3CNQS

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
CVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3cnqS00
1GT91 1SUAA 3QTLA 2XRMA 3VV3A 3UNXA 1CNMA 2WWTA 4NE9A 1T1GA 3BX1A 2DP4E 3DVSX 3VTAA 1AV7A 1GTL1 1AVTA 1SBCA 1ZVJA 1SIBE 4KPGA 2SICE 2ID4A 2Z30A 5FAXA 1TK2A 3DE5X 1GA1A 5ARDA 1XF1A 3GT4A 1KE2A 4DZTA 2ZRQA 3LPDA 1UBNA 4B5LA 4CFYA 2W2QA 3OSZA 2PKCA 1R6VA 1TM5E 4HX2A 1EGQA 1WMDA 2IY9A 1KDYA 3WQBA 3Q5GA 4CFZA 1P7VA 1GA4A 4H6VA 1LW6E 3F7OA 1SELA 1SCNE 3GT3A 3A3OA 3LPAA 1SBTA 1P7WA 2W2OA 2ZWOA 1Y33E 5K7SA 2ZWPA 2X8JB 1V5IA 3GCXA 1OT5A 5FFNA 1Y1KE 5I9SA 1MEEA 1CSEE 4MZDA 1TO1E 3D9QX 4C3UA 3WIUA 5AVJA 2ID8A 3BPSA 5SICE 4AKTA 4ZOQI 2Z2YA 4KB5A 4J94A 3DWEX 1AF4A 3DE0X 3DW1X 1SCJA 1C9MA 1SBIA 3F7MA 1SIUA 2WUVA 3F49S 1DUIA 5AVKA 1THMA 5JXHA 1T1IA 1P8JA 1HT3A 1Y3BE 3HJRA 1ZVKA 3Q40A 2W2MA 2WV7A 1GCIA 3WIVA 4BWGA 1Y3CE 1GTG1 4KG7A 1SUEA 4H6XA 1YJBA 2GKOA 2ST1A 1TM1E 2PRKA 1Q5PA 1TM4E 3L1KA 3T41A 5CW1A 2QTWB 2DQKA 3DE4X 3DVRX 4OMCA 4AKSA 3QMPA 5JMOA 2XTJA 1NDQA 3DE2X 3CNQS 4NE7A 1AQNA 1S01A 1R0RE 1KE1A 2E1PA 1S02A 3QFHA 1TM3E 3PRKE 2W2NA 3VSBA 4HVLA 1SPBS 1TM7E 1KDVA 1ST2A 2G4VA 1PEKE 2PWAA 3DVQX 3I2YX 5AMXA 5JXGA 1GNSA 4C3VA 4CG0A 1Y34E 2Z58A 1JEAA 1T1EA 1PJ8A 1Y4AE 3VV2A 3DE6X 2V8BA 3DYBA 1SVNA 3DE1X 3EDYA 1TMGE 3LXUX 2HD4A 4GI3A 2SBTA 3I34X 4K8RB 3SICE 1WMEA 4ZARA 1SIOA 2PMWB 1BE8A 4OV6B 1MPTA 5AQEA 5ARCA 5FBZA 4H6WA 1KDZA 2P4EA 4Z2AA 1NLUA 3P5BA 2W2PA 2X8JA 2WUWE 1A2QA 1Y3FE 3A3PA 1OYVA 1C3LA 1SUDA 2IXTA 4JP8A 1WSDA 3VHQA 3TECE 1BE6A 5B1DA 1AH2A 4YN3A 1ST3A 3ZXYA 3AJ8A 2SECE 1DBIA 4OMDA 2PWBA 4I0WB 3I37X 1SN7A 4WOCA 4FONA 1GNVA 1GTJ1 3PTLA 3ZXXA 5B1EA 1YJAA 3CO0S 3TI7A 3BGOS 1C9JA 1SCDA 3I30X 1SCAA 1IAVA 1S2NA 1BH6A 2Z2XA 2Z2ZA 4NMXB 1BFUA 1SUPA 3H42B 1BFKA 2HPZA 2SNIE 3DW3X 3A3NA 4DWWA 3GCWA 1OYOA 1YU6A 1PTKA 3VYVA 4RYDA 1YJCA 2Z56A 5JXIA 1Y3DE 1IC6A 3DDZX 3DE7X 3EE6A 1PFGA 2DUJA 4LVOA 2Z57A 3AJ9A 4DJ5X 1SUCA 1WMFA 1C9NA 3EIFA 1R64A 1AK9A 4LVNA 1SBHA 3SQOA 2TECE 1TO2E 1GA6A 1Y9ZA 4WOBA 3TI9A 5ARBA 1V6CA 1Y48E 1WVMA 4M1ZA 1SBNE 1SUBA 1Y4DE 2PQ2A 1NDUA 1VSBA 3D43A 1BJRE 2B6NA 3DE3X 3WHIA 5JXJA 1TECE 3AFGA 1SH7A 1EA7A 2PYZA 3LPCA 1AU9A 1SCBA
chains in the Genus database with same CATH superfamily
2BGIA 4OBEA 3NAZA 5HRUA 4GM0A 1D0IA 2DWPA 4G85A 4LHWA 3FFAA 4RIIA 5BSGA 5AUQA 5I8WA 1VIVA 3IDQA 3TRIA 1JFLA 3ZH9B 4FYYA 3F8WA 2W2TA 3CF4G 2GF9A 1QH1B 3ETEA 2VWQA 2PRJA 3GEBA 1E1MA 3BWVA 4HFJA 5COBA 3UATA 2GA8A 3STYA 1GKUB 3DF7A 3NCTA 1VE7A 2BF7A 4U39A 4PYLA 1CUZA 2WI8A 4R84A 1EGQA 4PS0A 2YZMA 3ANXA 1F51E 2OWDA 4JI3B 1V8PA 4CVNA 1XJ5A 3P9RA 4H59A 2XGSA 3BVPA 4OHVA 4BKPA 1ZD9A 5SY9A 2GJ9A 4K88A 1SIWA 2CD7A 5REQB 2NU6B 1CUBA 3PXEA 5K2OA 3GH3A 2PMBA 3LHKA 4MKZA 5BSHA 4OBBA 4ACBA 4BFWA 3G0BA 2OBLA 1L7QA 1PR2A 1QZ3A 2HMYB 3HCOA 2QRVA 3R3WA 4R2KA 5KYUB 4DIOA 3IPLA 1EQAA 1VCIA 4XIFA 4HEJA 3OJWA 4D8VA 5L51A 4AY3A 2GKGA 3EH1A 3LC7O 4R4JA 1M7BA 1OLSA 1JDPA 4NG4A 4Q01A 3C3PA 5D86A 2GZ3A 2BL4A 1N33B 4AICA 4D3FA 4IRUB 5FLXA 5E2IA 1W35A 4B4OA 3HBMA 4IDGA 3TWOA 3T7AA 4XQGA 1GL3A 4WZAB 4G36A 5ALDA 1ABFA 1I6WA 3JZDA 1IL0A 1XRPA 4KIFA 2CK3A 4DS3A 2OTCA 2ZRHA 1P7CA 3KJQA 4H7IA 1NW8A 2EIXA 2GNPA 2BE9A 1G2IA 1OBFO 4Q1FA 1WNFA 3TDMA 4TZ6A 3OWXA 5CB8A 1ZMRA 5LYJB 2H6EA 1LRLA 2OCPA 2XWBF 1TCBA 3EXAA 4BZQA 2AG0A 3G3EA 3NTOA 3CRW1 4JBLA 5DM0A 4N7BA 3OM8A 1I4DD 1JQBA 1MRZA 1QQTA 4HG2A 3PFWO 4I8XA 2PX0A 2XTZA 3RV4A 4G81A 2ONJA 3HBAA 1JTEA 4AJ4A 4WK6A 3LCRA 2VJKA 3I5UA 3I92A 5DYGA 2ZRMA 5H1YA 1TK3A 5JU6A 2VUTA 4FD3A 5AK0A 5D7NA 2JLBA 4KDCA 4R1SA 1UMBB 5FI3A 3GPDG 1DPGA 4TRJA 2ODEA 3RBVA 4QKQA 1CT9A 1KAEA 1Q6YA 2XCLA 1RRMA 1VXRA 1KAGA 3GBSA 3P0EA 2OYRA 4INJA 4PSCA 1NM5A 3ZS9A 1ZIPA 2ZU6A 4MEAA 5TPZA 4LYHA 4HDKA 2EW1A 5DZSA 4P3YA 3DUFA 3WK7A 1Z8FA 1UC9A 3WKAA 2AQIA 3ZQKA 1DKUA 2RARA 3F5QA 3L6EA 4JMPA 2WTUA 2FTKE 4B80A 4S1OA 5A0FA 6AT1A 2IYRA 3H05A 1EGHA 3C5VA 1AUQA 4RMGA 5JAHA 2XD4A 1NX9A 2IY7A 4B4UA 2YHUA 2ZS9A 4J3JA 3G8CA 4EP1A 2WWIA 3QFCA 3EXHC 4LY3A 4NPAA 2GILA 3L0IB 1H05A 3M9LA 2Z2IA 1OYWA 3H2BA 3ICOA 4H17A 5U4XA 3TCXB 4B2YA 1BU8A 4OM7A 1ECPA 2BCEA 1XLTC 2DQYA 5BW6B 2FJUA 2WEKA 2WJAA 1U0SY 3EISA 4NYJQ 1UMCA 1P9OA 4PC3A 2WWWA 1AH2A 3NTQA 3PJEA 4BB5A 2VQFB 2JIQA 4JC4A 4FGZA 2ZAIA 3LT1A 4AMGA 4NPHA 1OKKA 3AVPA 1IN1A 3BHMA 3N70A 5KX5F 1BU5A 3F3YA 2OHHA 2V74B 5E8JA 1XSEA 4JBWA 3U4CA 3OECA 1Z6GA 2HPVA 2FP4B 5JYBA 3DEYX 5ETJA 1KFJB 2VCYA 4YCDA 1E2QA 2A9OA 2FFAA 4N3GA 3T3MB 3VYTB 3ZBPA 4BLRA 1NVKA 1XRRA 4GDMA 4QGFA 1V0JA 2VPWA 2YJGA 3LBYA 3KCNA 4WPGA 5DB4A 4NZ9A 2PT7A 4QM7A 5FBLB 3PDJA 3PFIA 3L0PA 2ZIZA 2X8AA 3H9JA 3ROXA 2X9GA 3D59A 1EDEA 1G59A 1SU6A 3EFHA 1Y6JA 3K5IA 4G5HA 3RG2A 1X87A 2EHDA 3HCFA 5F2OA 3A05A 3HU2A 4IICA 3FVWA 1YUNA 4WZZA 5IBCA 1E96A 3F4BA 3NW9A 5TQVA 4EBBA 4Z3KA 2YWCA 4XSVA 2XMCA 2YV1A 2XXAA 4ID3A 2XUKA 1NW9B 4XGNA 1THMA 1IZYA 1G55A 3AVTA 1DMSA 1H2WA 4JEHA 4GMDA 3RV3A 1NBHA 4QELA 4V1CI 1XQWA 1JDZA 1U0GA 1TKAA 1XNHA 1ZXBA 4LK3A 3Q98A 1NVUQ 4D8TA 2H1SA 3W3AH 1BS1A 4P3KA 2G4LA 2V7VA 3ZV5A 1P91A 