3CNQS

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
CVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3cnqS00
1C9MA 3HJRA 3PRKE 1Y34E 1CSEE 1IAVA 1SUBA 1Y9ZA 1CNMA 2IY9A 3I37X 1KE2A 2PRKA 3LXUX 1AVTA 3DE5X 1WMFA 3DE4X 3QMPA 5CW1A 2X8JA 3WIUA 3A3OA 1GA4A 1ZVKA 1TM4E 1GA1A 1GTG1 4H6XA 1SUEA 4CFYA 1GA6A 2X8JB 1OYVA 2E1PA 3I34X 3D9QX 5FBZA 1SIOA 2Z57A 2PWAA 3AJ8A 1SUCA 1SN7A 4AKTA 1PEKE 2SNIE 1TK2A 4ZARA 4LVNA 1P7VA 4LVOA 3DDZX 1Y1KE 1P8JA 1BFKA 3BPSA 4RYDA 2W2PA 1TO1E 1GNVA 3DE6X 3DE1X 1V5IA 2W2OA 4YN3A 2PMWB 1BJRE 1Q5PA 2GKOA 3EDYA 4H6WA 3T41A 1R64A 1KDVA 5FAXA 2HPZA 1SCJA 1Y3FE 1GNSA 4OV6B 2Z2ZA 2QTWB 1SCDA 1SPBS 1KDYA 2B6NA 5B1DA 3ZXYA 3GT4A 1V6CA 5AVJA 3DWEX 3DYBA 2DP4E 5FFNA 3SICE 1Y4DE 1C9JA 1C9NA 1SUDA 4WOCA 3F49S 1R0RE 1Y4AE 3AJ9A 1WMDA 4CG0A 5I9SA 4C3UA 1Y33E 3I30X 1OT5A 1NDUA 2Z2YA 2PWBA 3H42B 3VSBA 4OMDA 3SQOA 3VV3A 1GCIA 3UNXA 1THMA 1AF4A 1ST3A 3EE6A 1Y48E 3F7OA 2W2NA 4K8RB 3WQBA 2V8BA 1IC6A 4DJ5X 5AQEA 3VV2A 1S01A 2DQKA 1ZVJA 4NE9A 2WV7A 5JXGA 1PFGA 3QTLA 1SUAA 1SVNA 1SBHA 5JMOA 1BH6A 3VYVA 1DUIA 4M1ZA 2DUJA 5JXJA 1YJBA 1C3LA 1T1GA 5AMXA 3DW3X 1SBNE 3L1KA 1MPTA 5JXHA 2ZRQA 3A3PA 5ARDA 3VHQA 1SH7A 3PTLA 4DWWA 1PJ8A 1SCBA 4JP8A 4C3VA 1OYOA 4J94A 2XRMA 3GT3A 1MEEA 2ID4A 3CO0S 4Z2AA 1Y3CE 3F7MA 5B1EA 1DBIA 1SBCA 1SBTA 2PYZA 4HX2A 2PKCA 3GCWA 4CFZA 1SIUA 1TMGE 1TM1E 2ZWPA 5JXIA 1NDQA 1XF1A 2TECE 2G4VA 3DE7X 1WSDA 1GTJ1 1TO2E 3Q5GA 1VSBA 1T1EA 2SICE 3LPCA 5K7SA 3DVRX 2SECE 2ID8A 2XTJA 1SBIA 1AQNA 3BX1A 3DVQX 1EA7A 1GTL1 3DW1X 1R6VA 1AV7A 1TM7E 2W2MA 4KB5A 1P7WA 2WWTA 3LPDA 5ARCA 1AH2A 1A2QA 3GCXA 3BGOS 4I0WB 2Z58A 1UBNA 1YJAA 4MZDA 1SCAA 4HVLA 1TM3E 1EGQA 1ST2A 2Z56A 4WOBA 2PQ2A 3D43A 1TM5E 1LW6E 2ZWOA 4ZOQI 1BE6A 4FONA 1BFUA 3DE2X 3WHIA 3TI7A 4DZTA 1WMEA 1Y3BE 3CNQS 3ZXXA 3WIVA 1S02A 3TI9A 1YJCA 4OMCA 1GT91 1S2NA 1KDZA 5AVKA 1T1IA 2SBTA 2Z30A 3DE3X 1AU9A 5SICE 1SCNE 2WUWE 1SIBE 3OSZA 4B5LA 1WVMA 2Z2XA 1PTKA 4BWGA 2P4EA 1KE1A 1NLUA 4KPGA 1SUPA 2IXTA 4H6VA 1YU6A 2W2QA 3AFGA 2ST1A 3DE0X 4GI3A 3I2YX 4KG7A 3DVSX 3A3NA 3Q40A 4NE7A 4AKSA 2HD4A 2WUVA 3EIFA 5ARBA 1TECE 1HT3A 3QFHA 1AK9A 3VTAA 3LPAA 1Y3DE 3P5BA 4NMXB 1BE8A 1JEAA 3TECE 1SELA
chains in the Genus database with same CATH superfamily
2P3OA 2F1JA 2AOUB 1CQJB 3VPCA 2Y68A 1QIFA 1JSCA 3AR3A 1I1QB 2REXB 5DXFA 3AUYA 4M76B 2J0UB 2YFQA 3I37X 3KEMA 3THXB 3I05A 3FPAA 1JQDA 3GP8A 3D6VA 1MHPA 4DMGA 1TIBA 4IHKA 5JAZA 5K8CA 4U3JA 4I4TB 5ERYA 1E6MA 4BLVA 4JLNA 2JCXA 2OHGA 1ABFA 1LK5A 2OHXA 3R5JA 4GPTA 3DT6A 3KOYA 4IIBA 4BNLA 4YO8A 3CEPB 3P7MA 3WIUA 1P9LA 1JR2A 1I80A 2CLMB 2O1WA 2B1RA 2XA2A 2ZSBA 3IQWA 3ITKA 3MA0A 3ONDA 5IBQA 1AKVA 3B89A 3WDMA 4MPRA 3ZWBA 4CFSA 1GAJA 4IQGA 4X1KA 3TLZA 2C99A 3G02A 4OB7A 2X9LA 4DZRA 1R9JA 3BTUA 1RS0A 3I1IA 2Z5FA 4KH0A 3DEJA 2ODEA 4N3NA 2FA9A 5JDIA 5LVAA 1O3YA 5C1PA 1EP3B 1XP8A 4XWTA 1OFIA 2VF4X 2G0NA 1KAQA 4CM6A 1BEZA 1V9SA 3B5IA 1LBHA 2XW6A 3C39A 3EW7A 3LQKA 1GA6A 2BI8A 2QUZA 3QLVA 3P2EA 4TXHA 4HN9A 4M9SA 3O7WA 5DLDA 4OLHA 3V4FA 3NDBB 4LZPA 4Y1EA 4CUJA 1E3TA 4HDNB 2UKDA 4YV2A 3D9QX 1TL7C 5IULC 4XLTA 1YAJA 1SIOA 5EJ2A 3ZDYB 3BJEA 3AL2A 1QAMA 4LJ6A 2Q2OA 2EOAA 4NZNA 2F3PA 1M2JA 1JJIA 1JR3D 1XZHA 2CBGA 2X0IA 1YIDA 3G5MA 2HCFA 1T4CA 3IIEA 3VKWA 1NF3A 4G0NA 1TQHA 3MJHA 1VB5A 2X6QA 1P7VA 2Q27A 3K9HA 2GWHA 2IXBA 5FLYA 1P8JA 1Y1LA 1PFKA 1JVSA 2PWZA 2LCQA 5LIPA 4AULA 2HRDA 5DIZA 1NQWA 1PKEA 1XOIA 1VIYA 2W2PA 3JQ9C 2ZRDA 3EZNA 3U3JA 4BMSA 1UAAA 3MCZA 2HF8A 2XGOA 3KFVA 3TE6A 1Q21A 3H8JA 4UNNA 2ZRIA 1UBOS 1U7OA 2FZ5A 1NJGA 3HV0A 1EX9A 4NMHA 1C8BA 1BC5A 3KTAB 1YI8A 3T5BA 3WS7A 1N4DA 1Z6AA 1R0CA 3CG0A 5G1PA 3EGCA 1EQ2A 3SYTA 3RC8A 4JKIA 1J70A 1XXHE 3KT0A 1MH9A 1SQGA 2HFKA 4QTTB 3A11A 2HT1A 1J0EA 1QGUB 2YW9A 1XEAA 3EGWA 1MRSA 1DTEA 4MA4A 4A82A 2BGJA 1U04A 2WIAA 3V4ZA 1PZNA 1KFKB 2HPAA 2C7RA 1ZJJA 3O8DA 1G8GA 2ZUUA 1E1QD 5FAXA 1TADA 3L0BA 1SCJA 3WJ7A 3SU8A 2AJCA 4MJXA 3FSGD 3UKDA 3K0CC 2P5UA 3MZ0A 1B8UA 1NA5A 2CLSA 1VC2A 1BHQ1 3OM9A 5K8LA 3BC1A 3BB1A 3L1IA 5KOHA 4RORA 1T6NA 3NEJA 1C9EA 2V0NA 1TW2A 1XLUA 1IYZA 2IHYA 5B1DA 1EFPA 2DUUA 1L4GA 2I6GA 5KSOA 2HN9A 5EWMB 4HLUA 4M0EA 7ADHA 2O8BA 5JAUA 3A25A 1U1DA 3SR3A 4PQEA 3K53A 1ESEA 1P91A 1PFYA 3JALA 3LYLA 3T4UA 4K2HA 4D8XA 1P44A 3OBBA 4D9MA 2NUAA 1US8B 2X23A 3BS4A 5K0BA 4XWYA 5B7GA 4N0EA 2WZQA 4BVHA 4OHYA 5FFNA 1AOXA 2CN1A 4LOLA 4IDQA 4C20A 2C9ZA 3UMMA 4I3HA 4PIPA 4A0QA 4I9UA 2WLSA 3E18A 5ICMA 3K5PA 3PC4A 3K05A 1ZBQA 1F38A 2CXTA 3ZX4A 1BWSA 1ZUD1 1CF4A 2KI5A 4Z4IA 1U6KA 1XDDA 4K8OA 1W9HA 5KWVA 3MSCA 1JFTA 5KAPA 2NQ2C 3VSEA 2OECA 3ODPA 3NVKI 4V38A 2DC1A 2ZSAA 1P7CA 2O8CA 3A9SA 2P6PA 5J40A 3VXKA 3QU5A 1SBYA 3WL3A 3HVKA 1T4MA 1BXKA 1I7NA 2ZRMA 1MA3A 4JJEA 4KMOA 1WBDA 1QFXA 1YULA 3AV3A 4ZQHA 2PWBA 2CDAA 2NZJA 3VSAA 4BECA 3VSBA 4I1RA 1P5RA 1TGVA 4MKGA 4WZBB 4REOA 1J8MF 1UWKA 5KYTA 3M89A 3NPAA 1O87A 3DMPA 4G0MA 5BQ3A 2R66A 4B4KA 4UU7A 1ELOA 2R6FA 1IONA 3CY6A 4ZAWA 1JB1A 2RH5A 1G7SA 1UC9A 4K87A 4LISA 2PU7A 3VV3A 1UADA 3AQ4A 5LQDA 1LD3A 4B76A 2GKSA 1ZK1A 3NGLA 3FN4A 