3CNHA

Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
200
Chain Sequence
GMTIKALFWDIGGVLLTNGWDREQRADVAQRFGLDTDDFTERHRLAAPELELGRMTLAEYLEQVVFYQPRDFTPEDFRAVMEEQSQPRPEVLALARDLGQRYRMYSLNNEGRDLNEYRIRTFGLGEFLLAFFTSSALGVMKPNPAMYRLGLTLAQVRPEEAVMVDDRLQNVQAARAVGMHAVQCVDAAQLREELAALGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (NP_295428.1) from Deinococcus radiodurans at 1.66 A resolution
rcsb
source organism Deinococcus radiodurans r1
molecule tags Hydrolase
molecule keywords Hydrolase family protein
total genus 73
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3cnhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cnhA01
1JUDA 3I28A 3QUCA 2WF9A 4Y2TA 2WM8A 5AVVA 3M1YA 3MPOA 4KNVA 1S8OA 2RAVA 4EEKA 5ALNA 4XQ0A 5AM1A 3FGOA 5AVRA 1T9ZA 3L8FA 5AKYA 1O03A 1RLTA 1TJ4A 3SF0A 2G0AA 5AI8A 5A3QA 2CN1A 4L6AA 1QQ5A 5AW9A 3MMZA 4Y2YA 4KYTA 3OTQA 3BWVA 2ZBGA 3K1ZA 2FUEA 2C8KA 3OCVA 2YMQA 2ZXEA 3AR8A 4C4TA 3AR4A 1SWVA 4UW9A 2FI1A 4UMDA 2VKQA 2W4MA 1TJ3A 3WK4A 4OCZA 1Z4OA 3ZVLA 5AW7A 5AVXA 5AVSA 2HOQA 4JDPA 3J7TA 4L6CA 3FZQA 4MWOA 3NRJA 4BBJA 5ALQA 2HX1A 4BX0A 4XE5A 3R4CA 3ESQA 4BX2A 2ZBDA 2NYVA 3R9KA 1Q91A 2MU2A 2P27A 3QYPA 1TE2A 3OPXA 3RFUA 3N5KA 1U7PA 4YH1A 1TJ5A 5JJBA 2P9JA 3I6BA 3PDWA 4I9GA 3E84A 1L7PA 3ET5A 3U7FB 4I9FA 3F9RA 3DV9A 3GYGA 3L1VA 4NAVA 3KBBA 1Z88A 4BEWA 5ALHA 1IWOA 2GHTA 2ZOSA 2B1QA 3DDHA 1L6RA 5AI5A 1Y8AA 3WKAA 2ODAA 1RLOA 2AH5A 1EK2A 3QUTA 3ZUPA 2O9JA 1PW5A 2C4NA 4UMFA 4KN8A 2I34A 1ZRMA 2PQ0A 4L57A 3M9LA 3L7YA 4RESA 1L8LA 1Z4NA 3OCXA 2QLTA 3ED5A 2HDOA 5ALFA 2NO5A 4NABA 3AR6A 5AW2A 4Y2JA 2W43A 2NO4A 4EENA 3HLTA 2DQSA 3FVVA 4AS3A 5AKXA 3ZW7A 2PKEA 1RLMA 1T5SA 3CNHA 4O8CA 1WR8A 3DAOA 2HO4A 4FE3A 4XPZA 5AW1A 3KC2A 4IFTA 4J03A 3SLRA 4G63A 4UASA 1WVIA 3WGVA 5ALGA 1VJRA 3KD3A 4Y3UA 4HGNA 3W5DA 4YIKA 3W5AA 1RKQA 5AKGA 3U26A 3FM9A 3ZX5A 3U7EB 2HI0A 4CF4A 1QQ7A 3S6JA 5AI4A 5ALIA 3NIWA 3ESRA 2Q4RA 4DFDA 2YN4A 1RMYA 1K1EA 1XPJA 1QQ6A 3UMBA 2BDEA 1NRWA 3QU2A 2HSZA 2G06A 1LTQA 2RB5A 2IOHA 4UM7A 2BDUA 3QU5A 3N07A 3AR9A 3U7HB 2Q5EA 2JARA 2HEGA 3QLEA 3L8GA 5A3SA 5T41A 2HF2A 4AP9A 4ZEXA 1F5SA 1Z4KA 2X4DA 5ALDA 3IJ5A 3P96A 3EF1A 4YCMA 3NUQA 4UU0A 2FEAA 2WFAA 4HGOA 2YMLA 2ZBEA 2MU1A 3WK7A 3SKXA 5AVQA 5AK6A 5ALUA 3ZWKA 1RPZA 1ZOLA 3AR3A 3B8EA 3AR7A 3PGVA 1MH9A 2B1RA 4OHFA 4F72A 2GFHA 3RF6A 5AW5A 1EK1A 2O2XA 2PR7A 4C4RA 2MSNA 2FPRA 2FPSA 4CF5A 2AMYA 4UMVA 3OCUA 4Y2UA 3DNPA 3SKYA 2C88A 2P69A 5ALMA 4HYTA 1ZD5A 1Z4IA 4H1WA 4RETA 5AM5A 2I6XA 3WKEA 1RMTA 3ONNA 4QQFA 4YCLA 1WZCA 2I33A 5AW0A 1YDFA 3EWIA 1O08A 5A3RA 5ALJA 2G80A 5ALPA 4J2TA 1Z4QA 3ZX4A 4Y2VA 3QUQA 4YCNA 4HGQA 3KDPA 2GHQA 4DCCA 1Z4LA 3I1YA 4Y2PA 3BA6A 4Y2QA 3B9RA 1LVHA 1RKVA 3I76A 2YMMA 1J8DA 4KNWA 3W5BA 3WK5A 2YBDA 2OA0A 1YJ5A 2B8JA 1KYTA 1U7OA 4NFLA 3L5KA 5AVTA 3L0CA 1L8OA 1XVIA 3WKCA 1FEZA 5AIBA 2QYHA 2FPXA 4UAVA 3VAYA 3FPSA 3A1DA 3N28A 5AIAA 4YGYA 4GIBA 1ZS9A 3AR2A 5AVYA 1Z4PX 3OCYA 2EATA 1RDFA 5AICA 1Z4JA 4XOUA 5AVZA 5IS2A 3D6JA 3CZ4A 4EX7A 3PCTA 5AM3A 5AK5A 3WGUA 4ZEVA 2B82A 2G08A 2YJ5A 1RQLA 4UAUA 5ALXA 3B9BA 4BEVA 2IYEA 3L8EA 1L7MA 4BNDB 2FPUA 3KZXA 3U7GA 2GMWA 1RMQA 3FPBA 1RQNA 3QUBA 1CQZA 1S2OA 1YMQA 2AGVA 5ALSA 3NAMA 3R09A 3ZTYA 3N1UA 5ALOA 3QU4A 3MC1A 5AM4A 3SMVA 5AKZA 5ALRA 5FP0A 1Q92A 1SWWA 1SU4A 5AM0A 2B0CA 1AQ6A 2W11A 3ZU6A 3N8GA 3ZVNA 2WF7A 2WHEA 1L7OA 2HCFA 4ZEWA 2YJ4A 1QH9A 5ALKA 4MUMA 2IOFA 4PNHA 4UM5A 2ZG6A 3A1CA 3ZTWA 2EAUA 4EELA 2IA5A 1TA0A 1WPGA 2JAUA 2R8EA 2C8LA 4NWIA 1YV9A 3UM9A 4F71A 3L1UA 3EF0A 4UARA 1NNLA 2D2VA 5AVUA 3TLMA 4CF3A 5AESA 1CR6A 5AKEA 1Z5GA 3E81A 3QNMA 4HGPA 1RKUA 4UMEA 3UMGA 5ALWA 5AM2A 3QGMA 4NV0A 3OCWA 2I55A 4FYPA 4BKMA 4JB3A 2CFRA 2Q4TA 2R8ZA 2YJ3A 3L0BA 5AVWA 1T5TA 4UATA 1U2SA 4DWOA 2YMPA 1ZJJA 2I54A 3U19A 4BNDA 3U13A 5AKJA 5AW4A 3A1EA 3L0YA 3MN1A 3OCZA 3QXGA 4HGRA 5AI0A 3E58A 2RARA 3NALA 2ZBFA 2WF6A 3WK9A 1N8NA 5ALZA 4DW8A 2WF8A 5ALYA 3NANA 4BX3A 4FFDA 4KX3A 2G09A 5E0OA 2FPWA 1ZRNA 3QU7A 2AUTA 2OYCA 2FUCA 2JAWA 3EPRA 5AW6A 2HHLA 5AK3A 4YIHA 5AHXA 1ZD3A 5ALVA 4KX5A 1ZD4A 2YJ6A 1VJ5A 2IOFK 3WKBA 3UMCA 5AI9A 3A3YA 1RC8A 3E8MA 4Y2SA 4AS2A 4HAIA 2R8YA 2YY6A 1X42A 1Z4MA 4QJBA 4G9BA 4EX6A 2OM6A 3HYCA 5IT0A 1U02A 1U2TA 3SHQA 3QU9A 5IT4A 2BY4A 5AKIA 5ALLA 2HF7A 4OD0A 3SD7A 2CFTA 5ALTA 5AW3A 3AR5A 2JAOA 1YS9A 3L8HA 2R8XA 3WK8A 4GXTA 1N9KA 1ZD2P 1Z5UA 4Y2RA 4CE6A 2GO7A 2B30A 2C9MA 1L7NA 3KOOA 4BYGA 1NF2A 3ZI4A 5ALEA 2JGAA 4IG4A 3QX7A 1VFPA 4C4SA 2RBKA 3ZWDA 4EZEA 2P11A 1YNSA 3ZVMA 5AKKA 3ET4A 5AK4A 2I7DA 1QYIA 4CNQA 3WKDA 3NASA 3IB6A 5AW8A 2WF5A 2FDRA 2G07A 3PGLA 4OFZA 4B6JA 4E88A 4Y2XA 1RRCA 2EARA 2YFYA 5AI6A 1J97A 5AKLA 4UU1A 3W5CA 2G1AA 3IRUA 2OBBA 3WK6A 1XP5A 2B8EA 2CFSA 5AKHA
chains in the Genus database with same CATH superfamily
