3CNHA

Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
200
Chain Sequence
GMTIKALFWDIGGVLLTNGWDREQRADVAQRFGLDTDDFTERHRLAAPELELGRMTLAEYLEQVVFYQPRDFTPEDFRAVMEEQSQPRPEVLALARDLGQRYRMYSLNNEGRDLNEYRIRTFGLGEFLLAFFTSSALGVMKPNPAMYRLGLTLAQVRPEEAVMVDDRLQNVQAARAVGMHAVQCVDAAQLREELAALGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (NP_295428.1) from Deinococcus radiodurans at 1.66 A resolution
rcsb
source organism Deinococcus radiodurans r1
molecule tags Hydrolase
molecule keywords Hydrolase family protein
total genus 73
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3cnhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cnhA01
3ZVNA 2CFRA 3QUBA 3PGVA 1N9KA 1TJ4A 3L7YA 1L7OA 4C4RA 4NABA 1L7PA 4HGRA 5AW4A 4DCCA 3OPXA 2O9JA 2NYVA 2IOFA 2YN4A 3MPOA 4OHFA 3AR5A 3E84A 4UARA 3WK8A 3SF0A 3WK7A 2CN1A 2YJ6A 1RLOA 4YH1A 3BA6A 2G07A 3HYCA 3SHQA 3ET5A 5AM5A 3KC2A 2W43A 5AM2A 3AR8A 3QUCA 3DAOA 2OYCA 4FYPA 3CNHA 2B0CA 2W11A 4GIBA 1NNLA 2R8ZA 2ZBGA 3WK5A 1Z5UA 2FPWA 2BY4A 3N8GA 5AKHA 1ZD2P 2WFAA 4OFZA 3ZUPA 1SWWA 4BEWA 5AW1A 3R9KA 4NWIA 3L5KA 1Z88A 2I33A 3FVVA 3ZX4A 1NF2A 1U2SA 2YMLA 1Q91A 4KX5A 1TA0A 4YIHA 2C4NA 1EK2A 5A3RA 2YMMA 2B30A 2HEGA 2OA0A 3E58A 4B6JA 3N07A 5ALHA 1VFPA 3I1YA 2I6XA 3I6BA 5AI8A 3FZQA 2HDOA 4Y2SA 3I76A 4KYTA 3KBBA 4GXTA 2JARA 4HGOA 4UU0A 5AW0A 1RPZA 3QLEA 3B8EA 3SKXA 4H1WA 1RLTA 4Y2RA 2G1AA 3AR9A 3U26A 2DQSA 3B9BA 2YJ4A 3L0YA 5AM0A 3KZXA 5ALLA 2EARA 4UMDA 2O2XA 1RKUA 4JB3A 5ALZA 4DW8A 1WR8A 2GHTA 5ALYA 3EWIA 2B1RA 3EPRA 5T41A 2HCFA 1Z4LA 2I34A 1Z5GA 2GFHA 3U7GA 2GHQA 2FPSA 2FEAA 2FUCA 1RQLA 1QYIA 5AM3A 3NANA 5ALRA 3A1CA 2C8LA 5AK5A 2FPRA 2G06A 3N28A 3E81A 5AW8A 2ZG6A 5AK3A 5FP0A 4YIKA 4OD0A 3MC1A 3NRJA 5AKZA 4Y2PA 2IYEA 1YJ5A 1X42A 1EK1A 2IOFK 3DNPA 3OCZA 3OCVA 1T5SA 1LVHA 2MU1A 2HO4A 1L8LA 2AH5A 4J03A 2EATA 4YGYA 2YMQA 4F71A 4UASA 4QJBA 2FPXA 2B82A 1O08A 1XPJA 3KD3A 4EEKA 4BNDA 5AVZA 3R09A 5ALXA 5ALOA 4XQ0A 1Z4PX 1Z4NA 2ZXEA 3IJ5A 1L6RA 4G63A 1F5SA 3WGUA 5AI0A 4Y2XA 2I55A 4EX7A 1RKQA 3N1UA 3U7FB 1S8OA 2AMYA 3N5KA 1WZCA 2HSZA 3W5BA 5AIBA 4CF3A 2P69A 2W4MA 1RLMA 3U7EB 3RF6A 2BDEA 1PW5A 3U13A 2YMPA 3ZTWA 3PGLA 5AVQA 3QU2A 5AI6A 3L1VA 3L0BA 2WF8A 2WHEA 3QGMA 3NASA 3WK6A 3NAMA 1JUDA 4CE6A 2YBDA 1CQZA 4O8CA 5AIAA 5AHXA 5ALKA 4KN8A 2WM8A 1TJ5A 4BYGA 3FM9A 3OCWA 2RAVA 3W5CA 3M9LA 5AI4A 1J8DA 4UMVA 1T5TA 2MSNA 2C9MA 2ODAA 3OCUA 3L8HA 4ZEXA 2Q4RA 3WKAA 1U2TA 4HGPA 3ZVMA 1L8OA 5AW9A 4UM7A 3ZU6A 4AP9A 2HX1A 4DWOA 1RKVA 5AK6A 4I9FA 2CFTA 3M1YA 2P27A 1RMTA 1Z4KA 5AVUA 4AS2A 2ZOSA 5E0OA 1U7OA 1WPGA 1TE2A 3W5AA 4YCNA 4UM5A 1YNSA 2ZBDA 5AI5A 2RB5A 3QUQA 5JJBA 2GO7A 5ALUA 3SKYA 2HHLA 3QUTA 1RMQA 5IT4A 3SD7A 1U02A 3ESQA 3L0CA 3U7HB 2HF2A 1QQ7A 3W5DA 3KDPA 4J2TA 3OCYA 5AW5A 4BKMA 5ALGA 3L1UA 2NO4A 4L6AA 2FDRA 2JAUA 5IT0A 4YCMA 2RBKA 3FPBA 1IWOA 1ZD3A 3L8FA 3MN1A 3QXGA 3QU5A 2JGAA 2I7DA 3L8GA 2VKQA 2ZBFA 4BBJA 2JAOA 3QU4A 3EF1A 1KYTA 4UMFA 4Y2TA 3WKEA 4KX3A 2QYHA 3ZWDA 2AUTA 3QYPA 3FGOA 4EELA 2NO5A 5ALFA 2EAUA 4Y3UA 3AR3A 3NIWA 2AGVA 2P11A 3AR6A 3OCXA 3WKDA 1WVIA 5ALTA 2Q5EA 5AI9A 5AM4A 1NRWA 4HYTA 2YFYA 2CFSA 4Y2VA 2WF7A 3F9RA 1YS9A 4YCLA 3QU9A 2HI0A 3FPSA 3RFUA 1SU4A 5ALQA 3P96A 4QQFA 3WKCA 1S2OA 1YMQA 4Y2UA 3A1EA 2GMWA 3A1DA 1RQNA 4OCZA 2R8XA 1FEZA 3B9RA 4UU1A 3ZX5A 1Z4JA 5ALSA 4KNWA 1XVIA 4MWOA 1RC8A 1SWVA 5AKIA 4L6CA 5AVWA 3PCTA 3L8EA 4NV0A 3S6JA 5AVTA 4XOUA 5AW6A 5AKLA 4XE5A 5AKGA 5AESA 3E8MA 4G9BA 5AKYA 1ZS9A 2FPUA 4BNDB 3IRUA 3K1ZA 5ALMA 2YJ5A 3ZW7A 2HOQA 3ESRA 4L57A 5AVXA 1YV9A 4BX3A 1Z4MA 1XP5A 4AS3A 2P9JA 3D6JA 3ED5A 4BX0A 2R8YA 3MMZA 1J97A 4CF5A 2D2VA 3UMGA 4HGQA 1Z4OA 2C8KA 3AR2A 5AKEA 2PR7A 1ZRNA 5AW2A 4DFDA 3QU7A 2YJ3A 3ONNA 2JAWA 3SLRA 5AW3A 4UMEA 1Z4IA 4Y2YA 5AKJA 4E88A 2B8JA 4IG4A 3U19A 1Y8AA 2RARA 4KNVA 5IS2A 3WK4A 4UAVA 1L7MA 3ET4A 4Y2JA 2C88A 4C4SA 2IA5A 3ZVLA 2OM6A 2FUEA 5ALIA 3DV9A 3SMVA 2B1QA 4UATA 1ZD4A 3ZTYA 5AM1A 5AVVA 1N8NA 3I28A 1QQ5A 1Q92A 1L7NA 2PQ0A 4C4TA 5ALWA 4CNQA 2OBBA 3AR4A 2WF9A 5ALJA 5ALNA 1RRCA 4IFTA 4I9GA 2WF5A 1TJ3A 4NAVA 2IOHA 2PKEA 1YDFA 3QNMA 3WGVA 5AVRA 3UM9A 2G08A 3R4CA 4Y2QA 3WKBA 2X4DA 3CZ4A 5ALEA 5AW7A 5AK4A 4UW9A 1O03A 1Z4QA 2G80A 2QLTA 1U7PA 4XPZA 3ZWKA 4BEVA 4FFDA 3UMCA 3GYGA 4UAUA 4FE3A 3A3YA 3J7TA 5AVSA 5ALDA 1CR6A 1RMYA 1ZOLA 3NALA 5ALVA 4ZEWA 3DDHA 3TLMA 2R8EA 2Q4TA 3QX7A 2YY6A 3AR7A 1ZRMA 4BX2A 2I54A 3VAYA 1QQ6A 2HF7A 2B8EA 1K1EA 4CF4A 3PDWA 4NFLA 4RETA 4ZEVA 4JDPA 2BDUA 2G09A 1LTQA 5AKXA 3EF0A 5A3SA 2FI1A 5ALPA 4HGNA 3KOOA 4HAIA 1ZD5A 1T9ZA 3UMBA 2G0AA 1VJRA 3NUQA 4RESA 1QH9A 5A3QA 1VJ5A 1RDFA 1AQ6A 3OTQA 3BWVA 4EX6A 1ZJJA 4PNHA 2WF6A 3WK9A 3HLTA 2ZBEA 3IB6A 5AICA 2MU2A 1MH9A 3ZI4A 5AKKA 5AVYA 4EENA 4MUMA 4F72A 4EZEA
chains in the Genus database with same CATH superfamily