1LV8A 3BJIC 2HA5A 4FDVA 3PVZA 4UKDA 1C4WA 4PSUA 2QN1A 3S44A 3IA7A 4WL0A 2E1PA 4I50A 1RQPA 3OQBA 1I3LA 4E5MA 4DUZB 1NBEA 1WDLA 4P53A 1HNNA 4K40A 1KNXA 1LVGA 2BLNA 3B1FA 1PEAA 1N0IA 5IDXA 5LUAA 4C7OA 2GPSA 4Y6PA 3DYBA 2XMGA 4JI7B 3UTDA 3I2GA 3MVEA 4ETNA 2O1WA 4LWQA 3W78A 2FZKA 4KREA 1WWKA 2R8PA 4Z0HO 3NBXX 1PGOA 3N74A 4S3MA 4E33A 5AW6A 1KDZA 4RCYA 4R1UA 2FEMA 1SXJB 1GPWB 2W48A 1I7QB 1C3LA 1M6HA 4LRTB 5DI3A 2JG3A 2DULA 4IJMA 4JQCA 1BE6A 3D6TB 3RK4A 5B2FA 3P9CA 3D54D 4N3NA 4LNUB 2R6JA 3U7EB 3SYLA 2J6BA 1NPTO 5HMMA 3B6EA 2VT7A 1ZWLA 1DC8A 2EJTA 3PXAA 4TKVB 2WF9A 1ZD3A 1W19A 3OUTA 1G5HA 1SCDA 4QBFA 4GGPA 4LHYA 3DZIA 4BJ1A 3LY5A 3N8DA 4UBJA 2Y3IA 2YC4C 3E35A 4B4DA 4ER5A 5K0LA 3EG9B 1IC6A 2BWJA 3ENKA 3IPAA 3MTIA 4DCVA 1RQXA 3CSSA 4EFKA 3D4BA 1YB5A 1KJNA 1SBHA 1SCIA 1DAEA 2GPBA 3PPYA 2ZI9A 3C98A 1L1RA 3IJPA 1NI5A 2XR1A 4IIUA 3RWMB 3EH2A 4N6OA 3ZGVA 4JVLA 2I71A 3UV3A 3WYAA 4V02A 1QG4A 3WBFA 2JFBA 1ICEA 2NUPA 2QTRA 4HN4B 1YA6A 5JYDA 1CP3A 3MGGA 4OTZA 1MA3A 3DXFA 4WESA 5AKHA 1KVTA 3R3HA 2PUBA 1TJ4A 1LC3A 4CM4B 5IBQA 2NXEA 4Z5XA 5CNJA 3LHIA 3GEPA 3ITNA 5KNCD 4W5TA 2HXSA 2JJMA 1T2FA 2VI5A 3S70A 5LP6B 1BHJA 3LBNA 3ZQUA 3V7NA 2ODAA 2KB0A 2ZUUA 1PR0A 3EMVA 5AJXA 4YJHB 3ZG6A 4UEJA 2YQZA 5CFLA 4JMLA 4KPUB 4KGDA 2C3UA 2J9RA 2L2QA 4R1QA 3U13A 4AIIA 3RS7A 4HK4A 1GG2A 4GSYA 2BM8A 4QARA 2R1TA 1RRVA 1UPUA 4Z7NB 1KEZA 2JB9A 1RXEA 5B7PA 1PR6A 3ZCUA 1SXHA 2ZI5A 4YP5A 1NP3A 2P5YA 3PUJA 3TE6A 5JBNA 5JRZA 3O47A 1JMKC 3LHFA 1MZVA 4MW2A 1LLDA 3DE0X 1F0KA 2G9UA 2XMZA 4QZVA 3STVA 1BKSB 1UDBA 2F1IA 2HUNA 3UXMA 1ACMA 3RAFC 3UAXA 1GKKA 2YFQA 2DCUA 2R00A 3HA3A 4QDOA 1FYXA 3LCUA 3ETHA 2YL2A 3I9JA 1Q2UA 1TF2A 2BD0A 3Q87B 4HMOA 2WD7A 2PCJA 3MF4A 3RD5A 2NAFA 2WRZA 1YFKA 3VTZA 4AJKA 1LUAA 4WHMA 1IN4A 3FCOA 1UQRA 4QA9A 2CCGA 2DHRA 4QYXA 3IIKA 1Y7PA 4K9DA 2M2IA 1SC9A 3FCYA 4QUDA 4CTJA 3IAS6 4HN2A 4JSYA 4NNPA 1AQYA 3MT7A 1KRXA 5CA0A 3O7MA 7REQB 2RAVA 2WU4A 3I2YX 2QSZA 2CWWA 1I8TA 4PLWA 1C7FA 3NAGA 1RWKA 4MV0A 1E2HA 2O2CA 3HLTA 1B4DA 1M2VA 3IDSA 4HGYA 5EZYB 3AVQA 5I9LA 3K96A 3ZE6A 4RFLA 2C20A 3EMKA 3O95A 5EVCA 4YT2A 2YJ3A 5CX1A 3TLZA 3UFBA 3PC6A 5EUCA 1DLIA 4JA2A 5EC8A 3EA5A 4MROA 5TT0A 3OZBA 3FNBA 4QO8A 1KOLA 2C92A 2PH5A 3PF9A 3QKUA 4UTRA 2DPHA 2P4HX 3OF5A 4C6HA 2H4WA 2QBYB 2LNDA 4P7KA 1I5RA 1B8NA 1IQPA 1RFLA 1U7OA 5EUMA 3ZCQA 4LSMA 4D92A 3IT3A 1KNQA 4CMGA 3WMXA 4Q19A 4UVDA 4PXSA 5AW2A 1S8FA 1WXHA 4TYWA 5FFMA 1M1YB 3AY7A 1B8UA 4XE5A 2A0XA 4MWDA 3ZHZA 5IJ0B 3AEUB 2GNOA 1PT9A 4S1PA 1ULZA 2ON6A 4C06A 1C5KA 1SM4A 1M7HA 2V4MA 2CEAA 5GMOA 1E79A 2C84A 4F86A 4UCXA 3TKAA 2OG1A 2I7VA 1A4XA 3WKCA 3SQXA 1STOA 3B48A 2X9QA 1V2GA 2AMYA 3CEMA 2L17A 3P2MA 4AN1A 4C87A 3LLVA 2JGLA 1V26A 4TUYA 2N9UA 3T0GA 3VBEA 5L9AA 4CEJB 2OE2A 1G20B 1DRVA 1GUDA 3LIPA 2OC9A 2CXXA 3MAGA 3QLVC 3MUEA 1LRJA 2WU3A 1R8JA 4HUJA 4L75A 3R9KA 5AESA 7GPBA 2A5YB 2QRJA 3N0TA 5LZ7A 1RWNA 2P40A 3TIVA 2QL7A 2ZVDA 4PYRA 3DMTA 3VH1A 1V16B 1GGEA 1T6YA 1U8TA 2EBHX 3M9WA 4GPBA 5DNEA 8AT1A 5EJ8A 3RASA 1TUBA 5HE8A 2G76A 1ZUHA 1KRHA 2AOXA 3V1UA 1V95A 3ELWA 3IEMA 2FDXA 1KP2A 1JIIA 5G1NA 3QXHA 3WQHA 3Q6NA 1FDOA 2W2KB 1JHMA 4F1KA 2Y9MB 4EMUA 3H1AA 5AICA 5ER6A 2VQ3A 1TQ4A 2IYQA 1ODKA 4MVJA 3N7TA 2NZ2A 2ADOA 2BZ0A 1R0XA 3IOEA 4E88A 2R7MA 3SOZA 5KQPA 3PHLA 3Q7EA 3UK2A 2WVJA 3C7AA 3JWPA 4K2HA 4MRMB 3B9RA 3UGTA 1Z4OA 2Q99A 3BTSA 3DEIA 4O1HA 1OFTA 1RLJA 1MD9A 1KY4A 4NY1A 4EYQA 4KMMA 4F3KA 1OU0A 1VPDA 2QS9A 3QYJA 4CNBA 4LF8B 4LV8B 5DGHA 4X66B 1VRVA 3OEED 1EB9A 4G1EB 1YQWA 4LRWA 5M34A 3ABRB 2OB2A 2ZYGA 4IX9A 5BOVA 3I01M 1Y8CA 3OZDA 4DCCA 5FTLA 2V9ZA 1DBRA 1ZY2A 3B78A 4NS4A 2P9EA 4MGZR 4RFVA 5CVVA 4LJSA 1KETA 5JJLA 4JJEA 4ZCIA 4LHXA 3LCMA 2X41A 4U02A 2XQFA 5G3ZA 4ALJA 1HT3A 1PHRA 3G9QA 3G9TA 3WG9A 1B16A 3E53A 1M66A 1Z38A 3DVAB 3U7FB 1J9ZA 4FW8A 3ZHYA 2F9FA 3JARB 3HXPA 2BFWA 2PRKA 3ND7A 5I7UA 5K0BA 5TARA 1FP2A 1Z17A 3AOGA 2VYVD 3SZMA 5JOQA 5KUTA 3KEQA 4M9RA 1YI0A 4BC0A 3S1SA 1GV0A 1M2OB 5IDYA 2QMHA 1G5QA 1R5NA 3QBEA 2PMDA 3REGA 2PG3A 3OT5A 3PTZA 4HRVA 3OQ1A 4XA8A 1EESA 3M5DA 4O8CA 3HQ4O 4RXMA 1U8YA 1LI7A 2WWGA 3WIOA 1CY2A 2JD0A 3ORRA 2PSJA 3DG9A 3MT8A 4LGMA 4N9QA 4BLVA 2R84A 5CA1F 4F11A 2B0JA 3PX2A 4U9HS 5JUWA 4HLDA 1PLKA 1TCAA 4MQ6A 4RHXA 1TAGA 4YC7A 1WTCA 3SHTA 5CDFE 4AMVA 4PLTA 1PCXA 3QUCA 3RG8A 1R15A 2ZIXB 4EFNA 3KJHA 2J3LA 2YBEA 1NNI1 2V58A 1ZCZA 4BNWA 2GK3A 4TGLA 3RIXA 3RTEA 3TSAA 4ANFA 4CLOB 4JXZA 4FCTA 2NYRA 1DV1A 2FCRA 4G8CA 5HZHA 3H17A 4K9SA 3PD0A 3GMIA 4ZZ1A 1ODJA 3A1NA 1I51A 2I4TA 2RFLA 2VOJA 3HSYA 1RKQA 3ACCA 3OBIA 2YJNA 4AQ7A 2OBXA 2UXBB 3FTPA 3GT0A 3K5HA 4I4IA 2ISCA 1NT4A 4CMBA 3R7LA 2RCYA 4DC0A 2YW9A 4FEAA 1JW9B 2H08A 5EP3A 3OF3A 1Y9AA 4GC5A 4H08A 2P7IA 3E84A 3GPIA 1OYOA 1T4CA 1I4OA 1YU6A 1MHPA 2RHOA 4X1IB 1TMKA 5BN5B 3NXKA 2ONKA 4I66A 4JENA 4OXXA 1HYBA 3I1IA 3P52A 5MGNA 2IPAB 3HDYA 4FFSA 5CCEA 2JKVA 1VCOA 2E5FA 2XMQA 2IP2A 3BCUA 4JLSA 1ES9A 1ZK2A 3P9IA 4MITA 5L7WA 1MVOA 1QZTA 4WNIA 3LY8A 2IYOA 1VE5A 4FB5A 1S4MA 2AC7A 2NVBA 4MV6A 2DXIA 1X1RA 1C0PA 4QOFA 4FM9A 4CM5A 3HYCA 4AKTA 2CLCX 