4L0MA 3NATA 1TW3A 4QXRA 1RYNA 3S8EA 3HZZA 5CAEB 4RMHA 3COPA 1GZSA 2WP8J 3GBSA 1GGNA 4ITUA 5BV1A 3DXYA 4DLXA 2AG5A 1C1DB 3KDSE 5CJ2A 2YJGA 3H8MA 2XOKD 1U3GA 2PD3A 3FGNA 4LVNA 4M1TA 4PW0A 4QXAA 3G8YA 3KHRA 2C2YA 4OJLA 3LX8A 2WMNB 4WFKA 1GAQA 5EUCA 4QECA 3ZHQA 1KP2A 4EHKA 4EPRA 4FDVA 3T9FA 5CA1B 1PX0A 4IRKA 1NZPA 1B8NA 4OMDA 2P9HA 3ACDA 4AIRA 5LZ2A 4BEBA 1SZJG 3SZUA 3IEMA 1PV4A 3EX7C 1FJXA 2R8HA 1RLTA 2BVNA 4WKCA 3HWRA 4M7WA 5B1IA 2ZYTX 3FTEA 2F8TA 4KGVA 5HK8A 5TGDA 5J9FA 1GDDA 3W9BA 2DAPA 3SYLA 1GFSA 4E07A 1W76A 2PEZA 5EI5A 4BAGA 1IXRA 3AFMA 1II9A 1S0NA 2X1HA 4R3WA 5JMOA 3WWZA 5DRYA 1UMKA 4CODB 4YCCA 5KQPA 1PJ4A 1FLVA 1T8WA 2OR3A 4KRYA 5B6PA 5K1ZA 2PUBA 1SCUA 2J0EA 3H84A 4MDFA 5BT9A 2W90A 2HREA 2O0HA 1JKJB 2Y0SF 3UNXA 1L6IA 4URZR 1PVDA 3GP5A 2EFGA 2VKQA 2VYND 4BZPA 4ZK6A 2CNKA 3A1NA 3ABZA 1RHMA 4H9GA 4YTEA 5LBUA 2EL7A 5JHHB 5KNLA 3LDHA 4QOIA 3TR0A 4HT3B 4HNTA 4MFCA 4ZQGA 1N36B 1I6KA 2AR9A 2J85A 2CL5A 1Z6ZA 1M5TA 3BFJA 3G7UA 2C9BA 1NW6A 3P5BA 4L9AA 5BRJA 3HDYA 1E2UA 2BT4A 1CY4A 1A2OA 3OEHD 3IOBA 4XE5A 4CV2A 1OROA 3R4CA 4BO8A 4OGFA 2PWZA 1ZLYA 2CNBA 1ZI6A 4OKIA 2WJPA 4I3GA 1N2CE 2RGNC 4ZJPA 1JN3A 4I14A 5CJ7A 1R16A 4RPZA 2C4VA 3SK0A 5BY2A 4E2FA 1CF2O 3O8BA 2AQKA 3D4LA 2HU5A 2F4NA 3CRQA 1TJ5A 1S0VA 1OREA 4D92A 4F8RA 3SAJA 5JJBA 5EWGA 1ABBA 4KRXA 5FL7A 1QTRA 1Q1GA 1LGYA 5KFSA 4G0NA 4H7KA 1SG0A 4Z1MA 3PDWA 2EANA 2KHQA 3GJ8A 4TQSA 3G0OA 5B66U 5ESWA 3ZLUA 5HS4A 3U7FB 5KSYA 3MGVA 5JCJA 4KCGA 3W04A 1VL6A 2KN7A 4W5QA 1K6MA 2C7QA 2QUJA 4XUGB 1E3WB 5AOCA 1OXJA 2I78A 1UPHA 4IGEA 3ICCA 1PZFA 1RAAA 2GD2A 4GYYA 4X1IA 1H8HA 4PEVA 2Q1XA 3PX6A 5KAFU 4LYEA 5EJGA 4CW7A 1NRJB 4N3BA 4RGQA 3W1EA 3ICQB 1I5OA 5ALHA 3RJGA 4B3DA 1NKBA 1NYLA 1ZCZA 3M6XA 4FCCA 2PMKA 4MULA 2ZGVA 3MTAA 3SEZA 4RZUA 1CUCA 1C8LA 3OFJA 3AM3A 4GFJA 2Z7JA 4P9NA 2RC5A 1NC1A 4JT2A 2DZDA 2EJTA 2XLCA 3ZUPA 5REQA 4DSNA 4BQSA 4QWCA 3L6RA 3REQB 3H99A 5DGHA 5HR6A 1U3CA 3GGJA 1L4KA 4KGXA 1ZRMA 1NRXA 4JLMA 1M7GA 3EUWA 4AG5A 3BDPA 3L7YA 5F52A 2L18A 1L8LA 4CMAA 3G23A 2E85A 3WGTA 3D3KA 2DUMA 3HVKA 3ZBPA 5ITZB 1QYWA 2HQRA 1XQ9A 3TIFA 3FBTA 4IZ6A 2I1QA 1YIOA 4PGXA 3KXIA 1T1SA 1XTTA 3PC8C 3DF9A 4LJ6A 4XIYA 3IH5A 2NO4A 3A0RB 3AONB 4Q37A 4DUPA 1NV8A 2HIAA 4M0MA 3WLFA 3SJBA 2VHVA 3UGJA 3DOOA 4G9EA 1PL8A 2F3NA 2ZAIA 4S1WA 4X54A 2A1TR 1JFFA 2WUDA 3HJRA 4Y2HA 1B8VA 1QAOA 4DIOA 2IA6A 2YNMD 1K9SA 4P32A 4FE3A 3KC2A 5JU6A 1T2EA 3N53A 1E2DA 5BQPA 3K71B 4XDHA 4KPUB 4G85A 5K4LA 3BDAA 1AB5A 3G0HA 2R8PA 1JIJA 1KI3A 1PL6A 2A9KA 4OU4A 4U5XA 4YJ3F 3OJXA 2JFNA 1UMBB 2YINC 3D02A 1OGIA 2VAWA 3KZVA 2BR0A 1CW2B 3N58A 4G4SP 5I8ZA 2IV7A 5C51B 3ZVKA 4P0TA 3AEZA 5CA0A 1MB2A 1U9JA 1KO5A 3MR2A 4GUDA 5EKDA 1P8AA 3ZEIA 1QQ7A 4IDPA 4B83A 2UDPA 3WMGA 5JRZA 3S6JA 2NVWA 4NSNA 3TE6A 3UWDA 3B52X 4X85A 2HBKA 1V8BA 3NIWA 5KWJA 1Z15A 3SQDA 3AUYA 2G1UA 2LNDA 4BQEA 4DFDA 4EYIB 2QKQA 1KO8A 1I7LA 4NI5A 2DBYA 3R5KA 2QTWB 5DLQC 1JE0A 1BAPA 1EBUA 1PR3A 5EIWA 5IASA 4FBUA 2BDEA 3PX0A 1IQ0A 1YQWA 4B9LA 2ZYSA 1YZVA 3CLKA 3COWA 5J2AA 3FRIA 4DCVA 4ECEA 4DB2A 2J0VA 2BCRA 2JBWA 1OJ7A 3AHJA 3DOHA 3H1GA 1JBQA 1H2WA 1FE8A 3EWNA 1LBHA 4G0OA 4DC9A 3KUCA 3TUIC 2VBGA 4FJ0A 1NVBA 3W79A 3FETA 3JRNA 4EYGA 3D8SA 1W9HA 4Q4LA 5CIYA 9ICQA 3LY8A 4Z8YA 3RUFA 1MV8A 3LDFA 1F5SA 2FN9A 2W6MA 3N2EA 4LJXA 1V11A 1ZU4A 4GPEA 4CQJA 2XAUA 4LDRA 1KEZA 3STXA 2CUNA 3CZPA 5DTIA 1NMSA 1QFXA 1Z33A 2PXXA 3JPWA 3MUNA 4FFOA 5KAPA 3H6HA 4XYBA 4UQGA 3VJKA 1F1BA 3GV8B 4BWVA 5LVAA 4Z4GA 2AG8A 4MICA 1V5EA 1BD3A 4MKFA 2QRUA 1JDNA 1GVHA 1UP6A 2E82A 2EU8A 2J3HA 1R4NA 4RQ1A 4F92B 1P9WA 2XY4A 5C1IA 3ROEA 2GBPA 1BS1A 2OO3A 3LY9A 3OY2A 1XKQA 4HC4A 4HNQA 4CQMB 1ISJA 1PLLA 1JDTA 1JDPA 1V9PA 3EW9A 2OY0A 3GK3A 4MPDA 5EJ7A 2J59A 3NW9A 3QX9A 2DTDA 1RPZA 4NS1A 3KHGA 4GLJA 1Y9DA 1DAEA 1QIEA 1Z6PA 3RBZA 5A02A 1X7YB 5EJFA 4RA6A 3WP0A 4C4RA 4NCNA 1U99A 2HMAA 4X1KA 2FPSA 3F7NA 2AMYA 5GGYA 3H65A 2GVZC 1V38A 3D1VA 4M1QA 2JKZA 5IDXA 2C5EA 2I2DA 2VL7A 3A1WA 1GZ3A 4HP8A 3AKCA 3OWXA 4RM2A 5FOTA 4AZ3B 3L4JA 1Y6GA 3V2IA 1C80A 5CB8A 3IO5A 4RANA 1ISSA 2WB2A 5IC5A 1E7WA 4X20B 5AM5A 1TCVA 4FIDA 4P5DA 3OBBA 4LC0A 3C3MA 2VDNB 1X7GA 3RJTA 5IKOA 2FQXA 4ZODA 3RK4A 1SUAA 3PQ5A 2ESRA 4MQLA 4KSYA 1O08A 2ZK7A 5L45A 3FPCA 3S2ZA 3TCKA 3LLSA 4MI6A 1DZ3A 2EP5A 2IX9A 4TUYB 1R1DA 1V9CA 5AJXA 1PJCA 1NA5A 3HI6A 3E22A 2A0WA 4PYLA 1A4RA 4XJSA 5L3ZA 3ZX4A 5JI2E 5DNAA 5J0WA 2JD2A 2GO1A 2W9AA 2NACA 4ZPJA 1WXGA 3PD7A 4C7XA 5EFOA 5F7JA 2XUHA 4YCNA 2W42A 4KIWA 4HLDA 4QASA 4R9VA 3KTQA 3L7LA 3T41A 3ZY2A 5HR5A 2FF5A 5DLEA 2B4YA 2LW7A 1VCOA 3T3PB 4DSZA 3KTAB 4JEIA 4N6NA 4Y2PA 1W88B 1YQEA 4A0HA 1O8BA 1MAVA 3B9RA 3HVRA 4O3NA 2BCUA 2LV8A 1Z22A 2ZP1A 5FLYA 3ZIDA 2K4IA 5D49A 2DQYA 4QZAA 4NEQA 5TQVA 1GFZA 3HV2A 3R76A 5BW4A 1GKIA 2YBDA 4CG3A 1RIIA 5B3JC 2SHKA 3QSYA 3DULA 4GNRA 1ZQAA 1T3GA 2C2BA 1CUYA 2CNLA 3DEIA 4KQCA 1YB4A 1P81A 2DQ4A 1E0SA 2R1UA 1KTIA 5H8WA 4IL6U 5KFGA 3K1AB 5D84A 1U04A 2Z6AA 3LYSA 4PYMA 3OFKA 3S27A 2XNDA 2KZZA 3F3MA 1FEZA 1SIJA 2Y6VA 1T1JA 1OIVA 2DJ5A 2RGDA 4LVOA 4NMXB 3MG9A 3SM3A 2VRNA 4PSAA 2PGJA 4ZN6A 1A72A 1GLVA 5B7PA 2K8BB 1AK9A 2ZULA 2PX6A 1ZS9A 2X0JA 4RPHA 2LIPA 1INLA 1P4HA 1Z4PX 1RVDA 4ZTBA 5K3SA 5IVHA 4P4SB 4PNPA 3QW2A 2ZB4A 4MB2A 3SX4A 2VRCD 4HYEA 2Q5CA 5HIIA 1D6MA 1WUYA 1AD2A 5A0TA 1ZN9A 1L5FA 5I4BA 1BDMA 1XS9D 1S9FA 1FYVA 3KKAC 3PCTA 1WZUA 3OT4A 4UB1A 3E15A 3DP9A 4JLUA 4TT3A 2M6SA 2J33A 4I28A 2C3PA 3E1KA 1KSPA 4BB6A 1O6FA 3F5SA 1OF1A 3LZDA 3Q3GE 4KO3S 