3CNQS

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
b'CVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3cnqS00
1WVMA 3A3PA 3AJ8A 1BH6A 3BPSA 3P5BA 5I9SA 1GA6A 1ZVJA 1TM3E 1Y34E 3BGOS 1TECE 2B6NA 1YJBA 3D9QX 4JP8A 4H6VA 4MZDA 1BFKA 3I37X 1T1EA 1C9MA 2SECE 3VYVA 3TI7A 1Y33E 1AQNA 1YU6A 1R0RE 3HJRA 3LPCA 1R64A 1A2QA 3QTLA 3DDZX 1BE8A 1BJRE 3I30X 2PMWB 2IXTA 5FFNA 1SUBA 2DUJA 4ZARA 1C9JA 4DWWA 1PFGA 5JXGA 1AU9A 2WWTA 1OYOA 4OMCA 3DE5X 1Y4AE 4ZOQI 3WIVA 4WOBA 3SQOA 2E1PA 2ZRQA 3D43A 3Q5GA 1V6CA 1ST3A 1GA1A 1TM1E 3DE2X 1TM5E 1CSEE 1WMEA 3AFGA 3VTAA 1WSDA 4J94A 1SIOA 2ST1A 3DW3X 5SICE 3VHQA 3EIFA 5B1DA 4NE9A 5CW1A 2HPZA 1C9NA 2ID8A 3SICE 3WIUA 2WUWE 1C3LA 2G4VA 4AKSA 1KDZA 1SBNE 1SCNE 1SBHA 2DQKA 1SUEA 4OV6B 1OYVA 1Y3BE 2W2OA 1S01A 3DE3X 2QTWB 1Y9ZA 1MEEA 4KPGA 1YJCA 1T1IA 1P7WA 4KG7A 1SPBS 1V5IA 1JEAA 1T1GA 5B1EA 1TM4E 3GCWA 3PRKE 1WMDA 2X8JB 4B5LA 2DP4E 2Z2YA 1GTL1 3AJ9A 1SUCA 1TM7E 1Y3CE 3ZXXA 2XRMA 1IAVA 5AQEA 3DE4X 1MPTA 1KDYA 3A3OA 1PEKE 2ZWPA 5K7SA 4AKTA 1GCIA 2Z30A 5AVKA 1PTKA 4CFYA 3GT4A 3F49S 1NDQA 2SNIE 3EDYA 5JXHA 3H42B 3EE6A 4DZTA 2Z2XA 1SUPA 3DW1X 4H6WA 3Q40A 3F7OA 3DVQX 3CO0S 3ZXYA 3L1KA 1SBIA 3VSBA 4KB5A 2PKCA 1TO2E 3LPAA 1Y3DE 1EGQA 3GCXA 1TO1E 5JXIA 3DE0X 3OSZA 1SCJA 4BWGA 1SVNA 1P8JA 4DJ5X 4C3VA 4LVNA 2SICE 3BX1A 2W2QA 2SBTA 4K8RB 3DE6X 3DVRX 4WOCA 2Z56A 2PYZA 4I0WB 3TECE 2X8JA 3I2YX 1GT91 1S2NA 3GT3A 5FBZA 1KE2A 1CNMA 1SBTA 5JMOA 3VV2A 4YN3A 1NDUA 4H6XA 2W2PA 4M1ZA 2W2NA 5AMXA 1OT5A 1PJ8A 1ST2A 3UNXA 3DWEX 1SH7A 4GI3A 2PRKA 4CFZA 1Y1KE 2PWBA 3T41A 3F7MA 3QFHA 4HX2A 1AVTA 5ARDA 2Z58A 1BE6A 1Y48E 3DE1X 3WQBA 2IY9A 1GNVA 1THMA 1AH2A 3DYBA 4NE7A 2ZWOA 4NMXB 3VV3A 3DE7X 1TK2A 4LVOA 4C3UA 4OMDA 2TECE 1SUAA 2PQ2A 4RYDA 1DBIA 3DVSX 2Z57A 1KDVA 1Y4DE 2W2MA 2V8BA 3PTLA 1Q5PA 3A3NA 1SCAA 1VSBA 2Z2ZA 1EA7A 1GTJ1 3I34X 1LW6E 1BFUA 4Z2AA 1Y3FE 2HD4A 1HT3A 2ID4A 1S02A 4HVLA 1XF1A 1SELA 1WMFA 5JXJA 1DUIA 1UBNA 5AVJA 1TMGE 1SCDA 2P4EA 4CG0A 3CNQS 5ARBA 2GKOA 1IC6A 5FAXA 1AV7A 1SUDA 1AK9A 2PWAA 1KE1A 1R6VA 1SCBA 1SIUA 1GNSA 2WUVA 4FONA 1GTG1 1YJAA 1ZVKA 3LPDA 1SBCA 1SIBE 3LXUX 1AF4A 2WV7A 3QMPA 1NLUA 1SN7A 3WHIA 2XTJA 3TI9A 5ARCA 1P7VA 1GA4A
chains in the Genus database with same CATH superfamily
3M6FA 4IICA 4Z7QB 2EBFX 3UAZA 2BKXA 2XUFA 3HKDB 3MWLA 3H5LA 3DD5A 4EYOA 3RYCB 2VDWB 5HUHA 2IEIA 2AEFA 5DP2A 4EKYA 2HQBA 2QU8A 3KKQA 4GQIA 5KU1A 3P9YA 2BGIA 2D62A 4QO8A 1YH3A 2NU7B 3LUCA 3ZGVA 2ECOA 3RAEC 1OB2A 4YCNA 4R1OA 3UOAB 3OMXA 4JXJA 3VI4B 3JYHA 5BSHA 1ZNXA 5JZMA 4PNHA 5F4BA 1T10A 2FXVA 1QCDA 1YXMA 2VQ6A 4HWTA 1FFSA 5HFAA 3TMKA 1ZJ5A 3I6YA 5KYUB 4F96A 3ICEA 1ISJA 1R4MB 1SVLA 1ZNQO 4UCWA 1VPTA 5I9LA 2FOLA 3WLHA 2PX6A 2YY6A 5HUJA 5TS3A 2HO5A 2WRZA 2FR8A 3HL0A 3AHFA 4PAQA 1NC1A 3QP9A 1FNCA 1WF6A 4TLEA 4BNNA 1K6MA 4I6JA 4KXVA 1GDDA 2FMFA 2GARA 3FSGA 4JL6A 2WTBA 4LJ5A 5JZVA 5KYGA 3Q72A 4JLKA 4M87A 3DBHB 3WLNA 5JAQA 1Y98A 1ZCFA 3OBBA 5BW4A 1QCYA 2R1ZA 1PX0A 2W4IA 2MINB 4NBTA 2C2HA 2J5KA 3I42A 3MAAC 1Z6XA 3HYNA 2JAOA 3LNCA 3CZ5A 1HDIA 4H4CA 4JODA 3VAAA 5KYKA 1V5WA 2YIMA 5FPHA 1YR7A 5C18A 2VF7A 3JAWA 1JJIA 4GOND 4I55B 3R9WA 3UANA 2HYDA 1QIHA 1YACA 3JQ6A 2XNHA 2QRZA 2C4TA 3T15A 2VSFA 4QA9A 4LBZA 4D9BA 2CB9A 4LK3A 4QOJA 4OQXA 3EARA 3ZCVA 5KOHA 3GYBA 4LY9A 2Z1NA 5IF3A 1YMQA 3HFGA 3I30X 3IKVA 2R65A 3D3WA 3SHOA 3IDZA 4OGLA 3RSSA 3EQ6A 3WWYA 1CVLA 2FWAA 2R7AA 2C9OA 3FJ1A 1KMMA 4ZT6A 1T0UA 1Z0IA 4ZAVA 1VKOA 1VJRA 4KOEC 3ZH2A 3VX3A 4POOA 1OAOC 3KJEA 3GFTA 5FTNA 7YASA 1PZHA 2OBYA 2ZZNA 1HORA 3FY4A 1PEAA 4XR9A 3NHPA 3O7MA 2AV6A 3FCYA 5FBRB 3FJOA 4BRSA 5K8LA 4OJKA 1Y4AE 3KOOA 4UHEA 3OZFA 4X64B 2VAVA 2GK6A 3SSAA 