4AM8A 1ZGHA 5GZ6A 3LQ1A 5HW0A 5CG1A 1IVYA 3QKIA 3CLUD 4K3VA 4KFUA 1JYSA 1E3EA 1GA1A 1QDUA 1UJ4A 3F73A 1XJCA 3V4RA 1OTHA 1PV2A 3H1BA 3WK6A 3RYCB 4EMTA 4CW7A 3NHLA 2P1RA 3HA5A 1VB5A 2JK0A 4R9UC 1G21A 4DM7A 2P91A 2BHSA 1M72A 5AT1A 4RK6A 2JVIA 3R7FA 4MP8A 4Q48A 2JLXA 5T6BA 3F3KA 2FLWA 1AMUA 5KQRA 3V6LA 2Z0MA 4RCZA 3V8RA 3X3HA 4JC5A 1L7DA 3BF8A 5AW0A 1MZPA 4NEGA 2AXPA 2D1FA 4YVFA 3JQQA 3SZLA 2EGGA 1X7YA 4FYHA 4C3UA 2RONA 3EC7A 4R5HA 2EJUA 3VZRA 2MMCA 4M55A 3PHCA 1VSQA 3ZLVA 4KCGA 4OJYA 4MWOA 5U9CA 4CZ2A 3X1KA 1QC5B 1T13A 3AVYA 3FUCA 5DGCA 3ZJUA 4D4KA 1U2SA 3FF4A 3N28A 2EL7A 4QDKA 4L4SA 5H3LA 4CF6A 4J9UE 2IWHA 1ZXXA 1RRKA 3RYTC 1QZZA 4I1PA 4L8GA 2GHTA 4MQ5A 4XYBA 1ZGCA 1I1NA 4WNAB 3EARA 2Q5QA 3ICPA 4JJFA 2GRUA 1Z6QA 3L7DA 4TLLB 5GONF 5PGMA 4MS1A 5BNZA 3R44A 3AQIA 2RGUA 2R86A 5H3HA 3U5TA 2J5BA 4KITB 1JPJA 1CDZA 1OGJA 1T3HA 4TT8A 2J9FB 1DT3A 1T6XA 2DBYA 2YHIA 1XVIA 3F8SA 5CM9C 5DTMA 3A6EA 1Y80A 3FPLA 1NL3A 2B2XA 2WWHA 4TMTA 4QTTB 4OHOA 4PIVA 1OX4B 2C5SA 4UARA 5FQNA 2YCBA 3MWDB 1P33A 2O2GA 1EK2A 1GR1A 4RJLA 1NR7A 2AKAB 3L93A 3K9CA 1TQHA 5AM3A 1UBJS 1NQVA 1G20A 3IT0A 1V5WA 3OFKA 3GDFA 3TZKA 1JIVA 1F6DA 3IOBA 1Y9JA 3JWEA 1DXQA 1OPRA 1LLFA 2CVHA 1R9JA 4BNFA 5AHXA 1N92A 5CJJA 1ZN7A 5I3CA 4QLOA 2FW9A 4LFBB 3FJOA 1JQKA 1VL1A 3DZKA 5HRAA 4MA5A 1TE2A 1ZK0A 2GYYA 1JDSA 1U0JA 5F7XA 4K28A 4PN3A 4A26A 3TGPA 3I37X 3NEJA 2FE4A 3FD8A 4BLSA 4PPNA 2C2YA 3H6HA 2FK7A 1UIRA 2Q46A 3I30X 3O8OA 5JZOA 3DDNA 3QUTA 3QQPA 3H42B 3K09A 4X61A 5EEGA 1DG9A 3CZAA 3I9MA 3CRQA 1ISRA 1N1MA 1QBKC 2BI7A 1JJVA 1O08A 1U28C 2CNWA 3CCCA 2WU0A 1EBUA 3FGPA 5JH7B 1Y6FA 3LNTA 2ODQA 2IVZA 1NZDA 2J6CA 3REQB 4EJMA 4FR0A 4IHJA 2CLLB 4CWAA 1YQXA 1M1UA 1ENZA 3IBTA 4RGYA 3WAJA 4ZU3A 3PGJA 4MRNA 5BN3B 4K81B 5AUPB 5E4JA 4GEGA 3GNLA 2V03A 4MUXA 4CN8A 5JHGB 1VMKA 1IB0A 2ZB3A 2VF5X 4R01A 2ZSKA 1YIDA 3CZPA 2WNIA 2AN3A 3SC6A 3G2NA 3AB3A 4BX2A 4X8HA 2A9QA 4RZUA 1A8IA 2YHSA 1HEUA 2ID7A 1USVA 1XTIA 5JS8A 3OA2A 2X0NA 4TTRA 4Z9FA 5JSZA 3LY7A 3WK5A 3KVYA 3INRA 3B53X 2ZJ7A 4BPRA 1NBME 3KZOA 3AJAA 3ROEA 1CUXA 2VBFA 3DHEA 1DHRA 4DMRA 3CNNA 1SQ6A 1J5PA 1NVAA 3X2FA 1GILA 5JCZA 4K05A 3TEJA 1S8AA 1NPDA 1KI2A 1Q7CA 2JH3A 2P2SA 4WDQA 3LW7A 5A4IS 5CM8B 1YDHA 2B83A 4K0RA 3NBFA 1N32B 4FDUA 2C94A 2Y1KA 3O26A 4O33A 4JP2A 1MO2A 4JIMA 1G41A 2AXQA 1JI0A 4TMYA 3X1XA 2NZXA 1MKYA 3CUKA 3UGKA 2OMEA 3PVSA 3DEJA 4CL3A 2WY2D 3U4QB 2HBRA 1XC7A 2DPGA 4UEKA 5D00A 2CWDA 4J29A 3RIYA 3Q8XB 4X1YA 2D6FA 3BM5A 2CMDA 4OCZA 4BWGA 1LQ2A 1RBMA 3SFVA 5B7GA 1GTG1 2RC6A 3QVJA 3LUAA 4BAUA 2QENA 2FDCA 3FAZA 2H9AA 4TTSA 1E7WA 2OCIA 2XDQB 2P9BA 1I0IA 4LYFA 4V0ME 1ESDA 3AI2A 5DYTA 4CDNA 3ZJVA 1XFDA 2JGDA 1MLDA 4G01B 3FNIA 4KE8A 1LDGA 3SMVA 2V7GA 1KOJA 3T54A 3ECAA 5EJFA 3E1SA 3IPXA 1GM5A 3OT1B 4RKWA 1US8A 4WCDA 3GLFA 5AD1A 2EP8A 4R7GA 3IBYA 2C07A 3K3PA 2FR8A 2VAVA 3LYLA 3GP5A 4FILA 1RAGA 4XEHA 3RUCA 2HO4A 3UH0A 4HVLA 5KYKA 1CUVA 2I22A 2HL6A 3UJAA 3OQ6A 5F78A 1LTQA 1M2HA 1BX3A 3TX2A 3RF7A 4R8VA 4YCJA 1L4KA 3UH1A 1E1RA 5CXXA 1SO8A 3E8XA 4MQLA 2ENUA 3NAMA 2RJ3A 5B37A 1QF6A 4ETIA 1EEHA 3RB8A 3STTA 16PKA 2ETXA 4M6WB 3FBTA 2QKYA 3SSMA 3FOCA 4Z7QB 5HUQA 4DKJA 2EFCB 5LKRA 4IHAA 3C4VA 2Q3DA 1G18A 3LV8A 3DD1A 3DDSA 1ST3A 3AIIA 1K92A 1BN6A 2Z4TA 4QU9A 4CKXA 4DLBA 5IHXA 1KP3A 1RBZA 5L3SA 2PKQP 3EASA 4K87A 1YQTA 1JKXA 4HJXA 1Q7GA 4RPCA 2CL5A 5IBPA 4BPBA 1A9OA 2WU8A 2ZU0C 4CN9A 4OHPA 1G6OA 3I5YA 1H0RA 1R0BA 3QIAA 4FUTA 1QVAA 4OSOA 5J2UB 2EZUA 2WZQA 3EVBA 3OCXA 2QMZA 3CJTA 3LGSA 6CHYA 3UGJA 4B3FX 3C4QA 2BFBB 3I09A 3FAKA 1MJGM 1XALA 2EQAA 2VDNB 3IAEA 2QP3A 5J5AA 1MO6A 3TX6A 1L4EA 3DE7X 4ZICA 3MSXA 5FHRA 4AKIA 3AF4A 4LZZA 3AZPA 1EQUA 3KPJA 2X0FA 1TX4B 9MHTA 5IJ9B 5D85A 3J7AC 2C96A 3DL7A 2ERCA 1RMTA 4OKSA 3L4BC 4B7AA 2OD7A 2ODWA 2PQ0A 2V8OA 4GLBA 4MMXB 1NE2A 3H16A 4GE0A 4KGVA 4FFWA 5FOWA 2OFFA 3T1QA 1X7ZA 2XRMA 5CH3A 1I2BA 2VVTA 3KLOA 3KWLA 1J56A 2G0AA 5ERYA 5IM5A 4XVUA 4JV5B 4Q3BA 5DX1A 4HTFA 4E46A 1YUMA 4ZTUB 5CD1A 2P6RA 2ZQ5A 3GT4A 3ZZNA 5IT0A 3WJAA 5T6MA 1LDYA 3MBOA 3W2EA 2FG6C 3T1TA 2GKSA 4CFYA 1Y7TA 3KK0A 4EKEA 3M7IA 3R3VA 1ADBA 1H2RS 2AQHA 4KVAA 4OL0A 4RU1A 4AN0A 5DCYA 4C0QC 1V4BA 4G4JA 1XQXA 1VBFA 4UPVA 2H8GA 4W99A 4YACA 3V4PB 1S8OA 1KTVA 2CXSA 3IALA 3N2LA 5B1HA 4JI5B 3KZMA 5DYYA 5JY1A 3PKJA 1KO5A 1OFVA 4ESEA 3PFKA 2RAUA 2E37A 3A9SA 5K3FB 1PUIA 2QROA 4AECA 1K1EA 4UASA 2MSNA 4L72A 2HIGA 1U8CB 1Q16A 3CIFA 3CURA 4M21A 4WOJA 2Q4EA 4CV3A 3UUWA 3WP0A 1BXGA 3VSDA 1RM5A 2JI9A 3H5OA 1SIUA 4R83A 4M1SA 1Y3BE 3OZEA 3AEQA 2CE7A 3Q3JB 4TMKA 4EK9A 4ED9A 4TMVA 1Q7TA 1ODSA 2QW1A 4AUKA 2ETVA 1C9DB 3TMYA 3ZE8A 1RQNA 1QCCA 3O8BA 3OIYA 4YQZA 4EO4A 4N5LA 4DMKA 3FYTA 2UXCB 5IDWA 4LY0A 3OAAA 1QIMA 2OBMA 1QJ4A 1POXA 2O57A 3NATA 4EVQA 5AFSA 1CXZA 3KQWA 2OD9A 2P5UA 4XYLA 2Z83A 5IUJC 5C4MA 3ZU6A 3RDPA 4JLAA 5KWVA 1LZLA 1XELA 2ZUVA 3T3IA 3ZGZA 1NMSA 1Z9BA 1NVVQ 3EPJA 1C1XB 2BRUC 4PQEA 3NASA 5JRJA 7ABPA 3U3XA 2O4CA 4U9UA 2ACVA 4C9BA 2FEOA 3LC2O 4MGIR 5D51S 1SURA 2C97A 4IJVA 4QQKA 1W4BA 1WMEA 1KSFX 1R0SA 4JR1A 1XRQA 5EZQA 3ZDBA 3V8NA 