3K5HA 1E7QA 4MRMB 2FPPA 4G0XA 4X9XA 5DTMA 3VZQA 5LLTA 3HKZC 2PJDA 2JANA 1QP0A 3SHOA 4X97A 4YO8A 5BW8A 3EBLA 1RWWA 3X2SA 3ZCSA 4GKKB 2UYQA 2VC2B 3DL0A 1C0LA 1RWKA 1P7YA 2NTVA 1AS0A 1R8YA 4L0DA 5BSHA 1DELA 4KVAA 2PSDA 3VR3D 2DFPA 1ORHA 1SQFA 3PQDA 1FTYA 4WK4B 5FPSA 2JNWA 3SYRA 4E08A 3SVLA 1C9NA 1I30A 1XLTC 3RS4A 3SV3A 1T5LA 1J49A 3O73A 4M88A 2W11A 3GUHA 1CRZA 1T4CB 2JIPA 3VPXA 3JS5A 1LLUA 3K5IA 1K5PA 4L8VA 4KQEA 3JAWB 3N9IA 2NRZA 1IOZA 2FFJA 3K0FA 4IDDA 1SHTX 4LMPA 4RKQA 1AKEA 2Q5HA 5AH0A 4Z9BA 3V6MA 2VQDA 4QODA 5B53A 3HXPA 5ESDA 1IN4A 1RJ9A 4TQGA 3SC6A 1SHUX 3VSEA 1OXSC 4BNKA 3A1CA 2BI8A 4G3IA 3R3VA 4R9UC 2QAGC 4TLBA 1FMFA 1WPGA 2X42A 3FTPA 4M4SA 4Q9HA 2ZSIA 3HB5X 2B34A 4DIBA 3HA5A 4KAFA 4YALA 3GF4A 1MC4A 3HQ4O 4ZZIA 4QJ5A 3U3ZA 2VDLB 4F5DA 3WDLA 3ZWMA 1Y3FE 1KU6A 1KRXA 3BB4A 4OQLA 3ETCA 4QFMA 2O7NA 3NB0A 3EMKA 5LD2C 2CFIA 1C14A 5FULA 5AKEA 2XRMA 1VGQA 2P4HX 1WXWA 2A9OA 4I6GA 1C9KA 2NNLD 1A9PA 4ND2A 4OSOA 4CR7A 1X9XA 3CN9A 2VDMB 3RAGA 4MKHA 2VF4X 3C1UA 4F04A 4KLCA 2VJDA 5JAPA 1RPJA 4QWWA 5C32A 3FCXA 1E9SA 3TPCA 3ENZA 3A6HA 3UQYS 7ICTA 3AB8A 3ILVA 2R8GA 4CLOB 4TQUS 3C1YA 2CFRA 2RHJA 2ERCA 4ZIRB 1VLZA 1Z45A 2FSSA 2OHOA 4HAUA 3TMYA 4D3ZA 3KVOA 2NU7A 1Z26A 2ZBPA 3PEFA 2UZ3A 1E2BA 1G9XA 2QVCA 2HA2A 4P6VF 2AFRA 2PLNA 4WK0B 4KR7A 3C4QA 3WNQA 1LU9A 2F17A 1C7RA 1LVGA 3CLRC 3PQ7A 5HUJA 2PUFA 4WCFA 4WZAE 1XWWA 1ZJJA 2V7XA 1GG2A 5LUAA 1KH3A 3ZBTA 3B5IA 3PYLA 3HP4A 2CC2A 3U13A 1OXKB 1DHRA 1PT8A 3LXMA 1W9MA 1WW3A 3H9QA 3JV7A 4RL4A 1U45A 5K3CA 3R7BA 3BWMA 3RKRA 1L5YA 4OK6A 4GWKA 4PZ0A 1A6SA 1M6HA 3W6NA 3BRCA 3KQUA 3VCBA 1L5MA 4MYTA 1ZVMA 3MGBA 4DW8A 2AGPA 1XDWA 2CNWD 3DR5A 3JQDA 5G1NA 3V2UA 3G68A 3H1FA 4UAGA 4BVAA 4CCSA 1EXVA 1NLUA 2C4HA 3RBEA 2FPGA 4LY6A 4AJ9A 1VGVA 2FPWA 2FMUA 2R1TB 2XB8A 2ENUA 2SCUB 5AK3A 1KKXA 4YIHA 1WMBA 5JQGF 3RSLA 1JHUA 5IWCA 3CQ9A 3UAVA 3MCAA 2BFWA 4DAEA 5HP4A 1A71A 2XMZA 5IJ0A 1KJQA 4RD0A 5LJIA 1D9FA 2O3RA 2FNAA 3QOXA 4IIEA 2A0FA 4HMQA 1K88A 5KVVA 1W49A 5KTMA 3K96A 3DKVA 3DVRX 1N25A 4WVLA 2XLBA 1B8PA 1PNVA 1MOSA 1Z6YA 3LRXA 4YNBA 1S3GA 1XYGA 3RVPA 3GEHA 3ONVA 3HCCA 4J0CA 2IIVA 2LKDA 4MK4A 2PKCA 1B1CA 4EPWA 2YVLA 1Q3VA 1YD7A 2OHFA 4M1YA 4F4CA 4AMUA 4WKOA 2GKSA 3R0JA 3UKOA 2VZEA 5HJ7A 1O94A 4IBOA 2PTGA 1DRWA 4NCBA 5KYTA 3P0JA 1QZXA 2E4WA 1FFGA 1PJLA 2FFBA 2VG8A 3ASVA 1DBPA 2B1IA 1Z5UA 2RKBA 3NCTA 4MO9A 1GNRA 4L08A 4OAPA 1V4NA 3NGXA 5E9JA 2OGTA 5DLGA 4CI0B 1J2TA 2WLTA 4RLFA 3H2IA 4I36A 2A1UA 2Q99A 4HSGA 4DMGA 4L8LA 3WRYC 1D4AA 4WBNF 1UT8A 1YJCA 3FHTA 1VFPA 2E9SA 2ZROA 4JUFA 4Y6QA 2ZPTX 1VIYA 2PUAA 4F2PA 3KQOA 2D1SA 1PJAA 1QGAA 4RV4A 4RXUA 1QYIA 1XXLA 1QTNA 3T9EA 4ALNA 3W3AH 3JYHA 3AO0B 4FEEA 5CCDA 3TFWA 3VPSA 5EP4A 3FUVA 2C2EA 3EWSA 1ZK3A 3HP6A 4ML3A 4A0SA 4B6EA 2EWVA 5F3RA 1MAUA 1VG8A 1YKSA 1A4XA 1Q19A 3AESB 1Q22A 1ZVQA 4MKZA 3W2TA 1VSQA 2XEDA 1QJ4A 1KK3A 2YWDA 4M49A 2BZ0A 3HVHA 3W34A 3BULA 3VKWA 3DHWC 4INAA 4XYLA 4JBYA 3MWGA 2VH5R 2JFHA 4J94A 3T99A 2C94A 1PNQA 1KR5A 1TJNA 2WU3A 5AKHA 3R6DA 4D3XA 4QDXA 3PC8A 3EGIA 2JDIA 4O4HA 1K97A 3HY6A 2J9GA 2R60A 3A05A 4Z6FA 1P7WA 1M2JA 3R5JA 4N12A 2WM8A 2GLEA 1C81A 1LPBB 2P9GA 3QLUC 1GTG1 1KMIY 2SKCA 4OFBA 2Y1FA 4UBMA 4A03A 3I1FA 4TVBA 3RJ5A 4F56A 2RJNA 4PZCA 4WW0A 1K8ZB 4DQLA 1H2XA 2F3UA 4WASA 2F9FA 1U8AA 4DL2A 3A9SA 4J0GA 4ASUD 4PFQA 1U3DA 2M2IA 3KOUA 2PFQA 1G7SA 3RRZA 3ZGYA 4MZXA 2VYVD 3AHDA 2VSFA 3ZLBA 3A9UA 5AKYA 2ZRBA 1SPXA 3NORA 2XRYA 2AL7A 1XVAA 1EVYA 3SF0A 3DQQA 5BSEA 5AI8A 1OE0A 2WWYA 4WECA 3HJFA 2KHZA 3ZCTA 2MMCA 3TFSA 4DV4B 3VJRA 3FUTA 4CEIB 3P2IA 3F47A 2HZBA 4BFVA 2YOHA 4CM3A 4Y2YA 1QB7A 5KFWA 4FHCA 3D5QA 3UF0A 1R0WA 3IMGA 2MYUA 1AVTA 4B6QA 1GSHA 4ZI7F 1U9CA 1G18A 5ERGB 1Y6ZA 4ZVMA 3V2GA 1KK1A 3GRAA 5KEIA 1R9MA 1R27A 4DJAA 4MYCA 4UZFA 3MS7A 3ER6A 1EFKA 3P2MA 3NBAA 2P41A 1GZ4A 5T14A 1HKHA 3PPWA 4RFSB 5EP2A 3H0LB 3RUCA 3SJ7A 4RADA 4DCJA 4UMDA 3WIDA 3VAAA 3A2LA 5CGQB 2WYUA 3P9NA 1V97A 1FDSA 1I33A 4F4WA 4BS9A 3DLBA 1U4NA 1RI2A 2OB1A 3H2HA 3W6OA 4Q47A 5IAOA 3JQAA 4GXQA 2OC9A 3J7TA 1C8KA 4P7FA 2ANCA 3LTEA 5HTOA 3GLVA 3RR2A 1BEZA 3U49A 3TECE 1SCNE 3TZHA 1NK0A 3H9UA 4NZZA 5G3YA 3R7LA 1UPTA 2XCUA 3WMXA 1Y4DE 3VO2A 1RHQA 4C07A 4ZWNA 4BEJA 3R9KA 1G5TA 3F8TA 5ES4B 4NCAA 3C8UA 4B3RB 4FSHA 2QRLA 3UHPA 3QYPA 3O8OA 2H51A 2CJPA 3KELA 1JN0A 3LCUA 1BYIA 2VUSA 3P32A 3PYXA 4NJ8A 2UYYA 3FGZA 5K4AA 2Q2OA 1BQ4A 4YH1A 4DFJA 1I3NA 2HDNB 5D3ZA 3UAXA 4DJ5X 3THYA 2MCFA 3RREA 2OUIA 3NHRA 2VANA 1ZQZA 1NYQA 1CJSA 1SVUA 2V96A 3I6BA 2ABWA 2V7QD 4O29A 2P9FA 4OUDB 4Q93A 4KVFA 4XQEA 4B9EA 1KFDA 1MJGM 5K03A 2F55A 2WHRA 3AL3A 2BSXA 1TM1E 3G2PA 3I2HA 4JC5A 2FG7C 2GQ0A 3IE2A 4Q6WA 1JPVA 4DMKA 3M33A 2PFSA 1BTOA 1PW7A 1U3VA 3RYCB 4UDYX 3GHYA 1JWLA 3CR8A 4UBOA 1IIBA 2VYQA 1J70A 3GMTA 4GBJA 4IVNA 3K0AB 2XGSA 2VTKA 3MIIA 2D1TA 2XVMA 4O5AA 1W44A 4AYBF 3RVNA 3IILA 2DXIA 1HLDA 2CL6X 4KYVA 4LVCA 2AJTA 4XGRA 4W8HA 1EBFA 1KSGA 5A1JA 1NN0A 1GPBA 1JQDA 4B84A 5LFAA 5LP6B 3BXPA 4AJJA 4KFCA 3LA8A 1L6NA 2YIJA 4OHWA 5KTYA 5C35A 4JI0B 5FJJA 1EG7A 4Q9JA 1SVWA 2XHEA 2P6RA 3CG0A 5KFXA 1LA2A 1UPFA 2PQ0A 3BD9A 3IAHA 4GHWA 5ER9A 1EXWA 1XYYA 2QI9F 