4GE0A 2PRZA 1NXSA 4JBGA 3KEQA 1DEHA 2XLCA 4M6WB 5KJFA 3KFVA 5LZ7A 7GPBA 3Q98A 2V5VA 2G6BA 5CW2A 3EH2A 1C4KA 5SYAA 5B6JA 5BNWA 3IP1A 1GXSA 1RMYA 1E18A 4DSOA 1J2JA 1VP9A 3L9XA 2RHJA 1Z4QA 3OJ0A 5KKAA 4QFCA 4YJKA 1N2IA 1SHKA 3O1JC 1JXMA 2NAPA 4QOFA 3ENKA 2V03A 1OLSB 2DQ4A 2OV6A 3M4ZA 5IPFA 3GFOA 1GGVA 4UUMA 2HCTA 1C8BA 2Z09A 5AW6A 4X0EA 1PGPA 1KERA 2H52A 3DQPA 3AP2A 3QY9A 4D44A 3K1TA 2BTOA 2GWHA 2PAAA 3BIJA 1ORDA 4CM6A 4LV8B 1YQQA 1XROA 3JYPA 4RF3A 4R7GA 5FTWA 1GG2A 2H1RA 3BH0A 2J0VA 3PGJA 2C84A 4MWEA 3OCUA 1K4YA 1P5FA 2IUYA 4PTLA 4HB2A 2JVIA 1EBUA 3GPLA 4UZSA 1DT3A 1UXHA 3CH6A 1PHPA 3UZUA 1YRWA 2Y76A 1DDGA 3OE7D 1DRJA 3OTIA 4EBBA 2YJTD 2Z3VA 4LPSA 1TYCA 3LZ6A 3MM4A 1RLUA 4X00A 5GY7A 1NKSA 4TTIA 1I36A 4GH5A 4UNNA 4G1UC 4OV6B 3WRVA 1ICEA 3PD7A 1C0EA 2Q7OE 2XGOA 1W5TA 3PRHA 3G6KA 2CXTA 1KEKA 5LU8A 3VPXA 2LCFA 3L6EA 3EIWA 2VPIA 3Q7EA 5GVSA 3TIGA 4DR1B 3PV0A 1QAQA 4C29A 1UPCA 4Q0MA 3V3KA 2PUBA 2DH6A 2OBNA 5F33A 4BQIA 2X0EA 4DNXA 2AG5A 2FMIA 3U4QA 1Q22A 2RCYA 4MVJI 1Q1EA 3GCWA 2XOKD 4R98A 4JIGA 4WKNA 1WSBA 2PZLA 2QTHA 2R68A 3G9QA 1J33A 3OEHA 2IHKA 3U17A 3WYFA 2OGZA 1FVHA 4MYDA 3MS2A 3DXZA 4HQLA 4RL4A 4BC1A 1BROA 4HDSA 4BWVA 3CPSA 4WOPA 2P3LA 3DEYX 3DBLA 2GAJA 5EVJA 2QGFA 2C2YA 3ONDA 3IURA 4YV7A 5DX8A 3SYTA 2I4OA 4B4OA 4YRDA 2AOVA 2REQB 5I8WA 2X0RA 3FIUA 3RLFA 5IVPA 3S2EA 1XVAA 3DULA 1XA4A 3SGLA 3S5UA 3W5DA 1HF3A 2D5AA 1U9JA 3IYLW 4X20A 1H2YA 3V46A 1VYUA 3DFIA 3H2ZA 4HPXB 4R9SA 1X94A 4UASA 2IP2A 3PRJA 2FUKA 5TEWA 1WXXA 1O08A 2RAUA 1T8UA 1OI7A 1W0JD 3CKKA 1L7OA 4UTNA 1YUMA 2XZOA 2PZKA 3BWCA 1KYWA 4YUWA 3ASUA 5BQXA 5HIAA 4UQOA 4OGKA 2VJDA 5JH7B 1LPSA 2BC9A 3H2GA 2ES4A 3OAAD 1AK1A 1IB0A 4DEVA 2XWPA 4FM9A 2L18A 2NZWA 3DKKA 2Q5JA 4L4UA 5FBKA 4JR0A 1AG9A 1BYIA 1JEYA 3PDUA 4FZ3A 1ECPA 4RD1A 1MIOA 1ZAYA 5DBHX 3QF4A 1ECBA 1OU4A 1E1RD 2ZUUA 3DAFA 3F49S 5AUPB 5KX5B 1X7YA 4V0ME 3T61A 2H9IA 5CK4A 4U1RA 1DP4A 1Z4KA 3PXBA 4ZEWA 1U9YA 2QPAA 3L06A 3PGA1 1GM5A 3LPMA 4O4HF 1RJWA 1DRUA 4WZBA 3EPHA 4MV6A 3L8HA 2K2WA 1BDMA 4JJ4A 1NMYA 3N5KA 2QJRA 4XUEA 2XVYA 5IHPA 4EZEA 3C97A 2JJ1A 3IXLA 1XTPA 3R75A 4MB6A 1DBWA 2CSXA 2LCQA 3RFFA 2HTFA 2IQ5A 1SUPA 1D1PA 1Z5UA 4G3XA 5LA6A 3SR0A 3CMMA 3EOAI 3LZCA 1TA9A 1NP3A 5BUCA 1C1HA 2NXNA 5JNRA 4WXMA 2RC5A 3S2IA 5HHTA 1ONSA 3L93A 4RSMA 4RETA 3TLJA 3M9WA 5HRAA 4W9NC 1A1VA 4LCEA 1A96A 2V7VA 1JSLA 2F3PA 1H2FA 2JGJA 1ONBA 2V54A 3KDAA 4G41A 4WASA 4D1YA 4Z51A 1Q17A 5EINA 3NCHA 1X9HA 2CLFB 3WYDA 4A0RA 5C32A 3AH8A 4EVQA 3OEEA 3VJMA 4B2PA 3EPKA 4RA9A 1QFMA 3FHTA 3DLHA 1V1JA 3IT2A 2X58A 2R97A 2X77A 3ASZA 4QJBA 3I1YA 4JYMA 4QUKA 1Q1ZA 4HB3A 4TLDA 1TZBA 4P9NA 2SHKA 2OP0A 3GRKA 3HTXA 1CRLA 1FP4B 2UUPA 1N4AA 3TMAA 2ZJ6A 1HT2E 1NONA 2MTBA 4HWKA 4K9OA 2WT4A 3FCUB 3PJFA 4JU8A 4ALIA 4BLQA 4RTLA 4HDCA 1BEUB 3INRA 4JVLA 1R66A 4D26A 3U3RA 1NI5A 2G7ZA 3K05A 1KGDA 5DGIA 1XDBA 4HF7A 5CLGA 2GK4A 4DA7A 2A35A 4NFYA 4FTWA 4FX2A 4ZT3A 1Q7BA 3ZIUA 4NDAA 3IPRA 1U0RA 1B0AA 4Q9AA 5JNWA 4BLVA 1FJXA 1ZM7A 4F9TA 5B3KA 3GT3A 3HUDA 2R6ZA 3MEQA 3SFVA 4QDTA 5TV2A 4JP5A 1T13A 2HNKA 3P52A 3U39A 4A8JB 1TZMA 2G9VA 1WPQA 1O03A 4R1NA 2R60A 5BT8A 2HBZA 1NBOA 1YSCA 2OFOA 2ZT8A 1UDRA 4H6XA 3ED5A 5HZHA 4DV1B 5DYYA 3LC7O 1QH8A 4UVIA 6CHYA 3RANA 4DV6B 5COQA 2RK4A 1DAMA 1L7BA 2GPAA 3C6ZA 3HUTA 2ZLBA 4QYMA 2QX4A 1U7DA 3ZHCA 4E22A 2AIRA 2I2DA 4PCVA 3RM3A 5AVWA 1F7UA 1DKUA 2O5RA 4LXUA 3ZE8A 5JMWA 2PUFA 3ISJA 5BWMA 4DUPA 3GELA 2FPPA 2J3QA 3LMKA 5AICA 4YXWA 3PTZA 5DMHA 3VAYA 3LDHA 3WKDA 1FLDA 3CR7A 1PG5A 4LTDA 2JKZA 2RBEA 3ABIA 4GSKA 2VLIA 1MMFB 2VK8A 1AIPA 1F6BA 1SVOA 4BAZA 3KHSA 3WYNA 5ERGB 4R68A 2OFFA 2DX7A 2YOFA 2R8XA 3KCQA 3R40A 5CAEA 1VXOA 3STVA 