2VFAA 3UFXA 3DVSX 4MVYA 3C1AA 3LOPA 3EUAA 2W04A 2W7PA 2D62A 3KZOA 1JHQA 3KWJA 2BHNA 1M6YA 2WOJA 1JEYA 2X14A 3Q8PB 1KBQA 1R2QA 2OCPA 3MW8A 4OIMA 4RA6B 1DXOA 1P5HA 2QD2A 4XGNA 4LZJA 3OJUA 3N2GB 4DIDA 3RTCA 2H4YA 2P4EA 1A8UA 2QJOA 4BPRA 3OQ1A 1NK7A 4HDSA 4JBLA 3D0KA 3B1YA 5HZHA 1WPRA 2IHTA 3HKZF 3IJPA 3BAZA 2KLHA 3T99A 3F4LA 1ZH0A 1KEUA 1TL7C 4LZNA 1XLWA 3CO5A 4G0PA 4Q4AB 1FXUA 1U7XA 4KKXB 4P4UA 3T7DA 1PTJA 3EE6A 1N7HA 1T1GA 2MSEB 3PWSA 4JROA 3EGWA 4R9SA 5J47A 4KWIA 2JGDB 4NOMA 4TQAA 3M6WA 2Z5VA 3U3KA 4YY3B 4KRFA 1MC4A 2GESA 2OHXA 3PVSA 4FMCF 4MPJA 4WXYB 1AB6A 4KO8A 5AOBA 4DLAA 2B34A 1E2LA 1Y3DE 3QUCA 3VR3D 3GXBA 4MUFA 3VNSA 1Y9JA 4JJFA 2FZKA 1Q83A 2F1HA 1K8ZB 3DBRA 3PSIA 4YPOA 5DW3A 1Y7PA 3TAQA 1TF7A 1MQAA 1D5WA 5DGDA 3GFQA 4PZAA 4QJ5A 3G68A 2BR4A 2C9YA 4G36A 1HSOA 3DOHA 3I0NA 3C87A 4KXFB 1E7YA 1PZHA 1OASA 4F93B 4B3JA 4R2XA 3SIXA 1DOAA 5FPKA 5JQGA 3KTOA 1PNOA 2WP0A 2QPAA 2XUOA 3G13A 3OCCA 2XT9A 4FFNA 1Z88A 5EERA 4KGZA 5E4TA 1U8YA 2ETVA 4FC6A 3TCXB 4PICA 2QB0B 1HKUA 1FQKA 3IHQB 3NEAA 4II2A 1V41E 4R8SA 3RTEA 1OUQA 1X7WA 3HBLA 3MS2A 1WL8A 3OZFA 4DSOA 2JIMA 2HUNA 5DBIA 1WXFA 3L1IA 4LTDA 3SG0A 3FMGA 4BP3A 5JISA 1UP4A 3IP5A 3EH1A 4O3SA 3QK7A 3U7IA 3RJHA 1CKEA 1WF3A 2FEPA 2OO5A 3P0RA 4YTEA 3LECA 2NUTA 4P36A 4A3SA 1P2VA 3K4PA 4EKNB 3FC4A 4XARA 4K8RB 2PFNA 2W03A 5IN5A 3RSFA 2L5YA 1BEEA 3UOAB 3AERB 3T3GA 3DS8A 2QRZA 1CUEA 1FFSA 3FCCA 1NVMB 2PU5A 2R00A 2WD8A 4JLAA 3V3TA 3KZIU 3W90A 2XYVA 3PQDA 3QTTA 3PQ3A 4NCAA 4ZMRA 2CMKA 3FCSB 3M7IA 4NK5A 2ZVDA 2QX6A 5EJGA 4MR7A 1TLFA 1QGUA 3PC6A 5J1TB 1YCHA 1NP6A 2BONA 2IUSA 3AR9A 3GGDA 3TJZA 4P3YA 4BNUA 2HD4A 3TSAA 2FLLA 2J3IA 1VRVA 1NDQA 3PDUA 2GBLA 2YWGA 3HV2A 2O2XA 2PS9A 3EOBI 3I1FA 3K1TA 4I1RA 4INJA 1YIDA 3SZLA 1FTSA 4IO1A 3TSYA 1ZGBA 4PAOA 3EEBA 3MJFA 2QM0A 2Y1EA 5TF0A 2VSYA 1JFLA 3MT7A 1DAGA 4EHDA 3PUIA 2H5JA 1L5LA 3HL4A 1KI7A 1OLOA 3PT9A 3H40A 5F9MA 2FUCA 4FOPA 4NYIR 2ZVPX 5FUWA 3WY9A 3FZNA 2MR5A 3KPUA 5ES3A 1PVPA 2FPPA 3P26A 1AK1A 4X92A 2XICA 2VS1A 2PEYA 3F6EX 1O0CA 2J67A 2BHRA 1FFBA 4OOEA 3U6KA 2NPIA 1WD5A 3LY7A 1P1BA 2PI4A 3FAKA 5AHKA 3EA4A 4OQXA 3UJDA 3DE5X 3ZWMA 2BZGA 4Y2PA 3P2KA 4O1HA 4AQ7A 1GYPA 2Q1WA 1C3EA 1GO3F 2ZRFA 3LNTA 4JIGA 5FOWA 5SY6A 1RKXA 4MIEA 1RHQA 4BO4A 5JUWA 1WMFA 3ROGA 1PG2A 2PFKA 2JLZA 1P60A 2FH5B 2G5CA 2JFYA 4L22A 2IUUA 5G1PA 4YGYA 3RC2A 4HNAB 3I61A 4OGLA 1NKTA 5C46F 1ZQQA 2O14A 4NR0A 2HQSA 1U4OA 1C14A 1FUIA 1GNVA 2RFLA 2IHYA 4H1HA 2PMZF 3F8SA 3EGXA 1NUSA 2PRJA 3E4CA 5KYGA 2HQOA 5AVZA 5IZCC 4UCQA 5JC1A 3I58A 2W6NA 2YNMC 4HB4A 4IIJF 2I80A 4RZSA 3G6KA 2XI9A 1Z4PX 4PBSA 1T2CA 3PQ8A 2OHJA 2IF2A 3PUXA 1JDVA 2GD0A 3L2OB 5P8WA 3UV6A 1ECBA 4LXYA 1LU9A 1XQWA 2B8NA 3NDRA 4EKYA 3EPIA 3ACDA 3K70B 1RXUA 3PW7A 4DL6A 1AS2A 1E0JA 5E3JA 5EMNA 2AL7A 1BGVA 1H8HA 2Q2WA 5B1DA 4WBSA 2DPGA 3DM5A 3EBLA 1SQ5A 3DC2A 3KYJB 4DDKA 3KWLA 4QLAA 4M9HA 1RHUA 1IQ0A 3DQPA 3WWYA 1B15A 3DWGA 4PYMA 3DEKA 2PJDA 1GRRA 4FWIB 4QD3A 3U13A 1W9MA 3U3JA 1ONBA 3ZQ4A 2UYYA 2Y0SC 5ICCA 2ZR8A 1FFEA 2I4TA 5CIYA 5IIIA 2ZUSA 3L0BA 2WF8A 2ERYA 3EIUA 1VYTA 2DH6A 3MAAC 2DE0X 3OQIB 3QGMA 2GPSA 2VHCA 5TR9A 2V0CA 3K0AA 3T5DA 4ALIA 1L4MA 3LP8A 4Z4CA 4ITUA 2ZWVA 3BL5A 5KWVA 2R48A 1T3NA 2JH8A 2V6JA 5GTIU 2WM2A 3QWFA 1HM5A 2RH4A 3I6MA 3WWZA 4P84A 5F2KA 3ER6A 3LIPA 3B6IA 5AIAA 1OA1A 1ZNYA 4XIYA 1M7BA 5EPEA 2CLHB 4FONA 3ROFA 4RDXA 1NL3A 1DAKA 2NV3A 2VQSA 4N65A 1F7VA 5BSUA 4KVGA 4U3JA 3KRTA 2R4TA 1GPYA 4FD3A 4INOA 4RC9A 1YRAA 4Q9DA 2MSNA 1B0PA 2C9MA 2P2LA 3KKLA 4KR6A 5BMVB 1B1AA 2DVMA 1JG1A 3DTYA 2G70A 4GFDA 4JC0A 2LMRA 4X8MA 5FADA 3N2KA 4C22A 4DEYA 1VPVA 2G5HB 2GPYA 2ZTSA 1RE0A 1G18A 5J0SA 4GPTA 5CXSA 1EESA 2YWDA 5JEEA 1ECLA 4DLSA 4EITA 1JIVA 4CM4A 5G1NA 1W0KA 1U80A 4RENA 2ANBA 5H5JA 2X0JA 1RWMA 3ZLTA 2JIOA 4PVDA 4FS8A 3R3JA 5B7PA 2PKCA 4GOJA 1C7ZA 4BN4A 5JWOA 4QDOA 4TYNA 1L5HA 3ZS8A 2IPLA 4H4CA 1GKUB 5FL3A 3R5HA 3A04A 4MIOA 1ATIA 4BNNA 1VJTA 1NT4A 2KZZA 2MYNA 2GD2A 1W87A 1KW4A 3RIXA 1Y3CE 3T54A 1HMPA 1Y3FE 1NVEA 3M5DA 3SKYA 2XOKA 4BQEA 5LQNA 2VSNA 3N53A 5K20A 1XRQA 3EZ9A 4KO2S 4RD1A 2JI8A 1N3YA 5D6NA 4Z6FA 1CIVA 5J0PA 2FETA 2FMQA 1P7YA 4CGYA 5HIAA 4GDFA 4XCXA 4XLLA 4AMGA 2HHHB 2Q8NA 4GE0A 2P9EA 3VOBA 4TTAA 1WV1A 3PEEA 4MR8B 2YIJA 1KYVA 3N2EA 3QWIA 2BCUA 3K35A 2ENUA 1DC5A 4LJRA 3OF5A 3TOSA 2WSYB 3L8FA 3CRZA 2DBQA 5FKJA 4AWBA 1YA4A 4IZIA 4AI6A 2CDAA 5IIMA 1U6KA 4R71A 4Q7MB 2CL0X 1U90A 2P2ZA 1WXIA 2KW5A 1XSLA 4L5CA 5H9VA 2HGSA 3LT2A 1OBVA 4V2UA 5C5JA 3NIDB 3OE7D 3WMRA 3H5NA 3TQIA 3WOHA 1UP7A 2Z58A 3H7IA 2TMKA 4GXQA 3GAMA 1UBUS 4TLBA 2LCQA 2QRKA 2VUTA 3LH5A 3FGOA 3P2JA 3ST7A 3JVIA 3RLIA 3RRMA 2YWXA 1U98A 1HE1C 2XRFA 1GNRA 3ICOA 2X5KO 4H7JA 3TUJC 5CX4A 5JECA 3IL2A 2ZAOA 3U7RA 1D6SA 4LJ7A 3LUJA 1KS2A 1QE3A 3O4FA 1S77D 4MYCA 1JIHA 3NOQA 4ZQHA 2VJNA 1JI3A 1SCIA 1ZUNB 3CE6A 1MA7A 4IM7A 4FHEA 2Q5QA 1GG8A 2K5UA 3EIEA 3QU9A 2QLMA 3PI7A 5A4KA 1FNDA 3KQYA 3BIOA 8ICUA 5DCLA 1CR0A 3EH2A 4MJXA 2O6KA 4HB2A 4AN1A 1UZMA 2REBA 5FLEX 1A04A 2BEKA 2XDAA 4RJKA 4MQUA 2KWIA 5GINE 1E2JA 1W75A 1WKVA 2FZ4A 1KFCB 4GHWA 2HMSA 1CBUA 4FYMA 1HT3A 4Z9YA 4OA8A 2EZTA 1TI7A 4OHYA 1C50A 3CISA 3HUDA 3TRFA 3VGJA 1KEWA 1JEJA 2B4YA 4AECA 3SZOA 2G5GX 2OGUA 2JFGA 1NTOA 3CGWA 3MBIA 4FYWA 1UK6A 2N9UA 3WO1A 2CLEB 5ISMA 4Y30A 2RDJA 1F2VA 4E5KA 5BPFA 5T7BA 5JAPA 2OB2A 1V7QA 4Q48A 4BNVA 3B9JA 4PLZA 3VUFA 2RQ5A 3GY0A 2C8VA 1V11A 5HW0A 1JW9B 2BMEA 2HJSA 3ONEA 4MI6A 2QBYA 1ODSA 4G9BA 1K8YB 4TVOA 4QOSA 4PR0A 5TQ2B 