3DZBA 3YASA 3GLGA 1HE4A 2OXFA 2PGDA 1YQQA 4WPGA 4TSRA 1LWOA 1F2UB 1Z29A 2AN9A 3DGEC 4IXDA 2XAAA 3MBIA 4EPTA 1G2PA 4RMJA 4WKNA 3VMFA 2HBRA 3PQ8A 4WZZA 4LE2A 3GRUA 3HR4A 3OCCA 2B8NA 2OVFA 4NABA 2FW8A 5AJHA 4EENA 2DFKB 3FVVA 3LC7O 3PCXA 4I9UA 4KVZA 3TW4A 4Z6KA 4A10A 5EIOA 2C1EA 4GX0A 3V8BA 3TL2A 1QO0D 4HJRA 3ZHSA 1X2EA 3DW1X 4BV3A 2QQFA 1Z9BA 3KWJA 1CDEA 2BFBB 1YWGO 4MH0R 3MWEB 4ZVPA 2VJOA 3CUEF 1ESEA 1DEXA 3L6BA 5EESA 3WLAA 4DL9A 1HRDA 2H08A 1U8CB 3PC3A 2PSHA 4ZYYA 5E95A 5AXAA 5JAOA 1KEKA 2O8NA 4AJ2A 4L4SA 1VDVA 4GR9A 4C4XA 5KTRA 4R8MA 2WB1F 3DMYA 4GL4A 4MQEA 1GUZA 5TS2A 4G1MB 2YYYA 4KLTA 3JQFA 3ZU3A 3NEYA 1B3RA 1QR2A 3FG9A 1FZQA 3LZ6A 4KLRA 4E2YA 1WKBA 1XD8A 4U3JA 5KYUB 1L8QA 4ALJA 3FYHA 5J2JA 1QXSA 2QF7A 4JLVA 1LRJA 4R41A 2FPIB 3QXHA 2CY0A 1FNNA 1JX6A 3QWAA 4TTAA 1HK7A 9ICLA 1FMJA 1NRWA 5TMPA 4QGSA 1TD9A 1Z0IA 4F2DA 5FOSA 2RB5A 2EF0A 1HDCA 2D5CA 2WSBA 1J20A 4DMMA 1YA6A 3SQIA 2OENG 2QAGA 3AILA 3GT3A 4PPYA 3TARA 3OQMA 2ASEA 1L9XA 1LW7A 2N47A 5I9IA 4E4RA 1JHVA 3BHNA 3WADA 2JARA 3QELB 3H11B 3L8GA 4QYSA 4F84A 4BGDA 4LFCB 1NF9A 2I7VA 1XMSA 4Q34A 5LKRA 3OIFA 3M9OB 1M0WA 1URJA 4KLGA 1IZZA 2X4DA 2Z1MA 3O2JA 3TRFA 5TQ0A 3IJ5A 3KPVA 3NNSA 2DGDA 1DAPA 3O8NA 5AQ1A 4DSAA 4QLOA 3PNQA 3TLGA 3FTNA 3D2AA 3QUSA 5AJVB 2WMDA 5A4AA 1MOZA 1XJ0A 4RQ7A 4V0NA 4GDMA 3THWB 3DE3X 3HACA 5EIBD 2QGNA 4RD6A 1SCAA 1GKYA 5E8RA 2ZRDA 2BH9A 1HY3A 1RWNA 1UMDB 3PVSA 1OBCA 2GXQA 4LGCA 3RRFA 1R66A 3I0MA 2X0EA 1EBBA 4EHBA 3SSOA 1QRTA 4MYRA 2ZZNA 2CBZA 5KFCA 4CM4B 3L6OO 1V6AA 3IQWA 4IDFA 3BXGA 1ZOLA 3I9OA 1UDWA 3KYCA 4GBGA 5DH9A 1RXVA 2ZBQA 3D6NB 4FHGA 5GOTA 3WP1B 4F72A 3M2TA 2BGRA 3UQ0A 4EK9A 2O2XA 2HZ7A 2LE0A 2HSDA 2ZS7A 2QGFA 5KFFA 3OCUA 4BFXA 1KERA 4JNKA 2MSLA 1PJRA 1PTJC 1VZ3A 3NO4A 2P3QA 2P8SA 1WXHA 2OZKA 2WYWA 2C0CA 2H2IA 3CISA 1W73A 1ZK2A 2I2CA 2Z1NA 3FLBA 3DQPA 2ZYVX 4YAKA 3Q0TA 4FWTA 3DFIA 3WKEA 3O8QB 2PGLA 5BP7A 1AHPA 2RC6A 4YWHA 2KICA 1UEJA 1WMAA 1Y7IA 2PSEA 4FNOA 4KGZA 1FFCA 3FFXA 2I33A 3PFBA 5KNCH 2ZUFA 4A36A 4YQYA 3C8DA 3PKJA 4M46A 4B0OA 3AC0A 1HH4A 3TEMA 1R0BA 1XMOB 3BWBA 3A58B 3IG8A 1G3MA 1XEXA 3UYLA 4YDRA 2BZGA 3ZDDA 1I7NA 1ZSNA 2HMVA 3OJUA 8ICLA 1JNXX 4KYIB 2O2YA 1FRNA 2LKCA 3M6MD 1XROA 2QAJA 3AU9A 4N7RA 1M2HA 5EHXA 2Q9AA 1XKLA 5FI0B 2KK0A 3VFDA 4F9FA 2H31A 3W7AA 2PGIA 4EHIA 1KJNA 1TEVA 3OSPA 5GTIU 5KFRA 1M6WA 1JAXA 2FR8A 2VHQA 3KWLA 4FD2A 3RC8A 3HEMA 4PRZA 4Q3LA 3CS3A 2W0MA 3CZQA 4NENA 3P71T 1UJ5A 4U9IS 4P5EA 1P0PA 8OHMA 4PHEA 4QFBA 3D64A 4E2XA 3ROZA 1TZJA 3BTOA 1Z38A 3CSUA 1F8FA 1ZIDA 2G9ZA 2QX4A 3LY5A 4KDEA 5A3VA 3D4BA 5JWRA 5BYJA 4L8FA 4DWWA 1T36A 3L0CA 2XA1A 4PZPA 2K8AA 3K9LA 4M9JA 3RUDA 5LKAA 3WU2U 2FPXA 2O8EA 3OO1A 1G6Q1 3BZUA 3HL0A 1C4WA 3DOEA 1O9GA 1IMOA 2ALJA 4FDTA 1YDHA 3T61A 4D79A 2QV0A 2AUNA 3DKPA 3JQEA 4EY4A 4XYGA 2ZQYA 2H3FA 4KPGA 3FGPA 5KFNA 1MABA 2V7PA 3MTBA 3OJEA 3KEFA 4LZJA 5DI3A 5C3MA 1TYEB 2FFQA 1NY6A 3SYKA 1RDFA 4KOEC 2QD3A 4KWTA 4RQ4A 4MPPA 4TZ6A 4OQDA 1PJQA 3WGYA 1ZC4A 2B7LA 4Q4HA 5KFHA 1WQ3A 5AM3A 2CK3A 3BS5A 2YFQA 1OYOA 1WB5A 3ANNA 4OH1A 1Q3HA 1EFVB 2FG6C 4GQAA 4WIAA 5SZJA 1OVGA 3RVDA 5A9SB 2QBYB 1QLWA 4EGAA 1MIOB 2BDPA 4RLHA 5ALXA 1QTIA 3GZNA 4FNAA 1XNJA 2IQ5A 4FQ8A 2FPUA 3KZXA 4ALLA 5DB4A 5I3ZA 3CPSA 1QFZA 3EQ7A 1KO7A 3DZKA 1YDMA 2EVWX 4ARVA 1SNYA 5IM4F 2FOIA 1H6AA 3HU5A 3P94A 3NAMA 1R4ZA 3SM9A 3IAM6 2P35A 3UV6A 3FC4A 2EIHA 1ZMXA 3OIYA 5DHAA 3LLVA 1KI9A 4EO9A 1SHKA 2IXGA 4M98A 3X44A 1T9CA 2H7YA 3SNKA 4DWVA 4B3HA 1RYUA 4JKYA 4XFDA 2IHNA 3EPPA 3JQQA 3RDPA 2V6MA 3CRZA 5KYNA 1P3Y1 2RGUA 5K3DA 4JYPA 3ZU6A 2R8RA 5FAKA 4R1TA 3Q9LA 2PSFA 5C5DA 3HXOA 1JEJA 4J49A 3VR4D 1H5QA 3T9DA 3CINA 4G5FA 1B1AA 2HVHA 1RBQA 1WPXA 1XO1A 3RH6A 4FZ3A 4IOMA 2FP4B 1U1GA 2ZRQA 5B5SA 4ZO7A 2IOFA 4DN6A 4GWGA 3B0XA 1Q0ZA 1Z00A 3HX0A 1G21A 1GOTA 2VN8A 1QOQB 3EZLA 4QU9A 4RF5A 5BURA 2WD9A 1OBFO 2VRCA 3LX5A 2FWJA 3WTBA 5A0VA 3ZDAA 2IA5A 1W34A 3UM9A 1E4VA 221PA 2E87A 5B1DA 5B5EU 1QZZA 5IIOA 3ECAA 2MWMA 4DSFA 3EDQA 4OMFG 5EPOA 2P0YA 5B1SA 3BGOS 1NNLA 5FOUA 3ZIAA 1GCIA 2GESA 2QB0A 3GRCA 5AVUA 3C2LA 1YRAA 3NXKA 2CXSA 1WM1A 1VHTA 4NDNE 4MRPA 4UB6U 4M04A 3KU4A 4RFVA 3KQVA 5DHQA 1ECLA 3SSMA 2H9AA 1ST3A 1TKCA 4OLJA 3K9FC 1M1NA 1S6YA 2JR5A 2G04A 1T6ZA 3QPVA 4KV9A 4L4ZA 1W4BA 2AGQA 3M6UA 4IDQA 5LYJA 4P0QB 2AFHA 4FFWA 421PA 1F4VA 4QFDA 1RZRA 1L3UA 1RBYA 3U56A 1J99A 2QRGA 2FVYA 1RXWA 3FFTA 3FYUC 2VAXA 1NQVA 3HJGA 3P9KA 2QW8A 4FW8A 4FZJA 4JMLA 1J2JA 1FRZA 4AJHA 5JBQA 3TBHA 1UBHS 1G0OA 5DQIA 1VHLA 1YVRA 2QV7A 1ZOOA 2ROQA 3OZEA 3THRA 3TTWA 2DC1A 5H59A 1L5SA 5CB4A 1DBSA 3D31A 5FTJA 1N5OX 4A23A 3IAXA 4YRDA 5THKA 4UATA 1KSFX 1LY1A 1GG5A 1VRCA 3N76A 3PPXA 4TLLB 5EFZA 1VRVA 3UG7A 4V0ME 4ZCTA 1KI6A 3DFUA 1QLNA 1QH1B 3ANSA 1GA4A 3CTMA 2E4ZA 3DUFB 1M6VA 1UM9A 4QQRA 9ICTA 3I30X 4LRXA 4AB1A 2PCJA 5KSZA 3FTFA 2VWQA 1XXHA 2HFJA 5DNDA 1V3UA 5D5HA 3LVBA 2WF6A 4DRXB 2IKSA 1TVKB 4HEA6 4MVCA 4JBNA 2W4QA 4P3OA 2BUCA 4CIXA 5EZ5A 2XIQA 2LKYA 1ISGA 3OEWA 1EFTA 4LF5B 3BRSA 1XSLA 1OU4A 3HP1A 3GRZA 4MW9A 2QVYX 4RD2A 2IZ5A 1RRKA 1YMUA 1QLJA 2F43A 1Q0RA 1UBUS 2GHRA 1EFHA 1E58A 2FUCA 3DO6A 3OZWA 4IXTA 3G5TA 4Y1EA 