2WD7B 2OV1A 1XTKA 2WVJA 2P65A 5HIJA 4LPKA 2M6LA 2BGRA 3U62A 1NFRA 1A8PA 3SBOA 3ZJTA 3DGFC 2YWEA 3QG5A 4C88A 2DEUA 7REQA 1BHO1 1Q74A 2JVKA 3PUHA 2OYSA 3FLAA 2PYDA 3CKLA 1ZUD1 4HMPA 2FSGA 5KVVA 4NMWA 2R62A 3G1TA 3OZEA 2IHTA 3GVIA 2AOTA 1Y63A 2J6HA 3CH7A 4C0HA 5LR6A 1MENA 1HE2A 1RWWA 1F2TB 1SOAA 1IAQA 3GFFA 4MUXA 1X1CA 2QW0X 4F8EA 4RZ2A 3TX6A 4NU6A 2OVBA 1FMLA 4Q1CA 2GN1A 2E4VA 4I5IA 1RKQA 4LHZA 2A0KA 1B0PA 1E1DA 2C5LA 4OHFA 5FIUA 1KK1A 2Q3DA 1KI6B 3H17A 2VJNA 4Y7DA 4FC7A 2J6BA 3T34A 1AS3A 5ES3A 3JRWA 4QPDA 1T3GA 2QD1A 5KREA 4II7A 4F2PA 4FZRA 3RYFA 4Q3LA 4XM1A 1DO8A 2JRLA 2C2KA 3HH8A 2X1VA 3EK2A 3K16A 4EVSA 4EHFA 2CDAA 1KDVA 3F46A 5HQ3B 1FMJA 1UOQA 3FCXA 1WBDA 2QG9A 1RS0A 2WIDA 2ZRMA 3GVPA 5JY6A 2C2XA 2O14A 3A05A 1Q3KA 3N3BC 1JBQA 4RK5A 4HXEB 1T6NA 1T9GR 2V7EA 4KGVA 4DR3B 1TXGA 2JFXA 3E9MA 4ZVVA 4KNVA 2HSZA 4WA8A 2I80A 5ALZA 5FR2A 4BQEA 1EXDA 4RYLA 3CZQA 4FNAA 3CNEA 5HF6A 2ZVQX 4AWBA 3ACCA 5IK2D 2I34A 3GLQA 5A5DA 2Q27A 4F9GA 1WZCA 2AKAB 1Y3FE 4IHJF 3B6EA 4JB8A 4TVKA 3U9TA 1HC7A 2EZUA 3C14C 2ZBPA 4LRSB 5D86A 3SIXA 5CA0B 3HXMA 1U2TA 4N7MA 3X2SA 3IDAA 3LS2A 3ORYA 4KQHA 5F7JA 5K6TA 4LV6A 3WG9A 1GNQA 1KDRA 1X7GA 5SZHB 1EYZA 1C0PA 2FF7A 4KGXA 3QFRA 1MDBA 1VE7A 1FMFA 2G88A 4R3UC 1YD7A 3BE6A 1G6HA 1SG6A 2H8KA 3C16C 4C0QC 2VT7A 2OPHA 4GPIB 4OQLA 2Z3WA 4FDAA 3TXXA 4PQEA 5DLPA 5JQGB 3LC2O 1CRPA 4B3SB 2ILTA 3TNFA 1QR6A 2GEFA 2PGXA 2P9FA 2WOOA 4YDRA 4GI1A 4AYWA 2OZLB 1BXGA 1L4YA 4M1KA 1A8QA 4KODA 3FMVA 5CT6A 4KDCA 3GFSA 3IDQA 5CB4A 2CF6A 3PXEA 5BV1A 1GEEA 2DLNA 2HLPA 1IE3A 3AUUA 4B33A 1USGA 3KM0A 5T57A 2PKXA 1HI9A 2CJXA 2YWCA 3TNLA 2WF8A 2QE6A 3D3KA 3LRTA 4OX9B 1RXSA 1XEXB 1TNDA 3GI1A 1ZUIA 1YJ8A 4KN9S 1H1LB 5ECWA 1Q1AA 5F35A 2VSXA 4B4VA 1AK9A 1JA9A 1BHSA 1NHWA 1XJWA 1XZ8A 1MTOA 1ZD1A 2CXPA 4J16C 4TVBA 3UHPA 3IE1A 1BVYF 4NMLA 3VYWA 3CB4A 1KK2A 5GZ6A 4H08A 1GL3A 3FVWA 4GYKA 4KV7A 4PLVA 4XYEA 1ZVQA 5LYJF 1W88A 2R4UA 5ALSA 4B44A 1QNFA 3L2OB 1TT7A 3MTJA 4FFWA 4IINA 4PG4A 2Q3HA 1U4OA 2GJ4A 4IVQA 4M8NE 1LRKA 4UAVA 3C8ZA 4IBOA 2NG1A 4TWBA 4EB6A 4YRMA 5DRTA 3TD9A 1IBKB 3SDSA 2JDIA 4B83A 2GI4A 4B6OA 1UBRS 2QLJA 4NYMR 4FYHA 3F71A 2DF8A 3A1FA 1YKFA 3HSKA 4K26A 4UBOA 3TQCA 3NATA 3NVAA 3R0JA 4P3YA 3R7BA 4I19A 3W5BA 5IC4A 4EAQA 3JZFA 4NDZA 2Q0SA 1Q7CA 2F62A 2Q0HA 2YW9A 3TBFA 3K70B 2H16A 4OHUA 4P5DA 4RMHA 1UT6A 1YV9A 5C3MA 3TG2A 2X14A 3AVVA 1DBQA 4RL6A 3WI7A 2C7QA 4CKZA 3ODPA 3NFRA 4AWAA 2BGGA 2NU8B 1H5UA 2XD9A 4EYEA 1QOZA 3UK0A 4B46A 5A5FA 3PDHA 3O7WA 3TF5A 2TSYB 3P4XA 1WXHA 3WGHA 2VUTA 4D56A 4EKNB 5CM8B 4TX1A 2GXQA 4XIIA 4KRGA 4ZJZA 2GO7A 1XCGB 2JEZA 1ZVJA 5C0OE 3D6NB 4QJIA 1EMDA 2JZOA 1ISGA 1UP7A 2ORIA 5EWLB 4DCCA 4PSKA 2H31A 2R1VB 3AUFA 3L0OA 4N76A 1H22A 4H3VA 2P2ZA 4KSYA 2Q3JA 4FEYA 1KP9A 4MJ7A 2NYUA 2NUTB 1N2CA 1VSVA 3C5HA 1STOA 4TYPA 2A33A 2A14A 5CFPA 3ZX5A 1W87A 1T6YA 2BDEA 4YRQA 4EA8A 4XRGA 3D8HA 4C14A 4L15A 2A2ZA 2E5WA 1UXJA 3HUFA 1C3JA 4GM0A 1F12A 3DAYA 3ITEA 4F4HA 5KB3A 3PFGA 1V2HE 1WXFA 3DHWC 3KE9A 4S1WA 1UKZA 2SECE 3MGBA 3H2HA 1KOFA 2RFLA 1GQOA 3EIEA 4P53A 3TE7A 5JISA 3CX8A 1CZNA 2BOVA 1HY3A 5IYZB 2GCEA 3IEXA 4YJ2B 1F2UA 4TL6A 3AKZA 1C9EA 1KI9A 4NYJR 5A4DA 2HJRA 2CV2A 4FKZA 5COBA 5AJZA 2JC3A 4IG9A 5BWOA 4B81A 2N3ZA 1N6HA 4FFNA 4G36A 3OA0A 4I1YA 4TRRA 4WN9A 3VPFA 3DR5A 1M1YA 2Y1CA 3G2HA 3PNOA 3ZJVA 1U4SA 4OHXA 1X39A 5KTMA 1LJLA 1E1CA 1XZLA 1ORHA 3NKLA 3AWDA 2C29D 4QWMA 3SE0A 4R9VA 1XMVA 1NOJA 5FPKA 3KAQA 1AKEA 4UULA 1CUSA 2P7IA 4ZARA 2HF9A 3TNDA 3PHLA 1IRIA 3BKXA 4W9NA 3M4YA 5BNTA 5LWQA 3ECCA 2GOYA 3H9JA 3KYBA 2NQ8A 3DLAA 3LVBA 3UW3A 2ICAA 2IIPA 3BXZA 1EB8A 1EWTA 2UZIR 3NJRA 1IN4A 1J7KA 3EVCA 4HFRA 5TQ0B 1TYBE 1G19A 