3PF8A 1KY4A 2HM7A 4JUDX 5J2UB 4D3YA 3KQKA 1M2EA 2QE7D 2GLEA 2XUFA 4IFIA 3G2OA 4LWQA 1N8KA 4JJAA 4QDKA 1UKVY 3HDVA 3WQHA 1BG6A 2DWUA 2H5EA 4UBKA 3BWEA 1QUFA 3HNPA 5HGJA 2FWPA 1CUSA 4HQRA 2XCOA 1NKVA 1SHKA 5A7FA 3Q3VA 2I4NA 3MRTA 1QIEA 1UF9A 4G3XA 4OQQA 2FXVA 1KK3A 2FSGA 2MSLA 4HDQB 5DM60 4KZPA 4LV8B 2H8KA 2PH5A 3CJTA 1D1QA 3E7DA 2PRIA 3GFGA 3WSWA 3FAZA 2NT4A 5CIWA 2XZDA 2BVNA 3NRZA 1P5JA 3QE3A 1NN0A 3EPLA 4E2FA 4NNPA 1Q0UA 2N42A 2J41A 1DKNA 3PX6A 3PEUA 4BQFA 3GFKB 2AJDA 2FPPB 5KWJA 3TADC 2PG3A 4B9EA 1JBQA 4CMKA 1FTQA 2J4DA 3JALB 4IDBA 5BXQC 3Q10A 4ZVPA 3A6ZA 2HOIA 2GCPA 2FLPA 3C15C 2PGJA 3OLVA 1M74A 4EBCA 2MYPA 3L8DA 3KL2A 3D7RA 2KVCA 2FCAA 5D5QA 3BS5A 1CRWG 3JRNA 2J6IA 4CKCB 4HAOA 1RZRA 2IYRA 4URZR 4R16A 2YFHA 1D6MA 4L15A 4AO8A 2AF4C 5KL1B 3FD8A 1E18A 3ESBA 3L6DA 5J5VA 5FI3A 4C4SA 1JSXA 1MC1A 1ZXLA 2GAOA 3KWMA 3SDBA 4HUTA 5EE5B 1ZH4A 2VZ9A 4FNOA 5EWLA 5IH3A 2PCLA 4RZQA 4BXOA 1QF9A 4V02A 4B6QA 4DL3A 4WOBA 3T5JA 3V8EA 3LK7A 3I2JA 5B12A 1QQ5A 2X5OA 4GUDA 2IZZA 3EUFA 2AQ8A 3KKOA 1N6KA 4DF3A 3THVA 3ZK7A 4QDZA 1HRKA 3ZHTA 3RRBA 1KETA 4FGSA 1LRKA 2QN9A 4I9GA 4I50F 5D8DA 4FZ5A 4LY0A 4OYLA 1XQ9A 4ZRNA 3W9SA 2HBZA 1OYOA 3SEFA 5K7SA 2HC9A 3ZEAA 3PJFA 4PGYA 5E7JA 3T7KA 4CIXA 2C0QA 3AZQA 2XBLA 3IE2A 3OE1A 4Y2QA 2DT8A 4FT4A 5ALEA 1Z18A 4NBWA 5LQSA 4GI5A 3CUKA 2BGIA 1D4FA 3RB8A 3RKSA 4OMDA 4RXMA 1DLJA 2O52A 4AYTA 3GEBA 5DN9A 1TZJA 1UDBA 4ZVOA 1CYEA 1UJ4A 4QRHA 1ZUIA 2Y4NA 2XCPA 3GPCA 4PX5A 4F3OA 1W36D 2VXOA 4YJ3A 3R5KA 3RUPA 4CL3A 1UHUA 4HZIA 4CTMA 4MARA 1YVUA 4FNMA 4LRYA 4O25A 1YCDA 3J7TA 3P2EA 5FD8A 4QZ9A 3PWTA 2G4CA 5J0XA 3OU2A 4L74A 5CP8A 4H3KB 4ZAZA 3T7IA 1ZONA 3VDMA 4GM0A 2OAEA 3FBGA 2ABWA 1G41A 4C0BA 4C08A 4EEZA 2J6SA 2I6UA 4F3CA 5JYDA 1JR2A 2XCIA 3EB9A 5JZVA 3QW4B 2JD0A 4L4RA 4P7FA 1AMOA 1HF3A 1AT1A 3DDHA 4DQXA 4NNJA 4TSFA 2OVBA 3M4JA 3MLEA 1SPBS 4U3JB 2VG8A 1CZLA 2NV0A 3B6ZA 4GNKA 5J5CA 1MX9A 3PIRA 5JYBA 1DI0A 4WEOA 4M6WB 3LWLA 4CF4A 1F6DA 2OQRA 4JGBA 4EB6B 2QQFA 4QZAA 1B42A 1VIMA 2V7XA 3OUZA 2OV4A 4K2HA 4LZWA 5CVVA 3QI7A 3VR6D 5IYZA 2EERA 3A28A 1ADBA 4LQLA 5IVDA 2HJRA 5LNK1 1GG5A 3NOXA 4Q4CA 3LPAA 4H7PA 2O57A 3F3KA 2C2RA 5IAAA 2F3SA 1WMDA 2HQRA 2BF4A 2O6LA 1LVGA 5HJ2A 4HAIA 1UKAA 1D5CA 3UMBA 1QYDA 4YAEA 4I99A 5BT8A 4S24A 1KQGA 2PCJA 4M0EA 1R8JA 1ZL2A 2CLFB 4V39A 2HA5A 2DKZA 5LP6F 4AKEA 3QPCA 2KKPA 1EJ0A 1GDDA 1W4LA 3DQQA 5K8TA 4CLRB 3IXMA 3UGTA 1RDFA 2DUMA 2W54A 3AONB 1DFGA 2H9YA 1ESNA 4R8KA 2O1XA 2H7CA 4LF8B 2JCBA 1GPH1 1QRAA 2PJZA 1U1IA 4I2VA 1Z2CA 1U28C 2P7HA 4QFDA 4X95A 1YR8A 1HQYE 4Y1FA 2PRSA 3U0VA 3D2NA 5DB4A 1XPRA 1A98A 1OILA 4QZVA 3NVYA 4OG2A 5C8ZA 3PTAA 3M8KA 3H3XA 4MUMA 1YE8A 1VMKA 4C6TB 2BPFA 4M36A 4I36A 4IX9A 2I2WA 3E0QA 4P22A 4F5ZA 3C48A 2XH8A 5KKAA 3WDKA 1WB9A 3OZAA 3GLHA 3GBVA 4ND8A 4DCCA 4NX2A 4GX2A 4RDHA 3RC7A 3P9PA 3WDSA 3IIJA 4F3KA 4FZNA 5EZQA 4RF2A 2XVYA 2QN6A 3F9CA 3WNDA 1SC3A 2Q29A 3E84A 1C3OA 1KAQA 1Q74A 1NXOA 1IFXA 4F46A 3MCTA 1B0AA 3SF0A 2ZUFA 4KUEA 4XB1A 2OD2A 3NYQA 4KAJA 2DHDA 4H0FA 2E5SA 4KR9A 2I1VB 4QRDA 4K9KA 1ODJA 2ONYA 4OGWA 2BBWA 3E7XA 1S3GA 2IIPA 3MBYA 3PUVA 1CXZA 2QSYA 5DX1A 3HLYA 4PAGA 3VX3A 5HKKA 1CLEA 4MJLA 5F4ZA 2ECPA 3R8CA 3S2SA 1CQPA 1HL3A 1UBHS 3NBKA 5TEWA 1F2UA 3EGOA 4F56A 4HXEB 4J0GA 3GLGA 3F4BA 1EVJA 4DT1A 1BXZA 1P4SA 2CCGA 4FYPA 4HNGA 3KB2A 3LNCA 5HFJA 4H7FA 2QRJA 1BVHA 3A6HA 2VHVA 1T10A 3IUQA 3ZY2A 3KLBA 4I2IA 4XX0B 5A05A 1QP7A 4L6IA 1YC5A 2GPAA 2PNJA 2JEGA 5CHEA 3GOHA 3QBDA 1O54A 1KTQA 2H1FA 1JXOA 5H4HA 4DLTA 2OOKA 3W2GA 5L7WA 5L1MA 2BCGY 2RLTA 3L5KA 2BJHA 2O7VA 3BJEA 3AUTA 1JQKA 1MO5A 3QFCA 2OFOA 3TPZA 5A7GA 3DMRA 3JPSA 3V5NA 1KR2A 2I33A 3FVVA 1U2SA 1N4DA 1NX6A 2YMLA 4ZT2A 7ICSA 1QH8A 4M9CA 3VHXB 5AFSA 4X6LA 3ROXA 4EK9A 1LVUA 1EK2A 3Q9LA 1PS9A 4P82A 3M1AA 4M4SA 4WN3A 5TVKA 5FA5A 2OA0A 1V11B 1Q3VA 1AIPA 1XU7A 4Y6QA 2IWRA 4MFCA 3SHOA 1Z2NX 3BMOA 3KYIB 1PG0A 3BSYA 1TVMA 1KO1A 2VK1A 4M9QA 1MHTA 3FPGA 3HK2A 1DAOA 5DISB 2IXDA 1KE1A 4FDLA 2WV7A 3JVDA 1SZHA 3UC9A 1ZLYA 2K6GA 1RHRA 3F3SA 3OEWA 2YIDA 3JR7A 2AYXA 3VR2A 1MEEA 1R0XA 4PG4A 4CFZA 2EVWX 1V25A 2WPDD 3TAUA 4BDPA 3NHYA 3OTHA 4I55A 4JIMA 1C0EA 2LM4A 3QX9A 1BEZA 4LNUB 4ZC1A 1AB5A 4WNIA 2OHFA 4IQWA 4I2CA 1NM5C 5CWRA 1M2HA 2GSWA 4BO3A 2BI4A 4QULA 3QIAA 2E6UX 2W2QA 3EEYA 4QHTA 3LKDA 2GBLC 4MVJI 3PFIA 5ECGC 1E94E 4WW0A 3T3PB 3UXMA 3IDFA 1SCUB 1MQ3A 3FPLA 3HB4X 4K5QA 4ZJPA 4HSEA 4FYIA 1RG6A 2N46A 1D7AA 4DW8A 4NC9A 1OSNA 3ORFA 1GG2A 1K6IA 2LE0A 2W48A 3EPRA 3N76A 2D74A 2R6R1 3LFUA 1VBKA 1EPUA 5FI0B 1CRLA 2I5PO 5C1IA 1VYHA 3SKVA 3VZBA 2EH9A 1ZD1A 2FW8A 3LRTA 3B1FA 4C0XA 3DOUA 1YTUA 5LXTA 4Q34A 3JAMA 4TZ6A 3RUHA 1M5UA 3AVUA 3SQNA 3FYUB 4MKGA 2WSIA 2Z2YA 1JLHA 5EZSA 4JL8A 5HIMA 1O4VA 3BTOA 1I7LA 5JBIA 4IW3B 1LS1A 3EF3A 2G1PA 5BPHA 4BMOB 1UK8A 2Q5IA 1OI2A 3AP1A 3G1TA 4BFZA 4DY4A 1X42A 3DE4X 2JBWA 1NULA 4H6PA 1OXMA 1Z83A 3O0DA 5KFPA 2BCSA 2VDUE 4N1AA 5E9JA 2MU1A 3IXLA 3WB2A 3X0DA 4DIMA 2B36A 3O95A 4FFSA 3K9NA 1B6SA 2Z9BA 4XSVA 1GYQA 1LI5A 3AEYA 4M0UA 3T35A 3HBNA 2NSJA 3E9MA 3KOZA 3NORA 13PKA 1E4YA 3OICA 3JU3A 1BFDA 1WUYA 2WUWE 3PNKA 5DWQA 2Z3WA 4OKSA 5EUBA 3URKA 