3ILXA 4NFLA 1KO8A 4CIYA 1MB9A 4ROSA 4PTZA 4YROA 3WB0A 3H1FA 1G4AE 5ESXA 1T1SA 2HB6A 2H54A 4I3FA 3H2JA 4Z9YA 2AT1A 5FBWB 3SLKA 2DWUA 4C4ZA 3FSEA 5A6SA 3AZQA 2ADFA 3CZ5A 1AX9A 2ZSIA 3O73A 4G0ZA 3ROKA 2GDJA 1FYWA 3NG1A 5A5DA 1XZJA 3SJBA 3E7XA 3UWOA 4D3ZA 3W2FA 2NU6A 1FW8A 3BBLA 4KVAA 4UTRA 1O6ZA 4G97A 1YASA 4E2FA 5JPDA 2O3RA 4Y6LA 4DQXA 3CF6R 5EIBC 3BJZA 2XZDA 1K7CA 1HL7A 5AM5A 1I0IA 2H0QA 3U5TA 2EQBA 2IL1A 3H9GA 3LUDA 4F71A 3UANA 1S3FA 3W4KA 3DFIA 2PYDA 3SC2A 4KLNA 2W6ZA 4RH3A 3WGZA 4J8PA 4RE6A 1Z7GA 1ZUIA 2KPOA 3HJAA 1R9GA 3HZRA 3K8ZA 1IVYA 3T5MA 3U4DA 4EJ2A 4EFDA 1PD1A 2PA3A 2OILA 1CZKA 1RYZA 4ZWNA 5HS4A 2JKVA 1LLCA 1JA1A 2W6QA 5ICFA 3WRVA 2RONA 3KE9A 1SVNA 3FETA 5DI3B 1NMXA 2H2GA 2IIVA 3EGIA 5ALGA 2BKVA 5KYGA 2BFEB 2OBNA 3OZTA 1BCSB 4KVFA 4S1TA 1AXGA 4BVAA 2ENUA 3RC2A 1WABA 2UZ0A 2VPQA 3RLIA 1R3UA 1B0AA 1TT5A 3GOQA 1WULS 2Q28A 4Q3AA 2V55B 3VZQA 4MRVA 1YOVB 3STVA 1WL8A 2P65A 4OP3A 1YKGA 3MXOA 4E6PA 4MUHA 2G07A 2BFOA 1OZAA 4PSVA 1PTJA 1XA0A 2H65A 2QORA 4MTCA 4J2TA 1R8YA 3EOAI 1FMCA 4MKIA 4K9PA 1IDN1 1SM4A 3Q7QA 5JQWA 1CUAA 1JVNA 2OCPA 3IUMA 4WESA 5ALKA 1GADO 1QJ4A 2O0MA 2PYIA 3MRXA 5K8IA 1NVDA 4O4JF 4HV4A 5F7XA 4X62B 1E1KA 4EA6A 3FDZB 1MEJA 3G2MA 4ABYA 1UBHS 5JTTA 2YV5A 1WY7A 2PO7A 1MOQA 3DDUA 1OREA 1P62B 2HMWA 1JEJA 3OCUA 2JI9A 3B85A 1TX4B 3O91A 1VA5A 1NI3A 1ZXXA 1A9YA 3WLOA 4LRSB 4IQ8A 2JH9A 3ETGA 1OZFA 4P4NA 3LHDA 1QIKA 3BSSA 3HWWA 2IVFA 3NHFA 2ARKA 3WYFA 5K09A 2CD7A 5KYUA 1TKBA 2FPPA 1F4VA 1K8RA 2OM6A 2PK3A 1IDOA 3OKFA 3MJFA 5AO9A 3CH7A 4M36A 2ZSJA 1ATZA 1KYVA 1NLMA 2EW1A 1XVLA 4RAQA 1JLLB 2C78A 3M1LA 3KUDA 3P2KA 1N5RA 2YZ7A 1KK3A 4MVCA 5CH3A 3HY6A 1JAHA 3OZUA 4H1UA 5U4XA 4EK9A 3T1YB 1SZDA 3CBQA 3EJWA 3NHUA 3NX4A 4FBLA 5FQNA 3VH3A 1DJLA 4FYIA 2PKCA 2CNWA 3QWHA 4RKYA 4MEBA 4BO9A 1DKQA 3SC6A 4BVFA 4DTCA 4TOIA 3SKYA 3VYTB 3KKQA 5AK5A 4MYTA 3OZXA 4AAYA 2PX5A 3HR7A 1Z68A 5EUMA 2VC2B 2RFLA 2BR4A 3O1HB 3AR5A 4DHWA 2ECQA 3IBTA 3IQDB 4OQDA 4E5YA 4EG1A 5K0EA 10MHA 1ZYUA 5K2OA 1G3UA 1R9NA 4ZEOA 2XEXA 1Z4JA 3DL0A 3OCWA 2SICE 3BH0A 4PVCA 2XUFA 1MQAA 3NDPA 1UPXA 2N42A 1Y6ZA 1RKXA 2EERA 4INJA 1SUWA 4P98A 1T9CA 5B7NA 2IEGA 2Q0QA 5EJGA 4GOOD 5T41A 2UZ1B 3MWEB 5K8JB 3CEMA 4RKWA 4WUVA 2PG3A 3TJRA 4DMKA 4HQNA 3GLGB 2LPMA 4O25A 4HH3C 5FNVA 1TPYA 3TF5A 1EK5A 2VP5A 3W4JA 4D3XA 3OO0A 4KQXA 1V7QA 3PWSA 4C7MA 4AJJA 4HEHA 1H65A 2HLDA 2ZWMA 1QO7A 4R83A 1BYUA 2NV2B 2BFWA 3I6ZA 1UPTA 5AHRA 4BRUA 2VUSA 3RUIA 1OASA 1E2GA 3U61B 1KZ9A 2VTVA 4MAFA 3GCXA 4LN1A 4PNPA 3ZE9A 1U7DA 3K09C 3ICWA 4JQCA 2CCJA 4LXYA 3KC2A 3QELA 4PFKA 3ILVA 4MS1A 4XTRA 4HVLA 5AVVA 1P81A 4AZTA 4D8TA 3L4KA 4MI6A 3BMQB 4Q1FA 1Z13A 1RHJA 3RUFA 4CDMA 2Q5QA 3D8UA 4E22A 4I66A 2D5LA 2Q0SA 2WPDD 1GUBA 2GCPA 3LRXA 4LMRA 2OPHA 2HA6A 4PU0A 5JJIA 3GGGA 4GGPA 1P1JA 2Q4DA 1EH5A 4A8TA 5B3KA 5JQGF 3HADA 2P62A 2QI9F 1O96A 4DN6A 1N8KA 1XQVA 4U1RA 3C16C 4LRWA 2A1UA 4NYMQ 4RULA 4OLJA 2NV0A 4WW0A 4KKVA 4AT1A 4QGBA 1BJKA 2DX7A 2OYCA 2NWQA 3AQIA 1DWUA 4MKHA 2I55A 3CTPA 4BX9A 3I45A 3FCOA 3UPDA 4EJ0A 1D6NA 2OV4A 1UXKA 3HBLA 3LX6A 2QD1A 4O2AA 5AOVA 4AF8A 9GPBA 1IN4A 4AG5A 5KWJA 4DIMA 2RBKA 3N2GA 3EGDA 4L08A 3OP4A 3TQCA 4E32A 5CA0B 1YJCA 2JCGA 4D9JA 3BFVA 4LMBA 1KYZA 4MQMA 3DWIA 221PA 5JSZB 3N6RA 1GPWB 1X9GA 3PKIA 5AHXA 3WGVA 3GD7A 3AL0C 3SLRA 1II8B 2OCLA 3ZEAA 5E2IA 1RQPA 3P0HA 2R1TA 2GHIA 3SIPA 4EKDA 3LUHA 2Q9BA 1AU9A 4C0KA 4DLWA 2BGUA 4KGXA 2XWJI 1XEXB 1TT7A 1HYEA 5JPIA 2FGKA 3IAXA 4HDSA 5FYDA 3QHAA 4H18A 3MTEA 5LZ7A 4B73A 3MELA 1NSFA 4DIFA 4G89A 2Q5OA 4NPHA 1HO3A 3OPQA 3GQBB 2PWPA 2J5KA 2JASA 4NR0A 4PLCA 3REGA 2H5JA 1NJ2A 2V97A 1AKEA 1CEXA 3EQ9A 3JWGA 3ZE7A 2LVBA 4P7GA 3BCUA 4QOEA 4F9GA 4Y2VA 3DWFA 3S5UA 3V7FA 1BDJA 1G5PA 1KBQA 2GN1A 2J3DA 4H7IA 4DBLC 3BZWA 3DF7A 3ICPA 4YRNA 4MQFA 4X85A 1XMPA 2ERCA 1U31A 2A9FA 3FDFA 4KPGA 4WA8A 4ZRNA 3PJFA 1L7QA 1VPEA 2IXTA 4ZP1A 5A7GA 1XUOA 3GC6A 3RYIB 1KI8A 4AXBA 2BE9A 1PDVA 1JRLA 1E3JA 1VI6A 1TVKB 1XCLA 1B2LA 5TQVA 3TOSA 3HU1A 3F7TA 4NZYA 2FX5A 3DB2A 1FYFA 3PHLA 3O7MA 5EMHA 1PYOA 3UHPA 3L0IB 1JBKA 3DUFB 4Q9LA 3WQHA 2UYCA 1GSOA 2OVFA 2IITA 2IS2A 4QHSA 2CT8A 2JJMA 3KZKA 3P2YA 4DARA 2GM4A 1L7XA 3UAWA 3QUTA 1DZIA 2J3HA 1D2GA 4PPGA 4OHZA 1EHYA 3ORHA 3OA2A 4JYCA 3O2QB 1BW9B 1MO2A 5B1IA 3JQ6A 2HQRA 3F0TA 1RAEA 5HE9A 4NJOA 1KP9A 1DOZA 2WUVA 1XJCA 3U4CA 1Y8QB 4INAA 3PQ2A 2GZHA 4L78A 1VHDA 1N4AA 1TAQA 2VS1A 4NG4A 3QKRA 1PN3A 4PAOA 4BJ5A 1RWKA 3PQ5A 4OA8A 1T4BA 4ZJYA 1CFZA 4RU1A 2JATA 4M9RA 1Z2OX 2YIDA 3G2KA 2AFHB 3AI2A 4D43A 1QBGA 1SQ0A 1Y89A 4YDRA 2QRNA 3LLVA 4MVJD 1PX0A 3BHJA 4GIBA 3PLNA 5A5VA 2V7EA 4YONB 2B1GA 1KAEA 2YVQA 3WIDA 5I3ZA 3LK7A 4KE6A 1H9BA 2IE8A 2MDTA 4R40A 3B3JA 4KFSA 4WK6A 1M7HA 4QTZA 5CAEB 2BFNA 4MS3B 3ZDXB 1RMTA 2FSUA 3BIJA 3W34A 1JQKA 4KSYA 4DLZA 2HI0A 2IV2X 1JIKA 1VBNA 3D02A 2XD9A 3SEFA 4QPDA 1IOWA 1MW9X 2G09A 3OZWA 3SG0A 3SJ7A 3KKLA 2J9GA 1NBOA 2BFCA 3QPBA 2M6LA 2H5LA 3SEQA 1J5EB 3LTNC 1COWD 1E9CA 2Q0XA 2WJ3A 3BD8A 4EY7A 3C6QA 1F1JA 2ZTVA 3DMRA 1P7ZA 5AVTA 1GUZA 2IGTA 3I9OA 3C74A 1XAGA 1M6NA 3VM6A 3GFOA 3CRW1 1WS6A 