1SCQA 1ZZGA 2I4MA 4XQGA 2P5SA 2BUCA 3N70A 1APBA 3C3BA 5H8WA 3LY8A 3L43A 1DO0A 2GAOA 2Q8PA 3KOYA 1TM2A 1CERA 3TW6A 3BE4A 2YQZA 3IPLA 4G01B 4NENA 3AEUA 5J59A 4F21A 2IXBA 1G9TA 1RHKA 1Y80A 4F1KA 3QJYA 1TCBA 5MDHA 3FR8A 4ZD6A 2GCOA 3GUZA 1YU9A 5ICCA 4LRTB 4UUNA 1J4AA 5B1YA 1II9A 3QBEA 4G0MA 3UB3A 5JJ5A 4S35A 1C2TA 3N74A 4H7KA 1BYUA 2B4AA 2WU1A 3D0QA 2F1OA 5BYBA 3STXA 3RFCA 1F4VA 2CBXA 1F2VA 1N8KA 3MXOA 3OZWA 1D2HA 3SLGA 5LP6F 2IDKA 3IGFA 2JA2A 2ZI6A 3R7FA 1YA4A 5BSUA 3W5UA 2QAGB 1UMCA 1PJBA 4RPKA 5BV0A 1WE2A 1OBOA 1OQAA 3ZKWB 3OLQA 3TLKA 4CG1A 2YV1A 1YC5A 4PIPA 1K4MA 1XZKA 5FBLB 1AUPA 1PSDA 3WMEA 2H5EA 3T3EA 5GONF 1BMDA 4L51A 3VKFA 3M4JA 4D57A 3PNSA 3EIFA 2NZVG 1TZCA 2ZU0C 1NVVR 1Y3HA 4NHOA 1BA2A 3SFZA 2XWQA 1G20E 3JQAA 1ZMTA 3CRMA 3GVHA 1CJBA 2QVGA 3QE2A 4ZWNA 4LKRA 3Q8KA 3UG6A 3FUWA 2AT1A 1ZBQA 3LUHA 3M9XA 4D9CA 1DQNA 2VP5A 3F3YA 4JLSA 3FYCA 2F59A 2H11A 4LKOA 4M9QA 1T4CB 3W7BA 4G4SP 2GN0A 4LUCA 5AVQA 1LS6A 3X1DA 5EP1A 3E9EA 3MZ0A 1QHIA 4MULA 2ZSBA 3OJFA 1VLZA 5HKOA 5EKUA 1ZHHA 2W2OA 1GNRA 3BFPA 2HHJA 2HK6A 3PFFA 4P8RA 5JATA 3NU1A 1ADGA 1UBLS 1LNSA 1LBIA 1G3MA 2PS9A 4GOXA 4PC7A 1GZDA 1I5OA 2DFLA 4LTNA 5AHWA 4ZRMA 4DAEA 1UAGA 3DTVA 5JYBA 4RIGA 5ICMA 2CMHA 1XZJA 1P7WA 3K30A 2QTVA 3BRSA 1ZOOA 4CEIB 2BEUB 2ZUFA 4ERNA 4G89A 1M5RA 1V5IA 4D9NA 5B7QA 5HYVA 4YLEA 1AURA 4ENVA 3WLEA 4IS3A 1Z62A 4IUCS 2FE4A 4FYWA 1CR2A 4CIWA 3W04A 3UA3A 1GLGA 3NUGA 3ZDBA 1LX7A 2XJ9A 3RIEA 3RTAA 1XNQB 4NZMA 3RR2A 1TJPB 1CRWG 1C14A 1XF9A 3AW9A 1U94A 4N65A 2ZTLA 3TLYA 3PUIA 2OAQ1 4LDAA 4TKZA 2C7PA 1ZVVA 4DCGA 3IHWA 3WR5A 7MDHA 3H1BA 2VA8A 3THOA 5HFNA 1UWKA 1CR6A 3THRA 2XB4A 3OU6A 4M54A 2R8YA 2XJ4A 3S1SA 4ABTA 2ZRHA 3BM5A 4KLZA 4TKUB 5G2OA 3TRFA 1Y3CE 3OURA 3I05A 4RQUA 4EP1A 2NO0A 2C8VA 1G7CA 2QG6A 4J7CA 3Q3IA 5AH0A 3RRNA 2CXUA 4CV3A 1TT5B 2OHIA 2XB6A 5DI3B 3HVJA 3ANXA 1MOPA 1NXTA 3BAZA 3OEYA 4RGBA 3TFQA 2P2DA 3EIUA 4OO3A 3ZWDA 1HYEA 1ZWLA 3CUTA 1MPTA 4EHIA 1DHRA 4HLQB 5T6BA 4O4JA 3MRXA 1H2AS 2XUKA 4J0GA 3A3OA 4AMZA 1T3ZA 2H1CA 3RNOA 1J1IA 1I4EB 2HSEA 4HHEA 3RS7A 1DDOA 3AL2A 1EFUA 4CFYA 1WU8A 1EVZA 3MIZA 5C8XA 2CNWD 3W06A 2G80A 1J7JA 2GASA 4W9RA 1NDQA 1SKMA 5KNCA 1GPBA 3M33A 2IU0A 5GJVC 1HOTA 3QKRA 4NOMA 4QX6A 3EDYA 3PPIA 2J1LA 2BFEA 4DZTA 4CMHA 2ZJ7A 3BG5A 1WP4A 1LX6A 3Q4GA 4EYSA 1D6SA 4OFBA 4RAQA 1G8YA 1XXHA 3V1YA 5K9ZA 3GU3A 4OQQA 3QKTA 1H9AA 4DZZA 4TV9F 1Z88A 3L79A 1A9ZA 3ZXYA 2JDID 2F67A 3PDWA 2IPAB 2JLRA 4GZMA 3P9SA 4I4IA 3BERA 1E8NA 4KGDA 2MU1A 4FLEA 3WQSB 2LKDA 4BP1A 4BOYA 4YRNA 3H2BA 4DIMA 5JYDA 3GLGE 2W4QA 4UU7A 2OBBA 4ZIRB 3M49A 1G20B 1DG1G 1VHWA 4MKRA 4RH3A 2JCSA 2SCUA 3ZK8A 5FTKA 3OLVA 1DAEA 2C0CA 4PQRA 1P62B 3REGA 3VR5H 2ZCUA 1ZMXA 1KJJA 2CMGA 3DFUA 5EJ8A 3A1NA 1H3FA 4NAHA 3LGXA 4O33A 2O7QA 4CTMA 5JSZA 2EJBA 2WD9A 4RW0A 2BKAA 2VA9A 4QXRA 3KOMA 4RTMA 2X2OA 4MH0R 3E0XA 1RJGA 2H00A 5TMPA 1LNQA 4PYMA 4PZEA 4UVGA 3HCOA 1QV6A 4OOEA 1PGNA 3NALA 4U0JA 4RJKA 1B8UA 2FKNA 1JNXX 4B3FX 2Q7XA 4ODIA 5J4LA 1WB5A 1ZGAA 3MIIA 3U7EB 4NEGA 1LPMA 1VLMA 3FGOA 4ND6A 4XD7A 2XMRA 3TQQA 3A04A 3T1QA 4YCMA 1CY7A 1H94A 4AN1A 4AVYA 1WDWB 1ZMBA 2IYQA 1J39A 4A0QA 5TIIA 3HDJA 1M7BA 4JVOA 2FP4A 4ND5A 4OHMA 2W8BA 5E2BA 2QP9X 4M49A 5EUMA 3HGTA 3IRVA 3RADC 3VKWA 1IY2A 3S2GA 9MHTA 3O6VA 1J09A 1L4HA 4JQSA 2I76A 1CNMA 2BKVA 4QO7A 5CB0A 3EMDA 2YWFA 2J32A 2OM2A 1HE3A 2XX3A 3L1JA 4L0MA 4L4RA 2NTJA 4CTJA 5IJ9A 2XEXA 1L3IA 1E5XA 1C9KA 2X23A 3C74A 4IIEA 2COKA 4HWGA 4MQBA 2FQWA 1ISIA 5TQ2A 3QSYA 4DE5A 5FR1A 2CD9A 2QTZA 1Q7TA 3MWYW 3OZRA 2BTQA 5CBPB 3OHMA 4QSMA 1G17A 2QN8A 3HRKA 4IMPA 4QQFA 1Q84A 4TGLA 4JI8B 4RSHA 1X7WA 2YOHA 5FLEX 3ZY4A 2ODQA 5BW5A 3P27A 3ZW7A 2XLBA 