4V0ME 4PPFA 4F4UA 1B00A 1NBIA 4KVFA 1NIJA 3AEQA 4EEKA 3L7OA 3R7SA 3T5AA 10MHA 3EWSA 3HQ4O 5D3KA 4AAYA 4LF4B 2AKEA 4N48A 1YGYA 3GLSA 4V0NA 4J1SA 2O8NA 2WHPA 3DDOA 1COKA 3BH6A 1TYBE 1YQEA 4XQ0A 1UXOA 3RT1A 3PRJA 3S4YA 3DZGA 4DDHA 5K8VA 5AI0A 4M9ZA 4X1YA 1F3LA 4J3NA 1SXJC 4RL6A 3WBKA 5F33A 3MIIA 3HCAA 2AMYA 3JS5A 2WJ3A 2EQYA 3T38A 5JSUA 1X1DA 5K8IA 5HOEA 4DA4A 3DLCA 2WAMA 5AIBA 3D2LA 3OQHA 1XNHA 3H5LA 3NONA 2OHIA 2QTFA 1L4UA 2YYAA 3EVCA 4DMGA 4MDEA 5LDDC 1SOVA 3W9YA 4N8SA 4J7XA 3U7QB 4MMXB 3K6SA 4IZOA 1P4GA 3T4UA 3TZHA 3WU2U 3PGLA 2X41A 5AI6A 4NKRA 4EJ0A 4B76A 3NVKI 2ZUWA 2C78A 3H9QA 4EHJA 1I7NA 5CK4A 3PFCA 3GROA 3UJBA 4AMUA 4B0PA 3E7PA 2AR0A 1AHPA 3PO4A 1FDIA 1JHZA 1NJ8A 3LY8A 2YZ2A 1V3VA 1EFVA 2J3EA 2YNMA 3NW9A 5G53C 5AUNB 1IJFA 1AGNA 4QC2A 1F60A 1E96A 3O3NB 3CLTD 2B9EA 1XTKA 3IDSA 3O38A 2V7EA 4D79A 4M6WA 2J8ZA 4EYOA 1X66A 4YCXA 2AXPA 1TJ5A 2BGRA 3AHDA 3NGMA 1E9CA 4GUAA 5CNMA 5LZ9A 4KTTE 4XJTA 4R69A 1KHTA 4E5SA 2H3IA 2R79A 3LUHA 4RIIA 1W4BA 1WETA 2GX6A 1QZZA 1GPKA 3HHEA 1RJWA 2X0NA 4HPJB 1MABA 5SV2A 2GOLA 4JFAA 3BTUA 3BIJA 3TAHA 3LQRA 1XD9A 1Z7GA 2RONA 5EIBD 5JVDA 1LDGA 1CUBA 1TGYA 1V2HE 1B73A 1ZCFA 4AW9A 1J5XA 4EA8A 5LZ4A 1MT3A 2IW1A 3CNQS 2VDWA 1UH5A 3O8OA 1IRXA 5TY0A 2YRWA 3HT3A 3T5BA 4F3RA 1WP9A 4LNAA 1ORRA 2B5WA 2DZDA 4MQBA 1A2KC 1L5ZA 1QOQB 2JFWA 5J4HA 1QDUA 4RQ3A 1MXFA 1O89A 3GCGA 1NHGA 3GUUA 4PX2A 5FTNA 4B9LA 4DLYA 1ILEA 3JQBA 3UY4A 2V7PA 1TE2A 3CJQA 1TO1E 1OW3B 1ZCZA 1HDXA 1N2OA 1YMVA 3QWAA 4TKMA 2YJGA 2AG8A 4LRTB 3AI7A 1JSRA 3K0KA 4ZO7A 4HT3B 3AM9A 3MTAA 4YQEA 3A6PC 1U7TA 5ALUA 4ACBA 2QX9A 3K0CC 5GP1A 4QODA 5HE8A 3BIFA 1TKRA 7MHTA 4DA8A 3SC3A 3AQ4A 3K1JA 1NI3A 4FC7A 2FFRA 4PHGA 1KERA 4I55F 5KMGB 2V7QA 3OJCA 3CNLA 3JQ9C 3N6XA 3GLHB 1UCVA 1OH6A 5K0SA 3AVYA 1TQDA 2G83A 2PU7A 3KJIA 4JR1A 4KQ9A 5AW5A 1SUFA 3I9V6 1MG0A 1G3QA 4GE3A 1MTZA 4WASA 5IT0A 1SUWA 3NB0A 4XLTA 2ZJYA 4QZFA 4A8EA 4NLZA 5F9NA 1OFHA 3I73A 2NO7A 3GG2A 4LTNA 4U4AA 2C00A 1ONSA 1OOEA 1ZIPA 2AMFA 2HJ9A 3BD7A 4TV9B 5AT1A 4EJMA 2Z8YA 3JRWA 4HF7A 1O6ZA 1OIWA 1Z63A 2ZANA 3FDZA 5IWAB 1O9BA 1VJ0A 4PBTA 4IZ6A 1HPLA 1HEYA 4H1UA 3EPKA 1EVIA 4NMXB 3UHFA 3HJFA 4LXXA 1QDLB 1VI6A 4HQOA 2E1PA 1VMIA 4TRJA 5T8KA 4DCUA 5I47A 1F2UB 3JQPA 2D2IA 1NKSA 1RBZA 3BSWA 3IH5A 2W9CA 1XA3A 3QPBA 3K70D 1JFFA 3AU8A 4LJYA 4BZXA 5EC8A 3GGPA 2NAPA 4KLUA 3PXDA 5A2QA 3MFQA 1BWQA 1WZUA 4O59O 5GJCA 5AM4A 4M0KA 3IAS6 2B3TA 3JYLA 3AI1A 1RFGE 3ENZA 3H5WA 4HTFA 1PD1A 4IIFA 2A5FA 4PZNA 1P0MA 2Y9PB 5DGIA 5FNVF 5JMPA 3OZWA 5JWHA 4YCLA 5K8CA 5CCXA 2HMXA 1LZLA 3TZEA 1DCMA 1L5UA 2A4MA 1TYAE 2GF0A 1V4VA 2ALJA 4KBYA 1PL8A 4F6RA 4AP6A 2Q1TA 3GLFB 4X20A 4IHJA 1UQUA 2CF5A 1AKUA 2I1LA 3A1EA 3HB9A 1UWVA 2RC5A 2VSXA 1WIWA 1MG5A 2A3NA 2R8XA 3R7WB 5FH9A 3NTVA 1TQ6A 1W4ZA 4UUNA 4DSUA 2K8AA 2JZNA 4L7QA 1KA9H 3WNCA 4MV1A 4REQA 4ZTZB 4U02A 5HIIA 4IIJB 2ZRDA 4B44A 4DWJA 5LMUB 3M1LA 1K75A 3PEVA 5U4QA 3UFXB 1OZ0A 1WDTA 2PMKA 3KOMA 2EP5A 3PC3A 1LK5A 4NV0A 3H4DA 2DTXA 3BHJA 3GMDA 1AS0A 3LUGA 2Y1DA 3L7AA 2G04A 4HWKA 3STYA 2REXB 3SJBA 3ICQB 1ZJNA 1YZ6A 1LSSA 5CRIA 1Z5VA 4B85A 2I99A 1QTRA 1VKOA 5KC9A 4FEGA 5KFCA 1VB3A 5AESA 1L6NA 4RA6A 4BB9A 2QTMA 2V4QA 1QKKA 1ULUA 1NQ5A 1BJTA 1W4AA 4I27A 3I04M 1JRLA 3EGCA 3WE7A 3ZC3A 3MR3A 4LNUA 4YMGA 4S3MA 2Z95A 1XELA 4OLBA 3I2HA 3TSCA 1KFSA 3C2LA 2Z56A 2Y9MB 5LZ2A 3DAFA 1WCYA 1KVRA 2XE7A 1NJ6A 2RAFA 1FRZA 3NTUA 4TLMB 5HF8A 3ZWVA 4URYR 5FWXB 3WLKX 3QVKA 1SCUA 2NU9A 2OBFA 3GIMA 2ARKA 3KEGA 4IQFA 1JE0A 1ZYUA 3TW0A 4TUYA 4OX9B 1NNEA 3VR0A 2AK2A 4UTOA 5DHFA 4BUJA 5BSKA 2O0JA 3KVVA 1O94A 3PQ6A 3IPCA 3NG1A 2BFNA 3CWZA 3PJDA 3CH5A 2NUAB 3HP6A 1KARA 2EL9A 1O0BA 5CURA 4NS1A 5I8ZA 5CVTA 1JNXX 4F2SA 3TVYA 4GAEA 3JWEA 3EW9A 4U7TB 4G2NA 3T3EA 3P0HA 4B3RB 5LU8A 2YJTD 3DZJA 1L7EA 2ZYHA 3I23A 4MIYA 3Q8LA 4O3QA 2WU0A 1G5PA 16PKA 1KY2A 5BYJA 4WK2B 4B4UA 1XSNA 1PGNA 3FWZA 5FI1B 1ZR4A 1LPSA 1CEYA 1MZPA 3O74A 1ZQKA 2G1KA 1QIFA 4JI1B 2ZRNA 2ZZNA 2ZIAA 4N5IX 4YREA 3ABRB 3H5AA 3JPQA 4TSRA 2PKWA 3PHJA 3IQIX 4AG5A 2WB2A 2AXEA 4DL2A 3RFVA 1V3QE 1DOHA 1MN8A 4BNWA 4GXNA 4LDRA 2C88A 3V9AA 3FSJX 4IGAA 4CM6A 2ZTHA 2Z04A 2E4YA 5JCXA 1IXRC 2APJA 2G3YA 4FHCA 4IS7A 3Q0TA 2Z8XA 4LF5B 5FL7D 4QJFB 1O77A 4LRWA 4MW1A 4OUDB 2YV2A 3KAQA 3OZUA 2XHEA 1UPCA 4BLSA 1CUYA 4UXJA 1T3GA 1Z2OX 2PQ0A 3AX6A 3BA1A 5A4AA 1TZCA 3SYMA 4TOIA 3D3WA 1W6RA 1I2ZA 4C0QC 4PRZA 4DOBA 1FU8A 4UUQA 2W2LA 4DYVA 4X1YB 3HP7A 1WE2A 3QNMA 4I2GA 4GOKA 1P61B 4RQ7A 4L50A 3T9EA 3OMXA 3WKBA 2UUAB 4YR2A 3EMKA 2QN8A 4F5YA 1FVFA 2X3UA 4Z5XA 1Z0ZA 3C8UA 4D5EA 2F8LA 4LJ8A 1SXJE 1DXHA 1Z0FA 2JGRA 4DQLA 3LO5A 4QNLA 3U7QA 5DFAA 2YH2A 4TPKA 1XTJA 3R7BA 3VFDA 3KQNA 2O19A 4D41A 4C0LA 3LHSA 1E3TA 2DR3A 2I6TA 3S99A 4ZTUB 4UE2A 4UAUA 4ED2A 1M2FA 3JCZA 5ADVA 3S68A 3KFUF 2NZWA 4X54A 1ZHOA 5LIRA 1IMOA 4W5TA 1MFZA 4MUJA 2NV6A 2FQYA 2ZVQX 4LOIA 4OB6A 4TT8A 5DLQC 5IDVA 1NJ5A 4ER0A 1NXQA 2CCKA 4H6XA 4XOIA 3H0MB 4X5VA 5KPDA 3PSTA 3RB4A 1G6KA 3G9XA 4TKZA 5DHRA 4DIOA 3A4IA 3HMKA 4NU5A 5HTOA 3F67A 2B6HA 1DPFA 3R3SA 1NT2A 1S2NA 1FS6A 2QG4A 3C2MA 2G9RA 2WE7A 3PQ5A 4GWKA 1JT2A 1Q3HA 4QAJA 4RV9A 2BR3A 2QM8A 4XUGB 