3DE4X 3IDOA 4GX0A 1GPYA 1XROA 4UDXX 1NE7A 3MHPA 4D7AA 4XWKA 5CBPB 3PC3A 4TPKA 2AR7A 4RK1A 1N5MA 2EW8A 3ZJUA 2O2ZA 1HQDA 3NBQA 1K63A 5JCPA 1F5SA 5HJEA 3LWDA 2ZJ6A 4AJNA 1PZGA 1TLLA 3H9EO 3AX6A 2QQEA 3R0IA 4LJAA 3UWPA 5A06A 1E2FA 4B7ZA 2DH5A 4LWPA 1ZUNB 3Q2IA 5TJ9A 1G19A 2QX8A 4RCZA 4KTTE 3WK4A 3RNOA 3I5MA 2OV8A 3QVGB 5AUQA 3ADPA 3QX8A 3WISA 3ZPXA 1KIMA 1VJ0A 4PX3A 4H0FA 1H4TA 4RTKA 3TQRA 3DLBA 3O4HA 4XFJA 3FIUA 3COJA 1DRVA 2QAGA 1Q1NA 3KR9A 4NOJA 3SJUA 4G1MB 4WFIA 1NP3A 1LK7A 2F59A 2V65A 1KEUA 3MVEA 1E1RD 4LYDA 3H11B 4O63O 4RVUA 1F12A 1EBBA 1NQTA 5LLTA 2L17A 4XIIA 1QVAA 1UBCA 1J24A 1YZFA 4FFDA 4LVNA 1HT1E 1UMDA 2WJHA 3IE2A 2C4VA 4LVOA 4LSZA 1A96A 1G5FA 4LE0A 2WJJA 1U11A 1XEFA 4NU5A 1O58A 2ZPUA 4WFQA 4B8ZA 3FVWA 4ZHQF 3THSA 4B6RA 4WOKA 5BQXA 4QU5A 1E79D 1KI2A 1W1UA 2HA3A 3SXUB 4JJ6A 3CX3A 4ZOEA 1LPMA 2H51A 2XAUA 2BWJA 2C84A 4X1YA 1GNVA 4EPVA 1QUEA 4A15A 1I33A 3WYCA 2CLHB 4Z4EA 3S6JA 4BZQA 4MGYR 1EQAA 4FYVA 4QNRA 1WUHS 2BBWA 1D0VA 5H02A 5FL7A 1XDGA 5D3KA 1SK9A 1Y4UA 2IS6A 2I4RA 2IY8A 3CKKA 1JMYA 1CD5A 3ZW8A 3VO1A 1U0NA 2F00A 2VNJA 2PM8A 3FDJA 3IAEA 2JJ1D 3QHQA 1QZXA 3NHLA 3R24A 4UHFA 5ALTA 5EPUA 5HFNA 1HNXB 1EEHA 4F4CA 3MC1A 4MP8A 3TYXA 2KX7A 2HRRA 2HUPA 1S8OA 1VGRA 4ZTBA 5ENDA 3WGNA 2IHNA 4G2TA 4JBYA 4DCSA 1MEOA 3FYUA 2V9PA 8AT1A 2FNAA 1IY9A 1JDUA 1YE8A 2NO0A 4RIFA 3S2ZA 4GBMA 2P2YA 3PDCA 3UMJA 2RH4A 2PCJA 1QUFA 1I4EB 2PZJA 4RY0A 5FB3A 3C3AA 1H8HA 1P2DA 1SCDA 3EN0A 3FTPA 2P68A 1LUAA 1OX6A 4PYOA 4YEDA 5F9FA 1RPTA 1QFZA 3CPSA 4R5HA 1CERA 3OHPA 3HN2A 1VKJA 4UQLA 3HJGA 4IMRA 1GZ3A 4Q3EA 1A5TA 1H5QA 1RBQA 5A02A 3LQQA 4RO0A 2NXJA 4BATA 2G9VA 2LKCA 1L3IA 1OY1A 2PLWA 4GR5A 3ZLTA 2GK6A 2DP4E 2WVJA 4A8HA 5CLJA 2IU4A 1ECPA 1KTVA 4RF2A 4FI3C 1U2SA 1SUDA 1NVMB 5C18A 1ISHA 3TE7A 1UWVA 4BNFA 2X0DA 1GGNA 1OKKA 1NXXA 1XMIA 3IX7A 3KVYA 3RK1A 1PLJA 1VRVA 4N40A 1YDMA 3VU1A 3WOVA 4PE5B 1NZFA 1XDUA 3VR5D 5BT8A 3T54A 2ZE8A 3RT9A 3ONWA 1LVGA 2HQ1A 4DQLA 1UDCA 2HOQA 2AYZA 2XF2A 2XV1A 3UM9A 4ENSA 4NABA 1IZ7A 3W2GA 2O2YA 5D3ZA 2QRUA 1MW8X 1YO6A 3FB4A 1U0OC 1ZICA 3SMQA 3EH1A 2IZ5A 4Q4CA 5I6DA 4GP6A 5EPOA 5EXTA 4C08A 4LFBB 1HA3A 3L1JA 1C81A 1VRWA 2CXSA 3KKNA 3L3BA 4OMDA 1JB9A 1RLTA 5C4GB 4B6OA 2K4MA 5K3BA 3GLFE 4AQDA 4Z7NB 4EW3A 4JL8A 4CUZA 4URZR 2NQ8A 4K5QA 3TTSA 3PQ4A 5IEBA 4AN0A 1MC5A 3A6LA 2XIQA 1DZ3A 3VDMA 1MZVA 3CNBA 1EB8A 4CRWB 1NYRA 3LAWA 5JI2E 4P3NA 3T12A 5IJAA 2X0RA 4IJUA 3DCJA 5JSKA 5C7LO 4JYZA 1ZOLA 3E9ZA 4TRNA 2JGJA 4PHCA 4XW2A 4A6EA 4NONA 5GIOE 1DT3A 2UVQA 1THTA 2V6BA 3A58B 2XDQA 3QOWA 3MPOA 1ISRA 2VXBA 2BEVB 3AB8A 1EXDA 2VNHA 3G9UA 1LGYA 1HYBA 2OOSA 3QI7A 1EESA 1T9AA 3K2IA 4HRYA 3GJRA 1GL3A 2AUNA 2HFJA 1MRNA 2NUPB 2HCRA 3DZHA 3G13A 3KD3A 3G88A 4FEAA 4MPDA 5GWXA 5NULA 2VNIA 2AA3A 4DADA 2ZFUA 3MWLA 1Y9EA 4ENVA 4TZKA 5ALFA 1F06A 4CM8A 2XVXA 3LE8A 1QIEA 4FHZA 4L5YA 1LRJA 4JHXA 4X95A 5FA5A 5ALJA 4PG5A 4Y2SA 3LOUA 4ZVOA 2P5TB 2C2KA 2YDXA 3K94A 4WNIA 4XIFA 1OJLA 3BWCA 5FNVF 1L4YA 2VRCA 3JD3A 4QGGA 5HM6A 3WTBA 5CMLA 2VDJA 4TWAA 3AINA 1KEPA 2QSYA 1TZCA 3NANA 4Q34A 1EJ6A 1YTUA 3DCYA 1PR5A 2PUHA 2YHUA 1Q11A 2GAIA 3DR5A 2NZWA 3NXSA 1DIOB 1G6KA 1OBCA 1W93A 3STXA 3IP9A 1LDYA 2WJVA 1Q12A 3ISJA 2IU0A 3PNQA 4I36A 4MR8B 4K46A 3D7KA 2WHQA 4DWVA 2EC5A 3GFGA 5KJCA 5LXTA 4HH0A 3VU0A 1VCNA 3IVRA 2W7TA 2OWDA 4PZZA 5CB0A 1W59A 2B35A 2V6IA 4JYAB 2HHLA 2B4TO 1DARA 1YJ5A 2GMWA 2NT4A 3CR3C 4L4SA 1H66A 1JU4A 4EDFA 3PQFA 2HM7A 1JXOA 1ZH6A 2VDRB 4BFSA 2PAFA 4UCXA 2WQ6A 1GCAA 4IH9A 3W8EA 1E2UA 1VSQA 3L1KA 3P52A 1VFPA 2WSSA 4CLOA 5T8KC 1X1CA 2IIQA 3D6AA 3W3AA 2VL7A 3IS3A 1FTSA 3AERB 4FXOA 2EZTA 2NU9A 4GX2A 1XZBA 4ZDWA 3U7JA 1Z35A 2YMMA 3KYCB 5F7ZA 3GGCA 4GOLD 4BLRA 1L5HB 1P2FA 3MLEA 2L0XA 1GARA 4UM7A 3UXYA 1DDGA 1ILEA 4LOHA 1NULA 1KJJA 1V47A 4RTSA 1W8DA 1CDEA 1YL5A 3DTNA 3STUA 5KTSA 4IGAA 5FR1A 5DHQA 1DBWA 3QVKA 4IEFB 4H1WA 4P81A 1RCTE 5CURA 1RPZA 2PQMA 2E5FA 3DLCA 3SR0A 2EP5A 1NFRA 1GDHA 5ERGB 1Z2AA 2GPTA 1J25A 2WIBA 4C30A 4DM7A 4O2AF 1XRPA 1Q84A 1IHPA 4JP1A 5JS2A 4FYHA 1GP2A 3B9QA 2GK3A 4KQ1A 5BR1A 1G17A 4HNVA 1DWOA 3OUTA 2F62A 2VNKA 4XEHA 4I2NA 1FB5A 3NHWA 4W8OA 5JH7A 1FUEA 3QE2A 5B1EA 3FPFA 1M74A 4HDKB 4TS1A 2ODNA 3EPJA 3AXSA 1C3OA 4RD6A 4BCDA 4YP1A 1P6XA 3MMNA 3NAMA 3VA7A 4XEUA 4HX2A 1MX5A 2JAOA 2CXXA 2BGWA 5TQ2B 1XO1A 2M32A 4Y30A 3UA3A 2BW0A 3EQ6A 2FUG1 4D5EA 2X5KO 4QUIA 2DLDA 4KQHA 1NYQA 4UBIA 4BX2A 3ZGVA 1NMZA 4H6PA 4OTZA 1WZ2A 4DR4B 3R0JA 4TS3A 3LECA 1BYIA 3R9KA 5JNUA 5E4FA 2FN8A 4DDVA 4BDTA 1KXZA 2QTAA 4RK7A 2PUEA 2NX2A 4C0SA 4AI6A 3UAOA 1AMNA 1Q22A 3H97A 2HIMA 1XKTA 3R7FA 1UZAA 4P54A 4OFWA 5KSZA 4G01B 5BYBA 4MYRA 1AV6A 4MB6A 3UH0A 4HRAA 1I3NA 4BZWA 4R0NA 3C6XA 4D79A 2FGJA 1YZHA 3QU2A 4YJGB 3CR7A 2GEFA 2R85A 1GZSA 2XNDD 1LPAB 2OMEA 1QHYA 1F6BA 1K6MA 1EFVA 2F9LA 2CV1A 1F0YA 1EWVA 1QBKC 2ZSKA 1XA3A 1GTL1 2BAGA 4IWXA 3VSDA 1I6KA 1RC1A 5IZCA 4AO8A 2XHZA 1FZQA 5LFAA 2YWHA 1Y4ZA 2Z9BA 5LBUA 3R7WA 3CZAA 1LPSA 3N3BC 2ZUCA 2F1KA 3BGOS 5E8JA 1C4XA 1F20A 3MQ2A 2Z58A 4L9AA 3R3JA 2FJPA 2G1JA 2BFAA 1ZISA 4F9EA 5KNBD 1S7GA 2D3WA 