1PVDA 4DBZA 1G2QA 2ZATA 4C4ZA 3MD9A 1NVAA 5JE8A 1KHTA 5DM2A 5L3VA 4FOTA 3DO5A 5A9RA 1R0BA 2YR0A 4JJZA 3UWPA 2MSLA 4G5XA 3O91A 4IMJB 5EE1A 2FQXA 5T3UA 1GGFA 1GQQA 2B1QA 2DPHA 3KDPA 4QUJA 4EF6A 1CQZA 5LLDA 2A58A 1QIIA 5BV8A 4YDQA 4XIGS 2JIBA 3JQ8A 4GPZA 4I9NA 1U6KA 1XZDA 1LC0A 2F1RA 5KSZA 4NBVA 5DOZA 2VCHA 2WIGA 4DC0A 1NXVA 3P9PA 5EQJB 5HF9A 4J75A 3AFNA 1E4EA 3L8EA 4XUDA 10MHA 4DLYA 3PK0A 4EG1A 4H1UA 2IEAA 3KJNA 3RJ5A 1NFQA 2ZSHA 3HUUA 3KKKA 4Y2RA 1T1JA 2O5EA 1JNYA 3N3AC 4DYHA 5FLYA 4AURA 4DV2B 4R7TA 5K0GA 1R0ZA 4BHTA 4BNHA 1PJTA 4ZVLA 5JS7A 1VL0A 2EOAA 3GLGB 5AHOA 3PDCA 1BXRB 2V6MA 3ETLA 4WQMA 3DLTA 3LVQE 2GUGA 4IHQA 3TIVA 5BV7A 1W46A 1Q7GA 4NP6A 1VKJA 1TYEB 5T4FA 3ABSB 2XMCA 4QYXA 4V24A 3N0RA 3IBYA 4PRKA 1QAMA 2WE7A 2QUAA 4Q93A 3H2KA 1N5JA 4NYMQ 2EKLA 3K6RA 3OA2A 3PYXA 3VVBA 2CKDA 1AKYA 4V1CB 3WLOA 1NQVA 2IF2A 2PTHA 4B3HA 2CVQA 4YH1A 3TK1A 4J1SA 4YONB 5KOJB 1HH4A 5K0TA 2EV9A 1GZSA 1DELA 1PJLA 3PFHA 3UW1A 1P3JA 1Y8ZA 1Q5PA 1X0VA 3JQAD 3WL4A 4JKOA 4ILKA 3NWPA 5IC6A 3M6XA 3ZCTA 1VGVA 3K9LA 4KX5A 4L8FA 1VSBA 5F77A 4GAEA 4CKWA 2Q5CA 1PK7A 1E4VA 3CSDA 2ZUDA 1PNVA 4YMIA 3X44A 1CUJA 3GQBA 1L5YA 4NCKA 1ISPA 4D6XA 1P0CA 4HZGA 1MGPA 2JARA 2OXEA 1HG0A 1TD9A 4L57A 1A27A 3DMNA 4Q1FA 4ZAGA 4OSOA 1GTMA 1PNQA 4DDTA 2WFMA 1AQJA 3A4YA 4TOIA 3E4CA 4XJSA 1QZXA 2V4MA 3PXCX 5AKIA 4FE7A 2OC4A 5DIZA 1KEVA 2ID4A 3FRIA 2XCTB 4OLHA 1GZHB 1PL6A 4DMMA 2O4CA 5CLQA 3SU8A 3HU1A 3WRYC 3DTVD 3GDOA 4XB2A 5JAOA 2H2FA 3MBOA 4YMSA 1FDIA 1II0A 5ALYA 2R25B 4QKQA 3WL8A 5CDHA 4RCYA 4IWNA 4YUXA 2PLWA 1BRMA 1L7RA 2AI3A 2X86A 4MQMA 5C8YA 2EZ4A 2X6QA 1XZPA 3M6WA 3SZRA 3BD9A 3WISA 3BK7A 2PLRA 2ZIAA 4E33A 3AB7A 2OOSA 2JGDB 3B5JA 1B3BA 3F9IA 1TIKA 1CQPA 2JI4A 2C77A 3D6UA 2NSYA 1P9RA 3COYA 4ARVA 2WSMA 1UBNA 1SC1A 2HZBA 2NUPA 3PCXA 1QORA 5FUYA 3E3NA 3GUVA 4AIRA 1EUYA 4BQQA 2J0SA 2ZWMA 3STHA 1E7WA 3EGVA 4ZTBA 5A7GA 3NHAA 1MEJA 1SK8A 2ZROA 4HRXA 2XCRB 2IODA 2DBQA 4E09A 4MGZR 5ALRA 4NYJQ 4O4HB 2QN6A 1J90A 1Q11A 4R2HA 1Z2OX 1MJNA 2H2WA 2H5JA 3IOCA 4LXIA 4JUDX 5K0NA 3U9SA 5EIHA 2X40A 3EFEA 4D3DA 2PRJA 1K7EB 2W48A 4LDNA 3SHFA 5IDXA 2C3PA 1QYDA 1R4NA 3ADPA 4BJ5A 1IK4A 3V9PA 3AX6A 4M1OA 5JR3A 2ZTVA 4HDRA 3UT0A 3CX3A 4OJNA 3ZQ4A 1R6VA 3N2NA 1TL7C 4TMFA 5JI2E 1QIMA 2H7VA 3F6PA 3G2PA 3SN6A 4P4NA 4D0RA 3HM2A 4EUSA 1ACLA 4URXR 4KHPB 4KK3A 5BR8B 3PKJA 3WL7A 4E5DA 3KTAA 3CUEF 4D82A 1QVWA 3HP7A 1JEQA 5FHQA 4BNFA 3E22A 1EWRA 1KQ3A 2CXQA 2XADA 3GGPA 1IPFA 2Q3LA 1OWOA 3L6DA 1AGRA 1D9ZA 3AEQB 3ZDEA 1WV1A 4U7GA 1BCSA 1YC2A 1I1OA 3BXOA 4JK3A 1NW9B 2VPYA 4G0ZA 4JLAA 4TWAA 3ZE0B 2GESA 2QR5A 1PYGA 2JK0A 4CM9A 5KNCD 1U9ZA 4ZTUB 2ZUBA 3DHEA 5HMLA 5L4SA 2FI1A 3B1WA 4LECA 4B3MB 3IMKA 1G64A 4IJMA 2JGFA 4DLAA 1J0AA 4DLXA 2D13A 4Z0NA 3PR1A 1HLGA 3AHEA 4BYMA 1EDEA 4BATA 1YI0A 2ZTSA 3S68A 1V0JA 2FPWA 2PFSA 4BNIA 5D00A 3C4QA 2XE8A 1DKQA 3RAGA 3L7YA 2R85A 1UZLA 3QPVA 1TVEA 2XB9A 1K6JA 3QVSA 1QU2A 3MELA 1M7HA 1I7SB 3B2EA 2IOFA 4I66A 3OQMA 1ZX1A 3QFSA 4MRMA 2VRNA 3I9FA 3LKVA 4JQOA 2K4MA 4BFTA 2PO5A 4TYYA 1O97C 3CVUA 1DV2A 1ZD8A 5CXUA 5JSUA 2O2CA 2IUUA 4WESB 1E89A 4I9GA 5AOAA 4RKQA 2PIDA 3TLBA 4GF5A 1TM3E 4KQ1A 1FRVA 4LNHA 4PNEA 1NVVQ 1I1QB 1DG9A 2WSIA 3BMOA 3SCZA 1RQPA 4M1MA 3LSYA 4P4SB 1CY8A 1SC6A 2BV3A 3N5CA 5CMLA 3RIMA 4GC5A 4NOKA 5IMBA 4JCOA 4BB6A 1SOWA 1IOVA 4K8OA 4MVXA 4RZQA 2Q4OA 2GK3A 1LZKA 1MXFA 2R6HA 5D3KA 2VIIA 1US8B 3E1KA 3WSWA 1H69A 3WA6A 2J9RA 4CR6A 1AE1A 3TI7A 4N4AA 1XVLA 1BEZA 2IPOA 1GPDG 3G2IA 1GVNB 3RPEA 2RHHA 4Z1MA 4LJ4A 2X19A 4LZPA 1HOXA 2GR9A 3RFXA 2X1MA 3IEUA 4M0PA 4P22A 1DIHA 4K9KA 1FYXA 3T99A 4DMHA 1SEPA 2GN2A 5CH8A 3UHOA 3OQVA 1SBQA 2H1VA 1EX6A 5CEFA 1USKA 1YB1A 