2ZR9A 5GJBA 3EIFA 2CVHA 3GLFE 4WESB 4Z7QB 5EE1A 3FMPB 3KHUA 4NMHA 1X2IA 2G36A 4OXXA 4UTXA 3BXHA 5COBA 1GA1A 2AC7A 1RRMA 5CX1B 3A3OA 1YRBA 4JQCA 3TW0A 4N40A 1Z8NA 1OLOA 2FKNA 3QEAZ 1P2TA 1X7DA 2BHLA 4PHHA 2WJWA 3QKRA 4HDQB 3CKKA 5TMBA 4KN4A 1HDXA 1LSJA 1JKMA 3FJ1A 4X64B 1P39A 5C1BA 4XDZA 3Q7SA 1L4YA 1M2OB 1D6JA 3LTNC 1EDZA 2CXRA 3A1SA 4R65A 4NZOA 1T35A 4UXHA 5AJYA 2R18A 2IPLA 3QU9A 3AB7A 5D86A 1HYHA 4UEKA 5C1OA 3OJOA 3GFSA 4TPKA 2HF7A 2OO5C 2DLDA 1M0SA 2RHBA 4YACA 4AF7A 4D82A 3PLRA 5DBOA 5TY0A 1L5KA 3DVLA 4CDGA 5JS6A 1QRDA 1WUKS 4RD3A 3RIMA 4P0PA 1KF0A 3KEOA 3PSAA 7ICKA 2KVSA 4CE6A 4JBLA 4ESHA 1TMYA 1GKLA 4LSGA 1UOPA 1GL6A 3TFQA 3ZV6A 5CBKA 1S8AA 4FIZA 1QSYA 4HAWA 3EZ7A 1V5WA 2HHTA 1M2VB 3MCZA 8ICFA 5D6NA 5T57A 2O8DA 5E3IA 3BDIA 3NVMB 2V9WA 3N8KA 3UMFA 1PR9A 2XOXA 3DB1A 5EVCA 2Z2ZA 2RJOA 3QOYA 5B7GA 3B70A 3P9RA 1R5BA 2QMUA 4G4GA 2ZIWB 4GXJA 2ASLA 1X7HA 3VOSA 4C0BA 4OFZA 3LUFA 2OMKA 2CLOB 4Y2XA 1YS1X 3ECSA 1I4EB 3PHBE 1NHWA 2QS9A 3C41J 3COZA 1G8AA 1DLJA 4I50B 5D3KA 4A6XA 2V7GA 4PHDA 4IM7A 5JI3E 1YCHA 3CY6A 3S8MA 1SKQA 4D4LA 1TKDA 2GZMA 3DO8A 3DQZA 3JZDA 4RNOA 1IPEA 1T1EA 4O8ZA 5DXFA 2JFYA 2Z57A 1PK7A 1ZM4A 3PE6A 4OSEA 2J31A 1FC0A 1G5IA 1UWLA 5HG0A 3HTXA 3GZTB 2XBMA 1CVIA 3LUKA 3RS3A 2CLLB 4CYMA 1JUDA 3QJGA 3UMMA 3VV2A 2ONKA 2PS1A 4KR3A 2BTOA 3VTKA 2JI7A 4PH5A 1NUAA 4DS3A 1MEJA 1HUZA 5AHRA 3GVXA 3MIZA 3NXSA 3PG5A 1A8UA 1ECBA 4K0KB 1KL9A 2XB2A 2HPVA 2Y9PB 4YD1A 2O7SA 2VNKA 1NG1A 5ECDA 1IHPA 4ECQA 4OGKA 5AVRA 1YCFA 2NO7A 3OZRA 5GJCA 3RTCA 3UIEA 2R6JA 4NJEB 2QVXX 4WLVA 3SVZA 4BCBA 3CUSA 3A4TA 3VQTA 4Q9LA 1NVEA 1SUPA 4YV0A 1COZA 4KE7A 1QQ5A 1P2DA 2RCNA 3BQTA 1YU6A 4EB8A 3NBYC 1Z08A 2BPCA 2IUUA 5TGTA 3LOPA 1YC2A 4M0KA 1NVAA 1QGUB 1E60A 1QCDA 3ETLA 3ZWNA 4REQB 2QTAA 5FJIA 1RI3A 4AXXA 3ITNA 4YCBA 1QPBA 3DE6X 1PLJA 3K53A 3LAWA 4RBNA 1WBDA 1CP3A 1E2FA 1V1MA 1T2FA 3D8NA 4LTDA 2V4ZA 1H5NA 1AC5A 3D3WB 3QP9A 3AEXA 3RW9A 3AUOA 1HETA 2A84A 1U0RA 3JTMA 3W1VA 2JIQA 2TMKA 4QOGA 2W03A 2BSAA 2JJ1A 5EJMA 2ZS8A 1QG6A 3PF8A 2DF4B 3IV6A 1W6RA 4MFAA 4KXWA 4LX8A 4V1CB 4DFMA 1JMKC 1NBMA 5KTPA 1JR3A 2XH8A 2I2XB 3T5CA 2QZPA 3USCS 4J2OA 5UKDA 4BX0A 4F8EA 3E48A 1E0AA 2ODQA 4F2RA 2QPAA 3W2GA 3QBDA 4G24A 5EIHA 2UVWA 2P2CA 1O87A 3FMIA 4TYWA 1SCKA 3HUEA 1Q91A 4Z4FA 5K0CA 1F8GA 3ZZ0A 4DNQA 1E8NA 2FW1A 5DE3A 4ASUA 1QO7A 4J1SA 3GJ0A 4BCDA 1WCNA 2QNRA 5LQNA 3RFUA 4EGQA 3GPIA 3TSOA 4YMTA 3A9CA 3RANA 3LQFA 2H7VA 1O2DA 4KLLA 2H3ZA 5F3XB 3F4BA 4O63O 4FFSA 4OIFA 3REGA 5IIIA 4IWXA 1HBJA 3H9GA 4OQMA 4ZP1A 4QDJA 3AUSA 3TAXA 4YR7A 1U1DA 2ZJ5A 2BBTA 4H08A 5L3RA 5BSVA 1ILEA 2FY8A 3GGSA 1RXYA 1ODKA 5TIIA 1RM3A 2GGSA 3QLUA 4OOFA 3U39A 5FLKA 4D7AA 1TVEA 2YZKA 5ADUS 2O8FA 5HX7A 5I9BA 2QQ0A 2CVZA 1DL5A 1XLWA 2CFOA 1NQWA 3GMDA 3O4FA 3FLMA 2FUKA 5E4YA 4DV6B 2V0GA 3FVQA 3MELA 5LA6F 2VVTA 4RJLA 1G20B 4FZ5A 4DZRA 2G0TA 1NSYA 3OZUA 1NXSA 1OA0A 2AXTU 3BWDD 3U4QB 1V3VA 1ZD1A 5CLQA 2BZFA 2I1VB 3K75D 2FWAA 1IHOA 4J29A 5L9AA 3DE7X 4EG0A 1RLOA 3L0IB 3VTAA 1LH0A 2BEWA 2JFWA 2FXVA 3ZZUA 1AIPA 2GILA 3IR7A 1XZPA 2Y05A 3L49A 2UXCB 4OATA 4DQDA 2XTNA 3SP1A 4HFJA 3GELA 5IH7A 2IU0A 2AR0A 2WRZA 2D1YA 4XM1A 2J1LA 4L72A 3ZNNA 5DX0A 3ZZTA 3BMNA 8ATCA 5DLFA 1QANA 2FLLA 2I66A 4ON9A 4RDIA 4O2AA 5SY4A 2JIZD 3KV3O 5A4JA 2YW2A 3CX8A 3TXXA 2EX4A 5CXUA 3QKSA 1NFFA 3AR6A 1R8XA 4EYOA 3KHSA 3GQBA 2W2LA 2EP7A 2RGRA 4ENSA 2R6ZA 3WGQA 2PUCA 4PICA 1K7XB 1NBIA 3ZGXA 5HA5A 3UGQA 3TVTA 4YMGA 1JLRA 2IYFA 2HO4A 2WJIA 3FPEA 1AN0A 4G65A 4XPZA 4EEZA 1VPDA 4HUJA 2KE5A 2Y92A 4MAFA 3TX6A 4I1UA 1KFTA 5FUMA 2XD9A 1KHHA 3G0DA 3IT1A 3QTLA 3JWIA 1Y5NA 3UTDA 1WWVA 3WGVA 4EG1A 1FDRA 5GMOA 5F33A 2Q62A 3CLTC 4F97A 2O7QA 5EE3A 3PV0A 1OHHD 3T79A 1CF9A 3W9SA 2FZCA 1X9GA 1B6TA 1NHGA 1P6QA 2PLFA 2RFLA 3TQIA 3PFHA 3SZLA 1K1QA 2BFOA 5CR9A 5IYZB 5ITWA 5J2UF 5BN3B 2AJDA 4N5NA 4LGVA 4MEJA 1SUEA 1ECGA 2OSBA 2ZSAA 4EB0A 3TSAA 3AVPA 3BCUA 3NBXX 3EULA 4ETMA 2Y68A 3O91A 1K1EA 2Y76A 4PPNA 3UK7A 3OOWA 4PYRA 1IE3A 3DOIA 3OPMA 3GJ5A 4G2TA 5G0UA 4XM2A 4RTPA 2GWHA 1PU2A 4LHXA 2A19A 3ZJVA 1XC9A 3KQLA 3GDXA 4L50A 4ZVNA 1OGJA 4XI9A 1RRVA 2HWUA 3QI7A 4GGPA 1UC4B 4TMKA 1NUUA 2MSKA 2HK6A 4GOOD 3E5NA 3ZH2A 1Q0SA 4WE3A 3QFFA 3ZV4A 4ZEXA 4D97A 3I5XA 2KJ8A 1XJCA 1UKZA 5I4KA 5E3JA 5BN4B 1S8FA 1QRAA 3OHSX 2O8CA 4C04A 3OEHA 4FXOA 2G4LA 3L6DA 4BRWA 2QN9A 2FGKA 3DMFA 1LUAA 2TS1A 3NBZC 4IL5A 5JR3A 1TYDE 3I5UA 4W6ZA 1ECJA 1X80B 2ZUTA 4C7KA 3V48A 1KC3A 3BQ1A 3C4VA 1O8CA 1B0AA 2GYUA 4UULA 5IDQA 4U1RA 3E8XA 5FORA 3P9CA 1K66A 2Q7DA 2XCIA 4MTLA 3AKDA 3FMOB 2DPYA 3M4NA 1TEZA 2Q5JA 3ON5A 4TS4A 5T64A 2SKEA 2VHEA 3OUUA 2H3QA 1FP4A 1O77A 2HGZA 2PHZA 4OM8A 1RJEA 1VCIA 4YAIA 2PR7A 1XDBA 1VSVA 2BM8A 2RGAA 4IIBA 3ZWAA 3ML1A 5EHZA 2C2MA 2IS2A 3T1YB 4HQRA 3BGDA 2O3JA 3OZTA 4HYYA 2HRBA 5DASA 3SS7X 2JF0A 2QRHA 3SKYA 1ULHA 4MR9B 1M83A 2O7VA 3HXKA 3H8SA 3DMGA 3L3FX 2QRMA 3KB1A 1TMKA 1LZLA 2ZWVA 4GP7A 5GM1A 3H2KA 5D7BA 2NTNA 3TJZA 3X0DA 3E9RA 4Q3OA 2X5KO 3MMNA 2NSHA 3T5MA 3TI0A 1VKJA 1SZCA 4OI4A 3VUEA 5LQJA 2MJLA 5KCZA 1XSPA 2R00A 2Q2QA 1QG4A 2HNBA 3LV8A 1XA4A 3D1LA 3HKEB 4G1BA 4B3JA 4DDHA 4LOJA 2KVCA 3ENKA 2IBTA 