JD 5TSDA 1XDWA 2PKWA 4LZAA 4JL8A 3V8QA 4A8PA 4B2IA 4EDFA 2OYSA 5J0YA 2XO7A 4V02A 4EUSA 3HUDA 4YIHA 2KP7A 3R9WA 2CB0A 1M2FA 2XE7A 3JQ8A 3ZWKA 2QPLA 2QU7A 1TZJA 2WSSA 3AYXB 3JATB 4AT1A 1O0SA 3OM0A 3KQLA 1N6KA 1OZFA 1FNDA 3D8HA 3MN1A 4OJMX 5JG7A 1CRPA 2HXGA 4BMSA 2X77A 3GD5A 3JR7A 4ZU3A 4DMHA 1GG9A 3TGWA 1G7CA 1V35A 5COAA 3TKLA 4ZYUA 3EZ7A 4WJLA 1P31A 3BZKA 1SUEA 1WF6A 2ZBUA 3VSDA 1WSAA 4E03A 4ADSG 4URXR 3FR7A 3P9NA 2OFFA 1QMPA 1E4OA 2BFBA 2C1XA 3KJNA 3EG5A 4Q82A 5HCUA 3WLKX 4ER5A 1ZK0A 4L51A 3VZBA 5B4VA 1M2EA 1MVLA 1UEXC 2ZRNA 3I39X 2JA2A 2HPVA 2Z0MA 2CFOA 1S89A 4K6GA 1J8QA 4GLFA 4HNGA 3RM3A 3R7SA 3S7TA 3UFXA 1X19A 4KKXB 2ZJ1A 3WGGA 4RQ2A 5HUJA 5LXTB 2AXPA 1OR8A 2BMAA 2C5EA 4O2BB 4C08A 2E5FA 5DN6D 1I14A 4CMCA 4QZBA 1Y8CA 3K3PA 4MZXA 2O0LA 2XRYA 5HFAA 3X3HA 4OH1A 2VZ9A 3QH4A 4FDAA 1IHDA 2FVYA 4UATA 3I1FA 3MTAA 2C1EA 4RIEA 2VNIA 1KZYC 4OU4A 4CKWB 4ENUA 5FPKA 3FAHA 1QH8B 4RF2A 5TPWB 3U5ZB 3ICOA 2OAP1 1NSYA 1CUVA 4KOEC 2CFCA 9MHTA 3LHSA 4GP6A 4TS4A 3SM3A 5EL0A 3CLTC 1CNFA 3MAGA 5B3AA 3ZBUA 3IGFA 4DFPA 2JCBA 5A04A 1EFTA 5JYDA 2ATCA 2FFAA 1ZQDA 1HE2A 4MW5A 1LLCA 4NYMQ 1SEPA 1G8FA 1XYVA 3F4LA 1FRQA 3ZVMA 4UPVA 3RDPA 3BCSA 2E4UA 2JJ1A 3K71B 1QNLA 3TLXA 3B3QA 4HPXB 1DFGA 5FYQA 2I1WA 3O1JC 4RY0A 1V4VA 3A4YA 1G42A 2AXQA 3G8CA 3OU7A 1ETHA 3PIDA 5SYMA 3SJAA 1FU4A 4BEBA 1N6HA 3HILA 1J22A 2Q4BA 2HU5A 4KXMA 1RXEA 5JD4A 5ALDA 2XVYA 5IBPA 4RZSA 4BKQA 1MIOA 2VQSA 4ALIA 3ZVRA 3GVPA 5U4XA 1XRNA 1TRKA 1GV1A 4BKUA 4BLPA 5BSEA 1OT5A 3D5QA 3Q7RA 2UVPB 4MRNA 4D0RA 1IUKA 4AB1A 2J0UA 4IH1A 5F1OA 2CVHA 1GKUB 2NACA 4FUQA 4ML3A 5TE9A 3N7SC 5GIPE 1XZIA 4R1UA 5BR8B 1KZ1A 1G4HA 4L50A 3RREA 1U6JA 2LKCA 3QVGA 2IEGA 4UB8U 2PZAA 2QS9A 1HE4A 3IV7A 5J0TA 4YJHA 1PD0A 3EQZA 2JEIA 1N9KA 2H18A 2PSJA 5HUHA 2OXFA 3IUNA 3LL7A 5DMHA 3H2HA 2XIDA 2V7VA 2R8HA 