3REOA 2IPAB 1DLIA 5CRIA 2WM8A 4UBMA 1ZESA 4PN7A 3KOMA 1UM9B 3HFSA 5CTAA 3RFCA 2HJWA 3P4XA 3H84A 1JEYB 2J0SA 2C83A 1Z0JA 1DFIA 1YNOA 1GSHA 4U7PB 2B9VA 3D43A 4ZRDA 4ZRMA 5JSYA 2BJWA 3AVVA 1D7AA 3DHEA 3WYBA 2HWWA 3TBHA 2MOKA 1NOIA 2WFLA 3RIXA 3UJHA 5ICEA 2VH2A 3H86A 4JP5A 1P39A 4X8HA 3RSGA 4YT8A 4N82A 2VZ9A 2WFMA 2QSUA 4KDRA 4JDUA 1Z29A 3WHIA 1IZ8A 1CJTC 3ZU4A 4P6VF 2PE5A 2PEYA 3QE0A 4DZTA 4RXMA 1MGOA 1QVRA 3O8RA 3TG8A 3W7VA 1YDFA 3L5OA 3ZZ1A 3QPWA 4D9BA 3A32A 2Y2UA 3QSYA 3EEFA 1FW6A 3FTCA 4WY8A 1XRMA 3B9PA 4I8DA 4L3VA 3K20A 4TMFA 5H5JA 5J2TA 4FGZA 1G59A 4KR2A 1DC4A 2OKCA 4JX8A 3B8HA 3NM5A 2Q1UA 3NHJA 1GGEA 3BXHA 5GADl 2OCIA 2VA9A 1X14A 4GRDA 4R2HA 2APJA 4UEQA 3WQRA 4JC0A 1WVGA 2A9JA 2Q99A 4K7JA 4IUBS 5FPKA 5CT9A 5BNTA 2Z30A 1P1HA 4C0QC 4CODB 4HAUA 2POQX 2IXFA 1UJMA 3NIDB 1R0YA 4TUYB 4UDOA 3ICQB 5KDOA 3QPCA 1MJ5A 3ORQA 4BKPA 1A9ZA 1U0HC 4HHEA 3KZOA 1GRRA 3UK1A 4E03A 3NW9A 1L7NA 2D06A 1NWHA 3NBMA 5DLPA 3V4VB 5T6MA 3F1LA 1WM1A 3ND5A 4BPRA 1L7BA 1K5GA 1N9ZA 2JFPA 4DXDA 1YRWA 3BMNA 2C31A 2IX9A 4NH4A 1N8SA 1I1HA 1I2CA 2FQXA 5CNKA 1RIIA 2BDTA 3QW2A 1BX3A 5A1JA 5FUWA 4KSCA 3ZG6A 3VC3A 4ARZA 3O0DA 4B71A 4BNKA 2JBAB 4Z7OB 5ALRA 2DWCA 4YRKA 4NXNB 4F3RA 5B4VA 2FRVA 1MXHA 1V1MB 2MSDB 3PFFA 2JIBA 2RAPA 2I6FA 1VXOA 4AKEA 4CN8A 1PV4A 1O8CA 1BOOA 3KSZO 2GCOA 1RFGE 4V0KA 2CEAA 1NVKA 4ES6A 3LXRA 1M54A 2P6UA 4F1KA 3IAAA 3WSWA 2WT4A 4HWSA 4M46A 2J46A 5LU9A 4OD0A 2R7AA 4Y2TA 2BHTA 1ID1A 2DJIA 1R12A 3UJBA 1FJGB 3NMUF 3D1JA 4MR9B 2J0VA 4N3BA 1XZ8A 1ZM3A 1JA0A 2QVYX 1S2LA 1L8XA 4IGEA 1AMUA 1LZKA 5T4EA 2XSZA 4OUKX 1GAEO 1QKJA 3IIJA 4XUDA 5AXCA 1FDWA 2XVZA 5EHZA 3LF2A 1A8SA 2F64A 3I4LA 5IXYA 3TINA 1A0OA 1VHTA 2H8KA 2WVAA 1KY5A 1OT3A 3RW9A 4RNDB 4Q3OA 4C7XA 4FM9A 2WYVA 2QYSA 2NAPA 3VR3A 3W4IA 1AUPA 4EF6A 3SSMA 1ZSYA 3E7FA 3FCXA 4IMIB 1OXMA 2R7NA 3MJCA 1JUDA 4IKEA 4J90A 2QVBA 4LSGA 2RGEA 1OF1A 4PPQA 3TLGA 2D6FA 4UZFA 3IV6A 4G1VA 4DLRA 1NT4A 4C7JA 3IMCA 2YRXA 3HP4A 3RHSA 3G89A 2B8EA 3ET5A 2PV7A 3BMOA 2RAVA 3F97A 3EUEA 3I9FA 3K2QA 3NHRA 3EEOA 4RVDA 5EE9A 4DNOA 3IDSA 3FR7A 4G81A 3MT8A 5AI9A 2WG0A 2Q4EA 3OIVA 3OA0A 1EM8A 3TLJA 2BUAA 3ZHVA 3P9PA 4BBJA 1GUDA 1L4FA 3RS8A 4EYEA 2V6FA 3BB4A 3UMGA 4XUGB 2DPGA 1MLDA 1WAMA 5CB6A 1VE7A 3T7RA 2GF2A 3NC1C 4WRRA 1O9HA 2C4HA 2PN1A 5JAQA 2Q2QA 3EIOA 1LA2A 1M2EA 1OBHA 2I9PA 3C8HA 1MMFB 3RO7A 1WD5A 4XIYA 3WI7A 1OYWA 3A1FA 2MSWA 2G5TA 2HX1A 5DCYA 3WKBA 4CGYA 4DNPA 3FOZA 1U2PA 3DKVA 1V16B 4FGLA 1AVTA 4IHAA 3K32A 1ORWA 1N2ZA 1P1FA 1WEHA 3BF7A 3SM9A 2IU3A 4MS4A 1RVV1 4P2GA 1R6TA 3H65A 4ZK2A 5BQFA 3CVVA 5AW4A 3UW3A 4IKPA 3OEED 4C07A 5F1OA 3GFSA 1M0WA 4PS1A 2CXQA 2P6NA 1Z88A 4OFZA 3OLVA 3VC2A 4AZ0A 4KQKA 2QSJA 2Q9AA 3KP1A 4MNTA 1CZUA 2EV9A 5B6PA 2BTEA 5BMVF 2ZBQA 2FMHA 3IGFA 4LVCA 5JC8A 3T38A 1T9HA 3LUJA 1YB2A 2ADOA 1RRMA 5REQB 4FNGA 5JALA 1YKFA 2V4UA 2A0YA 3A1SA 4QM6A 1OHHD 1JNYA 2JGDA 4M7OA 1GSAA 1ADBA 4ACBA 2QD2A 4X3PA 5EGSA 1XD9A 1JPUA 4EVSA 5KOJA 5LQNA 4CM7A 2X77A 1VPLA 1PT5A 3HWX1 1Z7EA 1E7RA 2ZRNA 1J1UA 4OFBA 4IQ4A 2MYTA 4QYIA 4OK5A 5CDGA 3RPEA 2B8JA 3O3OB 3UAVA 5BV7A 4QDOA 1PG0A 2E4VA 2V59A 5E6UB 2IZZA 4CEIB 5YASA 2P2SA 3BPSA 4XPIA 3MFYA 2KYRA 5JEEA 3ADKA 2DOKA 4ARAA 2F6RA 2C2MA 2PMDA 2D1YA 4YJ3A 1L7RA 5CDTA 1Q77A 3BJMA 3RYTC 4QSMA 4Q1AA 4BMVA 3PCTA 2F8SA 2GM3A 4A0FA 1OQAA 2BPOA 2YWRA 3MGGA 5LYYA 2WUFA 1E5TA 4KFCA 1P4GA 3K0FA 1GYPA 3P45A 3HO1A 1QC5B 1CZLA 1E92A 3PITA 5BO5A 4H1HA 2WYOA 1ESZA 3EDQA 3WGHA 1AUXA 1GG2A 3VTKA 2IUTA 4LYGA 3QYFA 4OGGA 4LRXA 2HXGA 3NHSA 3VNUA 4WT7A 3EXFA 3L6BA 3L8ZA 3PICA 4JLVA 3DKPA 4WKGA 1Z33A 2XNSA 3ONVA 2QRMA 4QJBA 2VUHB 1B00A 3OOYA 4IDPA 4BNVA 4YLEA 1JDNA 2GBPA 2V98A 3IERA 1TF7A 3KPJA 1GR1A 2W43A 2V74B 1YZYA 4P4UA 1Y3FE 2PHZA 5DO9A 1X7HA 2CZGA 1Z8NA 3DBHA 4N1AA 4GBED 1K8XB 2I3AA 5LXTF 1M34A 3PKJA 3MOGA 1M8GA 1PT6A 4G5RA 1BCRB 2UAGA 3PIDA 3IAS1 5CR9A 5KTKA 2YL2A 3K16A 4FYPA 1MA0A 1M66A 5EJ5A 2B6NA 1HX7A 3C8UA 4IQ0A 5A3RA 1W0KA 9ATCA 3TO5A 3QEMB 3ULKA 5FWAA 1YHNA 4MEAA 1GGFA 4IINA 1KEWA 2WJ4A 4QDUA 1U8ZA 5FI3A 3L4EA 3IO3A 2IX3A 1SBQA 1X9HA 1TF5A 2B83A 2FG6C 1CR0A 1Q2XA 2BUCA 3H3JA 3DVAB 3JCZA 2XODA 4ID9A 4PC6A 4YRJA 4AC9A 2UXBB 3JTEA 5KX5B 3JYOA 3TVTA 1E62A 1RIFA 4IG9A 3IPYA 2REQA 3PFKA 4WOCA 4FWIB 1YL7A 3R8XA 4F8YA 5BR8B 1RC8A 1YUNA 4ZAFA 4QQ8A 3CMMA 4H31A 4BGVA 3G9XA 2ACKA 3S8YA 5KNDA 2Q2VA 5ES3A 2W0MA 4ZU1X 2YOHA 2CLOB 3C7KA 4ESEA 5LDHA 2V1XA 1AURA 1WEKA 4JL5A 5F7OA 1TCAA 2WKPA 2N1BA 1UODA 1KNXA 1TCCA 1H1LA 3CSUA 3FGPA 3U80A 5JJLA 2R2GA 4OHCA 5L3QB 3UB2A 3WDSA 1RAHA 5L45A 2Z9DA 3M6WA 3DAHA 1EA5A 4I14A 4MCJA 4BNZA 1XZDA 1X94A 2H16A 2OCGA 3QJGA 5HR5A 5KVQA 5JLAA 4U02A 3VBEA 2VKQA 4DVGA 1CT9A 5KMGA 2BTOA 4LMPA 1CHNA 5HP4A 2RHMA 4G1FA 4LJ8A 4XRRA 4JOCA 3OE7D 3HDHA 4FDTA 3UT5B 4LZNA 1VI5A 4QFDA 4RL4A 1RC0A 3HHPA 1YF3A 1EFRD 4BN5A 3NV9A 5A9TA 3LQ1A 1YD7A 4EQZA 3AEUA 3MB8A 2VLBA 1BGXT 3UJPA 2EZ9A 4ZTUB 5AKIA 1E58A 1FP1D 2FFAA 1ZQ1A 4WDQA 4CE6A 2ORED 3PEUA 2XE6A 3IT2A 4N03A 3DEKA 4GDMA 2PUCA 4DJ5X 5FD8A 2Y0DA 3SSOA 3VVBA 2XTZA 1XXHB 2R00A 3CZCA 2C2YA 