1V8ZA 2AZ4A 1ZD8A 4UD6A 3V8BA 2VNHA 1SRQA 4M1OA 1WZIA 4PLYA 3W8NA 4PCUA 1IONA 3FH0A 2KSQA 4AO8A 5G4LA 2R1VB 2H48A 4BY9E 3MM4A 5E9QA 3U3MA 1SEVA 4EAAA 1G0NA 1U1IA 1ZLYA 3MMSA 5KOJB 3PS9A 5LXTF 1W47A 1R0WA 3ZWOA 1UP4A 1Q0TA 1JHPA 2R7KA 3C3XA 4PLGA 3TTWA 1W0JD 3FYCA 4CMJA 3G49A 1ECFA 1SOUA 1ULAA 2XUFA 5IYZF 3UHAA 1IAVA 5K6TA 3E15A 1QQAA 1EE9A 1K66A 4PGMA 1J20A 2GAFA 3AVWA 3DMNA 2CZCA 2ZUDA 4ND2A 5DW3A 2R68A 1ZOLA 3WWZA 5HNKA 2Z56A 3VZBA 3TPZA 3A4YA 4Z8XA 1JTFA 4EY8A 1GAQA 1Q19A 3C3YA 1Z06A 2JHCA 2PVCA 2ZANA 4UBLA 4B33A 5HJ5A 1XNGA 4B45A 1NXXA 3GEMA 3K8YA 5LYJF 4OAOA 3ZJTA 3LHDA 4CF4A 4UM7A 4D6YA 1NQOA 1NSTA 3B6IA 1RQRA 3R0IA 3BUSA 3HDVA 3UHPA 721PA 4EEZA 3W2FA 1SU4A 2E18A 2XCQA 2FVXA 4MB2A 4BFSA 4XQ0A 5E4FA 3CX6A 1L5HA 1PG2A 2NO0A 2C88A 3BE4A 5FIUA 4D6XA 5HHTA 4EPWA 3NB0A 3QV2A 1PNQA 4P32A 2NO5A 5FH9A 3FI9A 1AURA 1TT5A 2D0IA 3EEQA 3OJCA 1RMYA 4GPEA 4MVXA 4PEVA 5BNWA 4TQUS 3EEFA 3PITA 5DNVA 4EHIA 2C5GA 1PSDA 3F7OA 1JB1A 3BXXA 5THXA 3SJCA 4FHEA 2OCKA 3I6BA 3LPAA 2M6LA 3TUJC 3WYBA 3FN4A 4UTZA 5T5QA 4JVSB 4OLJA 4ZV4A 4YMUA 4FXPA 2Y67A 4ASUA 1VFPA 3D8HA 2BDUA 1SGWA 2WPNA 4YCMA 4INAA 1CEXA 2V6MA 1AF4A 1P60A 1U7HA 4IWYA 4XI9A 3S3TA 2HF8A 3LUHA 3TR6A 3WDSA 1V6AA 2RGXA 1P17A 2GRAA 2I34A 2FQQA 3KPWA 5BSUA 3TQHA 4RMJA 3WGIA 1PJ3A 4WA8A 4TVKA 1HPLA 5J4VA 2DBRA 1K4KA 3NBYC 2AOWA 1TLFA 1DQYA 2GPAA 5P21A 3S4YA 5EYPA 2V7QD 4FT2A 3PG5A 1M34B 1VGRA 3O82A 4X6YA 1ATIA 2B3TA 3MINA 1DZIA 4GKVA 4OUDA 4JP3A 3EFBA 4F96A 4ZYUA 2IZ7A 4Y2YA 1E9CA 1RWMA 5FBWB 4BLQA 1UDAA 3HU1A 4FYMA 1DDGA 2PRSA 1UZUA 4MRVA 4UBOA 3ZK7A 3ZWBA 2JAOA 2F43A 3VSBA 4XWWA 4HHEA 2VXYA 3BFJA 3W7AA 4YYZA 4KOEC 1Y1SA 5DNWA 1B15A 4XIIA 4FOLA 1TD1A 4L1KA 4I1SA 3GR6A 5H0IA 4DLAA 4EL0A 1XYGA 1SKQA 1H9AA 1WF3A 4BU0A 4HLUC 1VI6A 1QLWA 3WLNA 2V45A 2CNNA 1RJGA 1WEKA 2J3QA 2VHTA 3V2HA 3W3AD 3ZWMA 5B4UA 4PNZA 5EJ6A 4CLXA 3K0SA 3R5TA 4OHFA 4GBMA 1XEWX 3GLHB 4INPA 1ZCBA 3VPAA 2AKEA 3L8YA 2ZSUA 4Q6WA 3V4SA 1KMNA 2W71A 2ZI4A 1H4QA 2B9VA 3TNLA 2I65A 3Q9NA 1Z0IA 3ND6A 4MEBA 4BFXA 1QAOA 4NULA 1MDFA 1I13A 1A3CA 2AIRA 2JFOA 1EWKA 3ASUA 3MLAA 4Q7QA 1QKKA 2UV8A 1GHTA 1TQ6A 3A26A 2F64A 4PZ9A 4CGZA 4L0QA 4UDXX 3PJRA 2HSGA 2ILVA 2ZFUA 5HIAA 2R5FA 4LRUA 3TNYA 4D1YA 2Z2ZA 4Q93A 3O8QA 4E2XA 3OU6A 4NBNA 4INZA 4L6AA 1M67A 3R40A 4X94A 3E61A 1Z0KA 3S8YA 3LKDA 4WOPA 3V7YA 4TTAA 4B6RA 4YV1A 3WJ7A 4DJEC 1A7JA 3SSOA 1IHPA 5F9HA 2JGNA 2IW1A 4HRAA 3RUEA 3WRXC 1RZ3A 2PPVA 4WOBA 4LDZA 1VCNA 5ICGA 1U9ZA 1QIEA 3BYZA 4LXGA 5KTPA 3WA7A 3K4HA 4NOKA 1C81A 2FWNA 4TV8A 2AQKA 3SVZA 4C0SA 3E58A 3CONA 1O3YA 3QLJA 2FSPA 4B3BA 4DXAA 1TF7A 3P2YA 2ZEJA 2X0EA 4JNKA 1KDTA 3L4BA 1SZJG 3GLGB 5GV7A 1NN3A 3MHPA 2I9KA 1IYZA 1JMVA 1NVDA 1OV6A 5E9WA 2XA2A 3AI1A 2BELA 1GQSA 2HK7A 1GYRA 2WTAA 2WUGA 5D01A 5LA6B 4GKKB 2Z1DA 1BVYF 3KV3O 2GN4A 3G17A 4KBGA 2P3LA 3OTQA 3ZX4A 3C8MA 1M6WA 2VOEA 3QJGA 3AEZA 2GCEA 5AOAA 5F9FA 2E9SA 4UAJA 3A4LA 4LAFA 1DBPA 1S2MA 4FFMA 4RIFA 7REQA 2GVDC 3LQKA 1GRNA 3AKDA 4GP9A 4KO8A 3BERA 3OUZA 1LNQA 4XAQA 2WHQA 3RQSA 3G0HA 3Q8LA 3QOWA 1I14A 1XZLA 3JQGA 3OOEA 4QE3A 3R9XB 3TQCA 1FJHA 5E2AA 1GFIA 5J23A 4GPZA 1YB2A 1QRRA 1J24A 3R0QA 4HNAB 4IKEA 2GCIA 4Q7KA 2QTAA 2X8WA 3RJ5A 4JROA 3N2KB 3ZQ6A 5HKKA 1HE1C 4JJ7A 1W9MA 1CBUA 2G9VA 2Q1XA 3EDRA 2II6A 3M6XA 5SY4A 4CKWB 3IIIA 4B84A 5IT4A 4RTKA 1WBBA 1BXRA 1Z0AA 4E4RA 5FUQA 2NQTA 4A36A 3LCVB 2OLKA 2GFIA 4X5OA 4QFDA 3MCTA 3U4GA 4DBLC 4Z9YA 1PT8A 2WJYA 3JVUA 3NRCA 4AWBA 2PKXA 5JMOA 5KVCA 3ZVMA 1ISMA 1T9BA 1W5AA 3JYPA 5JSKA 3TZCA 4BO1A 1P4JA 4DYHA 1QP7A 2DERA 1NW3A 2Q1YA 1AKRA 4CTNA 4OGGA 1THGA 4I9UA 5LP6C 1Q91A 4WCFB 3MK31 4LGYA 3C8DA 4ZIRB 5AMXA 1G0OA 4OOFA 3D2LA 3CY6A 1GYQA 4EA8A 2AFHE 3VV2A 2F17A 1LDBA 2JAUA 1YBMA 2CZGA 2JI6A 3DE1X 3PGVA 4F9GA 2CXNA 1PL7A 1J7KA 1JLLB 2DX7A 2LRHA 1WCIB 2RGBA 4UULA 4UVHA 3VQTA 3WWPA 2G07A 5AJTA 3T94A 5MFPA 3FCSB 5SZJA 1U1FA 3A32A 2HMSA 2J3EA 1DAMA 1NLUA 4IM7A 3L4EA 3FF1A 1Z4QA 3QA9A 3JD2A 3DMPA 3TS1A 4NCBA 1OILA 2D0OB 3WB2A 4BBPA 2GD2A 1DG3A 3GBVA 3M83A 1ZCJA 2CMHA 1L8OA 4RSHA 4IO0A 4BGVA 1RXYA 4DLKA 1KK0A 2CKDA 2A88A 3OIVA 3DLHA 1ORIA 2VK2A 4MP6A 4RA6B 4IJKA 1XFAA 3ESXA 2H5EA 3KC2A 4S1VA 1KO1A 1E2JA 2Q3FA 2BFEA 1F4PA 3MYYA 2IYXA 4MLCA 1J09A 4AYTA 2DKNA 1GPH1 1JT2A 3CF4A 1V6SA 3N2ZB 2J5RA 2PKWA 3A3NA 1T0BA 1HBJA 2BY4A 1HE3A 2DTEA 5BN1A 2ZUSA 2OCYC 2VAPA 1IQ0A 4MB0A 3AB7A 5CGZA 4BFVA 2DH5A 2XD9A 2IITA 3NHSA 1D6NA 2H2GA 3FKSD 3KOYA 1NURA 5EZ5A 5AVQA 2G5TA 3C1UA 3E7PA 4RHUA 3M81A 4G0PA 4V24A 2XOXA 4QTZA 5A6SB 3C14C 3ZDFA 4EM6A 4FWIB 1E6EA 3B89A 2H4JA 3ZZ1A 3OOHA 2EZ9A 3CJQA 3BKWA 3LYUA 4ZDWA 3CNOA 3JQ9A 5T57A 1GO2A 1ZK3A 2ICAA 5DU2A 3UKDA 3V9AA 1OT3A 4GI2A 1UCFA 3BJEA 4PLFA 2O3SA 1AV7A 3FMVA 3HL4A 1LA2A 1O94A 3LU1A 1SPXA 2QZZA 3KJZA 3EGIA 4PVCA 5DN9A 4AY4A 4XM0A 3CINA 3A9TA 5C7IO 2VJCA 2A0WA 1YQGA 3CRVA 3UAZA 4E13A 1ZH2A 2BFCB 1KYXA 3IP9A 4WJKB 2X2OA 4ILEA 1MGOA 3G0CA 4Q7MB 4BKUA 2IYAA 3Q88A 3QXXA 2OO5C 4JKIA 5LXTA 4BXOB 1V9SA 1TYEB 2IDKA 3N59A 2PEYA 2BUBA 3RC1A 3GLIB 1M0EA 1AZTA 2VDRB 4JJAA 3NT4A 1XBTA 4EABA 