4RTKA 5DQGA 1WB4A 2KHZA 2MJLA 1JLKA 1THMA 2NZUG 3E7FA 3RRZA 3ZDZB 2ZSAA 4FPXA 3I2IA 3ND8A 1D2GA 1AUPA 2B8EA 5JVDB 4JAVC 2VJ5A 3BFKA 4BGUA 1NJWA 3OX1A 3PKZA 1KQFA 4Y6SA 3DOFA 1XRLA 5I7RA 3QENA 4B9NA 3PI6A 2Y27A 1WQ4A 4JVMA 1OWPA 4RAQA 2XE4A 3EMVA 3G8BA 1YZYA 4M9LA 1VBFA 5IBQA 1XP8A 1JB1A 4F4WA 4LJXA 3EFHA 3OX2A 3R5JA 4KACA 3U3OA 3D6HA 1KPHA 1G1AA 1JHRA 4LY9A 2ZUVA 4XQCA 2FJPA 3AC0A 2ZSHA 1USGA 1MUUA 3Q8WA 2PL3A 3OZIA 1BDIA 3A7DA 4RESA 5IBPA 2DQNB 1L4YA 1QH9A 2C57A 4CKEB 1IE3A 4I6EA 2E1FA 3ZXSA 3OOWA 4IIDA 5DGAA 3CUUA 2YXEA 1WDMA 1S8FA 3SSOA 4NENB 4CBVA 5JV5A 3L7JA 2VAXA 4QU9A 4G25A 2HHWA 1QGYA 2GCOB 3WAGA 2YTUA 1K8QA 2UZ4A 3IQDB 4HX5A 1TK5A 4X64B 3ZUGA 2G9ZA 5KG6A 3FSGA 5KFUA 4L5IA 4GR9A 4PQFA 2HEIA 4P3NA 3DLTA 4JK3A 4R2WA 4J0KA 4W6QA 5DM2A 4ZALA 1Y8ZA 5YASA 1O94C 2HTFA 1C1HA 2BT4A 1S4QA 1NUQA 3RHTA 3OQIA 1XZFA 3T34A 5FWNA 2KHVA 4YMHA 3RU9A 1T5OA 2HDNB 4L4YA 4QOHA 1XCGB 5CX1A 4GL2A 3KQPA 4MP8A 4KO1S 1L5KA 5JD5A 3L0ZA 3OC0A 1EINA 3FDZB 4WVLA 3DWFA 121PA 2QTNA 1PFVA 3DGFC 1IVNA 4OB7A 3QKRB 2KIVA 4ECQA 4HGZA 3KVYA 3RAQA 3KSMA 2FW9A 2VJPA 4P31A 4IDDA 4Q4AA 4D4MA 9ICCA 3VU9B 4Y8VA 1UAYA 1DBPA 4WA7A 4J94A 1L1QA 1D8AA 3TIVA 1JFFB 1O2DA 1ZKDA 3AYXB 4QRIA 3VDXA 3STTA 2VZ8A 1U3DA 4B2IA 3NHPA 2X0EA 1R5NA 2G07A 1TO2E 5IF9A 4AMVA 2RAUA 4X90A 4RO0A 4LPKA 3DBRB 4HI0E 2OBYA 3GVXA 3IBYA 4EZ9A 1ZQ9A 2F67A 3AGPA 3FWHA 3W05A 4DPMA 1RM6C 2DBVO 4CM4B 2R8ZA 1CFZA 2IU6A 4QARA 2W6MA 3CBQA 1U8UA 4ZK6A 4HN4B 1E69A 4PAQA 1JILA 3MVEA 4IHJB 5FJIA 4KCGA 3MWKA 4INPA 5DEIA 2C95A 3SZMA 4J0EA 4DG9A 2IE8A 3HCDA 4DEVA 3EGEA 4MF8A 3UYLA 1JEOA 2VWQA 1XMIA 2HWXA 4PTYA 3HNOA 3IEVA 2DR2A 3CSSA 4GG1A 2ODNA 2RHCA 4HNTA 5IX8A 1H5NA 1PDWA 1V5IA 3KP1A 4RY0A 4BCDA 4PYRA 4KREA 1UT8A 2CUTA 1IQUA 2RK3A 3BQNB 2EIXA 4K2AA 2F3UA 1J90A 1USIA 1NQVA 1U8ZA 2P4UA 3T1OA 5ITZB 3EPHA 2JEIA 1V37A 3BB1A 1YQ9A 4RL4A 1GPJA 3ONVA 1YZVA 4X94A 5HKAA 3ZDAA 3DPIA 3NX4A 3ZYCA 3HSKA 3MRSA 3L43A 4LOHA 3VH3A 3VMFA 2VLIA 3L8CA 5ETJA 3FZQA 3P2MA 1F4PA 1Y9ZA 4HWPA 1W6UA 1BXRA 3JQQA 3OZXA 2XX3A 3L9XA 5FQOA 1SHUX 2IYOA 2R85A 3DUWA 4MINA 3EIHA 4DEXA 1UFRA 1FDTA 2Z2XA 1RIIA 3U4CA 3OHPA 3ORSA 2JA2A 1QP0A 1YDWA 1BCRB 2VJYA 2ZI6A 3IXQA 2CV1A 4UVIA 1NLZA 2WJ6A 5D5HA 1U1DA 2XADA 9ATCA 3SKXA 4IRKA 1Z33A 2W4IA 3S2ZA 1GKLA 1NK4A 1A9XA 3T6KA 2AA3A 3ESCA 2DQSA 2D1QA 2XUAA 1G1MA 1K7YA 3PNMA 4GMFA 3CURA 3SXPA 5AM0A 4M9JA 4PYNA 3UTDA 3ZTTA 5F2EA 4HO1X 4RCVA 1ZIDA 3PHBE 4OKIA 1ZITA 5ALZA 1OWOA 2BRUA 4N3GA 3LRXA 3Q0IA 5KYYB 3G9QA 3HV0A 4UEJA 1A6SA 2WSMA 4LYGA 1V85A 1ZUNA 3IEIA 2EAPA 1V48A 3OAAA 4MGZR 1YKSA 4R1SA 4MWDA 2AZ4A 3EUEA 4C21A 2XE6A 2HSEA 4Q7KA 3X1ZA 4OMFG 1RQLA 2XNDA 1GDHA 3ES9A 1RSZA 3I9FA 9ICOA 1Y9AA 2GN8A 1D0VA 2Y0SF 3GPDG 3PLAE 1IN4A 2UYQA 2NACA 3UWOA 4LJ6A 4JBWA 3KVOA 1HUOA 4P3KA 1IN7A 1E99A 3EX7C 1J56A 1BHQ1 1DINA 4OSPA 1NQUA 2JLRA 1Z28A 4YIKA 4XWKA 4IINA 5IF3A 2R2AA 3VTAA 3DWEX 2QJFA 3KZKA 2IYEA 1WMEA 2OXCA 3DKPA 4KLHA 3JAKA 1UZAA 1CZRA 2J3HA 2YXNA 2E8NA 4PGGA 4BNZA 1AUQA 1JN0A 4WZ6A 2VJQA 2HA3A 2KOBA 1UBOS 4O2AF 4X3OA 2FMUA 2RGWA 4FILA 4J0CA 4J03A 4YA6A 5HCUA 4XYGA 4CHTA 4EYHB 1DDGA 2EATA 4RGBA 3AOGA 4PONA 2ZRHA 4M7PA 5EVJA 2A5GA 1UP6A 4UTRA 3ERCA 2X1HA 2BFCB 2Z30A 1RXSA 4D9KA 3ENVA 4XWGA 3P9IA 2JGLA 3M3HA 4QZDA 4D9BA 3I5YA 4ZT6A 5EE0A 3RRXA 3WYEA 3RRJA 3LSYA 4IV0A 4I2FA 4G0NA 1PR9A 4R5MA 4DHWA 2QARB 1UJBA 4PRKA 2F00A 2NVUA 4P4SB 1Y4UA 1XC9A 2H3QA 3L6EA 3KTAA 1FUYB 4L0MA 5K3AA 5TQJA 3STXA 2OBXA 1XTQA 2WK1A 1SD5A 1F1BA 2ZSEA 3FLAA 2IXGA 4X60A 1PU2A 5CT6A 2P2CA 5DP2A 2JB9A 4S2UA 3KZCA 5JXGA 3PUJA 3N5KA 4NK4A 3QX3A 4K86A 4NBTA 1H0SA 3W5BA 5CJPA 1Q0QA 4JLUA 3U7EB 4ON9A 5K4HA 3JARB 4FK8A 1PW5A 1VKJA 2IT1A 1BC5A 1GNQA 1U48A 2D4HA 1GSOA 2Q49A 3IO5A 4IIUA 4KXMA 2D8AA 4FMBB 3S7TA 4RHYA 4EFLA 3TMKA 5FV4A 4A82A 2PFQA 4YI5A 1MRSA 3CP8A 1RJ9B 2HSWA 2VBIA 4OIFA 2YOFA 4BFWA 3QHPA 1DEHA 3A6KA 1DXSA 3MK31 1I94B 1LLDA 3FTNA 3ADOA 1JDJA 1GU0A 1KDRA 1OCEA 1JQBA 1IZZA 1JUDA 4RD3A 3ETRA 1X9HA 1UOQA 4HZGA 2B7CA 5CVDA 3DAGA 3U1VA 2XY4A 1EB8A 3PSPA 1FMCA 2FMIA 2PY6A 4Q37A 3ZE0B 3RCBA 1IJKA 1E1KA 3KJNA 4XJXA 1A50B 2Z2KA 4JV0A 3COWA 3E1KA 4JUIA 1KY5A 3B82A 2IHVA 4TKVA 3W2FA 2IH5A 2SKDA 2QLBA 1ZRHA 3SHFA 4C3ZA 2VL7A 3LBHA 4M0DA 2Q9UA 1JLSA 2WWXA 5BW4A 7ICNA 1WW8A 1FDVA 1S2GA 1OMOA 4M21A 4M8SA 3DFUA 4G5RA 1PFYA 4A6EA 1LBIA 2FCRA 1DJOA 3DCNA 4Q9IA 4ZI2A 3G5LA 3C1YA 1AUOA 4O2LA 4W5OA 2C4HA 3ACBA 3T95A 2O2CA 5DSXA 3UXNA 1UR5A 1GNTA 1R66A 3SV3A 4BZWA 2CDNA 5L1JA 2A78A 4QICA 2P2SA 2W71A 3MB5A 2VHQA 3P19A 4CKEA 3PV8A 3MWJA 1OTYA 4A15A 4JI4B 2WYHA 3QFSA 4D5GA 3Q5EA 2QHXA 3LLMA 2HIGA 3AEVA 3BBLA 5BRAA 1WPGA 3CNEA 4QOFA 3TDKA 6AT1A 2EGUA 1LLQA 3ADKA 3BKXA 1EXNA 4K6KA 2A9QA 1L4BA 4C7XA 5IKEA 1MJNA 5AI5A 3VSBA 5KFZA 3LCJA 3ZVKA 8ICKA 3DC7A 3SS8A 1COWA 5KFBA 1UJ6A 3IAM1 3LZCA 4LBVA 2G9NA 3AHCA 3Q98A 4AVYA 3IESA 5IT4A 1GPAA 3KKAA 1RYYA 4DDUA 3PR3A 2IPMA 3ESQA 2DU8A 1U5CA 3F7TA 2IYFA 4G1EB 1CR4A 1XU9A 3U7HB 1CVLA 3DFMA 3CKYA 2KP7A 5H3LA 3SS7X 5K3BA 3VBEA 3G8DA 3ZIUA 4FYKA 2WWTA 4IS3A 2QB1A 2W7TA 3AEUA 3BWCA 3QEMB 2X6TA 4FR0A 4HHEA 5E1MA 1IWOA 1E9AA 2HBLA 3FOCA 