1A7KA 3PDIA 5KYWB 4DV7B 2QNRA 2RI1A 5I7VA 3SWWA 1N78A 4A1FA 5F73A 4RZ2A 3LP6A 3HCFA 3W3AH 2QLFA 3TRIA 4KQGA 5TQ0B 4R1QA 5IU6A 1ECCA 2EZUA 4ZT2A 1LSUA 4D9GA 4MW5A 2VI5A 3O90A 2VK8A 4MQ4A 4B6QA 5C46F 2VQ3A 3HV2A 5AJWA 3WK7A 4R8SA 3SC3A 2SHKA 4BNNA 4E30A 1XTZA 1CUSA 4BQFA 3E5NA 1ZI8A 5BN5A 1PX2A 2WIKA 3LW8A 5EE3A 2H5IA 5B64A 2IEZA 3UQZA 2CK3A 2GZ2A 4AN4A 4AU1A 4PO1A 1EK0A 2CMHA 3N87A 1Q3KA 2G6BA 1Z0IA 1ULBA 2HT6A 3NATA 3WICA 5HOQA 2OUKA 2ECFA 4PLTA 4BTVA 5DX0A 4ECEA 4AS1A 1SA0B 3HTXA 3QNUA 2ZUTA 3O4IA 1JJFA 1V48A 1SOVA 2AG8A 4LAFA 3KV1A 1Q14A 1DIHA 4JLWA 2IS4A 1LWNA 4BMOB 2DWOA 2GVDC 1ZC4A 5TEWA 5AUNB 4POOA 2OZPA 3KQQA 8ATCA 2WW8A 2NU7A 1Z2PX 3WJAA 2VEOA 1DOHA 2DPHA 1QZ3A 2HGSA 2I03A 2P1ZA 4R2KA 1PVDA 3PGMA 3THWA 1R16A 4WKNA 1SRRA 4CHTA 1P0QA 1R0BA 1U9ZA 2DHCA 1TJ4A 1ZM9A 4FC6A 3WFIA 1PWYE 1DQNA 4UEOA 3EFBA 2PJUA 1SH7A 4KR7A 1E2LA 2ZM5A 5I48A 2PKRA 1RD4A 4LJLA 4WK2B 2AFIE 1BKYA 2D2VA 3C4QA 5K5EA 3RJZA 1Z62A 1V35A 1V45E 4J0GA 4L7VA 3TZEA 1XI2A 3EIUA 2CFSA 4G4SO 3CNHA 3B52X 4C5CA 1IXRC 1DJNA 1QQTA 4C7KA 2WG2A 3I3SR 4UATA 1ONNA 4H27A 4OPMA 1RLUA 3N8NA 2XGSA 1ACMA 2JK0A 1ND6A 3LBAA 1F14A 1T3ZA 2WU8A 5MN6A 5J2TF 4CCAA 4QL3A 4RJTA 4US2R 3IQFA 4L76A 2PMEA 2Q4OA 1BHO1 1T0BA 1WHSB 2G1AA 3ANXA 1Z74A 3QVOA 1L5MA 5JWHA 2WB4A 5C80A 2COEA 2FCRA 3PWZA 3UHFA 1J09A 1P2VA 2QUIA 1LTHR 2P9QA 3LQYA 4AXXA 5FL3A 3HO6A 4N12A 4ZT7A 4NU8X 5GONA 1GKUB 5CFOA 4P0TA 1M6YA 3OT1A 2JHFA 1I7LA 3H1TA 3Q6NA 1VTKA 1Y6QA 2H07A 3H1PA 2X5NA 3NRCA 4FFLA 4D9KA 1KZGB 2MSLA 4O5AA 3E9CA 5DNVA 2QD5A 3ZD8A 6AT1A 2WF6A 4MGZR 4DQVA 1WNTA 5B2EA 4UUPA 5JCXA 4QU0A 3ETEA 3O2SB 3PC8A 1W46A 4IO0A 4XYGA 4TMYA 2ZT6A 3EG9A 3LHFA 2CYAA 5AXBA 4TV9A 4ZI5A 4DQKA 1UP4A 2C7VA 2G4VA 1W87A 1WSDA 2P4QA 3R23A 3KSMA 5B3JA 2GDZA 1TA4A 4WE3A 1XMJA 1I3KA 4BGUA 3DV2A 1Z63A 1GZ7A 4GKJB 2MIIA 1ZR4A 1TUEA 1SXJA 3DO5A 5FRDA 4HAVA 1QIIA 5CFZA 3PC7A 4KGVA 4QUGA 3ZIUA 2Z3WA 2O19A 2O59A 1DHTA 3EIHA 1K97A 5K3DA 1YVUA 2R8XA 1IOLA 3AFNA 4BGEA 2NIPA 1WMBA 4OYHA 4EH1A 3HJNA 4E07A 1I0ZA 1JEEA 1UXJA 2AKAB 2JIZD 1VXRA 3K1JA 3EBOA 4FLMA 3DMFA 3AEQA 3E0XA 4QOGA 1YQUA 2FR1A 5ITVA 3K2EA 5K05A 3D0OA 4JBLA 5AR1A 5EWJB 3M6IA 4LYJA 4B7CA 1RADA 2FOXA 3EEYA 3I9V1 3UJ8A 5IVKA 1P4HA 3OAAD 4H7KA 1EVIA 4O59O 1BEUB 3UAGA 3LUAA 5BSEA 5JD6A 2ZIFA 4QNNA 1AKQA 5JAOA 2GCNA 2D54A 1FSGA 2DQYA 3VU9B 2FPMA 2BRUA 5A05A 2GD6A 3VOTA 5DBEX 1H2WA 4HFMA 3ZBPA 3OQHA 2VYNA 3AVTA 1HLDA 3ED1A 3NALA 1WW8A 1E69A 3OZAA 3HO8A 4FZJA 2FEOA 3PNYA 2XDYA 1KK1A 1DTWB 4D26A 3H75A 1ZD3A 2GPBA 3CLHA 2PH3A 3EEQA 3MUNA 2PFKA 4YT5A 5JNWA 4PINA 2WTNA 4H4CA 1I9GA 1VJDA 3QFCA 1JG4A 3E4CA 3RDPA 3L8DA 3LVRE 1E2MA 4AG6A 4S2EA 1DSSG 4UVEA 4IS2A 4KWHA 4QUKA 1J42A 1DQYA 2C4NA 4WLNA 4N5LA 1U9CA 2ZVJA 3CXUA 3L0YA 4BMYA 5LQKA 4PZLA 3G0DA 3E8XA 1G291 2BJHA 4OGFA 3U4IA 3I9MA 4F04A 3K71B 4UZEA 2OG1A 3S3TA 4AZSA 3WGGA 2BFBA 3GA5A 4OXNA 4QRHA 2WWFA 1WPRA 2R6CA 1ORRA 3HJUA 5EZYF 3SBDA 4J43A 1WXIA 2ZYVX 3U6KA 2GPNA 4QXAA 3VR6D 1NUUA 4GMXA 3WAJA 5JFGA 3CX6A 3FD8A 1S2DA 2XBMA 2SBTA 1FYVA 3NO4A 3O6VA 4TWZA 3DNPA 1C5KA 2ZYDA 3AW9A 1DOAA 1GTZA 3H83A 1VYTA 3I6MA 1YR9A 3E2MA 1KZHA 1SU8A 1Y8RB 3FF4A 2BKXA 3V55A 3VR4D 2NYRA 1KK0A 2QJRA 4UHBA 5JNTA 2OV6A 5KJFA 2R86A 2B20A 2X0NA 3CE9A 1DWPA 3D8SA 4OHRA 3ZIAD 4ZQCB 2VDOB 4G1UC 1SD1A 2NTVA 2H1LA 2CNDA 1HZZA 1NXWA 3A1VA 2D7CA 1FJHA 2XGMA 1X1TA 2GHQA 3H7IA 3BVPA 4HT3B 1A7AA 4B5LA 1SKAA 5BXQC 1TD1A 4C7BA 4A36A 2HQSA 4QNMA 4Q03A 2OUIA 1AS2A 3ZY3A 3Q9SA 2ONYA 4M49A 5E4YA 1FNDA 1CUUA 3N2KA 4PYQA 2YWFA 3IJRA 2YCBA 3PUWA 5EXEA 1IOZA 1ZCFA 4X5OA 1VI2A 4F8JA 4F4UA 1NASA 2I71A 3GDWA 1J49A 3U31A 4ESHA 4ZCMA 2JZOA 1D0IA 1Z4OA 3CPEA 5L53A 2X7HA 5FOXA 3RTEA 4JB3A 4Q9HA 5JBIA 2O0KA 5IJ0B 1ZCJA 1M6WA 1H1TA 3C1UA 1HQKA 1E5XA 1QHFA 1Y6RA 1U3UA 1RDFA 2QX6A 3GH3A 1MX9A 3U9LA 4ASUA 2I8LA 4B3CA 1KMHB 4XOIA 3PXCX 5FULA 3RAEC 4W82A 1Y6FA 1KJZA 1WE2A 1K6EA 4J6FA 4EY3A 1A8HA 1PNOA 1AZSC 5C1OA 3TNFA 5BSFA 3ICEA 2E7ZA 4EKGA 4ZTZB 3HYSA 4C7OB 2WHXA 4R01A 2GNOA 2AE2A 2I0FA 4HXYA 3SBOA 4WH0A 3VDQA 3ZCXA 4A8JA 1Z26A 5LLDA 4CQNA 4O8ZA 1NVTA 3KYDB 4RQBA 1TO6A 1RWBA 3QFTA 4QXRA 1XMXA 3EVZA 2NZ2A 4QLOA 5LMCA 2JFNA 3GGSA 5I9LA 3OFJA 4HZGA 4WL0A 1N7HA 4LJ5A 4BTEA 2D0DA 3KV3O 1B43A 5CG1A 3B8EA 2QNBA 3EYAA 3QEBZ 4FWBA 4MIEA 4TWRA 3BERA 1COZA 4DQUA 3I04A 2C54A 2KB0A 2XBUA 4HN2A 2AFRA 1GAWA 1HDEA 5JWOA 3G1UA 3V2HA 2FLVA 3EC7A 4P22A 1CYEA 1RWQA 4TLDA 5T64A 1PQUA 2CFIA 2AX3A 2I6QA 2FQ1A 5AJTA 4AFNA 4TKUB 1C30B 1CSEE 1X1EA 1SUBA 2AV6A 1L1RA 2H52A 4E51A 1Y5IA 5A0TA 1KGSA 4K81B 3O94A 2J6BA 1UIMA 3RVQA 1FFXB 5NLLA 2XYHA 1V43A 1HORA 1N5KA 2V3WA 2D4AA 5M29A 4AZWA 4MYUA 5CB4B 2QR5A 1QG0A 1ZD1A 3TD2A 3NGMA 1JT9A 4FYJA 5IVDA 1WOYA 3NIBA 3E9QA 3S1AA 1LZLA 4E5NA 2XWBF 1F4LA 2QXUA 2VDMB 2H1WA 3MCWA 3NT2A 4GWKA 2DECA 4FK8A 4IOKA 2JLQA 3R5TA 3KUKA 4QYTA 1CIJA 3PHIA 3G2HA 4YASA 2O5EA 2VP0A 1DBVO 1TM4E 1EJBA 1YBFA 2VJPA 3COWA 3F2VA 3PYLA 3IEMA 4KUGA 1YZNA 4Q7KA 4YRGA 3L4SO 2E4UA 4I9HA 2GN6A 4PCVA 6REQB 2GO1A 1GU0A 2QMQA 4QD3A 4GE3A 3AZPA 2BL4A 2V6JA 1LJ8A 1U5CA 