2ERXA 3MPUA 1VHLA 3NYRA 4MLCA 3HFSA 4P4UA 3ZTYA 5BW4A 1QFZA 3F1KA 4XPIA 4HWKA 1VZ2A 5CM9C 1DK2A 1ZMXA 2WZQA 3RFVA 1KYZA 1PK9A 1Z2PX 5HGJA 1TJPB 3NXKA 1PL6A 3PR2B 4GLJA 4LHZA 3ROKA 2JW5A 4YCBA 1VMDA 1WMBA 1CYEA 2D5IA 4K0RA 4LTDA 1T2FA 2UV8A 3OOWA 5I5EA 3KYBA 4PZYA 3AU8A 4RORA 4N6NA 5G02A 4ZT7A 1HUOA 1T10A 2ZIVB 8ICJA 3TBHA 5J5VA 2F4VB 2CXTA 3VYTB 5LKAA 2ZBGA 3G2MA 4ER3A 1LWOA 1Z47A 2Y71A 4KXYA 1W5SA 2FYTA 4RZXA 4RTJA 3TW6A 2PHZA 4O2BF 2ONJA 5CDSA 1S96A 5KG0A 4Y2UA 2I22A 4DDTA 4I50A 3CCFA 4L3WA 3W04A 3FRJA 1PWXA 2BZSA 3NVZA 3A2NA 1TTQB 3MWEB 4OF4A 4UNSA 3M6WA 3H6HA 2OO7A 2GVZC 2VJOA 4W5NA 4CKEA 2Q9CA 1GFIA 3O31A 4YRIA 1VMAA 4TTRA 5TVGA 1PJ4A 2FJUA 2VXBA 1Z7YA 2ZJ3A 2PV7A 4Q6WA 4ENWA 2H7XA 5ERXA 3RUIA 3S55A 3V1NA 1QSLA 1N8NA 2A5LA 1XFDA 5IT9A 5IK2D 1NRWA 2I1QA 1XZBA 1G0OA 2AG8A 2QG9A 3T9EA 4C0HA 3L0ZA 1DI0A 3UJHA 2P1ZA 1XKQA 3B8HA 2JARA 2E8PA 2GAAA 3DAYA 3MXOA 5TQ0B 1A9RA 3AXTA 4TVKA 3SXUB 3TD9A 5L3VA 3F73A 1I9CA 1ZR2A 3PX4A 2RK4A 2B8NA 2YS6A 3ELWA 4WRRA 1XWIA 4OHZA 1SBTA 2HQ1A 3GEPA 1I2ZA 3O21A 2H4ZA 2XDQB 4B2PA 4J9KA 4EYSA 4BFSA 1ADBA 2Q4EA 1CUWA 3WBFA 3OIUA 3F6PA 1JG4A 1AV7A 2WWYA 3ZDYB 3EYWA 1XMIA 5D86A 1V5IA 2QB0B 4EQ6A 1UFVA 1AS2A 4OJPA 1SCJA 4RBNA 1U5CA 1P9NA 2H1SA 4WESB 5EPUA 2DQNB 3H2SA 3VPXA 2PH3A 1T8TA 4KN8A 1REQA 3V6KA 1KK1A 1QRDA 2Q9BA 2QJRA 3K4GA 5C4MA 1N6PA 4K3UA 2FOXA 3RYTC 1LF0A 4GZ5A 2P0AA 4MPPA 2AGQA 5KX5A 3EUWA 1NU6A 3ZUPA 1QJCA 2R6DA 3SFVA 1WX1A 5AXCA 4E6PA 1SOMA 4PIMA 3GPCA 5DW0A 1DZIA 2Z57A 3ABOB 5KFLA 4GXJA 4WFIA 2F3NA 4QG7A 1Y1LA 1UZMA 2ZATA 4KDCA 3G5AA 1UWCA 3PQ2A 4UU8A 2J6UA 1NP3A 1OAAA 3NTQA 5DO9A 2FG5A 4O4HB 3HBAA 4O3SA 1JFFB 1XIVA 2HA7A 3OQBA 4I99A 2ZRKA 3P4UA 4LIPD 3V4OA 4ARBA 3BJMA 1W93A 1YMUA 3S28A 1EYZA 1DEXA 1YVUA 3ICEA 4C7JA 4BGIA 4BKPA 1KFBB 1FFGA 1YFKA 2FI1A 2Q49A 3WTBA 3FTNA 