1EDOA 2C77A 5KNBH 3NX4A 4D8XA 2OD9A 3SICE 4RPJA 4ZMSA 4W5RA 4RSRA 1GZ6A 1J0BA 1L3CA 4LXHA 1RYMA 3TR5A 4KOAA 1QHXA 5JRDS 4S1OA 2I6UA 3KIPA 1XDSA 1XTRA 3CC8A 4XLLA 5IW8A 5TQ2B 5DNCA 1LV5A 4G09A 3KJZA 4Q7JB 4LMBA 3I2YX 4E5NA 2PUHA 4BP8A 2OT3B 3QKIA 1Z83A 3A26A 4LAFA 3RJ9A 3W5BA 3IMFA 2O2EA 4JC8A 5D3MA 4PR3A 1RG6A 5ILGA 4ZYUA 5K8UA 1ATIA 3DPSA 1ENZA 1VA4A 4IIJA 4RQ5A 1UBNA 4N0DA 4PJ0U 3LC0A 2EGUA 1ZH8A 3IPLA 1SCIA 2JA2A 3QVOA 2C4MA 4HDNA 5CA1F 1SXJE 4DOCA 2F8KA 4E94A 3GZFA 2JCYA 5BOMA 3EFOA 5B55A 4DB4A 1KAOA 3FSJX 3V8EA 4E51A 1VSTA 4UAVA 1T5BA 1VOTA 1W6UA 4DQXA 3H05A 4EAAA 4OFWA 2J3DA 4L0QA 4PFSA 3MR6A 1KJ9A 1TZMA 1ZDMA 1Y3IA 4LSWA 1R9NA 5JVDA 4RSMA 1PSZA 4B81A 2RGNA 4J1TC 4ZD6A 4INPA 1ETHA 2TMYA 3MWYW 4LZGA 4OQFA 4I2NA 4BDTA 1XKXA 5FPYA 2HRQA 2JH8A 2REOA 3OCYA 4N4AA 1GEGA 3NOOA 5EMLA 3GRKA 4RK0A 4ZXPA 4AXBA 1GIAA 1IOLA 3ORFA 5E2IA 2YWFA 3PW4A 2IS4A 1Y7PA 3KR0A 2JK0A 1JI0A 4H3SA 2XZTA 1WXQA 3HWX1 3UJ9A 1Z2NX 4A5OA 4D81A 4LK3A 2Q0QA 4UTNA 1X1TA 1X7WB 2OEPA 2RG1A 1N78A 3I8OA 2P78A 2ZTDA 4YK7A 4K86A 4A91A 1V41E 4ND8B 3B9BA 4MA5A 2WOOA 3B9QA 4X1YA 5KMGB 4Z3OA 1Z47A 1G7TA 3H3XA 3RS0A 3T3MB 3T3IA 3U7GA 2AKEA 3HCOA 2VNHA 2C7BA 3TAUA 4HN4B 3EVNA 1FYXA 2J5RA 2Q9BA 3WLMA 1XPUA 3PL1A 1M2FA 3ZTYA 1UJCA 3AH8A 2A94A 4B3IA 2MSDB 1NXPA 1MQ9A 3N1UA 2FF7A 3PFCA 3TW8B 1R3UA 1U9ZA 4C2TA 1G9SA 4ZFNA 3L4BA 1GAWA 4O5EA 1OC4A 4EYEA 1HORA 1EFRA 3E2PA 2JLCA 4FUQA 1WZEA 4U7DA 3F0TA 5DTEA 1H0SA 2Q45A 2RHCA 1WQ4A 3NFRA 3V8MA 2QTGA 2QJWA 3GAMA 1ZQYA 1A7AA 2ZI6A 4LZZA 4BMZA 9ICRA 2GZRA 4BLVA 2GUGA 1FOEB 3W4JA 3RH5A 4EJ2A 3ZTTA 1TO1E 1WOMA 2C7RA 1MHPA 1D7AA 1CB7A 1PWZA 4O1IA 5GVRA 1KQNA 3WNVA 3ZTWA 5B58C 2ILVA 2OLKA 1OFIA 4RTMA 1DIRA 1SK8A 1OAAA 2PUJA 4Z3DA 3TG2A 3MHTA 2R8EA 2C8LA 1T7PA 3K4QA 3ND8A 3MTDA 1L5VA 3SOZA 2J6HA 3AUTA 2VDUE 3K32A 4RLQA 5JFOA 3IRVA 4UUMA 5EWFA 3OLXA 1I5RA 1DRJA 2BR3A 2K87A 2R85A 1YB1A 4E5MA 1ZGJA 1ZNQO 2V5UA 2PH5A 1XRRA 3AF5A 5DNWA 5FHQA 1MJNA 2R48A 2HQSA 2UZIR 1Z73A 3LECA 1FU8A 4GI5A 4H15A 4L9RA 2ZUCA 4QPNA 3CNOA 3EZXA 4NBRA 1MNQA 2G1JA 4PSKA 4UAYA 2Q2WA 1T43A 1W5EA 1I7QB 2QMOA 2B99A 2SKDA 9ABPA 4NEGA 1UXIA 3MF4A 3BMCB 3LT0A 5CIQA 5AM2A 2BF7A 1CERA 5C37A 1M2KA 1BPBA 1CT9A 3ZOZA 3EXFB 3KKAA 3N8DA 4JITA 5JMTA 1CUKA 1FFHA 3MOSA 1XTZA 1E2QA 1DBIA 3QZUA 3CSDA 2WFLA 4ECSA 1AKTA 2XMGA 4J1QA 3TTVA 4C4YA 1FJGB 3C3PA 1KU0A 4NC9A 1S2GA 2QA5A 2CXUA 3EDYA 5MGBA 2O8DB 1RJDA 2I54A 1K4MA 1E1MA 4BNDA 2G1PA 4S05A 4R8UA 5J2BA 3E5HA 3NDIA 4R1LA 4C0LA 1E2MA 1EHCA 1AKNA 4ZJUA 3NPMA 3U0VA 5BMVA 3GMIA 4BMSA 1RZVA 3AZOA 3CE6A 3EASA 1JKFA 4R01A 3QXGA 4NOKA 4P4PA 4WZAA 5F5NA 2XNDD 3WHKA 3IEIA 3BIJA 1X86B 4KBYA 3AP3A 3T5GA 3UHJA 1G59A 4BJ6A 3QKUA 5DHUA 5BVGA 1HQCA 4LUCA 5FI3A 3MJVA 5EWMB 4PHFA 3A6FA 3MJSA 2FN8A 4Q3EA 4G8CA 3N0VA 4KXNA 5KSPA 3ORRA 5IJZA 4B4OA 5B1EA 5AW6A 4FO6A 1RQGA 4LPSA 4QOFA 3QVWA 5JXGA 2WDZA 3FOWA 5ED0A 5JFTA 5JPCA 1DJMA 2WDPA 4DA7A 1G8KA 1M5RA 3FRJA 3MAAC 5FT9A 2ZAMA 1J21A 4WN9B 4YRCA 4ODIA 3RV4A 5CFPA 5K3OA 4I55B 2IY7A 4Z7OB 1WSBA 4KTVE 2JC3A 2W8BB 4TV8B 4LDJA 4G9BA 4EX6A 1JDBC 3TDNA 2VQFB 4BVGA 4OJYA 3P9SA 5CT4A 4AG3A 1U2TA 4LN1A 2HMXA 1KDPA 1XJ5A 4IGAA 1CUAA 2CMFA 3IS3A 5AMXA 1B14A 1NLFA 1GAXA 1QV9A 4BXOB 4DEZA 2YHSA 3ADCA 2Z6QA 3B6ZA 1M2NA 3RVJA 2FAXA 2VPQA 3MJCA 3NZEA 4JX8A 2G0NA 2ZJ2A 3EIUA 5E4JA 4EMBA 1E1NA 2I4RA 5EHNA 3BT7A 2MINA 4URFA 3NT2A 2OV6A 2WWRA 4LSZA 3WYAA 1Z7WA 2C9MA 4ZU1X 3TZ6A 1F6DA 4JBHA 4U6NA 3TOXA 3BZWA 2WVJA 4IG4A 5ESXA 1RYZA 1YE5A 4YJDA 3P9ZA 2A9PA 2WAQF 1XK7A 1DXQA 2RBKA 1VP3A 1BO6A 4OHPA 1JEDA 5AKKA 1Q77A 1SK9A 3ZQUA 5AK4A 5KFUA 5IP5A 5KB3A 4IEIA 1KR2A 4XARA 3WB9A 3PSTA 4DBLC 3NASA 3HYLA 4O25A 4C80A 1FS6A 5A7FA 1AM4D 4M1WA 2XUAA 1FQKA 5EGNA 3MFHA 1EVQA 5ILQA 3TI9A 4CKWB 5JC1A 2E7ZA 3RHZA 1J97A 1U1IA 3E3AA 3ETGA 2AHRA 4IGFA 1IY0A 4UU1A 4BZXA 2CT8A 4YRNA 1ADBA 4WUTA 2OFPA 3ZWCA 4JMUA 2XUIA 3I72A 4X61A 1PDVA 3IAUA 4OOEA 1E79A 3QBJA 4FEYA 4KXMA 3U2QA 1E59A 5HUQA 1ZIOA 2H1IA 4MRRA 5C5CA 1I1NA 3R8XA 4DLTA 2XB9A 2GJKA 2GS9A 1Q1NA 2WYIA 4CCWA 4EUHA 1M6EX 3A36A 3FB4A 3GW8A 3F2DA 4L9SA 2FPKA 3JWEA 5DQGA 4G07A 1QIMA 2GCIA 4PGFA 2BZSA 4AAYA 1MC5A 1U5AA 4DG5A 4GT1A 3FF1A 5AXDA 1SGGA 1AA6A 3UPTA 1PV1A 2V97A 1M8KA 3HJBA 2NNWB 2ZTEA 1SKSA 3INGA 3VC8A 4KNVA 4FQ5A 3I52A 1E69A 3EFBA 4JYBA 4PR0A 4RTLA 2KE7A 1XF1A 2X76A 4D25A 3BGIA 1FVFA 3AU2A 4LZDA 1MVLA 3WLSA 3ICWA 4DLPA 1VKNA 3KCQA 3AMVA 3SFVA 3PSFA 1PGQA 5ECGC 3Q8QB 4B9SA 4O5KA 3DYVA 4L6AA 3A0UA 1EUCA 1QG2A 2F64A 2WWWA 2XA9A 1OKKD 5AW9A 3T9BA 1D2CA 5E6SB 3UCXA 2JG3A 5K8IA 4UUBA 4YP7A 3FUCA 2PA0A 2W7OA 1D0SA 4HQLA 4O4IB 1GSOA 2FEKA 3CF4A 3RU7A 1EWQA 2C7PA 3DD5A 5LA6A 4F12A 5CB1A 5IN4A 1V25A 2R97A 1J0XO 2WHPB 2Q7OE 1I2DA 4EI7A 1LPSA 4YP6A 2C97A 2JZOA 3A9VA 2OYRA 4J9NA 3NG1A 4N9WA 4UB2A 2CNWA 4R8KA 1IAQA 3OPYA 4MDYA 5LOVF 3EGEA 3B6JA 4ZAZA 2DM6A 3HGMA 1E1CB 5K09A 2ET6A 1PHPA 1UKEA 1JJBA 1LPAB 1ONNA 4H6PA 4HL6A 2OKGA 2WJHA 2WWGA 4RDHA 3ZBQA 4D6YA 5KQGA 3UV7A 3M6LA 1NW7A 2IEIA 2OZLB 2PT5A 3ZE0B 2HNAA 4PG6A 3OLYA 2ETXA 5A5EA 4O2AF 2PIAA 2J07A 5F5XA 3Q3VA 4RIGA 3KYIB 1L7VC 4HNGA 4IXMA 3U31A 3OX2A 5EKSA 