4IXNA 4B32A 1GKLA 1OBVA 1SKYB 3AY7A 3COYA 4FBGA 5TXGA 4WGFA 4OP2A 3BTVA 4HDRB 4EJSB 2X8JB 4YR9A 1RKQA 1Z7WA 3N53A 4JB0A 2G28A 2QP9X 4U7DA 3BRWD 3TMKA 1F8XA 1XFDA 4FLFA 5EJIA 5TC4A 3LKVA 3HBFA 4QBKA 3M82A 4N01A 2W6ID 2R6R1 4JEIA 1VA4A 2G63A 5EVCA 4RPCA 1GZ6A 2JAQA 5TX7A 1XCPA 4NU0A 4G9EA 4U7TB 2QYTA 2AR0A 3WB2A 4AO6A 4G8BA 3OWXA 1TFRA 3K4QA 3DBOB 4W1PA 1E2QA 3AF4A 4YCJA 4C0HA 1M3SA 5EKUA 3C3KA 4G24A 4HFNA 4LF8B 3RAPR 1CPYA 5AW3A 5KYXA 3UXEA 1S2OA 3FDXA 5DCWA 4HAWA 4IGIA 4J16C 1U8UA 2XUOA 4E5VA 1GQOA 5IXSA 3DEAA 4N76A 2PL9A 3BHIA 2EF1A 3G8AA 4RJJA 4MWSA 1EE9A 1R4AA 2ZKLA 4B87A 5K8UA 4PWYA 2VBFA 3GT7A 3ZDRA 5EJAA 3H2HA 5BW8A 4LDRA 4L2IB 2F3SA 3GGJA 1V5IA 2HWXA 2QPTA 3HXLA 3OT4A 1MAVA 1UMBB 2BIFA 2NUBA 4OMUA 4EATA 5AUPB 5CLHA 5LQCA 3F90A 1GV0A 3RFVA 2VQEB 3TUIC 2H1IA 1VHLA 1OZHA 1NTOA 4NNPA 2WSSD 5CA1B 1DC3A 2AXPA 5A3SA 2PU5A 4Q3LA 3SHTA 5KNDH 3ANTA 4D4HA 4QXOA 2GQ0A 1D2HA 1DGQA 5E1OA 4OBEA 4YYEA 2R2AA 2ZT7A 4YAJA 4OQMA 4B79A 2BEUA 5IT0A 5MGNA 3G5TA 3PGA1 1IZYA 3T3GA 4PF1A 5HVNA 5CLFA 4DUGD 1C4KA 2QTWB 2J5BA 4WUTA 2P35A 3QJ5A 1CJVC 4L51A 3WBFA 2RH9B 4JJFA 1XC7A 2FRDA 1U5BA 2I7XA 2IUYA 3I04M 3JQ8B 4CLRB 5BXYA 5ALPA 2P6RA 4QQFA 5E7QA 3SE7A 3HBNA 2PX3A 4HXGA 4MKRA 4HVCA 3E9RA 1IEVA 3E9MA 3FWHA 3FZQA 2WG1A 3W1WA 4F21A 2NTYC 2EF0A 2D7DA 4PGFA 4WBNB 3C6KA 3DAGA 5CX1A 4R6XA 3BN3A 1PW7A 4TSRA 1RP1A 1TJNA 3ESQA 4AX4A 4ADSG 1A1VA 2C9MA 3PR1A 3K1AB 4BJ1A 1Q3TA 5I5GA 1M8KA 3DNFA 3KWJA 3EBPA 1WMDA 2OYRA 4CR6A 2GTPA 2J4FA 4QAQA 3U44A 2HIAA 1DO0A 3VKHA 2IYAA 4ONEA 1M2FA 4FR5A 1C9YA 3LO5A 2M6RA 3KPUA 4EMBA 2NSYA 2QP4A 2JIDA 1XKXA 4XWGA 5K0GA 3P9ZA 4DC9A 3PD7A 1J8YF 3WLEA 3WSTA 2NPFA 1E2EA 2XMPA 1J5PA 3EGOA 3R6TA 1BD3A 1NKSA 5AJVB 5JYEA 5K45A 3JQBC 4I9GA 2OGUA 4EVIA 3I0MA 2O8EB 3QE3A 1LNSA 3BFXA 1K7XB 4P3OA 5GONF 1J2UA 4TZ0A 2JRLA 3JSXA 4CEHB 1PE0A 1PJSA 3I52A 2VDVE 4G65A 5AJUA 3RLFA 2EFEB 4EVQA 1TC1A 3KE8A 3HUUA 3PL5A 5KNLA 3ADBA 4F06A 1GFIA 4EBBA 2BP7A 3FPJA 3U4GA 2X2FA 2RGGA 4IXMA 1X8KA 4XYBA 4C06A 1P5ZB 3FPEA 4F72A 5JADA 4ZEWA 2SKEA 2Q6LA 3QIAA 2NVUA 4XI9A 1OFTA 4OAQA 1X7WA 4BV8A 4Q4AB 4I2VA 3ZVMA 3I0ZA 3UG6A 3B2QA 3O9ZA 4Z7QB 2AG0A 5F98A 1BN7A 1NMEA 2NLOA 2RB5A 1ZD8A 1V3VA 5FOQA 3CRQA 1TLFA 4DIDA 1OMOA 3OO1A 4KNYA 3GJ0A 2BT4A 2HK9A 5DI9A 1ZUHA 3PUXA 4Y9TA 4LBVA 3M6VA 3ROQA 1MH1A 1S01A 2B34A 1T0PA 3VSCA 3GRUA 2QTBA 5EIWA 2QN7A 1HURA 5ALSA 4BOYA 1GZHB 4F4HA 4U2EA 3OJCA 1T5LA 2I2DA 2PKYX 2EBUA 3TKLA 2UYOA 2DLNA 3T52A 4CN9A 5IDWA 2I66A 2XQVA 5JATA 4XSHA 4O3FA 3H6GA 5DSXA 1FDSA 1U2QA 2QLTA 4X66B 4D9FA 1JDBC 1YZUA 4HAIA 3OZBA 1SBHA 5EG5A 5JMOA 1DC8A 2NQTA 3OLWA 2PV0A 2X3YA 2H17A 5A3VA 3N8IA 2BGMA 1E59A 1K4KA 4RHXA 3ISVA 4M1ZA 3TB4A 4EIWA 1IIRA 4B1FA 3AKEA 4QQRA 1CUWA 2YN0A 5BQPA 3WDLA 1SEVA 4F2GA 1ICIA 2AZXA 1BSVA 1DVRA 1GCOA 5AJXA 1LBSA 2BHRA 2G82A 1SQSA 4GR9A 4KDCA 1Z0UA 1AKUA 4RANA 1T43A 1OC2A 5IVHA 3Q98A 1T35A 4ARIA 4BRZA 2AIRA 3L4BA 4F7DA 2R6DA 1GZ4A 1M8PA 1P1BA 3YASA 3P32A 4JSTA 4CNQA 1RQLA 2O6LA 5CM2Z 5FOVA 1C2TA 1POWA 3KS9A 1SU7A 1P75A 3AY0A 1XHEA 3EZ2A 1GVNB 4R3WA 5DGCA 3R0XA 4LKOA 4DWJA 5JRDS 2ZPAA 1N2XA 1P1CA 1VKNA 2O7NA 2GHRA 2WTEA 1B93A 4KX3A 4S0ZA 3ZTWA 4KXUA 4AUKA 4BNXA 4XSGA 4CIDA 4EUNA 5K99A 3HCCA 4UW9A 4F38A 4EB6A 1KPGA 1CJCA 1F1BA 4BIIA 1J6UA 1ZJ4A 3A28A 3WRYC 1FUKA 1U2GC 1PT9A 3OTGA 4FR2A 4J94A 1QLHA 1ZC3A 4NOLA 1ZOSA 3ORSA 4NI5A 4GZLA 1VPTA 5DGHA 3CGWA 3HB7A 1XD2A 2ACWA 2ZS8A 3NU1A 4Y67A 4RTQA 1EWRA 2B7CA 1Y3CE 4YA6A 5HKKA 3GLFB 2BSXA 2ZRBA 3AW8A 5BQOA 2JCSA 3CCBA 3AXTA 4ZDIA 4MPPA 5FXMA 2YHBA 1UANA 1U3TA 2ILVA 1NLZA 4I6JA 3A3YA 4TRMA 1OW3B 2JGAA 1ULZA 4LHZA 4N0QA 4TLBA 4GPIB 4EF5A 3I76A 5LNK6 3E27A 5A3QA 1CUEA 4XZ3A 2QUHA 1U9JA 4PC3A 2EGHA 1BA3A 1C1XA 1C3EA 1FFYA 4WOPA 1LSSA 4JZKA 4PN3A 2AB0A 1SPXA 1Z7BA 4CDRA 4HWKA 2BGTA 2JJ2A 3G2PA 2QSZA 3QVVA 4V2UA 5HGJA 2PGLA 2XCRB 1SIUA 2ZWPA 1GPJA 3C5VA 4KVZA 1CY7A 2HF9A 2Y1KA 4JR2A 3V7YA 1Y7HA 1VG8A 2TMKA 1Q17A 5HHTA 1QLJA 4WERA 3DMNA 5J2UA 2IU6A 1GZVA 3WL4A 2JFUA 4YDSA 4M9ZA 2IUEA 4DR3B 2O9JA 4OEHA 2QKYA 7MHTA 1LVUA 3C4VA 4LHVA 3ZCQA 3VZDA 3RR2A 2O54A 3GGPA 4HNSA 2GZSA 3VR3D 1XTJA 2JBHA 4ECAA 4V0LA 2IF0A 4E70A 5F9HA 1XAIA 1CUBA 2CHFA 1GPNA 2JDIA 3MMPA 3AF3A 3EF3A 3GVPA 2HWYA 2VOEA 3AJDA 4FGJA 5J63A 3NOOA 1DG3A 4NJEA 1NSTA 4JMLA 1M73E 4P36A 3K9BA 5F23A 1FTYA 2AC2A 3JVEA 3NBKA 5E1BA 4DLKA 2FPRA 3L7NA 4P80A 3OCVA 1O54A 3LRTA 1KFCB 4IJVA 1VL2A 1G5TA 2COKA 3AHFA 4CKWA 1XVVA 4GX1A 4BC0A 4BO5A 3RU2A 2B92A 5C7IO 3K6SB 3DOUA 1ZW1A 1L8LA 1XIVA 2NSLA 4PR3A 4HLNA 1ETUA 1N8NA 1UBNA 4G1EB 5DFAA 4F46A 4EKNB 4H2DA 2JJQA 5BWBA 4XAQA 3VISA 3B1JA 2IYWA 2C5FA 4HBZA 5TSDA 2Q4BA 2WINI 4HS9A 1CE8A 1MD9A 2W90A 3VPSA 3PPVA 4J3NA 1FXUA 1W6UA 2OO5C 3UK6A 3F3SA 3NCHA 1Y3HA 4L9WA 5KSYA 4AECA 1T6YA 1Z82A 2O48X 3P96A 2JLXA 4A5OA 2C29D 2R25B 4A0GA 4M1MA 4D81A 1UDRA 4YPFA 1BDMA 3SJCA 4TKLA 2H2FA 3D2AA 3R3SA 4GYJA 4CF4A 1XVAA 1ZXBA 3P97A 3LBYA 4IXWA 5FUYA 3TDKA 1PT8A 2RGNC 5KWSA 2DCUA 1DBRA 2YWCA 3TI7A 1KS2A 2Q3FA 4R41A 3THYA 4MQEA 2QGFA 3IT0A 4BYMA 2OFXA 2PS0A 4OI2A 