4XRGA 2XXAB 1V39A 4MV8A 1S2DA 3N07A 4YI3A 5L4LA 3I32A 5AJYA 2CUZA 1U1DA 1V5IA 2PA0A 3V9PA 4D81A 1H5QA 1NTOA 2LUOA 1SU8A 4DWJA 1Y8RB 4MI6A 2QIPA 1N0WA 2GI4A 3AV0B 4HJRA 4IDFA 4J94A 1DXHA 4NZNA 3QNWA 1NLMA 4EVRA 1PEYA 2ZSBA 4ZMSA 1K7FB 1W4CA 1OI3A 4Y0NA 4Y2XA 1R16A 1ATZA 2AFRA 1BVRA 4PZ0A 4K9LA 4WMLA 1HR0B 3PE4A 1IHDA 1Z6YA 1Z22A 1GCIA 1U3TA 1VCHA 1T4BA 5H9VA 1L8AA 2CUNA 4LZLA 3BWEA 4KTTE 3N2IA 1EU1A 1IOVA 5BSMA 1JLKA 1MC1A 3D8TA 5CJPA 2DFTA 3RVNA 2WWFA 2QUKA 4MO9A 5FPSA 2XOKA 2BTEA 3K8OE 2OXCA 2WOOA 1TM3E 2ZIEA 4LWPA 2CDCA 5KCZA 2B94A 5IABA 3MSCA 5BP7A 4QDZA 1KZHA 4OFZA 2OO7A 3OY7A 4RK0A 2NV0A 1H0HA 2PUVA 1E5DA 4FFPA 3V8MA 3WNZA 4F3NA 5DI3B 2YZNA 2R0QC 2QVYX 3CWCA 1ANKA 4PQRA 4BVJA 5ICMA 3MHTA 2B6HA 4RZ2A 3PNQA 5DV9A 3K05A 3KO8A 4ZI3A 1GZVA 5ALMA 4BN4A 4I9GA 5E2BA 1OFGA 3ONDA 2F7SA 1Y3FE 4RK5A 3VPSA 4WN3A 1W59A 3BDVA 5KTKA 2LGJA 4IIYA 1TRHA 2Q5IA 3ND5A 1XZAA 1SKYB 3OLCX 3MBIA 1M2GA 5CDHA 1DAPA 4JOCA 1P1HA 3S29A 1D7OA 4CUZA 3CZQA 2BEWB 3GC6A 3GDWA 4HFNA 4IFEA 4YONB 3TZLA 3LOUA 3KKZA 4G37A 2XNCA 3R77A 1KI1A 3JQPA 3KOOA 3IPRA 2OHFA 1ABEA 1ZIXA 3DB2A 3F4KA 3KX2A 4DCGA 1DELA 1E4VA 3GP3A 1Z5OA 4DPMA 4I5FA 1G63A 4ZPXA 3GFFA 1N2JA 2J87A 3FZGA 4TSRA 4GFDA 1BCSA 1OCEA 1JJIA 3EE6A 5DVZA 4PZDA 2C5FA 4O4LB 3VZDA 1MR3F 2ZE7A 2EKBA 2V4UA 3CBGA 3DPSA 4QDJA 4EFLA 2FZGA 4LZNA 1UKYA 1JR3A 3O5AA 3UUEA 1M8GA 1QDLB 1NF9A 3L1HA 5BSTA 5JAZA 3QXJA 1XCPA 4UNPA 1I6LA 1HOTA 4I3GA 1K5HA 5CA1B 2D4AA 3TD9A 3EQ9A 3DBIA 1EZ4A 3MTBA 4DPLA 1FFGA 4RDCA 4M0UA 2H8KA 4RAQA 3U56A 2FB9A 2IA5A 2MSCB 1Q77A 5DHUA 1WCV1 5FAXA 3P9QA 1DCKA 5KTMA 4QUGA 1KEPA 4EYOA 1GDHA 2Q4RA 3QXCA 1EUCA 2C2BA 4QASA 5HBGA 3U7GA 5CX1B 1TCUA 3EVCA 3VR3D 3RPEA 1R6VA 2HV9A 1PWEA 3BFPA 4U6NA 1D1TA 1TUIA 4YRRA 4Q3LA 5KMGA 1V5GA 5JD4A 2FGKA 2JAXA 5FRDA 5KNDA 3U61B 2IIQA 5BV8A 2WF7A 4FZ5A 3OPYA 1SKUA 3GB9A 4UFPA 4GPTA 1TTQB 2JLYA 3OQIA 3R8FA 3JZMA 3IP8A 3GVHA 4ADSG 4UBIA 3RUFA 1ZISA 3E70C 3KQYA 3O4GA 3CR7A 1XMIA 2YXLA 3LK6A 2W2LA 1T5LA 4J6EA 4ARZA 2R62A 3NV7A 1JNXX 4GZ6A 1HYGA 4MIEA 4DNOA 4DA4A 1MEJA 4RGBA 3IAFA 2C3MA 4F5EA 3HKEB 3ZGLA 5CNMA 3RKRA 1R5JA 3V00A 5BY2A 2ZZNA 1JAXA 2PYDA 2VBCA 4PYOA 2WDPA 1E6KA 5C8ZA 3SF0A 5HX7A 2JIBA 3VJRA 2YVUA 3VMFA 5HXAA 2CVZA 4RY8A 1TU3A 1QM5A 2RHDA 1OX5A 4R1TA 3AHJA 3ILYA 1HYHA 2XT9A 1KE1A 2G8NA 2J30A 2PXHA 3BXHA 5CNKA 5I7RA 4DQVA 1X7ZB 1PUXA 1KXJA 3W6PA 5K6RA 2R8YA 3N2NA 5CVDA 3LA8A 2EG5A 2NTNA 5G40A 2XCUA 3G9ZA 5K0ZA 2W0MA 2VP4A 2NYAA 4KK4A 1K4YA 3ZEIA 1P29A 2QP4A 1GYPA 5FTWA 3K0BA 4HLNA 4REQB 2O2YA 1HYEA 5F51A 4P4SB 3AVVA 3OPYB 2P3SA 4BVLA 2BBOA 5ANRB 4C22A 1BE8A 5C9ZA 2XJ4A 2ZJ2A 5E7QA 2R60A 4BNJA 1EA5A 1UR5A 2OCGA 3EJ6A 4P7BA 2GYVA 2X13A 4WACA 1MRSA 2HW8A 1TJYA 3N2GA 4LTNA 5B1DA 2FUEA 3QVTA 9ATCA 3I1JA 2VYND 3PQEA 2J0EA 4GUDA 4JC8A 4OMDA 3EY9A 3N8NA 4ZK6A 5KSWB 4EI9A 4QAJA 1AA9A 1Z8NA 3O03A 4DR7B 3HJTA 2B7LA 4MR9A 2FUG6 1DC7A 1U7DA 1MQAA 2DF8A 2FFQA 4XGRA 2GXUA 3WADA 3HJNA 4CMAA 5HIKA 1GVHA 4IZ6A 4BQOA 4HDOB 2EZ4A 3KJEA 3P97A 4BV8A 1MBZA 1TZCA 3DR5A 4BQNA 3TB4A 4DW8A 4JODA 4YJ2B 1FOEB 1PKXA 4YBZA 4A2WA 3AXSA 2DUJA 3BGWA 3MB8A 3ANSA 3BSWA 2WMNB 2YVLA 2XF8A 3EZGA 1S9DA 1MNQA 1N8SA 1YA8A 3NHJA 1S7CA 2G83A 3OI7A 3GFRA 3OHMA 3QUAA 4M53A 4MO2A 3GYBA 3P5SA 2FRXA 2DC1A 4MW1A 1YFZA 1JAHA 1WHSA 1G17A 2HMUA 2PSFA 1C3XA 1T8SA 3O2SB 4LGVA 4Q4JA 3K1AA 4NCJA 5F35A 4JH0A 1RRFA 4U4AA 3KAJA 3O7WA 1NWHA 1M2FA 3GCDA 1CD5A 4C88A 3PWSA 4MRRA 1M1XB 2J31A 3E0XA 4A0HA 1GGJA 3JQ8A 3PCRB 4AO7A 4YRAA 1QU2A 2Q8NA 2AYXA 4CMEC 3U3ZA 1D9XA 1NATA 1PJ2A 5E0KB 4MICA 3AETB 4J9VA 1OLOA 1FSGA 2ZTLA 3M2TA 3HVUA 4N3CA 3VHXB 4BEJA 1U5CA 3EZ7A 1GNTA 2CYBA 3NOXA 5ITZB 2O6LA 1E9RA 1PS8A 3DT9A 1W25A 2EBFX 3NBZC 4O3FA 5BVHB 5HJEA 4OXQA 4AJOA 3WRWA 1VL5A 4Q18A 1DCTA 1N8KA 1YR6A 1C7ZA 1JFRA 3GCXA 4RKEA 2O8BB 2HIAA 2CVPA 2O0MA 4M0CA 4YJ3B 1DQZA 4FDAA 4C78A 2JFHA 4F6LA 4ZOQI 4A4DA 3NV9A 2QN3A 4OQLA 4OI0A 3W4IA 4JYPA 1GFSA 2XUPA 5F2KA 1Z33A 5FUYA 4FI3C 4KIJA 5H59A 1IM2A 5HIMA 1KBQA 4KR0A 4S0XA 2HBQA 5KTNA 1YCDA 1MIHA 3JYOA 4PX5A 3SWWA 1OAOC 2XE4A 3K0FA 3L40A 3IHLA 1T2EA 5JMTA 1VI2A 4MUKA 1ZMBA 4D4HA 3A9WA 3KE8A 3ELUA 3DULA 3O75A 4PCLA 2FSVC 1D6JA 3HEMA 1A0OA 4MOWA 3K6KA 5GQSA 5J2UA 2CSUA 4MVJI 3U7IA 1ZIOA 2P2NA 4REOA 4DR2B 1L5OA 1SVWA 1T1SA 1LLCA 4XGIA 2PGNA 6PFKA 5JT1A 5D3ZA 3OT4A 3LVBA 3EVFA 3GGGA 4BMZA 5T4FA 4B87A 3K6SA 1QYXA 3VVLA 4BMCA 1OF1A 4DLZA 2ZM6B 5E4TA 3OLQA 1XLTA 4Q1EA 5EJAA 4WKGA 5CURA 1UP7A 4W5JA 4HYQA 1NE7A 3QXSA 1U2ZA 2XYGA 5KNBH 2PMWB 2J3DA 3RYIB 2OM2A 4GOLD 1Q3TA 4OSPA 5T4EA 4Q1VA 4YCBA 2YJ5A 1JDBB 2PLNA 2WMYA 1WSDA 1ORHA 3Q0TA 3SZRA 5FOXA 4K6FA 5TDHA 4LNUA 2GZRA 4BP1A 3WQSB 1U8AA 4UCQA 1W93A 2BGTA 1SBZA 2N3ZA 4UHEA 1TB4A 3OQOA 2F3RA 2IU0A 3OJFA 1SN7A 5TE9A 4D9EA 2BR5A 5C8XA 2XI4A 1KI6A 2FF7A 2OVBA 3AERA 1M10A 2H3HA 3F67A 3F96A 3G2PA 1J99A 4LVCA 1MB2A 1E7QA 1MP0A 3AR4A 1Z2DA 3C5CA 2GEBA 4IY1A 4KLNA 4JT9A 4Q21A 3OG9A 5AW9A 3VR1A 1B14A 3UANA 4R1PA 1JU3A 3ISTA 4ZTBA 1QOZA 3X0DA 2H2HA 5JD6A 2R1UA 1X94A 2DBVO 3TL2A 3FBWA 3KJGA 2QZSA 1RYYA 2B36A 2PM8A 