1DG1G 3Q1LA 5F3DA 1MVLA 1ZRSA 4N4AA 2I7DA 4QWWA 2V1XA 2ZJ4A 4FB5A 4JWNA 1E6UA 4ECVA 2QL6A 1DZIA 5BQPA 1XROA 3W8NA 2I2XB 2JH9A 1KBZA 4FXOA 3FNQA 2E37A 1ZNWA 4Z7OB 2ID9A 1J25A 1M0EA 2HHVA 1RZVA 2GBIA 5CDUA 3ZWDA 1SVWA 2FEMA 2GA9A 3H2YA 3UVEA 4IGKA 4L4UA 3D5QA 5EHZA 5LDHA 1RKBA 2AWNA 4R1TA 3CF4G 5DSZA 1U7HA 2XOEA 3RB6A 1O6FA 1P1RA 1YT5A 2ZTMA 2PX4A 3C5CA 3DHEA 2YFKA 4IRCA 4PFKA 4PO3X 1NKBA 1DUIA 2VZ0A 3D6NB 4D02A 3JWGA 1O95A 3I05A 2FKAA 4JK1A 2I7XA 2Y1GA 1QCYA 3SYKA 4Z9FA 1E2BA 1E3IA 5CTAA 2WR8A 1LBEA 3SFVA 2KM1A 5KPJA 2KB0A 3TXAA 1VLHA 3F9RA 2R2GA 1DHRA 2WIAA 2WKSA 4KBFA 5AOAA 5DYGA 3SYTA 2L82A 1XKQA 4QASA 4POOA 1M10A 1ISMA 4HEJA 4QUEA 3B0XA 3TOVA 2YHSA 3JZFA 2GUGA 1C0IA 5LN1A 1QJCA 1JG4A 2BQRA 2FE9A 2YC2C 1GGJA 2ZAGA 3H5IA 1XO0A 1ESEA 2VPIA 1FYFA 1TMGE 7ADHA 3H3FA 1QRTA 4G85A 1XT6A 4UU1A 5J63A 2WYOA 5D86A 3PR2B 4KXLA 1OHHD 1KYWA 5DBCA 2FFHA 1NP3A 2MDTA 1KVSA 3P52A 1LQTA 1QBGA 2FE1A 4S1WA 4AXBA 2CSXA 2H4XA 3AZOA 2EGHA 3J81A 2Q0XA 3B53X 4OB8A 1ECCA 1UBSB 1H38A 1DTEA 3E5HA 2W2XA 1A8HA 1E20A 2FN4A 3HYTA 1ZIYA 2Q1UA 5FWYB 2ZUTA 1BMDA 1QRUA 1HT0A 2JG3A 4XOUA 3SEZA 1QR6A 1YOVB 1W1IA 5AKYA 4LPSA 2JKYA 4KYIB 2CF6A 1KVTA 1EE9A 3BJZA 3IMCA 1ZQHA 1EUDB 1QMGA 2A4KA 4EL0A 1IAVA 1SJ9A 3TJMA 1YMUA 1LA2A 1MOPA 4CLOB 1GTZA 4ECAA 1YV9A 1PFQA 2CMDA 2QGFA 3KJEA 4OHOA 3I42A 2WTNA 4LDAA 4ZU6X 4TURA 1B93A 1RYZA 1T0UA 1T26A 1XV5A 2P9JA 3KHKA 3OA2A 4FT2A 4M76B 3TE6A 3NNDA 4LE2A 2VUHB 5D6OA 2O8FB 3N7AA 2D2VA 4HDKB 4JWMA 4JVOA 2W6JD 1ZN7A 1KKLA 2P3SA 1U5BB 5BUZA 2C8KA 3PYXA 3V4LA 5JHHB 1NVWQ 3DE3X 5H0IA 2MA1A 1X1RA 2WLSA 2RH8A 2ZJ8A 2VRCD 4RIHA 4U6SA 4A26A 4C9BA 2ATVA 5BOSB 2MSKA 2JIRA 5JNTA 4ZP1A 2ZM5A 4MV4A 4AZ0A 4B8YA 2RH5A 4I2JA 2PBFA 4XX0A 1WM1A 1B43A 3ROTA 1HY3A 1BVYF 2ACKA 4LC9A 1G8SA 4PE5B 3TQQA 1N34B 3P9YA 2BBTA 3I52A 5IIJA 2FZ5A 5GPBA 2MHCA 3GNLA 3V9PA 3TKAA 4BVLA 3GNTA 4MUEA 3K31A 3NIFB 1BFUA 5HR7A 1RRKA 1HLGA 1M0WA 1YR7A 2ZW9A 3JAKB 2GPNA 3S2EA 1SOUA 4BFSA 2JI6A 3RTBA 3ZU4A 2B99A 2P35A 4RDIA 1K7XB 4UM9D 4BXOB 3DSRA 4JB8A 4QHYA 1KORA 721PA 3WS7A 3FVRA 5J0RA 2AFHB 5CHYA 4CIDA 4PIPA 1ZM7A 4B6OA 4DILA 4ENWA 2FUEA 4S1OA 3W34A 3HKBB 4D96A 4EG1A 2V7WA 2BFCA 1EJ2A 3PMNA 3KO8A 4LWPA 3P9NA 3OZBA 4B3FX 4HAYA 3T3OA 4WACA 4K0RA 3T7JA 5A4FS 4P4SA 4PLFA 4NMMA 4B3DA 2P2GA 1GARA 4EF6A 1WXGA 4D74A 1I2AA 3IVAA 3U1BA 2A7QA 2W4QA 2X77A 4JJ8A 3PGKA 2O6HA 4AJ9A 1O03A 1G6OA 3DLIA 3SQMA 3ZNQA 4Q44A 3D5EA 2DTDA 1UWCA 2PGIA 3O8QB 1AH2A 2ICAA 3NXSA 2TMDA 1QE0A 4XPZA 1YZ7A 2MMGA 1B14A 1XCPA 4D9NA 4FQ7A 4RKEA 1YWGO 4ELVA 4DQSA 1LTHR 1Z68A 1MD9A 4P0TA 3P8ZA 2AFRA 2C9ZA 1SKRA 2C54A 1T6XA 1IHXA 2FP3A 2QM3A 2QYSA 4ZA2A 3VTFA 4YV7A 5C35A 5IVKA 1SKSA 2AFIB 4RANA 2PSDA 4E1BA 1C1XB 4UVGA 2ZB7A 1KBUA 4KPGA 3W78A 2IQ5A 3BWDD 4Q7QA 3IVGA 5JAHA 1BSVA 2D06A 1HO3A 1ZICA 4OFXA 4KGDA 4M60A 4HWOA 4PS1A 2ID8A 1TQ4A 2GTIA 3EZ6A 3PUYA 2GEKA 4JJZA 3OUUA 1HE3A 5DTQA 2O1WA 4JI7B 2HPAA 2JASA 3FYSA 3A10A 1N75A 4ZGWA 4WCFA 1SOAA 4RTQA 2HRQA 1D03A 2A19A 1R74A 2WJGA 4NEQA 3HPQA 2FN7A 1ZQAA 1K5PA 3VO2A 1ECJA 3N7UA 5FNVB 3CA8A 3B2NA 3V2UA 3VPSA 2KJ8A 2XWBF 1Q84A 5CYOA 3QKUA 5IBRA 4MO9A 2JJYA 5L4SA 2JGFA 3Q7TA 5J3JA 1IM8A 3OEHD 4YUVA 3VDNB 4EG5A 2ODBA 1OFVA 4DFPA 1JWBB 3HA5A 5ALPA 3JPNA 4RQ1A 1Z26A 5DTMA 1GAEO 9ICEA 1TCCA 3GVPA 2B92A 3HXPA 3IUPA 4RK1A 2AJQA 1YGPA 4R0NA 4TV8F 1M3SA 1LB2B 2IYAA 3SX0A 4XLZA 1V8FA 2C2EA 2JEZA 2UZ3A 2X4LA 4MHOA 4R9UC 5DKFA 3LWZA 5KTOA 1O6CA 2NO6A 2XUGA 3ZCVA 3FNGA 1FZTA 1DRVA 3H2SA 4DLLA 3NT5A 5BV0A 1W1UA 3FJOA 3H86A 4NFYA 4P3OA 1RXCA 3T9AA 1GZ3A 3W5HA 3R6DA 4BVFA 4CPDA 3T5PA 2WAOA 5EKTA 4PNHA 4JOBA 4ZQGA 5DM1A 2HXYA 2VC2B 4KODA 3PWZA 4DIBA 3GLUA 1LNZA 2B78A 3J81j 1C8BA 1NXPA 1BYUA 4K6MA 2H0RA 4AJ4A 1KGSA 4GLOA 3VSCA 4C78A 4GZ5A 3FGNA 4O5AA 1FYDA 1N9KA 4D4HA 5I7HA 4LFBB 5JJKA 3SPXA 5KNDD 4C2BA 1GWNA 1ZXIA 1LNSA 1OWLA 4F4JA 2CDCA 3KLNA 1P0IA 1K1SA 1W59A 2HJWA 2XUDA 1GFZA 1C3OB 3E9RA 4LRQA 3OPXA 1DQSA 2J3KA 2VDNB 4XIFA 2O9JA 3UJHA 3VQTA 4AN0A 2IOFA 3BK2A 4B3CA 4F5DA 2YB1A 1CJSA 3DOOA 8AT1A 5MN5A 4Y2HA 3A1TA 1E32A 3UWSA 4UARA 3FVTA 1Z07A 3B3GA 3W7AA 4A2WA 1OE0A 5NLLA 4M37A 1Z25A 1J2UA 4B5KA 2EX1A 1KP2A 1VGRA 1THZA 3IULA 2QENA 2QROA 3CO0S 4OAPA 5SYAA 1E79A 1MABB 1QGAA 5AJXA 4CF6A 2RE8A 3BA6A 3CF6R 2CHVA 3UT0A 3KETA 4BX8A 4IWYA 5HZMA 1UJCA 1Z0UA 4E12A 2PYZA 4YO8A 4Q24A 4DV0B 2CNKA 3FE2A 3GR6A 4DSFA 4M1EA 2F4NA 2R84A 4Y7CA 3V1MA 4KRXA 3RVLA 2ZQZA 1KI4A 3T94A 5FOXA 5IUNC 4TL7A 1K5DA 1NNLA 1GZ5A 2I8AA 4OHWA 2ISOA 4V03A 1Z5UA 2AE2A 4I2BA 2BY4A 2TMYA 3D31A 2ZB8A 1PHRA 2ZJ7A 1ONPA 4G8BA 7ICKA 2P3LA 1KYZA 3K4HA 3W2EA 4AURA 4DMRA 1YFKA 2A7XA 2RG7A 3H5OA 2EWVA 4II7A 5IKOA 5IAEA 3KLPX 2CK3A 1TM3E 3HU3A 1EHIA 3MHPA 3ZUPA 1UZUA 2QVBA 3UXHA 3UQYS 1J8VA 1FF9A 1QRDA 1EFRD 2OGWA 3PW5A 2R6CA 2WZQA 3BL8A 3DW3X 5K3DA 2DKNA 1OX5A 3AEZA 3H19A 2KN7A 2RJNA 2NSDA 4R05A 3ZX4A 4U5QA 2DWCA 1HI9A 4F4ZA 2ATLA 3LCVB 5DGHA 1H9AA 4YIHA 5KIAA 3ND6A 2FHPA 2R1UA 5KMGA 2UXBB 1U8AA 4TTRA 1R00A 4E08A 4D4IA 4OHMA 1WMBA 5D1HA 1U0JA 1YOVA 1PK8A 1JHYA 3I1YA 4O1IA 3ZCXA 4CCHA 4J07A 1E3EA 1DKOA 2X19A 3BRCA 5C37A 4G97A 1CERA 1RLUA 1J0CA 