2X8AA 3AQIA 5TY0A 3M3PA 3LCMA 5FJIA 2H4YA 3K0EA 1P2SA 4R1LA 1MO2A 3ORFA 1HUQA 3W4IA 3ZHRA 4QOGA 2HXYA 4HX5A 1L8LA 3IO3A 5C7IO 4ZEOA 2EFDB 1V11A 3E8XA 1SUBA 4PF1A 4EPWA 4KRFA 4RD3A 3WNBA 1FU4A 5LN1A 1VSUA 4J91A 4M0KA 1IUOA 1OJLA 1DDIA 3AR2A 1N78A 5KVCA 3EEOA 2Y3IA 1GLNA 1NG1A 3QLJA 4G0NA 1DIRA 4GNKA 2HPHA 5D01A 2J5XA 1FEZA 2ZSEA 5D6NA 4C03A 3MGKA 1HFEL 3ELDA 4YP0A 4D9GA 3TAUA 3B20A 1BX3A 1SHTX 1XN1A 4AICA 4UNPA 1PNTA 4FFBB 1U8FO 2Q4EA 4KFRA 4M9ZA 4DQXA 3OJLA 4L4SA 1G0OA 4IDEA 3EZLA 1WCIA 4E14A 2B69A 5ELLA 3LQ1A 1JJFA 2HT6A 4R1QA 1PYOA 3K72B 5DBFA 1GD1O 5H1YA 4EGFA 4F3YA 1NPTO 4H1VA 2VFAA 3WFIA 4F4IA 3GJ6A 2QTAA 3CUSA 4RPHA 5E4JA 3E84A 4KQGA 5IYZA 2HA0A 3ZY5A 4HUQA 1RPZA 3DZ8A 5CVUA 2DPGA 4DHEA 1FW6A 1SXHA 1RYFA 1WMEA 4RPCA 5G4KA 4ATNA 4E6EA 5KC9A 5GIPE 4P3PA 5A2GA 1RRFA 4HOYA 4IY1A 4G0XA 3NS7A 4IPTA 4R8RA 4RGQA 3R0IA 3P71T 4LJ9A 1OWMA 4P83A 5BQFA 1WNTA 3B5IA 2DERA 1TKAA 1UK8A 2VDOB 1WW8A 4H7EA 2ZIXB 1XG5A 3W5SA 4BRUA 1PR3A 5KHLB 2CLIB 2EBWA 5F1PA 3DEZA 1OA1A 1YS2X 5CW1A 1EX7A 1ZJZA 3IAUA 4KVAA 1D4FA 4XRRA 3ZDRA 3SK0A 5BR7A 4ZYXA 1X1EA 3C8MA 4IHJB 4OIFA 4QREA 1SU8A 2Z9DA 1V4VA 3B6ZA 1HK7A 3IR5A 4E2ZA 2OCIA 1BE0A 1O4WA 3FBGA 3H9GA 1X13A 4FZJA 3FKSD 1AQIA 2PKWA 5TNXA 3ETEA 5IM4F 2WE8A 4KC0A 2QUKA 1KZ4A 5A03A 3LQKA 1TU4A 3OX1A 3LDGA 4RH0A 3DE3X 3MWEA 2QTWB 2HL6A 1PT5A 2ZCJA 3RU3A 3IO5A 3VR6H 5HPYB 4CYMA 5HMMA 4FDTA 3R9XB 3F4LA 4G8CA 1R6DA 4GL4A 3JALA 4AF7A 4CQLB 1H4TA 1M2HA 4PLWA 1ZAKA 1XO1A 1RJFA 2WP0A 4G6ZA 3ZD7A 3EXAA 3ILHA 4YGYA 4MZXA 1O7JA 3FNIA 2MOKA 2ZYIA 4MUAA 1JHYA 3I5MA 4TLAA 2ZBQA 1NSTA 1EDZA 5THXA 5FAKA 1MB0A 3VSEA 1TJNA 1V26A 1PR2A 3Q9UA 4H0NA 2QS9A 1FJ2A 3E7XA 4KTVE 4KZPA 4WDQA 4XEHA 1HQCA 3A25A 2XKJE 3EGCA 3J80A 3FA2A 3UPUA 2V4ZA 3C4JA 3CG0A 3EF3A 3K8YA 5LQSA 3ESYA 2D1RA 3QVTA 5J23A 1FFXA 3H13A 2Q6KA 5EVCA 5IZ4A 5A4JA 2RGYA 3IAXA 1CZRA 1P1FA 2W6IA 5HCNA 2EDCA 4M1QA 4EECA 5ITVA 5E6UA 4ARZA 5LYJB 1S2GA 3ZXXA 3U31A 4ARAA 2QXTA 5CK5A 4PBSA 1DCTA 2YCLA 4K87A 5HSGA 1JFSA 3HBLA 4IUBS 3QXJA 2O5VA 3ITKA 1FP7A 3B8HA 4XDHA 8LDHA 2AQIA 3RARA 2I1QA 3BWYA 4BMZA 1C7FA 1NBAA 1S1MA 3SKYA 5IT4A 3WKEA 3ZDZB 4KMRA 2FRDC 3JQEA 1IOZA 3A06A 2YQ4A 5HGJA 5K20A 5KNDA 4L27A 1G66A 3NP9A 4HYEA 4Q3NA 1OFTA 1J5XA 1RI3A 3GRUA 1G8GA 1RBQA 2Q9CA 3G17A 3MLAA 3MA0A 2XDQA 1A3CA 3K15A 3H4MA 4OAQA 2I66A 4X6LA 4JXXA 3GLIB 4JYBA 2HDWA 4E1VA 1HX7A 3L4SO 2EJVA 4HVAA 2CFOA 3BK1A 3T3IA 1YK0A 1J8VA 2WILA 1P9OA 2X1HA 3AI1A 1H6AA 3CUWA 2E4UA 2BMWA 2ODAA 3L1HA 9ABPA 3AB3A 2FOIA 1N8NA 3EFHA 1LUAA 2ISSD 3GGGA 3UJ7A 1EFDN 1F17A 2EQ5A 4LW8A 4N7BA 4KAFA 5EJAA 3UH1A 4AJNA 4WWHA 2ZIWB 3W34A 4D42A 1S8OA 4QTTB 2O20A 4I4TA 4U8HA 1GAEO 4KU4A 3WRYA 1QB8A 2H2AA 1MA3A 2AFIE 1SXJE 2NP6A 3ZWBA 2VF5X 2P3QA 1N8TA 4ZAZA 4BRZA 1ISRA 2ZUEA 4PX9A 2Y1GA 1CU1A 2W98A 1CUVA 2G83A 2V6BA 1YA8A 1HNZB 5EIBC 3T7CA 2FTKE 4PFSA 3LY9A 4WY2A 3C7AA 2WYUA 1MRNA 2GZMA 2OXTA 3DE0X 3EDQA 4Y6SA 2BGLA 4A2WA 2ZE6A 3BXEA 2VSOA 1Z07A 3UCEA 4ZPXA 3UFXA 3KG2A 1P8JA 5ICGA 2J9FA 2ZM6B 3JVEA 2VP6A 3MSCA 2R6CA 3K9BA 3FWPA 3FPSA 1UCFA 1EZZA 1G21A 1I6LA 3A0RB 3KZXA 3ON5A 1FRNA 1VPDA 2R2AA 5JBIA 3N39C 4U5QA 3RTCA 1OKKD 2RI6A 5T4BA 5HQTA 2YS7A 2DZDA 5JXWA 4YJDA 1V95A 1EXNA 3D7RA 4L74A 1PWEA 2VAWA 4BP9A 3ZOZA 2BMAA 5CT8A 1JXOA 2DUUA 4RKFA 3MRSA 1I3OA 4ZGBA 3X1YA 4M9RA 2ZPUA 3RC9A 4IIBA 4KUGA 4ASUD 5EQDA 4E0BA 3L7JA 4FC6A 3LQQA 3UV3A 2INGX 4KW7A 4RV9A 4CV1A 2UUCB 2UZ1A 1OGIA 2EGUA 1N1DA 3PEUA 2C8JA 2QYHA 4NYIR 4P81A 4RV4A 3ZI4A 1GU0A 3LYHA 5KKNB 5L45A 2O3UA 4BTVA 2XTZA 3AR3A 3MPOA 3P9NA 1JECA 3ANSA 3OF3A 1Y1RA 2G28A 3FGZA 3A58B 1XDSA 1FU7A 1QUFA 3SF8A 5C1PA 1FFYA 3PXAA 4QDOA 1WO8A 1VIMA 1ZKDA 