2TYSB 3ZWDA 4EZEA 2QN7A 2XSZA 3LKZA 5LZ4A 2QU7A 1XAGA 3KDAA 1C9NA 4HQKA 5AKGA 2NPIA 1P0FA 2E49A 3NHUA 2QDXA 3KD3A 4I8IA 4WW0A 4Y6OA 3RLFA 1P19A 5ARBA 5IAOA 5JNLA 2I4LA 3K5WA 2J9XB 5ALZA 2JDIA 3VR6D 3T5MA 5NLLA 4A6PA 1MCZA 2WSBA 1TMOA 1PYGA 2QRGA 3A2LA 3IHWA 3PZBA 4QG7A 4GXQA 3KPUA 2BGJA 4WN9B 2VC2B 2XXJA 3EC2A 2C58A 4YJFA 1H6DA 1GTL1 4MI9A 1XGKA 4QIHA 3WNQA 1U63A 4PIMA 4NZPA 2BKLA 4GXRA 3WQRA 5JPCA 5KX5B 1C9EA 1LB1B 3UHOA 3CHYA 4Z3DA 1N1EA 5G41A 1SA0A 3WDMA 3K9LA 3CW9A 5EHIA 1J25A 1L6RA 3B1VA 4UM8B 5HCUA 4NBSA 4TQGA 4J4HA 4RTOA 5DRTA 4REMA 3W5VA 4EMSA 2Z3VA 1KAMA 1VSTA 3MTEA 3SYNA 1J33A 4TXNA 4FWTA 1ZVQA 4N9WA 4LSWA 3NRJA 2G1JA 4GM1A 2RBEA 2JJ1A 2XX3A 4Q3NA 1Q0SA 1EX7A 2IHTA 4B7UA 3BPSA 2VDMB 2FEPA 2VJMA 2YXNA 3FVTA 1Z3CA 3C85A 3INTA 4H31A 4TS4A 1I1HA 4HI0E 1VMIA 2WM3A 1GTMA 1KZ1A 4RH0A 3KOWA 4Y2UA 1YRLA 4J90A 5AXAA 4QLBA 2YJ4A 4L73A 3C1AA 4M36A 3MT0A 1PYDA 4OIFA 1NMQA 4YDHB 1TYBE 2FJPA 3G02A 2G0TA 3G82C 4OB8A 1G3RA 3WRVA 3REQA 1NVGA 3OEEA 4CCSA 1VHQA 4EJSA 3JS5A 3UOGA 3IQIX 3E8MA 2GBFA 2YS6A 3A8TA 2GF0A 4CG2A 1QV7A 2HWKA 1H2EA 4YIKA 3RRBA 1C8BA 2JLCA 4TVSA 2VJPA 4NF2A 1AA6A 3SX0A 4L0CA 3QXGA 4JGIA 4MKRA 4EVSA 5B57C 4J2HA 4I9FA 3R7WA 3TZ6A 2CUTA 5ELMA 4AKGA 4QHYA 4CG3A 3M4ZA 4PPGA 2VDUE 3ZGYA 1EVIA 3OAAD 2PUHA 2CYCA 1Y8QB 3G8YA 4IYRA 5IEBA 5K05A 1KC1A 5E6SA 2R8ZA 4YLEA 3PXXA 2IYSA 1IUNA 2HH9A 4EGJA 1B6RA 5EI5A 3SSAA 3RTDA 5H5JA 1EKXA 1OA0A 3O9VA 3WLAA 4CKBB 3KALA 2X19A 2ZIUB 3SI7A 4KR7A 5EJIA 5DPMA 2WJGA 1OMOA 1LI5A 4RQUA 1JR6A 2OHIA 3QHPA 1YJQA 4IOJA 2NO9A 5HVNA 4XDYA 1LX7A 2WSIA 4U2FA 3O94A 4DLTA 1UDWA 1ZESA 2ZYAA 3K30A 1A97A 3AJRA 4KUEA 1CUDA 1H8EA 4R2JA 1E62A 3TH5A 4TKVA 2WAYA 3DOUA 3FMGA 5SZHB 1B43A 2A35A 5B3JC 1I30A 5KNDD 1XR3A 3N8HA 3PFFA 4FJ2A 1JI3A 2XNDA 3PSAA 5I7AA 4QXRA 1JFFB 3IO3A 1SCAA 4OYLA 2Z2XA 5C4IA 2X58A 4MCAA 1WXQA 3HEAA 4ABTA 2WT4A 2VQSA 1KIFA 1V3VA 3UJPA 4UUNA 4DV5B 5AKIA 4E31A 5JASA 4RA9B 4P58A 4TPKA 2IVFA 4XX1A 4IDQA 2B21A 1S89A 4O5AA 1QGOA 2ZI6A 4E5NA 3BH6A 1MJGA 2ZIWB 2Q4DA 3Q8WA 3HWSA 4PZLA 4JUIA 2JLZA 4EI8A 2CF5A 4OPMA 5EAIA 1BOOA 4UTVA 4LF5B 3C5EA 3C3KA 3H2JA 3SR4A 3PYLA 3QGMA 1VECA 1XDUA 2QJTA 4LZJA 1VA4A 2MT9A 2OFWA 2BP7B 3GRZA 3C6YA 3JQ7B 4WINA 4BV2A 2COUA 1ZH4A 1RVDA 4P3OA 3UJ3X 2PV7A 1ZCAA 4OUDB 1EMDA 2P9HA 2E0IA 2Y68A 4ALIA 2XMDA 1B2LA 3IURA 1GCUA 3LSYA 4FNAA 1DOZA 3RQIA 4E32A 2C7PA 3DDUA 4XPIB 3HV2A 1ZK1A 1T24A 3QEKA 1CRPA 1ECGA 3PQ6A 3GA0A 2FUCA 1ZL2A 4CBVA 3R8CA 1FX1A 3U19A 2DPYA 3HUTA 3OE7D 5A4AA 4E2FA 1AD2A 2NU7A 2QR3A 4GAEA 1T9CA 3HJCA 4HX5A 4LK2A 1X7WA 4BNMA 1VLLA 1XXLA 4W1PA 4OHZA 3IMGA 3G23A 3DR3A 1EZ1A 1G8AA 4PICA 3DEZA 1XQYA 5HF9A 4CM8B 5C51B 1U0BB 4XYGA 4JSRA 5C31A 3BWBA 4YRSA 2WUDA 4WUTA 4ZCTA 2O0LA 2P68A 4Y1EA 1IEQA 1IH8A 1TYAE 1L5VA 3DBHA 3RTAA 2JH9A 4GE3A 4UOQA 2P0AA 1FTWA 4UQOA 3CA8A 3EW7A 4E09A 5I9MA 4ZAVA 4LBYA 3NT2A 3GIDA 2RG1A 1GSAA 4G5YA 1YL7A 3DDOA 4LJYA 4PLHA 5E9JA 2OVFA 3IKLA 4YAOA 3WX0A 4QVIA 3GFGA 4JI8B 3CH5A 1F7VA 1NWCA 1WXIA 2E89A 2XYPA 4F56A 4PIPA 4GL2A 5JBQA 3GFSA 3Q41A 1AN0A 4TRNA 1JLMA 1RJFA 4N82A 4R9NA 4F8EA 5I8PA 2IW3A 4P33A 3TOCA 3VXKA 3QE9Y 1WUJS 5JSHA 3VYSB 4MUMA 1ML4A 5AVSA 2FSVA 3SKXA 2PWAA 1ZJ5A 1VBMA 4DA9A 4RZHA 5JVDA 1ZR2A 3BQ9A 3UJDA 1F1BA 1C1DB 4FLFA 4N5HX 2BFCA 5DHSA 2MU1A 5J47A 2JARA 1RC8A 1DQNA 1QFSA 2R8BA 2LKDA 5TQ0B 4DFDA 5CEFA 1MFPA 1A7AA 2ZSHA 4DXHA 5HFJA 3F5SA 1KI8A 4C89A 1WSAA 2OFXA 3PIIA 1JKMA 3K0CA 5EE1A 3CVWA 3GNSA 5CLHA 4HRYA 3TW8B 4ARBA 2ZQZA 4F72A 2HLDD 1M3SA 3I23A 2VYCA 5I01A 1ISIA 3EA0A 1XLWA 4PU0A 4LXXA 1H5UA 2W9XA 1E2BA 3EGDB 2A9VA 2NTYC 3HDHA 1TDJA 4XPZA 3QEBZ 1CUHA 2J46A 1JTVA 3LT0A 4DQKA 1ZJZA 4F4DA 1VPLA 2V7TA 2D13A 2G9RA 3ROFA 3B9QA 1N7GA 1Y6QA 2ONCA 1Z7WA 3GLTA 1UANA 3GRAA 3HN2A 3L7NA 4DG5A 4E3ZA 5JZ9A 3BIFA 4EB8A 4CM4A 2CCJA 2E4ZA 1JRLA 2IOYA 3TXXA 3WQQA 3B9BA 3SF8A 1J8YF 1PX0A 2EVWX 2FZEA 3NPAA 5I7VA 1UPAA 2X8BA 2BYTA 1FQJA 3CT4A 1DLJA 3II6X 3QENA 5LB4A 5B5SA 4QPPA 4OREX 3NNSA 5KVAA 3PYXA 2GDJA 4XWGA 1SUBA 1M1NB 1VSVA 3FKJA 5CHEA 1MRNA 3GX1A 3ZI4A 4P4NA 5JWRA 4QATA 1IG3A 3AFIA 3LCJA 1N7IA 4P54A 3BRQA 3QTLA 2ZJ4A 4L08A 1JHYA 4K9PA 4O4HA 3GG2A 1QH1A 1GUZA 4IIFA 3IMCA 4XJSA 3VTAA 3DVSX 3UOAB 2QYOA 1RWWA 4TROA 3ZDQA 4J91A 3QYFA 1J8VA 3F3MA 2G7MC 3N86A 4BZZA 1JVSA 4PGGA 4WBXC 3WGVA 3PX3A 1FMCA 4J6FA 3KFVA 2H4FA 3RS9A 4CF7A 2XV1A 4WZAA 4JYZA 1DU4A 4ZTZB 3ST7A 1Q11A 2EV9A 4COOA 4FZRA 4Q47A 3NETA 4YT8A 1RLIA 4HWPA 3RF6A 2EFYA 2IODA 1H0SA 1RKBA 3BBLA 2CXTA 3UENA 1ZQ1A 4QL3A 3L8ZA 1ZU5A 2HJSA 3QP9A 4FFOA 2V6BA 1Z0ZA 3K0AA 1Z8DA 3ND9A 2GPWA 4RKRA 4J0DA 3AF1A 3IGFA 3ITKA 2DJ5A 2C4VA 2RAPA 2XDWA 3P26A 4JBGA 5CMLA 1CIPA 1JG1A 4IJWA 5AOBA 2JHFA 1JIKA 4DADA 4AY6A 3ZLJA 1Y7IA 1QK3A 3OO0A 2NWQA 2V5UA 2GR9A 5IVDA 3RW9A 1FE8A 2BRUA 3PEWA 1TRKA 2BJHA 1A2OA 2QVZX 3EXHB 4IV5A 1JQAA 1JKJA 1Y3CE 3CJRA 3HDGA 4FI3F 2VHXA 4KG7A 3MTGA 4M49A 3B6JA 2ISQA 5KKAA 4AB1A 3E6AA 3BMCA 3BTOA 4DIKA 4LISA 4MS1B 1A9XB 3FMPB 1V48A 3DB1A 1WPRA 2QWXA 4OJTA 2RAFA 2HZBA 3FTNA 4WLUA 1EUDB 4M9CA 4OX9Y 3IIEA 2X14A 4XCXA 