1Q7BA 3LH5A 2N46A 1EUZA 5UKDA 4LXYA 4ZGWA 2C5AA 2SBTA 4K28A 4BRWA 1VG9B 4HAVA 1M8GA 1PW7A 3UC5A 4HV4A 4RCYA 2VK1A 4PYMA 4Y9RA 2A0WA 2P2ZA 4OHWA 5JNUA 3NS7A 3V8BA 1H2BA 2NXNA 4L02A 4LNHA 5K0ZA 4PGGA 1J21A 1RJDA 2ZJYA 3RYHA 4W5QA 1F9EA 1SZJG 3ETHA 4CMHA 1CUIA 2XWJI 3N07A 4TWBA 1WV1A 1T3ZA 3CJTA 3UJPA 4ECYA 2EOAA 1FDUA 3W4KA 5DB9A 4M9CA 2GILA 2IYYA 1F1JA 1TZCA 3FTPA 1ECGA 4KRXA 4C4TA 1Z7WA 2E4WA 2J6CA 4LCBA 2IY7A 4WZZA 3RG2A 3C2QA 4FOOA 2HTFA 2H1VA 4QUKA 5LD2C 3A1CA 2YFYA 2WT4A 3BX1A 2RGCA 4Q66C 3UG6A 1T4BA 2W6ZA 1HGXA 4IHKA 2WJYA 2XECA 4OXKA 1DG9A 2ZT7A 4CTOA 1JZTA 2MIIA 3DZHA 2Z2ZA 2HT1A 1AV6A 1Q83A 1Z38A 3AOGA 5JSKA 1Z6GA 4A8JB 4L3VA 4WADA 1WZUA 2YXEA 1U0JA 3RAQA 3HJTA 2P9JA 1XNRB 2CLHB 4DL3A 4GNKA 3KK0A 3RSSA 3M1YA 1OA1A 4YV1A 1C7JA 3VXKA 4CKCB 3TB4A 5I7SA 4ICIA 2MSLA 2PCLA 4MQFB 3QVKA 2PZJA 2APJA 2I3GA 4REQA 3NRJA 1Q1ZA 2QN2A 4D4GA 4I3FA 1XU4A 3EPRA 5K4LA 5K8CA 2R8ZA 4KIWA 3MFIA 4LSMA 4GMGA 4BLRA 3UJ3X 5FTLA 2CC2A 1OGIA 1VJDA 3KWJA 3M89A 3SK0A 3G0GA 1M2VA 2IZ1A 2P3SA 4Z6DA 2KX7A 3ENKA 3KDPA 3NOXA 3ONFA 3PKJA 3USES 3DMGA 2ZI9A 3CX4A 4LE1A 1KJIA 3ZKAA 4J03A 1ULZA 3GLIE 4BMNA 4CKZA 2HO5A 1ZYQA 9ATCA 1DWPA 2WABA 1IM8A 4PH5A 1SIJA 3BXZA 4HJRA 1PJRA 5CDTA 1J70A 2HBJA 5FXMA 4HGYA 3W2TA 1EFPA 2CGEA 2P2SA 3SZGA 3TANA 3B78A 1FLAA 3WR5A 1TIKA 5DB6A 3HWTA 2M9NA 3ZY2A 3RAXA 3HDTA 2WHPA 4RKRA 4XW2A 5TB5A 4DYDA 4PRZA 4PSVA 3UJCA 3KYIB 4WOKA 3W3AD 1U8ZA 3N8HA 2VANA 3EXIB 3PGA1 1U45A 4WK2B 3VR4A 1M1NA 3VU9A 3PFCA 3QTLA 3LYUA 5G3ZA 5MN4A 2KW5A 4K81B 3HEMA 2OK8A 2ZQZA 2ZPAA 1D0VA 1UKZA 1VRWA 3ESZA 1WUTA 4MAAA 4CUZA 4EW1A 3K4PA 1R8JA 1DKPA 3HCPA 4QVGA 1UPCA 3OH8A 5GWXA 3VHLB 2GUWA 2ZJ0A 1T35A 4D4LA 2NAFA 3OPMA 5A4DA 5DEOA 3NMUF 4F5PA 1AE1A 3LCRA 4C3VA 3NHUA 3EF1A 1U3DA 1N7JA 1KHHA 1GWNA 2A57A 3GEGA 4QU5A 1NRIA 2AC7A 1K97A 