3WWYA 2HLPA 1B14A 1WJGA 3P94A 3DM5A 3ZJ4A 2C5EA 6Q21A 2ZQZA 1LLDA 1R4ZA 2R7KA 4EO9A 3OPYA 2SKDA 1DEAA 1XAJA 1JLSA 1XK7A 2BGRA 3L0ZA 4KXQA 3TEFA 3UIEA 4B6EA 1CR6A 2WZBA 3D2CA 3TRDA 2YIVX 1O0BA 3VNQA 1M2VB 2RCYA 1TLTA 4OMCA 1UXOA 4YRLA 5FA6A 4Y0AA 2QV0A 4YMTA 5FDFA 3D6TB 5EMLA 3PC2A 4D0RA 1FLDA 4UD6A 4TYNA 2JVKA 3F73A 1H8ED 2ODBA 1USWA 3KQMA 4MO9A 4HC4A 3PFCA 4M3NA 3LO8A 5SICE 4M9QA 5IM5A 4GWGA 3QLUC 2R8EA 4GKVA 4JCOA 2C2GA 4KQCA 1FS4A 1NQVA 3QBJA 1PAUA 4C4AA 3IR5A 4ZCSA 2K2QB 1Q7TA 1GM5A 4CTJA 1IN1A 1V2HE 2AZMA 3ZCSA 1QH8B 1W88B 4E5UA 3LFUA 4G5FA 2IE0A 1BVHA 5HG0A 5I9IA 5EERA 2GCGA 4D3FA 3PEEA 2A1TR 1G66A 1QHSA 2EQ5A 4JCCA 4OXKA 4K6MA 4LFCB 4UTZA 3BMCB 4UMFA 1CUHA 1QYWA 3B1XA 5T4FA 4BWGA 3R3YA 3H05A 1YS2X 1XJQA 2FQWA 4ZAYA 3L46A 2QUJA 3SQNA 4NHEA 1TAHA 3I53A 1D09A 4E5PA 1D2CA 1UMCB 2ZAIA 3B1ZA 1JWAB 4Z0TA 2M6SA 2MYPA 2YYAA 3CLSD 1IVNA 3BCSA 2C07A 3DE0X 3S1SA 4IG4A 5I7OA 2ZYUX 5I7AA 4BFTA 5JCOC 3W05A 2AHRA 2YXBA 3FGNA 3V34A 1Z0DA 2GH1A 3IHKA 4GP9A 4W9MC 4CMEA 4RWZA 3PXDA 4QOSA 4MXDA 4GQIA 3TSOA 3A3NA 1XTRA 3AEZA 5H68A 3ZE0B 4DL9A 2I67A 4EABA 4I9NA 1EVJA 4RA9A 3E03A 3VFDA 4KHPB 2YQ4A 3NH9A 1CUZA 1GLVA 5EMKA 3FVVA 2NYVA 3NWPA 1LDBA 3OCZA 1E0AA 1LWOA 2EAUA 3E1GA 4D9HA 3NONA 1RYHA 1EXNA 1U9YA 3K4PA 2O14A 4W5JA 1AK9A 3L7IA 5JZBA 2QT0A 1OLUA 1RXCA 2QAIA 4BMCA 5ITZA 5ISMA 4TVBA 4NOKA 1CQJA 2BF4A 2HMYB 2ZIVB 4CV3A 5A6VA 4BVGA 4GEGA 1U5AA 5CBKA 2ZOSA 2J0UA 3EARA 3GIWA 1QVZA 3BFJA 3IVCA 3THXA 1YBMA 1NYTA 1KH1A 4FE7A 3JQ7B 2OO7A 4WADA 1XQYA 1E2PA 1SULA 4I4TA 3VAZA 1BE8A 5KB3A 3SZMA 3OZVA 3SHVA 3ZDEA 4UM9B 1M75A 4HKTA 3FW1A 1HFKA 2OVBA 3ZCVA 3TECE 1EUYA 1ULTA 2E6UX 3CPHA 1VPDA 2A30A 3M6AA 3EJ6A 2VQDA 2FN4A 2DT8A 1Z16A 4UTXA 2QG6A 3BDIA 3CJTA 3OZGA 1RAGA 1D3AA 3O4VA 1DCTA 1H6CA 1T25A 2I3BA 2Y0EA 3DKKA 3WHPA 3BCRA 1U2DC 3R3WA 2A58A 3DFUA 3DPUA 2REBA 2TS1A 4X20B 2I80A 4Y2GA 3I5UA 4XCVA 3M4YA 4JNCA 2RDMA 2RIPA 3HKCB 3I72A 4WECA 5C0OE 4CCYA 2Y92A 4LF5B 3KU1A 3AOEC 1E2JA 4FYMA 3KQUA 4HDNA 3TRFA 1FX0B 1GA1A 1AKTA 3MRTA 5WRFA 4DBVO 2WT8A 4CMIA 4E5SA 4G5SA 1FP4A 1PW5A 2Q3EA 1R8XA 1KGDA 5ABPA 5LN1A 1MOPA 2OCXA 1GQQA 1YR3A 5F78A 4BVKA 1QZTA 3R5SA 1TCUA 3E2IA 2A5GA 2NYAA 1UC4B 1U9IC 4BHTA 4MX8A 2F8LA 3W2IA 2YIMA 3EMBA 4URYR 1ADFA 2H2IA 5TDHA 1ZVMA 2WTUA 1KVUA 4XLZA 4F3YA 1IY0A 1WKBA 3FOEC 1PHRA 1IXKA 2B21A 2E0IA 5P21A 3O8CA 3GIDA 5HZGA 5FBZA 1Z5GA 1E9VA 2AOTB 4AVYA 4ON9A 3T9CA 1CDOA 1JKIA 1IJFA 2ZVDA 3Q0TA 5EJ8A 3AGPA 2WYWA 3C1OA 2ZAMA 3PQDA 4R7ZA 5EC8A 4ZARA 3K0AA 1CRPA 2C2OA 2O4CA 3OMLA 4GYYA 2MT9A 3D3KA 3M6LA 5ADVA 4JB2A 3DHWC 4YCMA 5JI3E 1FNSA 3FFTA 1OTHA 1QTRA 2FWIA 4JA2A 3SVZA 3V80A 3OP1A 1CDZA 4NMMA 1X6VA 3SHWA 4RABA 4FD3A 2AJBA 3Q7RA 4HGRA 3NHYA 3PQCA 4RZIA 1T2DA 4IHJB 1J33A 4QG3A 1RR6A 2P8JA 2F4NA 5CH5A 5I7FA 3RROA 2VTBB 4PTYA 5JV5A 4QICA 1T3SA 3LA8A 3UUFA 4HQRA 2HY7A 2AWNA 1CQIA 3IA2A 5B6JA 4WN9B 1DQRA 1L8OA 3ZH9B 1XQ1A 3RIMA 1RAAA 3RVPA 2PS9A 4WNYA 3TSZA 1SXQA 3IIMA 2WWXA 3VOBA 5JPCA 3GI1A 5AQ1A 2YUIA 4R98A 2PMWB 1QH1B 1E7MA 3CHYA 2Q21A 3U9SA 2I2WA 4ACAA 2PIDA 1P17A 2CKMA 5EWMA 4E09A 1EFDN 5J47A 2YFKA 2P11A 3I2FA 3O8OB 2AKEA 3GEIA 2GS9A 1UJCA 4FMCB 1NY5A 5HJ2A 1ZWKA 2IFTA 2XJ9A 3N59A 5HSGA 1V4NA 4H3KB 5AJYA 3TLAA 1US8A 2DY1A 4JP2A 3RYCB 4FX5A 4LK2A 1V3QE 2RHHA 1PWZA 2OLKA 4FSXA 4FW8A 2IOFK 3L6EA 4S1NA 4JT4A 5GV8A 4ZYLA 3WC4A 5AP9A 2EXXA 3VYWA 4PCLA 1I7QB 3AH8A 1HRKA 1SUFA 1II9A 2CLDX 1LBTA 4Q1CA 1ZFNA 2UUOA 1KSGA 4ERNA 2E4AA 2HYDA 4AJ2A 4DMLA 5ITSA 2OZLB 3V33A 2IHUA 4XVUA 1GU7A 2K87A 3GJYA 3W6PA 5AVJA 2YCLA 2FPLA 3GJTA 3S40A 4HTFB 4ZFNA 2O8DB 4XCXA 5AKHA 2IKQA 2FEPA 2R6HA 4J0IA 3SKVA 2ZTMA 1KVTA 3IDFA 3VKGA 1KYWA 3T7CA 1KEEB 1N1DA 5FORA 4HNHA 1KZ7B 4WZBA 4Y8VA 3Q6IA 4ZOAA 1SAYA 1K7FB 1QM5A 4RD0A 4JENA 1RLMA 4TTVA 2ZZKA 3ZEIA 3VVCA 4I3GA 1LEHA 3CH4B 4YRMA 3EC2A 3T6KA 3DBIA 1APBA 1RBMA 4N3CA 3ZJTA 1ZO8A 2HF7A 2HJSA 2C9CA 3C6ZA 3GJ5A 1QHEA 4HCJA 5KTTA 1IVSA 3NKFA 5A0VA 1N1MA 2C4TA 1UXHA 3WZMA 2XTAA 5LNK1 5G0SA 2H9AA 2G8NA 2J4CA 3O4FA 1EGVB 1RLJA 2ZBRA 3PXUA 1E3WA 4M1EA 5FBKA 5LP6F 4ZYXA 3WIEA 3IJPA 4EAQA 3ZWCA 1T9GR 2P6MA 2PZLA 1CULC 1HMPA 3F6BX 3FHLA 4AJKA 3RIGA 3PUVA 3NYWA 5EXSA 1RQRA 3SQOA 4ZGGA 3FFXA 3TR5A 1WD7A 1SC1A 2I2XB 3G3EA 2VF5X 1VG1A 3HHEA 3KQTA 4LJKA 3RBXA 3MGKA 2VSOA 3TEMA 4RHUA 3FYTA 3U7RA 3T5PA 3MWKA 4JJ7A 1F60A 3Q85A 3MGBA 4NL4H 4TV8A 3DGFC 1NBMA 1PQ4A 3BB3A 2OGSA 1GKKA 1QIDA 3AUKA 4DNQA 3T94A 4P4GA 3DL4A 5J2UF 2HU2A 2V03A 3ZGZA 4MRSA 4ZOBA 4ZJUA 3QJYA 2W2NA 5GM1A 5LQMA 4TTTS 1O94A 1CV2A 2D00A 5BN4B 2WEKA 3IQEA 4LCJA 4PYRA 3N8KA 1MVNA 4I1IA 4GSLA 2EYUA 2IYVA 1QF7A 3GMSA 4R54A 1ECJA 4KVGA 3I39X 1ZMOA 1RRFA 4CKCA 2RB4A 5DI3A 2OGZA 1F8FA 4WCFA 5F3DA 1EXVA 1PR9A 3NAQA 4GUAA 2HA7A 1GCUA 1JL3A 1YRQA 3IAM6 1HT0A 5EN4A 2P90A 5FUVA 3AKZA 2E4ZA 1D4ZA 2QTZA 2M6KA 3P2IA 4F84A 4CMGA 1HZJA 2Y0PA 2LKDA 4L95C 4LF9B 3HUEA 2W6MA 5HZMA 4GNKA 4LZAA 3M4ZA 1GQSA 4I1OA 2V7XA 4EDHA 4YDQA 5EMJA 2H85A 2IPMA 4JIGA 4CG3A 4JEMA 3FTNA 1E5DA 1SVIA 2Q6VA 2QVCA 3TRKA 2JJ8A 3DZDA 3IQIX 1GO2A 5SV2A 1HDGO 2HPHA 