2AJDA 3VV2A 4YN3A 3VR3A 1NDUA 3GAFA 1CLUA 1PYDA 1V9CA 3CCCA 1KZGB 4FZ5A 3MN1A 4XQCA 1EZ4A 1WETA 4DOMA 3I6MA 4BNGA 2OORC 1GADO 2DAPA 2XE7A 3TR5A 1L4MA 3W1EA 4JU9A 2R5FA 3IIMA 3C3AA 1NKTA 1UBSB 3VR4A 1HFJA 3H8VA 4FFLA 4WMLA 4D98A 4KZKA 5I9MA 1N0HA 4DIUA 1UK7A 3VPCA 3KB6A 1DTEA 2PRKA 1AA9A 4Q7LA 3NBXX 3D8UA 2AVDA 4JI6B 2PZJA 1ZONA 2AD1A 3GPDG 1JR3A 5LP6B 1NM5C 3OQIB 1CFJA 5FPPA 4GR4A 2UYHA 2ZI7A 2HC9A 1EE9A 3PNQA 4BNWA 3AUKA 2E4ZA 3R8CA 2G1AA 1L7XA 1ND5A 3RG8A 3VNRA 3IHKA 3MBKA 1QIKA 4NK4A 4P3NA 4U2CA 1XMQB 2C3MA 3QFFA 3NHSA 4FGWA 5GONB 1VJ0A 3RKSA 1G6Q1 2B8EA 1U1GA 2DBYA 3F98A 2ZWOA 1G18A 1U5BA 1X1TA 3L0ZA 2QTFA 5SV2A 3SC2A 2Y1XA 4URZR 3QF7A 1KGSA 2P9ZA 2ATVA 3DZHA 3R5HA 3NTOA 4UHDA 4RPLA 2AFIB 4R40A 3N8NA 1SXJB 2ACVA 4XWWA 1JKJB 3C1UA 3QVWA 3DCNA 1P2VA 5BXQC 3KE8A 2PE5A 3DFKA 1X87A 4FFVA 5HJ7A 2FFHA 1I1HA 3AF1A 4TZKA 2AG1A 2ZJBA 4QU9A 3OE1A 4P80A 1WW3A 2UVQA 3MUOA 5E0KB 3MTQA 3L0CA 3I0MA 1NN3A 2ECFA 5JNTA 3EF1A 4JOSA 1H5NA 1XAJA 5F1YA 4ZHQF 1EGAA 3QLEA 4LXQA 1EUDA 5E6RB 4YYEA 4EGJA 4UBJA 5IJ0B 1IYZA 1QIGA 3F7NA 3OKCA 3C7DB 4K03A 4NL4H 4DIFA 3HXLA 1TFUA 3UH0A 4IHAA 4X24A 3PC7A 3UOGA 3INYA 3CZAA 3D4PA 2WR8A 4QJ5A 4YRAA 2I3GA 4RC9A 2JI6A 5KYXB 5M29A 3M1IA 3DC7A 4L5AA 1HE5A 2NNLD 5B3AA 1UBTS 3ZV4A 4F9EA 3EXHC 1EEHA 3GEMA 2CZGA 4IIJF 3V4OA 5K3FB 2XT9A 1KH3A 4O02B 4UM9D 2NPOA 2A9PA 2WYOA 1Z6AA 4L02A 4KWEA 2GZRA 1TU3A 4UD2A 2X0FA 3SLKA 2F8LA 2JG3A 1R37A 2NVUA 4EPTA 5CD9A 1MAAA 4QBKA 1VP3A 2ECQA 2WSLA 3JWGA 3NT2A 1DPFA 1TUBA 1PFUA 3TLMA 5C4GB 3E7DA 2ZETA 4PQFA 4AK9A 4AIIA 4CQJA 4HEHA 4IM7A 2F3UA 1FS5A 4HD8A 5DYIA 4HVLA 2AMJA 3ZZNA 2YHBA 5IG2A 2JFWA 2IDZA 1VHJA 1N9GA 4G1CA 3S2UA 3CWCA 4XPZA 2OAP1 3I12A 4IR7A 4JJGA 4O25A 4BAGA 2YWDA 2GHRA 2I2WA 3GMSA 1WMFA 5KU7A 2XDWA 1V8OA 3JQ9A 2VDVE 2A3NA 3IAHA 3QVOA 4ZJYA 1N0IA 1OAAA 1P31A 1PN3A 4RE6A 2XMGA 4BN5A 2FQ1A 2G1PA 3SC4A 1E2DA 3P2OA 2QRVA 2X5NA 2XAUA 3O3MB 3E53A 4DPKA 1RWOA 3L82B 3RWMB 1EUZA 1R6BX 1SCDA 2O06A 1C81A 1W4BA 3CQ9A 3NHWA 3VRHA 4D8WA 1Y5NA 1RMQA 5IUJC 2RGWA 1A95A 3FAKA 3KKNA 2W6ID 3PSHA 5DT2A 2ERYA 2AK3A 3TZ6A 4FS8A 4X62B 3QE4A 4NJMB 4W1PA 4XXHA 5JJCA 4MK4A 4KCGA 5EJ5A 1IN6A 3GO4A 1P1HA 1KYIA 2PS1A 4MRAA 3CEPB 2BISA 3QELB 4MB2A 2WLSA 2QP3A 2VNKA 3EG9B 3PNBA 4GOKA 1L4BA 3KQPA 4KYIB 1PEYA 1S9HA 1SA0B 1I7DA 1NTOA 2E85A 4TV9B 3DV0B 2O8BB 1M2VA 1KSJA 5K3CA 2CZQA 3NWBA 4ZYUA 4E88A 4BQRA 4AM8A 3AIOA 4NMMA 3UJ6A 2PJUA 2ALJA 2J4DA 2P9HA 3V7WA 1MX5A 2BBWA 4UNIA 5KMGB 1R4AA 3IT0A 1RJEA 1E9VA 4AULA 2ODWA 3GJRA 4A0SA 5F7ZA 4P86A 2DPMA 3L3BA 1KL7A 3CJQA 3RC7A 1SRQA 1RCUA 4UNSA 2JJ2D 3G6WA 2RBGA 3JD2A 3D4NA 1OIWA 3L84A 2VUIB 1EGMB 3ANMA 1T36B 3E70C 1R3DA 1ZC4A 2YZNA 3KKEA 5B30A 3A2NA 5KTNA 2O8FB 3K0SA 2VDQB 3HWRA 5LQDA 2BR5A 3PGMA 4OB7A 4X3PA 1IUPA 2ATCA 2J30A 2Q5IA 3GGSA 5A9SB 1JP7A 5EMHA 4JT9A 4EWLA 4EJFA 2P2NA 4AZ3A 3H9QA 3KB2A 4RNCA 3ZY2A 5JCOC 5F5NA 2BD0A 3IQWA 4FK8A 3UC5A 5I4BA 2H18A 1CEQA 1MGOA 2DPLA 2B1RA 4Z0HO 4KLCA 3SYMA 2RHWA 5IAOA 3ZCQA 5DNYB 3KVRA 3DMPA 1FK8A 2FEMA 1NL3A 4N18A 1FDSA 3HFJA 1MU0A 1SMKA 1JG7A 2H4FA 3MT8A 1WVMA 2FUCA 4UARA 1CNFA 3SHTA 3VH1A 4CUJA 4ZTZB 1FDUA 3SG0A 5EYPB 1BH6A 2GDZA 2H3EA 3P5BA 2HTEA 3WJAA 4M8IA 4PVCA 4C2AA 1GPH1 2QTGA 1QVVA 5EZ6B 3RVQA 3V3TA 5JSFA 1RM5A 2OCYC 4QVGA 5FOUA 2CL0X 4ZRDA 4X5OA 3LW7A 3JPWA 1Y34E 1W19A 2OM6A 1XCMA 5AJHA 4M83A 5F64A 4FUTA 2B6NA 4QPPA 2P41A 1MB9A 4G09A 2JCGA 1U7PA 4BB5A 1XDGA 2FFAA 3VSCA 4H6VA 2I2CA 4DLUA 4IJQA 4A3SA 3K09A 2A4KA 3TGPA 1U2GA 2PSEA 2ZBGA 5HE9A 4ND3A 4M86A 2VCEA 1YGPA 3JQGB 3KQTA 2HCJB 3HO1A 3HJCA 2DMRA 1DB3A 4LF5B 1JH8A 3UWDA 2ZAMA 1Z22A 1HFWA 1P1JA 1BNCA 2BFBA 2QZPA 3G82C 4FOPA 4OXXA 