4G86A 4JC5A 3A2MA 4PVCA 1JPJA 4GWKA 2R9VA 3CIOA 4M55A 1EVIA 5M3BA 1SB3C 4U4AA 4QYSA 4D6PA 3TBKA 5FTKA 2BGKA 2Q4DA 1L5RA 1CEYA 3UN1A 1TGVA 4PRKA 4PXSA 3TXYA 2F1HA 2JI6A 5CNIA 4UHJA 4ABYA 3BTOA 1QG6A 3E1GA 1FFVA 4BJQA 2ESRA 4HZUA 3W1WA 3S8EA 5CFLA 2ZJ2A 1R0YA 5C5CA 4FMCF 1FQWA 1P73A 4I9UA 3CF4G 5JZOA 5K8JB 1AVTA 5KC9A 3AKDA 2YJ3A 4F3NA 4E32A 5J0XA 1N2CA 4UC0A 4YPFA 1P0IA 2PVPA 2VDMB 1D2EA 2FAXA 3QVSA 1C8VB 2NX2A 2XMQA 3DDZX 4OJ6A 1CJBA 1N5IA 1EWVA 2Y1OA 4GD3Q 1TM2A 2ZSEA 5TX7A 1Y3IA 1MA7A 3D5EA 5HE9A 1J2EA 3OEHD 3PGVA 4HUJA 3IEKA 1IC6A 4QQKA 4X8MA 5L3ZA 4DWVA 3MGBA 4UAYA 2VRCA 3ILYA 3TK1A 5ERYA 2FSHA 1UBJS 2JFPA 1U1EA 3H3JA 3NTXA 5J2TB 4FNAA 4HGNA 2HUPA 3VPSA 3Q5EA 5D3KA 1QO0A 2H1HA 4LXHA 1NXVA 3K6SB 4LF7B 1FFSA 2B4KA 3A6PC 2ZUEA 5A5VA 2NMVA 2AQ8A 2FLNA 5AHXA 3GU3A 1PDWA 2POCA 2PZMA 3EG9A 3F71A 3H1AA 2BFPA 3AF2A 3RIHA 3CKYA 3HCBA 4YXFA 3EASA 1LU9A 3M4NA 1BXRB 3IB3A 4YCMA 1ZQ9A 5BVGA 4TZ6A 3D7LA 1RRFA 1UODA 2FNAA 3IQIX 1JLHA 4OFXA 4FBUA 2RHGB 3QUCA 2G70A 3N6XA 4RVDA 4CQMB 1BGVA 4WDRA 5BPHA 1PR0A 3AWIA 3RFCA 2NRXA 1T9CA 2BELA 3G17A 4DL4A 3TFOA 4HS4A 4R9RA 1W4ZA 4BNVA 3WIUA 3F53A 2KHQA 4TQAA 5KFWA 3GV7B 3AB3A 5JNVA 2HIHA 2OILA 3QW2A 1B0ZA 3NBMA 3T1NA 4NECA 4IJ5A 1N2GA 1ZESA 4RZUA 1KKLA 3DFKA 4F2PA 4S2EA 3FCXA 1AQNA 2IYXA 4JB0A 5BQPA 3PEYA 5G0TA 1ZQ1C 1W2GA 1M1XB 1WCWA 4HBZA 5CYOA 5LQSA 5BWCA 1QP0A 3MOGA 2X0EA 1W47A 2EZ9A 3V8VA 1RI4A 4BJ3A 1V9SA 5EZSA 1NC1A 2HCTA 4ZH4A 2X76A 3FZNA 1V5GA 3JAWA 4DL6A 3MTQA 3PPWA 3R3SA 1SA0B 1X7XB 1GNPA 1HDIA 3FSGA 5FWYA 2BEWA 4F2HA 5IHPA 1NX9A 4G2TA 3MAJA 1U1IA 4YCAA 3WTCA 4B3RB 2X22A 5CB0A 2C0QA 3AJEA 4FONA 2JATA 1GUAA 4MQLA 5COQA 4BBZA 2YXLA 4DNQA 5BWLA 3IRVA 2W9AA 1YKGA 2P9BA 4GX1A 4QPCA 1FJGB 1XKTA 5JSFA 2JFGA 4TS3A 4MWGA 2CL6X 2W2LA 4CKXA 1PNOA 1ZGGA 3UY4A 1TECE 1NJ2A 3O4JA 4UZEA 