2REOA 3EZ2A 2AU0A 3K5HA 2JARA 3EVNA 1VL1A 3MCAA 3N2GA 2HBMA 1ECWA 3ZWYA 4BTVA 3I01M 1R4MB 1NFFA 4TV9A 1X94A 4HZUB 4ECTA 2FF7A 4EG0A 4UREA 1YU6A 2GDJA 1GN9A 3IOEA 4OQ4A 4ZV4A 4TT3A 5JQGF 1IBMB 4HADA 3MSCA 2IEAA 1XLTC 2VH1A 3R7FA 3RTAA 3MMXA 4B74A 4QVGA 3USES 3N0XA 3NJ4A 3GJSA 2G1AA 3KKMA 2PUAA 3NLLA 3GLFE 3U26A 1SC9A 3ROQA 1EI9A 3L0YA 4Z4IA 2W9CB 4NE7A 4NMLA 2ZUEA 1H8HD 1P17A 3O4IA 1PS0A 4JB3A 2IC5A 4IHKA 4DM3A 4INAA 1HIWA 1I0LA 2BEUB 1Z0IA 4MLPA 3W5JA 5EIEA 5KFTA 5JIBA 4RTJA 3H2GA 5HQJA 1G5HA 1WO8A 4UVEA 3QEAZ 3ZHRA 1DADA 2GFHA 1Z06A 3H9CA 4MSUA 3E05A 3GJ4A 3IAM6 3L0SA 4MOWA 4B3XA 1W36B 3K0CA 3S2GA 3M6AA 5KT5A 3FYUA 1KMIY 4QVIA 1OXSC 3TPCA 1T25A 3CUWA 3RVMA 3PZPA 1T3HA 2JLYA 1PL6A 2C8LA 4QBTA 2JIZA 3L1KA 1RHMA 1BA2A 1BRMA 1M7HA 5IZCA 3VJKA 2CNLA 3GG9A 4FVTA 3ZHVA 5AKZA 2PDAA 2EAMA 2Q0QA 2W3RA 4G1CA 3GBSA 1YJ5A 3OFNA 1DCTA 3OIFA 5J1SB 3C6BA 4H7DA 5EWFA 5C7IO 4FS2A 4ITVA 1T9GR 3BRWA 3CX8A 1XIVA 1VCHA 2HO4A 3DO8A 1KTVA 2PIDA 1FMJA 2F1IA 3H1GA 5JADA 2OZVA 2GILA 2QV0A 2RK4A 3KM0A 1U7UA 2O3SA 1PP4A 3LLUA 3MYRA 3F7MA 4NPCA 2GCIA 3FBWA 4E30A 3QNWA 2NUTB 2ZU0C 3SV4A 3LHKA 3DR5A 3HY4A 2B37A 1UZLA 4D46A 2WHPB 1Q21A 5KG0A 5F52A 3CVYA 2C3PA 2BM1A 2ZYDA 4LQDA 4AG3A 1UBFA 1EDZA 5KS2A 2GZSA 4O3PA 4KITB 5KNLA 4UHEA 4RD4A 4XI9A 4XFDA 3IJ5A 4LZZA 1RBQA 4YYEA 4FZ3A 1A96A 3IQZA 4QXOA 5AXBA 2NT3A 4B46A 3H5VA 3GVHA 4QPJC 1IBLB 3G2MA 3H9UA 3KLMX 3L0PA 4MR7B 1MR3F 1UDRA 5EA2A 5BMVA 3BXFA 4TUYB 4P6VF 1ZC3A 2D0IA 2LD4A 4YRQA 5JZBA 3U49A 1RPTA 1I2DA 2C42A 1Z7EA 4Q9JA 5J9FA 1AGXA 1JR6A 4YHHB 1ZOPA 4EBEA 3F73A 4FEAA 1G8PA 1XQYA 2AFIA 3GV7B 3L7LA 4NBUA 1RPAA 3FMVA 3IDZA 1KAOA 2ZRLA 4J0DA 3ZZ1A 2ZBQA 3C41J 3COPA 3LMKA 2BPOA 3ELUA 4CV2A 1G17A 1RI5A 4EPXA 2XB2A 2C0CA 1YJQA 1QIIA 2HU2A 2RHMA 3TDMA 4II3A 4IDNA 4KR2A 2OG2A 1NXVA 2EHDA 3BVPA 2CV2A 4XIJA 3KKAC 1FP6A 3C0KA 1SBHA 5EESA 2C7RA 5L3SB 2P6PA 4KR3A 4TM8A 4M0AA 1Z0AA 1RJDA 4MUAA 3O1JC 2YBDA 3EA0A 3GW8A 4WCFB 3OQOA 4P2GA 1GSAA 4QWCA 1P1IA 2FR0A 4MYDA 4RPZA 1SVMA 1T8SA 3KQQA 2KLBA 4CMIB 2FMSA 3TKYA 4DZZA 1R9GA 3NM5A 3Q72A 3EEQA 1AO0A 2VIXA 5IC5A 4RKWA 5IULC 1WCLA 1IZYA 1EJ6A 3KEFA 1B76A 5E4JA 4D8TA 1ZHFA 3E8XA 4UMVA 3TFSA 1ETUA 1YRLA 4ME6A 5KVQA 2V9ZA 3KD2A 4J9QA 3OE7A 3O8OB 5JZ9A 2XKKA 1MRNA 3RSLA 5KFHA 3QXHA 2COKA 4FFVA 4R6WA 4WCDA 4JHLA 1RABA 4OLHA 3DXZA 3ZBTA 5HHTA 1A0OA 3FN4A 5AW9A 2FFJA 1MJ5A 2F3NA 2IKSA 3K8QA 4G0QA 4R51A 4AP9A 1M2NA 1KI1A 2NRZA 2Q5FA 3D0QA 3EGXB 1HE8B 1V16B 3UB3A 3EFBA 5FPYA 5CB0A 4Y9UA 1JQ3A 1E9SA 3BOSA 3NHLA 1JVSA 4D81A 5E0OA 1OJLA 3D3KA 1ISGA 2DUNA 3A3OA 5JZSA 1U3FA 2NGRA 4KDCA 4JYZA 4M2LA 4RV5A 4WY2A 1YBVA 2UVQA 5DTIA 3UAWA 3N2ZB 4N40A 3ZY5A 4EAQA 1K06A 3CG4A 4TKLA 1CUVA 1YNSA 2NU8A 3LVVA 1K4MA 5FFNA 3FVQA 1KJYA 1QZTA 3NV9A 4L1KA 2C98A 4GMHA 2YXLA 3VJMA 1X7GA 3IUBA 3L07A 5K09A 1G38A 2QA5A 4J16A 3KHSA 2C4MA 1FDSA 3M5CA 1F20A 4IL5A 4C0KA 3NVDA 4OH7A 4G4JA 3BGOS 5K4AA 3FHCB 1F2DA 3KJQA 5H1YA 5D3MA 1H2XA 2QV7A 4QTTB 3YASA 2Z6UA 4Q3BA 1ZD8A 3NHFA 2NO4A 2L19A 2PGNA 4L6AA 4GC6A 1BE0A 1KJ9A 3A0RB 3LDGA 4AFNA 2OQ2A 3B1VA 4B6PA 1AV7A 1CJBA 3WFZA 4NOLA 1E6WA 1J0AA 3CG0A 4DQVA 3DLHA 1U0LA 1AZLA 4NPHA 1X2BA 3HRHA 4NXZA 4DLEA 1ZN2A 3JQGB 3PGXA 4ZAFA 5C4GB 1AQIA 1QBKC 8ICYA 5L3RA 1IL0A 4L85A 4EPRA 4MV6A 1JYFA 4FO6A 2A35A 2AQIA 3WDLA 4LF9B 1DIHA 1S8AA 4RVOA 1JJAA 5ECYA 1XTVA 2FMPA 1DMSA 2NUBA 2AC7A 1U4BA 2RP5A 4H17A 4KPFC 4NAHA 1KDHA 4G37A 1GKYA 1K5HA 2DKFA 4HTFB 3V6HA 4JJGA 3Q40A 4D3XA 3IQWA 4G6ZA 5FUBA 1NJYA 2QS9A 1XMVA 4B7XA 1NRWA 3P0FA 4M1TA 3BXXA 4YJFA 1IRIA 5LLTA 5EIXA 1P29A 5CGZA 5BVGA 3SNKA 4FMPA 3PJGA 1NN1A 1YS9A 2ZJ1A 3V1UA 3ITNA 1WVMA 2JBAB 1ENYA 2VSQA 1RPLA 4GI7A 3MMNA 2CMFA 2ZQ5A 3HBAA 4QOEA 1A9YA 1JR3E 1ISHA 2D2FA 4KLSA 2H06A 4UDNA 3UOGA 1JQJC 3AW8A 3GDOA 4RZHA 4HH4A 4REQB 1WZ2A 4FW8A 2I7CA 4DWVA 1KKXA 3C2QA 5KFVA 1W34A 2ZIFA 4S35A 4BJ6A 3C5GA 1BQ3A 5HKOA 2H7XA 4P86A 3UPUA 3OHSX 2IZ7A 2E9SA 3V4ZA 4L6CA 4LCJA 2GQ0A 3ISDA 2WHXA 1L4EA 3KJGA 3SK0A 4YD1A 3PC8A 1SIUA 2QW1A 3T5MA 3ZK8A 2DWPA 4TYPA 5AUPB 3TUZC 4GZMA 4DRXB 3VMMA 4M98A 2ZREA 1FA9A 1GSHA 3G2NA 5FTKA 5KCMA 2J6BA 3TW8B 4R2IA 3UJ3X 3A6LA 3O4RA 5CX1B 4DQKA 3NWOA 1KRWA 1N8TA 1GT91 3MPUA 4WI1A 1JHUA 3KAKA 4ZO9A 1QHIA 3GUZA 1DX9A 3IRUA 2QAGC 1QX4A 3TZBA 2XGPA 4F2HA 1O5TA 1GUZA 4KLRA 1W73A 4KLCA 2W9BB 3TH5A 1GTG1 2Z1NA 3N74A 1D0SA 3UJ7A 1AE1A 4UZFA 3I0MA 1T0PA 3RDPA 2DERA 1CUCA 2NQ2C 3ASYA 1ZK1A 3R0IA 2O3UA 2I91A 4NCIA 1X2EA 3GT0A 3BQ7A 1UWKA 4BX0A 4USAA 7ICLA 1Z6PA 4D6YA 2AX4A 4DLUA 5I5GA 4C4XA 1KEZA 2GEUA 3EVEA 2P9QA 3EIQA 4TZKA 4ENSA 1PYOA 3BCHA 2QGZA 1WCV1 3CN9A 5IM5A 3SSAA 2I4LA 3LXRA 1FRFS 4HDAA 3O6VA 1NKEA 2YVKA 3VR4A 4CETA 3WO0A 1PGPA 1FMTA 1J5EB 3K75D 2NQ8A 4I19A 1AN0A 2C0PA 5FBLB 2ZTEA 3RQSA 5G0SA 3LL7A 5MF6A 4P9NA 2FLWA 4ZEOA 3WIEA 4F2GA 4W1RA 3AFNA 3MRXA 1ZGAA 2Z2JA 3E1GA 5K3CA 3JASA 4TTIA 2G36A 3A0BU 5TGDA 4Y6LA 3ZDQA 5HQTA 1CVIA 4AJHA 1KH1A 5H83A 2WM3A 3ABIA 5JXJA 2P79A 4EDHA 1XHLA 4MI1A 4WKCA 4DSEA 1XRMA 3U19A 3Q3IA 1WSAA 5B4VA 3H11A 3R9IA 2XB9A 5COBA 2QKQA 1P19A 1TU4A 3RJFA 4INZA 4QQKA 4C2UA 2JFBA 3BILA 1SR8A 4AWXA 4EG6A 1ZMRA 2ZSBA 