1SCUA 4V0QA 2ODTX 5F2NA 2ECFA 3GOHA 2AR9A 5KMGB 1V1MB 3A9UA 1FYFA 3C1OA 3F6BX 3HKBB 5CFZA 1PV4A 5HF5A 3H97A 1ACJA 1I3KA 1HYQA 1XEXB 1T4GA 2W37A 3MRVA 4L78A 4YMIA 5EGNA 4R51A 4BAZA 3KB2A 4BN0A 1SOWA 1IBMB 1M2KA 3THXA 1WVIA 1AGYA 1IJFA 5DCWA 3E9CA 5DM60 4QQFA 4Z4QA 1RPJA 3CKYA 3NZEA 3HV0A 4NFHA 1N1GA 1MPTA 3NOOA 2IEBA 3DXZA 3LY9A 3NTLA 2P4EA 1TZKA 1B0PA 1E6UA 2WTEA 1J23A 3QYPA 3ETDA 1X0VA 1XB2A 4KWEA 4L8VA 4ZHQA 3LTNC 5ECGC 5EE0A 2PMCA 1RJWA 3OC6A 3ZOKA 1GZ4A 2I76A 3IQFA 4Q1DA 1BO6A 1W52X 4MTCA 4LY6A 5AVOA 3RHSA 4BTVA 3ZCVA 3JVVA 2HPHA 1DNPA 4XUGB 1FXWA 3S2IA 2XYVA 4HBZA 1BVHA 1L8XA 2E4WA 3R3XA 1SBYA 2BKXA 4O2AF 4OQQA 4Z9XA 1KGSA 4LMBA 4E30A 2N1BA 3HO8A 2FQWA 3CCBA 1T9GS 1T6ZA 3ICWA 3D31A 1R4ZA 3KFLA 2XZOA 3AF6A 5FPYA 3M4XA 1PNVA 3QX8A 3FVQA 4UE3S 2CNLA 4OK6A 1KJYA 1WMFA 3EXHA 4HXGA 3LUBA 1B41A 4KWHA 1F3LA 1V6CA 3EA4A 1EFPA 3PR2B 1HL7A 1IXKA 4UAUA 3CFYA 4DL9A 3HCAA 1NVMB 2QLTA 5C53B 1LWOA 3F1KA 4AMUA 5A3RA 3GRYA 3HBJA 3THWB 3PKZA 4ZYLA 2BZSA 2V6GA 3T7KA 2BFPA 1YDEA 3EPRA 1ODTC 1SBCA 1I01A 2RH9B 4D4GA 1ELOA 5LMCA 3A0RB 5AM0A 3HJFA 3H11A 2KYRA 3WE7A 4O1MA 4BE4A 3FIUA 5AVRA 3O93A 1ZVVA 4M83A 1VLHA 4RGVA 2RGCA 3MRXA 5FI5A 3L7AA 3QPBA 4B81A 3HVIA 3CH7A 1I10A 1PJTA 2WFLA 4MUBA 1M8JA 2J3MA 4EUKA 4AZVA 2EKDA 2IS2A 2OQ2A 1SCNE 3QIVA 2O7RA 3IB6A 4LG1A 3TIXB 4OK3A 4NJOA 3DAPA 2XYQA 3ODGA 4H7PA 4ZHQB 1GARA 3MXTA 4PYJA 1IVNA 2F1JA 5B6JA 4LEIA 2VJBA 4TWBA 2AJDA 4TS3A 2W42A 1RZRD 5JCXA 2RGDA 2PS1A 5CDSA 5K0TA 1FU4A 2WDZA 3B3JA 2RBGA 3C3JA 4Z86A 1M1NA 3RS4A 1DRJA 4CL2A 1N0VC 3IXQA 1KVSA 2AUMA 4L95C 2IXBA 3MG9A 2OFOA 1WY7A 2BGLA 2PZLA 1PSZA 4X63A 4XWTA 4C0WA 1KTIA 3VPGA 1VE1A 1DFHA 1BGVA 2QOEA 2JGDB 1QIJA 5H9WA 4RANA 2ZZKA 3AR6A 1VSUA 2LE0A 2Y99A 3RABA 4HC4A 4D96A 3BILA 3FHCB 2G17A 5GONB 1R12A 1JSRA 4WX2B 3H5LA 3ESDA 4BJ6A 4M46A 3I01A 2PAFA 4Y2HA 1YULA 1GTZA 4WLEA 4LZAA 4YO7A 2Q62A 1B6GA 1GZ6A 1CLUA 4C6SA 5ADUS 1PGQA 1FSFA 3IBFA 4GSLA 3K9BA 2C9DA 4BZWA 3L0ZA 3RVJA 1U98A 3M6AA 2HU5A 3L4KA 1FUIA 3V33A 4WGFA 2PRIA 1E2DA 1NSFA 1YI1A 1W4RA 1YZTA 2EW8A 3AEKB 3CU5A 3HHPA 1SIOA 2JGKA 3G59A 2XWQA 3ED5A 3ZCTA 3KETA 4DV4B 2DB3A 1K2VN 2FGJA 2VJOA 3VC1A 1IFXA 3AWIA 1A1SA 1OFHA 3DHNA 3LZDA 4RL6A 4D0NA 2Y0BA 3DC7A 1A2QA 4U1RA 4YGYA 3LS2A 4Q3EA 4TLCA 5LKAA 3QPVA 3HJGA 1I2CA 1OFUA 3G9XA 2C99A 1E5QA 1IB6A 1XWIA 2A3NA 3FRHA 4K1XA 4L22A 3EVZA 5EEHA 1QTNA 1T9HA 4P92A 3RM3A 4V0MA 1USWA 2HJ9A 1SY7A 1XF9A 4DCPA 1R8SA 3NVAA 3PJGA 2R25B 2QPOA 3ADDA 2F8MA 2QF7A 1I36A 4DGSA 3IOMA 1KH1A 4GT1A 5JQGF 3KM0A 3ZLBA 1R6BX 4BO3A 4IH9A 2HJRA 3KR1A 2GBPA 2HPZA 1FEZA 2PBFA 1I32A 1SEPA 2A1IA 4IVQA 5EKDA 4U9IS 2W6OA 3HO6A 2VJQA 3BRWD 3LBIA 5F7JA 5CEEA 3OX1A 3NUGA 5C1DA 3LP5A 1SUCA 5A02A 1CR6A 1I6MA 2QE6A 2NUTB 2UYGA 3AP1A 1JKFA 2XH8A 3DTYA 2VSYA 1C7QA 1RACA 2CJXA 1ZX1A 2GLUA 3GRCA 3GJ3A 1G21B 4FGSA 1JPUA 1SCQA 3L1IA 1SOVA 1JHXA 5IN5A 3Q7TA 1W76A 4KSBA 1L9KA 4TUYB 4YIHA 5TRTA 1V9CA 4PV7A 2NZWA 4NTZA 1E3WB 1Y37A 3CUSA 4QDXA 4IPTA 3L04A 4HY3A 4AJ1A 2GTIA 1VQ1A 3EHEA 4MV3A 2DWCA 5AW5A 4XLTA 5GJWC 2Y6UA 3EXEA 1WHTA 4PZAA 4BMDA 2V65A 5IMBA 3WLJA 4HCJA 2CLOB 1GT6A 1DKPA 2HRBA 1WUTA 5KU7A 3OFSA 1CUGA 1B0UA 3ONNA 4EELA 1Z25A 1VP9A 4KSYA 1QIDA 4GMHA 1A7KA 5DLDA 4KLRA 3IILA 4MVJH 1PVVA 3PUWA 5I5GA 3LP8A 3LLUA 3IHKA 4G1UC 5LFAA 4DQDA 1M2VB 5EZYA 4UNRA 4TZTA 2HMVA 4CT0A 4CM7A 4XTCS 4H7FA 1QO9A 1ORRA 2C59A 2EP5A 4MTLA 5CDTA 2A0KA 5B1SA 2I4MA 3RANA 4BS9A 1QYVA 3BEDA 1F2DA 2Z4SA 2FX5A 2GYUA 1RR6A 3N3AC 3BFKA 5DXJA 3SPXA 2DFKB 1JAZA 5CGQB 1PJLA 4J16A 4I50B 1AT1A 2YASA 1T5HX 3FLMA 1KEWA 4S1WA 5FF9A 1GPKA 1ZEMA 1NRXA 1ZOIA 2QNBA 3A1UA 3NM6B 4FE3A 1NXOA 4XGQA 4XKJA 5DYNA 2FN8A 1TVCA 5L53A 3UB2A 2BMFA 2FFRA 1YQQA 2C95A 5ALPA 5SZIA 5FLKA 2OZEA 1Z0SA 5C8YA 4F84A 2ZBEA 3BZUA 1T10A 1KP9A 2PSSA 2MTBA 1M9NA 1HURA 5BV1A 3LX6A 2NT3A 3OJXA 2A6PA 4XB2A 1U1GA 1L5SA 3L8CA 2OO3A 1RADA 2AA3A 4L8LA 3U60B 4FGJA 3VSCA 4Q15A 2F62A 4TV9A 4XWKA 2IHNA 1BW9A 2HCTA 1QG2A 4QEDA 3T9EA 3PFCA 4FFVA 4N3BA 4F93B 3RLIA 2W2PA 2Z95A 3OQJA 1FYDA 5T41A 3SYTA 4BNNA 4E5SA 3RRZA 2XGMA 1OGIA 1WPXA 4F9FA 1P0MA 2G28A 4EFMA 3ICEA 3COSA 2VSFA 2FWIA 4HVTA 3UPDA 3BULA 1I7NA 3LKBA 5FL3A 5JTUA 2I7TA 4A0GA 4S35A 4LDAA 2X2FA 1E1RD 4FYIA 1TEXA 1DJPA 2YVKA 3EVAA 3HYNA 3RGGA 4YUYA 2FQYA 4Q03A 1ISJA 2IYYA 4H1UA 4OYHA 3TGWA 1CY1A 3H3JA 3OJ0A 1LV7A 1U81A 2Q6LA 4Q24A 5FORA 4BQFA 2B1IA 1RRGA 2IU3A 5BOSB 1AN9A 1U04A 1HL3A 1KS9A 2FWPA 3QUBA 4QOGA 2WZBA 3WRYC 2AK3A 4LJRA 4JKOA 2ZYUX 4DJDC 2DFVA 4EJSB 4F4HA 1TF5A 4FKMA 1JDVA 1P5JA 3H0KA 5E6SB 5JO9A 1NYTA 1KJQA 521PA 4IJQA 1W4ZA 1UZLA 1FTGA 3B1WA 1XCJA 4LA4A 1V2HE 3REFA 1B8VA 2WIJA 3W2HA 3LGXA 3G5AA 3W2GA 4EG7A 2AOTA 3ABQB 4N41A 3JQ6A 1LJLA 4PX2A 1P3Y1 4G0WA 2R65A 3N53A 3I58A 3D3NA 4ITRC 3TCKA 4CM1A 2XQVA 3GL9A 4XOUA 3JR3A 2H65A 2O23A 4D9CA 3AR7A 1YDFA 2E4YA 3H4TA 5DM70 3ETJA 1VHDA 2UU9B 3AUTA 1PKEA 2H7CA 1VZ3A 1H2BA 1SULA 1YR8A 1BQ3A 2P9ZA 2ZYIA 3BC1A 3PXCX 4NOLA 4TWRA 4JU9A 4AG5A 2J45A 1WUHS 1DPFA 1N2GA 3DKKA 2ZXEA 2UUCB 3U44A 3E3NA 3KT3A 4PSKA 1NZFA 2Z6QA 1O94D 