1NLMA 2JHDA 2Q29A 3WLOA 3DMYA 2RKOA 1GAEO 4G36A 2VAMA 1D1TA 1F8YA 3E7WA 4L8LA 5FAKA 1E3EA 3HACA 4R1LA 4XGQA 1R6AA 1USWA 4MQMA 1JW9B 2P69A 2D0DA 1ZHOA 1TX4B 3OJUA 1F4LA 4I5GA 1DKRA 1M5UA 3GQBA 2G9RA 5E6RB 2ODEA 1C7YA 1NWCA 1BO6A 2EG9A 4YP6A 2PUAA 3SAGA 2HHWA 1AN9A 1XL0A 3C8DA 3M6FA 2R1UA 3KFLA 3QK7A 2EKQA 4PGXA 1AKNA 4G0MA 2C58A 1JVNA 5E1DA 4DRYA 1D2MA 1KI7A 1TQ8A 2ZDHA 1T0BA 2GJ9A 3QELB 1CZLA 2JH3A 3PS9A 5JS1A 1E9AA 2AJTA 3AU2A 3CWZA 3CY6A 2OV4A 3NGLA 2J3DA 4NATA 1II0A 1G291 2DY1A 3S44A 3GQBB 4M7PA 5E6RA 3F74A 1NTRA 1HYQA 4MI6A 1KF0A 5LU8A 2VPTA 1IMOA 2G7MC 5CT5A 5KDOA 1IH8A 3OQMA 4ECUA 2AMYA 2FPRA 2WKSA 3AETB 3E5NA 2CVZA 3F67A 5CJJA 1SC6A 1TQ4A 3GLTA 4CLRB 3OZAA 5KSOA 1IXKA 5F78A 1Q0QA 5A9SB 4JJGA 1BU8A 4TQSA 1NI3A 5G5HA 2J3HA 5DHSA 4ZXFA 3VBEA 1KI4A 3E2PA 5FHRA 3KOOA 2BBWA 4UM8B 3NNDA 4ZVRA 4A0FA 1ODJA 4L4UA 3ZQ4A 2ZEJA 5B4UA 1W36C 3CURA 4DLTA 2C5SA 4DG9A 1LS1A 5JEDA 3GPLA 1FXWA 1TO2E 5J2DA 4B4WA 4AKIA 5DOZA 1K6IA 4YMMA 3RKSA 3SIPA 2I3DA 1E0SA 1Y1RA 2FWBA 2C3PA 3VKHA 3PEUA 4JLMA 4IQFA 1FS5A 3M0EA 5HFJA 5IPFA 5F98A 4PINA 2C8KA 2J9FA 4GRAA 5K2MA 4W9MC 2X8AA 1OOEA 4M1TA 4E4YA 3JAWB 3TTUA 5ADVA 4KK3A 4QBHA 2OYRA 3WL4A 1X9SA 3V6JA 3G1UA 5FOQA 4FN5A 4CQNA 3FWYA 5JU5A 5I9BA 2OTCA 3W78A 4DLPA 3IAEA 8MHTA 1OV4A 3A36A 1Q17A 2IHVA 4KQJA 5FRDA 2RAVA 3GT3A 2MCFA 1DXSA 5JECA 2O1WA 3CPEA 4KJXA 2O8DB 3TLAA 4F8EA 2YOFA 4KFUA 2O4UX 3L41A 3GT7A 5DM1A 4JC0A 4P8RA 3GRPA 3IDAA 4QNMA 3E5RA 2WIDA 3C5WP 3EBPA 3GVXA 3C14C 4NBUA 1YUMA 3UOAB 1D8YA 4AKSA 4W99A 1XJ0A 4GOOD 5JAHA 1M6VA 5AWFC 1BQ4A 2JKZA 3AI3A 3BIWA 5EHIA 3E2EA 1VC2A 4JBYA 3SBEA 4YT8A 1NF2A 1VKNA 5FJJA 2B7BA 4M87A 3K1RB 3I6ZA 4NP6A 1U9CA 3ENWA 4C87A 3GLKA 4XWWA 5KREA 4R66A 4BMOB 3ERCA 3X1WA 2ATLA 1ZUHA 1XRPA 2DLDA 3VGJA 1IBKB 4LYEA 3IPRA 1KR2A 2NO0A 1V95A 2HK6A 3LP8A 4KL8S