4DNQA 2HHTA 4A0GA 5CCBA 1LFDB 2OLJA 3GLGE 4ECEA 3GLKA 3RH5A 5G0WA 5IHPA 2MOKA 3AWDA 1CQXA 2FQXA 1B1CA 3F1KA 2ZJBA 4K6OA 4NU6A 1GR1A 2XYPA 3D3WB 5IC6A 3RT7A 4F4DA 5AVVA 5HM8A 4Q8EA 1NATA 1E4EA 2LTAA 1YIAA 3BEOA 3A0UA 3VR6A 3WL4A 1K2VN 5AVKA 3S2YA 2QBYB 5DI9A 1XZQA 4EF4A 4QVKA 3QNUA 2OXEA 4BBPA 1OFUX 5JDIA 1RRCA 1KY3A 3GUVA 1S6YA 3JYQA 2VNSA 4RNDB 4C04A 4JYBA 2R0QC 2DF4B 2PSJA 3NBAA 4ZZIA 2COUA 2O54A 2JH3A 3CX6A 1TW3A 1L3UA 3RYFA 4DBVO 3RYCA 1SXPA 2DY0A 3KXPA 5AW7A 4MCJA 3GLTA 4QUHA 4WLUA 4F11A 4UTNA 5KNCH 2PFSA 3ETGA 2XD9A 5F1YA 1QRRA 1TD9A 3A70A 3ZZNA 4BEVA 1P2FA 3T4PA 1P5ZB 3HJNA 3IOMA 3QWHA 4QGSA 3S5JA 4HYQA 3P5SA 1WV0A 1NBWB 5EWEA 5CEHA 1AHHA 1EXWA 2HDWA 2I3DA 4O5CA 3ABSB 3LDAA 8ICWA 5BSMA 3SEQA 3PPYA 1RM5A 2GYYA 3PITA 2W2KB 2A1AA 4NLBA 1BOFA 3IP4B 1IHOA 5AVSA 4UUMA 5T67A 3DL7A 5A5DA 1F8GA 5IKXA 4K87A 5DSTA 2Q7OE 2YZMA 4FN5A 1IEQA 1NVXQ 2I7TA 3B70A 3JALA 4OXRA 2VRBA 3RJJA 3ZDYB 2P78A 2JH7A 4MVJP 4OUKX 5ALVA 4RWEA 1QE5A 4KXQA 1KZYC 2ZTUA 3MJEA 3RSZA 4BKOA 1WNTA 1SCJA 2WUDA 3DBLB 1N78A 2HV8A 1KTIA 1XAGA 4RZ3A 2BCRA 1XRSB 4V1CI 2Z1MA 2NRXA 1UODA 3E9YA 3LA8A 4MCAA 2YICA 3MGCA 2PBZA 2ZRCA 4X9XA 2HMVA 4B4KA 1DJQA 5L4NA 1QQBA 5EWLB 1P8JA 2UUOA 3EDYA 1LK7A 4J29A 4RPIA 3RODA 2NZJA 5JS8A 4HNRA 1N57A 2Y6UA 1TM1E 1E1CB 1JXQA 4O4JF 5LCXA 5HKKD 5EHGA 2OWEA 4K9MA 1VA5A 2MSDB 4N9QA 4LMPA 1LPOA 1ZKMA 1PTJC 3ZJUA 2PUWA 2FR1A 4LVNA 3RARA 3UJCA 4E5PA 4HFMA 4FS3A 5K0LA 2AW3A 3NHRA 4KQWA 3GF4A 4DB2A 2OLEA 5A3QA 5CRXA 1KRPA 1QLWA 2QT1A 2GCOA 3KTAB 3LKVA 4BIIA 4QLBA 1VJGA 3WJ7A 3R3HA 3FMFA 3ZIAD 3PNYA 4OXNA 1G6HA 2MR6A 1K98A 3ZYZA 5DM0A 4GLXA 1B3RA 5L3QA 5E3IA 5L95A 1BPYA 3C6YA 3DDWA 1IK4A 3E3LA 1NBAA 5GJBA 3FXAA 3AMZA 3HLTA 3N6RA 3R0ZA 3JARA 4ZQCB 1XWWA 5T3YA 1LY1A 2ZIEA 1Q1ZA 4B6FA 1GCGA 3T9FA 2ZJ2A 4U63A 2BFMA 1D07A 2DF8A 4RQBA 3RU7A 3RVDA 4D80A 5DZSA 4ZDIA 2OYSA 2CLCX 2ZIGA 3F6CA 3R5FA 1U3UA 4HX9A 1BMTA 1UBMS 3G6VA 3AUFA 3CLKA 4ZVKA 4EHKA 2Z6VA 4DL4A 3JAWB 4F4FA 4RF3A 1R64A 5BUCA 1W4RA 4N3AA 1D1PA 3QKRA 1H2RS 2JBHA 1E60A 4C8KA 2R25B 3CUYA 3CZCA 4J43A 5GY7A 4MKFA 3MS7A 4B6EA 4KN6A 1JG3A 4LRXA 5HDBB 3VH2A 1SV4A 4AJEA 2VQ3A 5ARDA 1XZPA 2QQGA 2CE2X 2VDLB 3D8RA 4PEVA 4TKVB 2DR0A 3VR2D 4MHSA 4FS1A 2GCNA 4RPHA 4HV4A 3TFOA 1CUGA 5J0OA 2OAP1 3O9ZA 2WPDA 3HCPA 4JELA 1RLOA 5DULA 4AO6A 1U63A 2NTJA 3ZD8A 5HHHA 3H4MA 3NP7A 1I3NA 1GAJA 2IIBA 1OAOC 2IQIA 3AB8A 4FYXA 4XGRA 2EFYA 3WFJA 3L6OO 3PWKA 5ECDA 1E63A 1UXGA 4IL6U 1Z56C 3NJ8A 1E2DA 3K70C 4DQRA 3DXXA 4QXAA 1UBLS 4C7VA 3QY0A 2F43B 3CTMA 1XNRB 5AH0A 3JQ7A 4AIIA 1OD6A 3HGTA 4R01A 4UCFA 5BVGB 1I6LA 2JBAA 2JEYA 2PH3A 2LW7A 2VQDA 4CR8A 3OLQA 2BGNA 2JEFA 2RKOA 3WK5A 4ITRC 1OU0A 1U04A 3LRPA 2IZ6A 2XZLA 1KSHA 1RCTE 4DO9A 1L7AA 1XEWX 2ZSJA 3C85A 4RPJA 3WGHA 1RPJA 1ZQDA 1GAXA 1H2WA 1SK9A 2G77B 4YG2A 3QX8A 3R9KA 2L18A 2HA7A 8GPBA 1EWKA 1M1XB 1ZZEA 2QTWB 3HWRA 3LWBA 4LZGA 3FPHA 5JD3A 1E2UA 4J9KA 3GJZA 2V7TA 1E7WA 3JPYA 4GOMD 3N7RC 4IKPA 5K0GA 4UB2A 5EXDA 1LBHA 4GPIB 1J2RA 1FRVA 4NV1A 3AU6A 1MNAA 2D2EA 2EFHB 5J0TA 2RGCA 2V96A 4C6TA 4MH0R 2O0KA 1YUMA 4ZANA 3TCNA 1HJPA 3T3FA 1KR5A 5J2DA 4JKYA 4K81B 4CR6A 3GAAA 5C8XA 1LW7A 2KI5A 4B6JA 3K0EA 2C99A 2I29A 5BQXA 1ZVKA 2WUVA 4MWZA 4HH0A 4I3GA 4OJTA 2ZR0A 4RGVA 1H6BA 3L40A 4P4TA 5AI8A 1HV8A 4L3VA 4OXQA 4JYAB 4C4OA 1ESZA 1V38A 4CCYB 3OE5A 3FLBA 4YHBA 3M70A 2IYWA 2ZTVA 1JA9A 3HS3A 4D8YA 3SICE 3ZCSA 2QLLA 2ZVJA 2K2WA 4Z8YA 4DLBA 1RPZA 3B5JA 3TM4A 3DZHA 3T79A 5DEOA 1WLSA 1KZ1A 2NXWA 1YJBA 3A25A 4W7HA 1R8YA 3O93A 4EHFA 3C23A 1VI2A 4GQAA 3WLOA 4E2WA 4H1WA 4TWRA 4M9NA 3D3EA 5KFGA 4C6SA 1VPTA 5ADHA 5AUQA 2CUZA 3LE8A 5CB4A 5KYYA 2PGDA 1UAGA 1FQJA 3ABQB 4JLNA 1JIQA 1YDEA 3KZXA 1URJA 3U80A 5JAQA 4IDEA 1N77A 4BJHB 5EN4A 4R2JA 4G8CA 2O3JA 4ZTBA 2GN6A 3HEAA 5AR1A 3WLJA 3G9UA 2P62A 2IHMA 1S76D 2OFFA 3ME5A 3W0LB 4S04A 4M0CA 4A27A 2P0AA 3PEWA 3PPXA 2AJLI 5DDIP 4BFCA 5FEMA 1SHTX 5CM2Z 2HTEA 5DYTA 1U3WA 2NSYA 3LBIA 4M7WA 4BFLA 1N6NA 3LF1A 1HEUA 3H11B 1PEDA 3V4VB 1N3BA 2W5UA 5AK3A 8ICCA 2IUFA 3KJXA 2M98A 3PPIA 3ZWCA 1FIUA 2HMYB 1W94A 2XTMA 4ESOA 4CRWB 3JXEA 3DHWC 4IUCS 1VQ1A 3TACB 2P8JA 5BUSA 1VE6A 4MGYR 4FWBA 5L3ZA 3SN6A 3ER8A 3GA7A 2DPYA 2Q2QA 3K2EA 2VJLA 1UKYA 3MBOA 2HSGA 5E95A 4BCBA 4G5YA 3GN2A 2NTYC 3E6AA 2YMQA 9GPBA 5KKCA 3UMMA 2W6CX 1DIOB 1UKBA 4DXHA 4L8YA 3GPIA 2Y71A 2QARA 4JC8A 1H8ED 1KMQA 3QRWA 6GPBA 3KD3A 1VHTA 5CAEB 3TL6A 4JQSA 3TQRA 2I6QA 4D8XA 5BYAA 2XMSA 4UNNA 1ZQXA 5DLFA 3D8BA 5K0EA 3RYCB 5T8KC 4PH5A 5I7VA 3UJ8A 2BI7A 3IEPA 4XIIA 1Z4NA 2E55A 1UWLA 1S2IA 1ZCAA 1D4AA 3E3AA 1N2XA 4FXPA 1GGFA 4Y2XA 4LISA 1NRIA 1PI3A 1S7CA 4C3UA 1Z5NA 3ZE2B 1LI7A 3OWOA 4FLMA 4K9RA 1QU2A 2R96A 4ZVSA 2X15A 3W1WA 4RF4A 1BVRA 2WDPA 4HXFB 1XYGA 4MUHA 2ORIA 1RJ9A 3PR4A 1ZGJA 2O5EA 1XCJA 4NJOA 4KKVA 2FZEA 2WICA 5B37A 5IILA 2AGQA 3C1UA 3UOWA 4RH1A 2W98A 2VK8A 2DJIA 1WUIS 3HYLA 1P1KA 2H57A 5KYTA 1P33A 3NMUF 2ZI3A 3DTVD 5HE9A 4WL0A 3UGQA 1U9ZA 3NASA 1C9YA 2V7QD 3IPXA 3NAMA 2FZVA 4LZOA 4EYGA 2NAFA 3WJ2A 4X8HA 5J2AA 1YB6A 4J0HA 2A94A 5T4BA 5GJVC 1CQZA 2GK3A 2ZCUA 1N0UA 1FYXA 1Q0RA 1VG0B 2FUG6 2XVZA 5TIIA 1JR4A 1D9DA 4XB2A 4IHQA