5GV8A 2H1HA 4FOOA 1N5LA 3TXAA 1YMVA 2P66A 1W2GA 5C7LO 4JVOA 1EEXB 1DMSA 2M6RA 1QHGA 4Y6SA 5BR1A 1KEEB 4YO7A 4CQNA 3UBMA 1IM8A 3ESYA 2VTEA 3W8DA 1ZGBA 4AZWA 4EJFA 3C1ZA 5K0TA 3GLHB 4TZ0A 1X7ZA 5U9CA 2C7OA 2QL6A 2EQBA 2FZWA 2W6IA 4QA9A 3RQIA 4I99A 1KKMA 3HEAA 4EB6A 2VOEA 4MV9A 4QELA 4EYHB 1G8GA 2FFRA 4W1PA 2CJWB 3KUUA 4ECAA 3GGCA 3AFIA 1AUXA 2G70A 3VRHA 1XRQA 1Q1EA 1H4TA 4D43A 2Z56A 1RPNA 1JEEA 4HYQA 2BFPA 5FFNA 4BQPA 3R7SA 1GTSA 1NW8A 1SBHA 2ZIXB 4W9NC 3KUKA 1NLMA 3OIUA 3LP6A 3O5AA 5EJ9A 7ICQA 1A8SA 3OVMA 3VU9B 4W8OA 4YJHA 1JKIA 3RSOA 4GR5A 3UAYA 4V0KA 4BN5A 1U63A 2Y3IA 5CPBA 1IUKA 2HBJA 2XYVA 2OCEA 4EHJA 1RXIA 3R7WA 4JXZA 1EK2A 1GGEA 2CUZA 1VYUA 3B20A 3G9UA 5T8KC 3HG7A 1IUNA 3I01A 2OP1A 4QTZA 2O2JA 3MR3A 4M87A 1HTWA 1XD2A 2WTNA 4J8PA 4UNIA 2YOGA 4WK6A 3STUA 3VR4H 4DC1A 2XIJA 3H7AA 2AFVA 2CKMA 3E9MA 2E21A 3KTFA 4UVGA 3ZJTA 2ODGA 3L0DA 1T24A 4I5GA 3LW8A 4GMXA 4S1VA 4AJIA 3OMWA 5FEUA 4JI8B 2DBZA 5SZHB 3WFIA 4MWGA 1Q7EA 5DDYA 2RH4A 3GV0A 4IJVA 2LBPA 3LPLA 4TQAA 3A2KA 1XDUA 1R0ZA 2AS0A 1MQ8B 2ZVPX 1UJ2A 4OAOA 1SY7A 2FSHA 2PA3A 4LBYA 3V1KA 2YR0A 4AKEA 2VI5A 2OQRA 5AKXA 2PZMA 2WLSA 3RUHA 1ZN8A 4LZWA 4H1HA 3F7TA 2WICA 1ADGA 3CNHA 4IJKA 2IUEA 1WR8A 1XBTA 2N75A 2XECA 3FZYA 3IAS6 1BG6A 4DCSA 4MW2A 1F0MA 4I2CA 4NE7A 3U7IA 3RFFA 2BPOA 1MAAA 2W6JD 1LBTA 1AURA 2ID9A 2ONZA 3LPMA 3D5EA 3QNUA 2Y8EA 4HRVA 4BE4A 1RJWA 5BSRA 2VJPA 1NUHA 1WTAA 2PMCA 4ZT5A 3VZBA 3MAGA 1FSSA 3AI1A 1KQGA 2VYVA 2MDTA 1C7QA 3EXEB 1IXZA 1KVSA 1P7PA 2J45A 2F9MA 4FNMA 3PGXA 4H7PA 4LRWA 4EPVA 1HTTA 1L7XA 3SE7A 1H8ED 2OBXA 2F1KA 5KNBD 3UW3A 2Z3WA 5HVNA 2XB4A 3N2KA 4KZKA 4YMIA 3W7BA 4KHPB 3MYRA 4AG6A 2AOTB 1ZH4A 2K4MA 3HDQA 4R54A 4IILA 1HX7A 1DQSA 1XPJA 1ONPA 3WMRA 5C7YA 4B3TB 1K7EB 3WNDA 3JZIA 3SIWA 4YUWA 4ZOQI 4UHEA 4WXMA 3UWSA 3LVVA 1JIVA 1TUGA 2QLFA 4G0MA 4JYCA 3WJ2A 4MS1B 1WD5A 3G9TA 3OQJA 2HJHA 1HZZC 4D4GA 4ECVA 2XXJA 1KO1A 5E9AA 3PE4A 4YR2A 2D54A 2Z5VA 5FH9A 1ZMTA 4K6MA 4DE5A 4FLFA 1LDNA 4QOHA 2XCSB 1Y7TA 2H5IA 1DVRA 3B5JA 2VNSA 4UHKA 5JQGB 1RE0A 4H0FA 4MI1A 4E5KA 1JWBB 4YUYA 2O7RA 1EI9A 4U2KA 4H7JA 5J5VA 2AEFA 4BBPA 4YDQA 3ANYB 3DZDA 2IP4A 2BL4A 4PBSA 1P2GA 3OKPA 3TI7A 1E8DA 3F6BX 3SEFA 3AF4A 3ZNOA 5CFNA 5F7XA 1CY1A 1B7GO 3W2HA 1H0RA 2EZZA 4RVUA 4H3KB 2ZXIA 1X8JA 2GEKA 3O9VA 3PHIA 3RVKA 1KYIA 2BGIA 5HF5A 3RSGA 4Y67A 3BVPA 3O84A 2GM5A 2G5PA 4DLUA 4WKGA 5DN6A 2M6LA 1YQUA 2IF0A 2X2FA 2ZIVB 5DISB 5JNVA 4E11A 5MHTA 4WOJA 2FWPA 3ZCPA 2AFHE 3AIIA 1GRCA 1TKRA 3DOJA 2D1QA 4GZLA 2RDMA 3I3SR 1UMCA 3N8NA 1FNBA 4AJOA 3AYZB 1DXOA 3U5TA 2BGTA 3NDJA 2JLYA 2OECA 4W5JA 3JPYA 1EP1B 1NSTA 4BJ1A 2EJWA 2PR2A 2PRZA 3BF8A 4MROA 2IY9A 1RPTA 3E23A 4B3BA 4PBTA 1TJYA 2F8SA 4MQ6A 1EQAA 4JUBA 4M1SA 1T9KA 3MAJA 1YAHA 1GPYA 1OILA 4IWNA 1JDJA 2OCIA 3BJZA 1T3NA 1AZLA 1Z2EA 3CZRA 3N86A 2DWUA 4GI7A 3KZIU 1LNQA 1YDFA 4YMVA 2ATXA 2G80A 1IDN1 3Q7PA 3A9RA 1MJHA 4AF8A 5NULA 2ZYAA 5DB7A 3F6EX 1MO4A 3O1IC 4KODA 3ADKA 4MMZB 4PSDA 2XXAA 4F4IA 1OZGA 1LLDA 4CKZA 3D8TA 1HE8B 3BBPA 3L8CA 4RVGA 5JAUA 1CYEA 4YI3A 2HPZA 5LU8A 2LYAA 4ZHQB 1C4KA 5EYPA 2ZTVA 2JAQA 4KMOA 3FDJA 3SXUB 4LRTB 2GCNA 2FE4A 4B3FX 1HNZB 2P9CA 3O8LA 3ZG6A 1ZGHA 1MZVA 2B20A 2ZWIA 1PSDA 3E0FA 3H0RB 1GU7A 2OILA 3P52A 3BE4A 5CK5A 1OLUB 2OWOA 3OEEA 1Q57A 4LMAA 4YC7A 3LJKA 3IURA 1S97A 4IICA 3EK2A 4ND6A 1KE1A 4BTEA 1USUA 5KU1A 3AUFA 2ID4A 3O7WA 4QRIA 4ZOBA 3WDMA 5E3HA 5BOVA 2JI6A 4QLAA 3L0PA 1C9YA 9ICCA 1L1FA 3J81A 1A9QA 2TECE 5EAIA 2K7FA 3OEYA 3G6VA 1QR6A 2ATIA 3FHLA 1BCSB 3JSAA 4P82A 1W35A 3Q7QA 3L9WA 4TV9B 2DKFA 3IGFA 1N63A 3IBSA 2IGTA 1A2QA 3KQKA 3M9NB 3D3JA 3HHEA 2EX1A 3M5CA 3WWCA 2WIFA 4HR7A 3I4CA 1YZ3A 4PZNA 2PTHA 4KVGA 4ZOLF 3GT4A 4F3RA 2Q8QA 1CZKA 3BE5A 2IEZA 2XNSA 1SHLA 1USIA 2FUNB 1VIVA 4GYWA 1YDGA 2EATA 4XJXA 4E32A 5HILA 5H7XA 4MUGA 3IBYA 4XYEA 4QBIA 1G6KA 4LC1A 3WLJA 3V4LA 1JSLA 4KJZA 2VJYA 1I01A 1VE1A 4EX7A 4DCOA 1CRWG 1F2TB 1UDRA 4HGYA 3GRPA 3LL4A 4RMGA 5LN1A 2OBLA 1U6KA 2OD2A 3LDAA 2QD1A 3Q9NA 4ZHSA 5AUPB 3JZFA 2X9QA 3Q5EA 1DC8A 3CRXA 1CR0A 4ZOAA 3PHGA 5JWHA 3BIOA 2F48A 3LGAA 2BJHA 1EA5A 1UOOA 1HYEA 5TT0A 4L15A 5FL3A 2YVQA 3T35A 3LP8A 5HGJA 2HJSA 5ALSA 1GN8A 4MVWA 5KTTA 1H4SA 2HKIA 1ICIA 3HUUA 4D98A 3WLKX 4ZKDA 4J6EA 4JP1A 4R1MA 2VSYA 2FXIA 1DSSG 3E9EA 3L6UA 3NTXA 5FO1A 1IUOA 4PAMA 5IZ4A 4MDHA 3MC1A 5AM4A 1NR7A 4BBAA 2X8AA 1ZICA 5JUMA 5DB8A 1NKVA 4ZT7A 1NF3A 1HG1A 1Q92A 1MVOA 2D5BA 2KI5A 3V1UA 4C08A 2B0CA 2OXIA 1ZW6A 1AQ6A 1PV2A 2E1PA 4MR7A 5F77A 2CHUA 2XTAA 2ZUSA 3CUUA 3UJPA 1T8YA 4BLUA 3PC4A 4IRDA 4EKEA 1TUBB 1ZCAA 4PBRA 5IIMA 1DUVG 2Z3ZA 3RLIA 3TAPA 3HSSA 4LGMA 1EJ0A 3B8HA 3BCRA 3L7MA 2NU8B 1QH9A 4Z4EA 3PB3A 2R5WA 3F3SA 3TQHA 4L3VA 3HK2A 3VMMA 5BVHA 1YAJA 1E20A 2A0XA 3D3NA 3GLFB 2HJWA 4QWEA 1SC9A 1EE1A 2GD0A 1I4TD 3OUZA 3NETA 5KDDA 4QZHA 2F67A 5DDIP 6REQA 5J2HA 1VE7A 2DL0A 3FSRA 1YE3A 3NT4A 3PO5A 2H1WA 4RNCA 2I80A 3RVBA 1AZWA 2BN4A 1EQUA 2L42A 3AEKA 4NONA 1D8AA 2BJVA 1KBZA 2HHCA 4RXMA 4F85A 1XTVA 3BB3A 4PHCA 1XQWA 4JSRA 4PLFA 5T5QA 2ZZKA 4EG3A 4DR6B 4E5UA 4FYVA 4HFRA 5TC4A 1OLSA 3PX7A 1V5GA 2FWIA 4AYBC 3ZE1B 3HR7A 4J0HA 4QZVA 8ABPA 3MUOA 4GLBA 2WSYB 