2WKSA 3IUEA 3EFOA 3PF8A 5BQ5A 4A26A 1WUYA 2BKAA 3BIOA 4ALIA 1NRXA 3EISA 4DQDA 3II6X 5JJKA 1YJBA 2WM2A 3ZVKA 3ELBA 2MSEB 5CXSA 3CX4A 2FSGA 3RCBA 4EEKA 3EZ6A 5AIBA 4J0JA 1I36A 1X3SA 2UVPA 3CZ4A 3UV7A 3FDZA 4B6PA 2BBSA 3I64A 2TSYB 1P29A 3V00A 4CV0A 1OH8A 2CHVA 1D6MA 3AETA 5G40A 5E6SB 5LZ5A 1DAOA 1JHYA 2VP6A 3A3PA 4K6OA 1X9IA 4C89A 1QOQB 3WA7A 1A9QA 1PF7E 1W4AA 1XDBA 3CRMA 3PXGA 4Y1RB 2PVSA 4RQUA 1QIMA 3NOQA 4GPZA 3UA4A 1TMOA 2RJOA 4YH1A 2HSWA 4CKBB 2PUJA 5JBQA 1XLWA 5H3LA 2I6SA 4S35A 1PJ8A 2BM8A 4DG9A 3HACA 3AC0A 3V6MA 2ID9A 1X92A 2W58A 3D3WB 4B6GA 5JDIC 1JLLA 3F71A 2VBGA 1PR6A 1VHJA 3NORA 4IWYA 1DDOA 5I4CA 5LP1A 3X44A 3S81A 4K9KA 5TT1A 1OE0A 1X70A 3GG9A 3AVPA 2CBZA 3QLVC 4PZ9A 3E5HA 2V58A 1KH3A 1QMGA 2P9FA 3T7DA 2I5PO 4Z2AA 1M1NB 2JFYA 2DM6A 5JS7A 1ZR2A 1AXRA 2REOA 1KC1A 5J23A 4HH1A 4WXYB 4K9SA 1DI0A 3PNVA 1NVVR 2B94A 2Z4RA 4GZ5A 5E0KB 1SBCA 2OV3A 1IQRA 4RV9A 3IR6A 1S5PA 2ZBGA 5DCUA 4DCNA 4BO4A 4DSOA 4WNAB 2MCFA 3ZYCA 4EI8A 1W5AA 2BFPA 3GJ7A 4BNDB 1AKRA 3LUCA 5JW6A 4YAIA 1QPZA 1SG9A 1B0UA 5EXPA 2VCYA 3FI9A 3VMMA 3S5JA 2GEDA 3NEPX 1MXFA 5L40A 2GESA 5EZ6B 3HLTA 2E5LB 2FDCA 2J3LA 2X4LA 2UZ1A 3M4XA 3DBVO 3MWEA 2VSFA 4GWLA 4PZPA 3KOUA 4XIJA 1WPGA 4BDSA 3ENNA 5JXIA 4R9NA 3ENKA 1KYTA 2Z1MA 3DE7X 3LHSA 3HB4X 3KJGA 1UH5A 3NDJA 5GGXA 4YMGA 5C1DA 3SHOA 3WL5A 3HM2A 1Y5MA 3PL1A 1QTNA 4ZO8A 5IC6A 5C31A 1CY1A 4UU1A 1KQGA 3L8YA 4AROA 2PKEA 3G2LA 1DRJA 4N8EA 1SHKA 3ADDA 2B4QA 4XGIA 2HU7A 3ER8A 1KO4A 4EUHA 2BHLA 4W8GA 4E5DA 3ANYB 1OXSC 3KDSE 3M0EA 3SSNA 5I01A 1CP3A 1ENZA 2RK6A 4Z3OA 4EL0A 5BV1A 3MTJA 4FU0A 3ADCA 1ODSA 2WT9A 1RQXA 4KQMA 2Y0CA 3C15C 3KB2A 4JBNA 3I9LA 3GEBA 3D0QA 2B5OA 3B7PA 3G68A 3F78A 3NBZC 3F47A 2I87A 1ZJYA 3LT1A 2GNPA 3Q7TA 3TS1A 2I4TA 3WZLA 1PUIA 2O7QA 2XMDA 3H04A 4YPOA 1GZUA 1BU5A 2JGKA 2QL5A 3MPUA 4GI5A 2VQ6A 2Z8ZA 1GPDG 4WIAA 5AT1A 1T26A 1N7JA 5HS6A 3OEHD 3WGKA 3KWLA 4RTRA 1GPKA 3ZY5A 2G7ZA 1QWOA 2IXEA 4YJ2B 1LU9A 2ZJ1A 3M5DA 2VG8A 2WVHA 4JI6B 5M34A 1SCAA 3K5WA 1NUQA 1PL7A 4LHEA 1ZD4A 2D1RA 1OGYA 2WSLA 3AEYA 4IF4A 1EGQA 1NGSA 5FWYB 1PEAA 1XZIA 2EBFX 2YNMD 3AU9A 3IBFA 2L42A 2P67A 2A92A 2GNAA 3NT5A 5JSUA 2O2GA 3CVUA 1T5SA 1M6VB 2PD4A 2J08A 3CF4A 2A5JA 5F4BA 4OYYA 4L6IA 4AKIA 3GEMA 1ISFA 2AFIB 1BWQA 4FONA 4I4TF 3GQVA 4IIJB 1I10A 1YHYA 1PJLA 1FZTA 1DUVG 3LW7A 4DANA 1YA4A 2BZ1A 2W4MA 2I99A 1FTNA 5TMEA 1XRRA 3DG9A 5JSZA 3AP2A 5GV7A 3JWPA 2YMQA 1II8A 2DY0A 2HDWA 3VRHA 4V2IA 3PXEA 5BN3B 1N1EA 1I8TA 1TUIA 4I4CA 5ADWA 1LNZA 4QOFA 3RVOA 1O95D 1UFVA 2GRJA 2HTEA 4PAQA 5EQTA 4GKKB 4DA8A 2XWSA 1XEXA 2UUPA 3HN6A 4DV6B 2VDWB 4XM1A 4PFJA 3AMVA 3PTZA 4GLLA 4PYKA 4HWGA 4NBWA 4H7FA 3TI9A 1TU3A 4GKBA 5DM4A 1OVGA 2IHTA 4L4YA 3HMKA 2XMBA 4JJKA 3OU6A 4ALLA 2AW5A 2IW3A 1HSZA 2PY6A 1NI4A 3GQBA 1S4MA 5BMOA 1USGA 1CF2O 4EI7A 4FB4A 4R2XA 3JVVA 2LBPA 4GM4A 5FCDA 1HNZB 1FS5A 3KK0A 5D5PA 2YWXA 4TM7A 3IPAA 1A4IA 3RTAA 3AOGA 3PU6A 5A1TA 1XEWX 5BY2A 1W30A 1GGHA 4E88A 3JPWA 2Y66A 2GT1A 4X41A 4BEVA 3RG2A 1E9SA 4BS9A 2RHRA 4YCAA 2P79A 4G3XA 4RVOA 3VNRA 4AJIA 2KBFA 3AKYA 2JI7A 1Z5VA 1T8SA 4KCGA 5IKOA 4D3SA 4CL2A 3K0EA 4PBTA 4B3RB 1E7YA 2G8LA 2IA5A 3HL0A 3HWSA 1EVLA 1MIOB 1PJBA 1Q6YA 1U1FA 4LRTB 3D7LA 1KA9H 4ZVLA 2WE7A 1N57A 2J41A 4MCAA 1QF9A 4MUYA 1HMYA 4IFEA 4HATA 3ZDZB 5FH9A 1BW9A 1G18A 3LDFA 4KBFA 1M1YB 1YS6A 4LJRA 4YV7A 2JLAA 4JT2A 1Y8QA 1PFVA 1NM5C 3JWIA 4MW0A 1WW3A 3L8CA 5E9QA 3DOEA 1GOTA 4GI3A 2CJYA 3C3DA 3AVOA 1Q0HA 4JLOA 2UYGA 1HETA 5KNCD 1SBZA 3I2YX 3KL2A 3LCVB 1XYYA 1FRQA 2C98A 1XPUA 1O97D 1ZK4A 2AFHA 3CRNA 2A59A 4B40A 4D9CA 3C3EA 5L7YA 2J7KA 3B70A 3COPA 2A35A 1CTQA 2VUUA 2XADA 3L77A 4Y2RA 1ZRHA 2XTMA 3G7NA 2PMKA 2A0KA 3B7WA 3HU5A 3P9XA 3D6JA 3A2LA 3DBRB 5AI5A 3EVDA 5K3AA 3KBOA 3U7IA 1D4FA 1UKYA 1PTJC 5CAEA 3LHKA 3K15A 4L4UA 4MS3A 1IUOA 4UVHA 4DLTA 5J58A 3QYAA 3WL6A 4WX2B 1DL5A 1V7ZA 1NMYA 2EJCA 5CXXA 5IT9A 2F4VB 4QBTA 2ISCA 4JGIA 3I61A 1SUSA 4HBGA 3PR3A 4RQTA 4RPJA 2X8WA 1SZCA 2CYBA 4JK3A 1SOAA 4BCCA 4B5KA 3R9XA 1O4WA 3EZFA 3BICA 1LPPA 5GY7A 2QWXA 5E7JA 1Y8ZA 1J1ZA 3V4SA 4INZA 3I1FA 2ZYGA 3WGOA 3EY4A 1FSSA 4BNUA 5AICA 4E4TA 5JSQA 3O8LA 4Q7EA 3A70A 1Z8DA 5AD1A 5K9ZA 2BFDB 5THKA 1DAKA 5BPHA 5CBPA 2Z1NA 4DA6A 4RX1A 2I54A 3GYGA 2AI2A 5FJJA 1HL3A 2C61A 2GUWA 3PRKE 4MR7A 3O5AA 1GRVA 1IAVA 3ELDA 3H17A 1CNMA 1DXYA 4ZQFA 3RF6A 2IY9A 4QJIA 4NYJR 4G5XA 3MJSA 5FR2A 2O52A 1FRNA 5C5CA 1VP3A 4WZZA 1IATA 1YB6A 3DC2A 1EUQA 4XARA 1ZUNA 3K2BA 2X5XA 2GEVA 3ZHOA 2Q5FA 1JDTA 2HO5A 5HIIA 4EPYA 5CNIA 1ZPDA 3QVGA 1BN6A 3L7KA 1LNQA 3BK1A 2YHIB 3TIVA 1GNQA 4KE8A 3GT0A 5F3RA 1MBZA 4KU4A 3HP7A 4FGWA 4UJ3A 1YQWA 2BCGY 5BT9A 4OX9B 3KM0A 5K2MA 3SK0A 3HWRA 3FSRA 1ZIXA 2J9FB 3TNDA 3AP3A 3JARB 3S2GA 3H11A 4YRDA 3W6NA 2MSKA 2WK1A 4JJGA 3K0CA 4DHEA 3R4CA 4P0QB 3HJCA 2FV8A 3I9NA 1MFZA 3QBTA 3OFKA 3WYDA 1NIPA 1F17A 3DMHA 4GXQA 3QXHA 3CNLA 2CDRA 1JP7A 4IW3B 1F0KA 1U0RA 3IODA 3MWDB 2NAFA 4HGZA 4OH1A 4TWIA 5G53C 4GF5A 1S8NA 4MWTA 4F60A 1JQLB 1YZGA 1T0IA 1JR3A 1XVTA 1M2OA 2B2XA 2FLWA 2V7WA 3LXMA 3MUOA 4IXTA 4RV4A 5HEKA 3VPAA 2RI0A 1DKPA 5K8TA 3VKUA