4WJZA 3T06B 5EQJB 3HP7A 4RHCA 3MTDA 5IUNC 1E3JA 2CXRA 1S7GA 1QYRA 1ZH0A 3OCZA 4OQEA 1M6NA 3FCAA 1ZKMA 4PGFA 1CJKC 4Q4HB 5EXDA 4QT4A 3E03A 1WDKA 2I6FA 4EA6A 1UXOA 4K03A 4RK7A 1JFVA 3FWNA 4US2R 3FOFC 3SX2A 4RY2A 4YP0A 4UUOA 4DV1B 4MQFA 3HXOA 3RS8A 3DV0A 5DULA 4P5DA 4TTQA 4CKBA 2DLCX 3UW1A 1FRQA 1HQCA 3FKSA 4GH5A 4MQUA 3ZCSA 5A71A 4YY3B 1B74A 2XCIA 2P2GA 4TKLA 5H80A 2GSDA 3V2IA 1Z73A 1NJ6A 4RSGA 5F98A 1VM6A 4N5IX 3BCRA 5LM3A 2RG7A 4MUEA 3KL4A 1XG5A 2NXNA 2VEOA 2WSYB 3FSGD 2K2WA 3ZTWA 2XKAA 3L1KA 4BEVA 4LSGA 4KXNA 4M9XA 5JS6A 2AMJA 3A1DA 1XMXA 4B3HA 4GUAA 2IIVA 1PTJC 1P0IA 2OHVA 4D7AA 1E9AA 2B4RO 3EPKA 3F98A 1PFYA 3L41A 3VR2A 5HJ2A 1EQ2A 1FRVA 5DJ5A 1TM7E 5FBHA 3FIJA 4BX0A 1N6LA 2BCJQ 1ST2A 2C78A 4OLHA 4N48A 5GM2A 1E8MA 3WYEA 3IFSA 5FUXA 4X60A 1QH9A 1R37A 1XOIA 4P36A 5ENDA 1UUFA 5KO2A 2IBSA 4UVIA 2P9FA 2YRFA 1JS1X 1TMGE 4OH7A 5ITWA 3H8VA 3TK1A 4TTTS 3HVRA 1TFRA 3U4DA 3DSRA 1T5BA 5AKYA 3DHVA 3DMGA 3QI2A 3WFJA 5EFZA 2Y66A 4H6WA 2IYEA 1DDIA 5C7LO 5J4KA 1P1CA 1UAGA 1N5MA 3SKYA 5DLQC 4A8JA 2XT6A 3ELDA 3DFZA 3TSWA 3WICA 3D2CA 2C98A 4QUKA 4LDJA 4MV1A 3S28A 3MGKA 4DV2B 2BMDA 3EVNA 3O8NA 4LDQA 4NQRA 1Y5NA 3S5UA 3UMSA 4NPCA 4MRAA 2A7XA 3NBAA 2RKOA 2BM0A 1E5VA 2YMMA 3WTBA 5EMNA 4BRSA 1PD0A 3TBKA 3KB8A 2K6GA 3OPYI 3SQWA 1UBTS 5D5QA 3TW6A 4BNKA 2ZULA 4R31A 4LY9A 4F4IA 1YL6A 3C6ZA 1WKVA 2WWVD 3ZU3A 4AJEA 2NPOA 1YRHA 2HLDA 4N1AA 5IW8A 5JVDB 1K3UB 3TJMA 3S8MA 1X2EA 1NDHA 3ZV7A 2H5LA 1C0EA 1YZKA 2PS9A 3M49A 3TZBA 2GK4A 2P9TA 3ZV3A 1LD3A 3PTAA 4DILA 4W6ZA 1DAHA 5BWBA 1UKCA 4M9QA 9LDTA 2UVDA 3LO5A 4JVOA 5ICCA 5F1PA 2GXQA 1EZZA 1KC3A 4WZAE 1EM8A 3BD8A 1K4MA 3BX1A 4LV5B 4BQIA 2O5VA 2SKCA 2XCTB 2EOAA 4ZALA 3FLEA 5IN4A 4XJXA 1XF1A 4ID9A 2H4YA 4U6SA 3IB3A 3GH1A 5LNK6 2W2QA 3P9NA 4MYUA 1DJQA 1LCIA 2AN9A 2R5WA 3G0OA 3D6AA 4D74A 1JWAB 1YFJA 3O2JA 3V46A 1J9EA 4RY9A 2BTQB 2IX3A 3ILXA 1GTSA 2O07A 2ZIFA 3O9ZA 4P08A 4A73A 1W36B 4J7UA 3HKCA 4QXMA 4R5MA 2EATA 2NZYA 3CUUA 1HETA 2GZDA 4YP6A 1BDHA 2O59A 3GVCA 4I6JA 4ND8A 4EHLA 4J1TC 4QOEA 4P9NA 5CB6A 1ISSA 2IEZA 5KHAA 1H2HA 2CL6X 3OZIA 4BATA 4C7JA 4YUWA 2GN0A 1CR2A 3DBVO 1H6BA 3PEFA 4RSMA 3S6JA 4WK0B 2GK7A 2P69A 2PEZA 4NZOA 2OZVA 1GG8A 5L3RA 4KZKA 2BBSA 5FWNA 4R2IA 1SG6A 4A2QA 1Z0DA 3KSUA 3NHWA 1MQ9A 1NY6A 5AWFC 2OP0A 2YVAA 2NYUA 3E5NA 2B7BA 5AVXA 2XAUA 5GIOE 3IHTA 4FE7A 4X6XA 3FDIA 3P32A 1FBNA 2NVUA 3D1LA 4ZT7A 3SJAA 4BNYA 2G06A 4J16C 2RHRA 4ALMA 2HRZA 3W1EA 5AUOB 2WSMA 4IQ8A 4YCNA 4KQFA 2VYQA 4IF6A 2ZLBA 3Q15C 4YREA 5REQA 4CKCB 1G3UA 1ZA2A 1Q57A 4I6GA 2ZITA 3AF2A 3VZCA 3ZIUA 3T4EA 3VFDA 1LJ8A 1XMOB 3MWYW 4RJTA 2E7ZA 2O6HA 2WYWA 4H18A 4RA9A 2J85A 3PHBE 2HA3A 1F6WA 3EDQA 2AR0A 5F4BA 3TTTA 2INGX 4F2DA 3T61A 1T2CA 3ESRA 2H1IA 2IV7A 1IK4A 4I3FA 3FHLA 4MAFA 2M1XA 2C3YA 4M7OA 4M1KA 5ARCA 5DLEA 3TDNA 4AP9A 1DTEA 1LPPA 1QIIA 1R27A 4YB8A 4IIGA 5JC1A 2HBZA 2HCRA 5CVCA 2MYTA 3ML1A 3UFXA 2J4FA 4R9RA 4CI0B 1YL5A 3L4SO 4XDZA 1L6IA 2I2WA 1KZGB 3ZXYA 5AW8A 1P61B 4R2XA 1DV2A 3RUHA 2WMDA 4DRXB 1L5LA 5BMVA 3H1FA 2GLTA 3IAS1 1M34E 1UKEA 1ZM4A 2WLTA 3H0EA 4WXHA 1T8YA 4Y7CA 2Z09A 1EUDA 3I9V6 3GLRA 3GXBA 4OV6B 5DISB 4DLRA 3QNMA 5H82A 4L2IA 5CBPA 1GPNA 1E3DA 3MXOA 2PZ8A 2WG2A 3L0YA 4Z2YA 3VR2D 1ESZA 3K09C 3VPCA 1T2AA 5CCXA 4RVGA 3EUWA 3RIEA 3V80A 3GPLA 1G5RA 1U9IC 1KK3A 1WW3A 3NHBA 4O25A 3EGOA 3IEIA 5JROA 2JF0A 1O6FA 4FUQA 2Y0EA 1HFJA 1RLOA 3C74A 3UAWA 4R3WA 5TGTA 4C1NA 1D2MA 3HCBA 1F0PA 4KQXA 4KMRA 3CB2A 4MA0A 4X20B 2FE1A 5K3DA 1GJRA 1M2WA 3HABA 1C41A 1G7RA 4EUSA 4K3UA 1XZGA 3TLAA 1X7GA 3NDBB 2PD6A 4HYEA 4LGCA 5ABPA 1GZ5A 3VU3A 1IN5A 3IVRA 2XRZA 2DWOA 1O97D 2HDOA 1UZNA 2NW6A 2FPKA 1N6NA 4N5MA 4UNSA 5EKUA 1XZKA 3TQOA 3FZQA 3T7TA 4X64B 4BNUA 2NMVA 1GPMA 3MJVA 4P4UA 3CYFA 4U7TB 3TLYA 4J0JA 4JEMA 4JYBA 1LQTA 4Q02A 1J0CA 4MWBA 3SFTA 3USCS 3KOMA 5MGBA 1PFQA 3AONB 4IZHA 3R3ZA 4V1CA 5JDCA 1GCOA 1FUYB 3H5RA 4ISCA 2OXRA 2W00A 4KQ9A 4OXIA 2M6KA 1UDRA 1NPYA 1X14A 2C9CA 4FCCA 3SFZA 3VZPA 5KKNB 3U80A 2P35A 2NZUG 1XQ9A 2WAMA 4GI1A 4DLSA 4YMGA 5ITSA 5B58T 2PLAA 3ROZA 2PGLA 3G1TA 4GWGA 5JPIA 5JJIA 1UC8A 3MCUA 4R71A 3LT4A 4PFQA 2C5LA 4TTPA 1JN0A 1OXUA 3FGOA 3VKHA 3BWCA 2V3CC 4A92A 1NQWA 3GROA 4PRLA 2G67A 1VG0B 2V7EA 3N8IA 4WZ6A 1QF7A 3GCGA 5F7OA 4JLVA 5ECWA 1WW2A 3W2TA 4UEOA 1R6AA 2A3RA 2QQFA 4HLQB 4EZIA 5K03A 4OL9A 5ULLA 5B7QA 1PLLA 1Q7BA 3Q1LA 1U02A 1DKMA 2WW8A 3INNA 3CKLA 3NONA 2EZTA 4FSXA 4GLFA 3U39A 4D97A 2ZRJA 4N8SA 1JPNA 3A4MA 2LP4Y 4GECA 1N6OA 2QTGA 2BMVA 1EWTA 2VRCD 4F92B 4TM7A 3QFFA 5LD2C 4ZDJA 5J2TA 4GPD1 1G9XA 1I24A 4CLDA 4DV0B 4JYCA 1E4OA 4AY2A 4F4FA 4P83A 3SS9X 2MIIA 3NTVA 1NI3A 2K7ZA 5AVUA 1U4OA 1Z4PX 5D3QA 2YZKA 3K4PA 3TZHA 2IP1A 2KQUA 3ET5A 3GJYA 1F2VA 4Q4JB 4CCAA 3CS3A 3GRPA 4WADA 3DKRA 3W79A 1JECA 5LLSA 3LAWA 3WOVA 4ND4A 4TT3D 4NJEB 4UQLA 3B20A 3FOEC 3IRVA 4OEHA 2IBTA 2RB5A 3ADOA 2ZPUA 1CUSA 3BWYA 2YWFA 2CHQA 3LL4A 5EA2A 1VPEA 2QR2A 4D5EA 2C4HA 1GTJ1 4IDCA 3THRA 1QAMA 2I7DA 4HQ6A 3IKTA 4E1BA 3E5HA 4I1YA 2ORIA 5FP0A 1HSZA 1NW7A 3IBSA 4IUCS 2PL5A 1X86B 5ED0A 3V32A 1ONOA 4QT0A 1KWKA 1L5GB 4A91A