3QNMA 2FEWB 2QPLA 4R1SA 2EH9A 3LT5A 5KL1B 1VLLA 5COAA 4XWKA 1ZHHA 3RU2A 4YRKA 3MCVA 4B0PA 1V9LA 1X92A 4K6KA 3DZFA 1AQYA 3C5EA 4Q7KA 3RRYA 4E1AA 4DR7B 1SUBA 2ATEA 3FPJA 3GDOA 4IW3B 4F38A 3JQPA 1WHSA 3N2LA 3DE1X 3NOQA 4JOQA 1P1CA 4QIWC 1NK6A 1AS2A 2HC9A 3ZLTA 4K4HA 5HW0A 4UD6A 1NBME 4EA6A 1Q12A 4LDPA 3R3XA 4NG4A 3MWDB 3IUBA 4FUTA 1UBEA 3T52A 5JZSA 3U19A 3EGXB 1JRPA 2CUTA 1JROA 5KFLA 3IVRA 3MJRA 2C5BA 3O4IA 2EQYA 1PJ8A 1Y6RA 4KPYA 3QEBZ 1Y5RA 1P62B 1E5LA 2C5HA 3CX4A 4U7FA 5E4TA 4RACA 3RYFA 2XEXA 2VDRB 5TEVA 5ICCA 2L69A 3OFNA 5LMCA 1AJEA 3VC1A 1ZH6A 5DSZA 2PT6A 2NXEA 4DUGA 5JO0A 4OA8A 5D87A 2X2EA 1TTQB 3WRXC 4FOPA 4X95A 2O52A 4OYYA 4C14A 4N48A 3K9BA 2PH3A 1EGHA 5BN5B 2B6HA 3X1DA 1G19A 1B76A 3D4OA 4R1NA 3RB6A 4QLBA 2BDTA 2NZ8A 4YASA 3R8CA 3W8RA 1JEQA 2G9VA 3R74A 1DGQA 1KXJA 4FYHA 4PZAA 3GRVA 3JASA 3ZI7A 2JA1A 1Z63A 2FMHA 5ALVA 4XB6B 1YULA 1BJKA 2YJ6A 3GI1A 3KKEA 4MCAA 3V55A 1S5PA 2GCOA 1SKUA 3ZDCA 3ZK8A 3JW8A 1KQPA 3JARA 3BMXA 4BNUA 3FAKA 5J2GA 3HFGA 4I2JA 1KA9H 1O89A 4IEEA 1X42A 1DHTA 1GR0A 4A0FA 3NM5A 2BEUB 2H5JA 1EZ4A 1CQJB 2DYKA 3FDXA 5IT0A 4I55F 5JYDA 5KTKA 2VBCA 3CCBA 7ICSA 3I4FA 4DO9A 1DJPA 1E9VA 1P8JA 3UYKA 1UBMS 5ARCA 1DRVA 4IQGA 2ECKA 2BJWA 3OG9A 4KMMA 4WOBA 3MSXA 4E4TA 1IHDA 4KKXB 1RP1A 4OHOA 2HWWA 2GI4A 1OXTA 3R77A 1PD0A 3T06B 4W5NA 1RRPA 2HGSA 1P19A 3FA2A 1WS6A 1Z39A 4BN0A 5TX7A 2YFKA 3O8DA 2Q5IA 2ZYHA 5LZ8A 1R3DA 3VO8A 3IQXA 3U4MA 5E2AA 3KQQA 5K8LA 1L1EA 3RC3A 3QX7A 3L7IA 4Y6RA 2ZI7A 5JC8A 1M0EA 4UAJA 3LMKA 2ZXFA 4CUZA 3KLNA 2P11A 5FKJA 3W3ZB 1YNSA 2I3BA 4OHXA 3ZVMA 3AHCA 4LJ9A 5KYYA 4JV2A 2VSOA 3GRRA 1CS0A 3K73O 3JWJA 1ZG3A 4O4JB 5E0KB 2D8MA 5TJ9A 4BPRA 4ZI7B 4JLDA 3VNQA 4DKXA 3IB6A 2I9PA 2L2QA 1S7CA 3I9V1 1E18A 4OUKX 3ZIUA 5IHPA 1U0JA 3DLTA 4HNAB 2NO6A 4TXMA 2ZRCA 5FAXA 5FQNA 2RIRA 1D8YA 5T8KA 1LWNA 4NMMA 2O23A 4BFSA 4CMHA 5CFZA 3ZDYB 5KWEA 3TLEA 2IGBA 4A16A 5CG2A 3ADDA 5DZSA 4ECZA 4D5EA 3KZNA 2ZQ5A 1M1YB 1AKRA 3ISDA 1ZJ5A 1DC5A 5C81A 1X3LA 2IMWP 2QUAA 4RGBA 9ICSA 3P9IA 4KNYA 4HYKA 2Y71A 2QB1A 4LV8B 1LBEA 3I28A 5HKOA 1HEUA 1PGJA 5HR7A 2WF9A 1N2SA 3H87A 4TKZA 4YFYA 1P61B 2VT2A 2XGGA 4X94A 2WIDA 2IZOA 3T3EA 3TF5A 1IY2A 1B0PA 2HLPA 3L9XA 4FBLA 2H1OA 4J0JA 3ZH9B 2LTAA 4L16A 4ZZ3A 2X2OA 3F2VA 4Y6GB 3PFKA 4RIHA 1OXXK 3A28A 3QOWA 4WXHA 2NXCA 5CIWA 5DIZA 1SUCA 1ZHOA 4L74A 5DYNA 5AM1A 3ODGA 1JRLA 3EF3A 2P40A 3ICOA 3WAJA 1BKDR 4PZ9A 4XXHA 5JWOA 1QF9A 3DNMA 4NE2A 4N76A 2ECFA 2VXYA 3HXQA 1UXOA 1O03A 2DHEA 4F4YA 4B7UA 5K20A 2UVPA 4RPXA 5AO9A 4XFKA 3O7MA 5CEFA 1X70A 2CRXA 1WL8A 4M0UA 1OJLA 4QYXA 4RF4A 3AVTA 2ODTX 3WI7A 3QE9Y 1LDBA 3EXIB 2ZBGA 1OGYA 1IK4A 3SX2A 4OMCA 1SKYB 1CUFA 2FUEA 2IEDA 4QPCA 1CNMA 1H1DA 1X0XA 4M36A 3O21A 2C96A 2BGGA 4MJ3A 1NONA 2AOUB 3AR8A 3R3HA 4FK8A 2DHRA 4QIHA 5E2BA 1FW6A 1EIWA 4O4IF 4PSUA 3U16A 4BO7A 4TKUB 5KVSA 2NIPA 1ZIYA 2XGPA 3ROKA 3RVQA 4D3DA 5JE8A 4YV2A 2C2ZA 3AIMA 4A8TA 1C5KA 1X8LA 4KI0A 3IIEA 4OCZA 1Z4OA 2ZJ8A 2X8JA 1POWA 1K6EA 1UIMA 1TKBA 1N2CA 2HF8A 5DX1A 1QHHB 1TPYA 1ZCBA 1HEKA 3RF9A 3BXEA 5DWVA 1II8B 1NQXA 2G9UA 2VRWA 4M7RA 1HXHA 2VP9A 1IBMB 1L8AA 5LYYA 1OPXA 1T2CA 1LW6E 4Q3AA 5EXPA 4BX2A 5FBVB 2QUBA 3G88A 1VSBA 4ZVKA 5LP1A 5I7WA 1JG3A 3U4QA 5FNVB 2J3LA 1E9AA 2C1XA 4JH0A 3S2FA 1Z82A 4FE4A 4YROA 2NTJA 2Q3LA 4QJIA 3RS9A 2Z2IA 1S2DA 4BQQA 1H2BA 1VI6A 3CUVA 3F3KA 4OEHA 2RHMA 1U8EA 3CVYA 4B31A 3WL7A 4ZQBA 4WJLA 2J9ZB 1ISHA 1LJUA 3DPUA 3KSDO 2EDCA 3FCCA 3TBFA 4CTKA 4DBZA 1XEFA 3LQQA 2XI9A 4TMYA 4KLOA 2V9PA 3G0CA 2ZIAA 2YXPX 3ET5A 3ONEA 1XRLA 3OU6A 4TMFA 1YS2X 4NX2A 4ZQHA 1IN1A 4HAXA 3QEMB 3FYTA 1Z2CA 4RIIA 1F3LA 2JBAA 4QATA 5IMSA 4HDOB 1MRSA 4JUZA 1KQOA 4HWOA 2VXBA 2BTQA 5DCYA 2OCPA 1B15A 4NY8A 1QM5A 3DB2A 4TTPA 3OX4A 1F12A 2YTZA 5KC9A 2VCYA 3BL8A 1C7ZA 5DEOA 4FOLA 2IU4A 4L5YA 3G6KA 4DR5B 4Q18A 1DX4A 4LJKA 4WI1A 5AOVA 3T94A 4WBNB 1ZZEA 4B4WA 3LVWA 1ORVA 2Z6VA 1A97A 1T9GS 1CC1S 3KG2A 4C78A 4KQ2A 4IMIB 5BUZA 3HILA 2RK3A 3FROA 3FYUA 4D56A 3HKBA 1AV6A 1BSVA 3SC3A 1EVIA 1VZ2A 3BJRA 4OXYA 1SXJA 3UJHA 2JFQA 5LP6C 4A8PA 2NQ8A 3EGDB 4ZOHC 1UODA 3AG6A 3LCJA 3SLKA 1GQFA 1KO4A 2PVPA 1WCV1 3TNJA 3EZYA 4PN7A 1Z4NA 5H9WA 3LXXA 5A9TA 1CS4C 4PYJA 1CR1A 2XUZA 2REQA 5KVQA 3GGDA 3WS7A 3QZ8A 3NYWA 1TEHA 3GFKB 1FRQA 4QARA 5C9ZA 1RVV1 5BSUA 1RAEA 5BWLA 1E1QA 3JAKA 2EQAA 3UAGA 3OAAD 5A6VA 4CCAA 3S29A 2W6ID 3ZHOA 4G5QA 3MFYA 4FCWA 1QV6A 4P80A 4OAQA 4YBRA 1CHNA 1XZNA 2LIVA 5KFDA 3DAOA 3KDAA 3NIFB 1XTBA 4FWBA 4HOYA 4ER0A 4J03A 1LI5A 1E7MA 5KQMA 3WGGA 2B6GA 1T1RA 4BUJA 5AESA 1P7VA 4J0KA 1HWYA 3GG2A 1CEEA 1J5PA 2W22A 2XBUA 4LI3X 4BMPB 4RABA 3ROPA 5JAZA 1KJ8A 1KRPA 5G41A 1RZ3A 2B83A 1FYWA 2AB0A 8ICAA 2IDZA 3H6GA 4FINA 3OQNA 3ZUGA 2QJRA 3Q12A 2VTBB 2WJGA 1F8YA 1XSNA 2ZIUB 2BELA 3CU5A 3URKA 5B1YA 1NVXQ 4KDFA 4DQKA 3BTUA 1XSEA 2G8NA 2HA0A 5DO9A 3RT9A 4Z9YA 5EXDA 1NG9A 2BMJA 3RFAA 3F71A 2QG9A 1PNOA 1G8SA 5DGAA 2O3TA 4U63A 1UK7A 1C9MA 8ICMA 1XZAA 2FR1A 4M9NA 3BMQB 2QX9A 3IE0A 1NRIA 3WB1A 4L22A 3MGAA 3B1JA 4M7PA 2HSZA 4OJPA 1PYOA 4YRZA 4L7VA 2YWCA 4NJOA 2OPBA 1AMOA 4EVSA 4MP6A 1W5AA 1Y80A 2POCA 2WWXA 4I5DA 3IFSA 1BQ3A 2H1FA 1WMEA 2HBLA 5BQ3A 2VATA