2QBYA 4CIXA 4GSLA 3W5JA 5BSRA 1Z2NX 3KR2A 4CKBA 4G24A 5ULLA 4JSTA 1F6DA 3WGZA 1AF7A 4MYUA 5JMTA 1SAYA 1EBBA 3OC0A 4MQEB 4EG7A 1JEDA 3OMWA 3K9GA 3U80A 3CZRA 1WEHA 1PTJC 3I2IA 3H2IA 5JNVA 3A7DA 1XZHA 3OWXA 1KMHB 5I7WA 1XALA 2CNLA 1M75A 4GBGA 4AUKA 5DTEA 1SRRA 2ID9A 3DJFA 3P9ZA 3K1AA 5FH9A 1X86B 5LJIA 3IKMB 1HL7A 1D1QA 3BB1A 3VJLA 1KO8A 1P74A 3RC1A 3TKAA 4UOEA 5IKEA 4AZ0B 1ICIA 4LC9A 1FDRA 1FNDA 1K6IA 3MQ2A 4LNAA 2EZ8A 4PZCA 3CZMA 3RU9A 4BX0A 3U7JA 2Y92A 2X22A 4HTFB 3T1VA 1SY7A 3QNWA 4M1WA 1AGXA 1OBHA 4MVCA 4ZRNA 1RHRA 5KYYB 2YXDA 4YA6A 1AU9A 2W6JD 1FU8A 1T4BA 2G9ZA 2WWTA 3G2NA 3PKZA 4HYYA 4TXMA 5AKJA 3ZBUA 1FCJA 1T8YA 3H83A 1IB6A 1CEYA 4NBRA 4WN3A 2CHVA 3C1OA 4EX7A 1VOTA 3HWX1 5CPFA 2Q2WA 2ORED 1R0LA 3JVUA 2H63A 2ZRQA 4CLOB 1F51E 1T2UA 1WNFA 2Q1UA 3KR0A 3LWBA 4X94A 2YJ4A 5DO9A 2DRIA 5IH7A 5BWLA 3Q5GA 4PQYA 4EQ6B 2OBMA 1Y8RB 4NCHA 1O97D 4GOMD 5G3YA 5L40A 1AGNA 4IJUA 3BREA 3PITA 3C6XA 4FYYA 2F6RA 2FK7A 1Y4UA 3ONEA 3B13B 3L0PA 4CF3A 3QPUA 4R41A 1TM5E 3GJ8A 2JIZD 4DQLA 3SQMA 3MMZA 1WHTA 5DN6D 1QHXA 3S55A 4AX8A 4BLUA 1CF9A 2FN3A 1NR7A 4LYFA 4RMJA 3QEMB 3S29A 2D59A 4B2IA 1J9ZA 1X15A 2PX5A 3HKDA 3TINA 4C4RA 2D2FA 5DHFA 5GMOA 1GITA 1YTUA 3RYCA 2VDWA 2NTYC 4U7WA 2WJ4A 4MLPA 1VIVA 4L5JA 5CBKA 4QNMA 2HPZA 1D0VA 2NU7A 3GIDA 4INOA 5LBTA 3FWKA 3UT6A 2ID8A 3DMTA 4GFDA 2GN6A 1E69A 3IILA 3LT2A 1EVJA 3O8LA 1UBCA 2JH8A 1KI1A 1AQ6A 1WMSA 2P40A 4DJEC 2WKQA 5KYUA 1BMFD 2YVLA 1R9MA 3A70A 1R4MA 4OHCA 5EJ6A 1Y9JA 1M8PA 3KYCB 1NQ5A 3DHNA 2OORA 3BL5A 3G3EA 2W6MA 4Y2TA 4FEEA 2FLVA 1Z13A 1NURA 2WMDA 1OYVA 1W4LA 2RGNC 3DC2A 3OZ7A 5SY4A 1KSGA 2PL5A 1AZSC 3FGPA 1FFGA 2Q28A 2ONKA 5FBVB 1YQXA 2NIPA 3B6JA 1WCV1 4U9UA 3DBHA 1U4NA 2O5CA 4MGKR 3ZXSA 1CUGA 4OYLA 1E2KA 2I87A 2QL6A 2MINA 1SCUB 2RONA 2JEYA 2B36A 1FFEA 1PFWA 1PW5A 4RHEA 5BNFA 1KY4A 4BB0A 1RPTA 3Q7SA 4TV8F 3JQQA 1B8PA 4NULA 1NM5A 2FN9A 5BVGB 2BY4A 1IXZA 4OI0A 4YFVA 2I67A 3OUTA 2CDCA 4OI1A 2I78A 3LA8A 3ND6A 4TWIA 1TAHA 4GPBA 5JOQA 4D25A 1NR1A 2ZAGA 4Y2VA 4N5LA 3I61A 3LUFA 2G04A 2MYTA 4HRYA 3AJAA 2RB4A 4JA0A 3ENWA 4CCAA 1BU5A 1OZAA 3L7IA 3VXKA 2HMUA 1RACA 1XCOA 3JQFC 4OFXA 3RKUA 4R9UC 2GBLC 5ADHA 5LQAA 4YCLA 3WQQA 2NVBA 5KIAA 3E35A 3UA4A 4FZVA 1LLCA 1GTL1 2P77A 2C8LA 5K8VA 2HGSA 3NVKI 4NYIQ 1I4WA 4ZCIA 2OZPA 4Z3DA 1KEZA 4WPGA 2Z4SA 3SC2B 2JA1A 1P2GA 3BAFA 3OLWA 5FJJA 5K6AA 3VPDA 4RK1A 4A36A 2NV0A 4HKTA 2G1UA 2QEQA 1G5FA 4MW1A 3TDNA 4F6RB 1UAAA 1OC2A 1TRKA 4ACAA 2X4DA 2EFCB 4HP8A 1KI3A 2M32A 3SWWA 3DE4X 1V4BA 2IU4A 2I55A 4K9DA 4M6WA 1GSAA 1QH1B 2W2XA 2W2VA 3PL1A 4PLCA 5DBIA 3OCZA 3ZWQA 2NW6A 1UKEA 5BURA 2WJJA 1J8FA 1G3QA 2IYSA 3PFNA 3ZEIA 4EHDA 4AZTA 3FPKA 3TSYA 3U3KA 3ZOKA 3HB1A 3DZKA 2B2NA 4Y1FA 5GZ3A 2W9XA 4B45A 2IZ7A 4GM4A 4BS9A 1FXWA 3D3JA 3SXUA 1RI1A 4BO4A 2P35A 2VT2A 3HCWA 1OLSA 3NUQA 2EW1A 3SJ7A 2HSDA 4IILA 4Q1DA 3LA6A 5FBWB 4B47A 3M5CA 3GLVA 1X6VA 3HYRA 4PXYA 4ZO8A 1B8VA 3T1YB 3UV6A 1NVTA 1O96B 1H66A 3KWFA 1JF8A 4C6RA 1XX6A 2XA9A 2DQYA 1XSEA 3D59A 5CVJA 2J8ZA 3E5MA 2VP3A 3CO0S 4UTVA 1K5HA 5TMDA 5AVZA 3U3XA 1DI0A 2QG4A 3AP1A 4X8MA 2X7JA 1D8AA 3EQ2A 1YAJA 3B89A 2UUOA 1LF0A 4Q66C 5TEVA 3AKCA 4YMVA 3PFWO 4IW3B 1LV7A 2RGEA 3WJ7A 1F2DA 2QPLA 3F6CA 1LNZA 3HACA 3FMIA 2WWRA 2YV5A 1VMAA 1E9BA 2HHLA 4S0ZA 4NV1A 1K7CA 1P4AA 3HDHA 3D5TA 3QA9A 5BR4A 3ZDXB 5K8TA 3PEYA 1MF7A 4MUBA 4WE3A 1AY0A 2ZWVA 3ONVA 2FU5C 5JVDF 2VYCA 5AM1A 2C5BA 4XGQA 3R6DA 1OA0A 2PLNA 3RS4A 3NIDB 3PC6A 5C31A 3L49A 5K99A 2GCPA 2RHOA 1ND6A 4R2LA 3EJ6A 1NHGA 2YYZA 1M6WA 1TYAE 3SXPA 4NC9A 3T06B 3VDXA 1KFJB 2H07A 1N5DA 4RKWA 3FTNA 5JT1A 3H5OA 2BHLA 5GTDA 6LDHA 2V96A 3V8MA 1DJQA 1PS9A 2I9KA 5LDGA 2FFRA 2I1LA 3RBZA 3EGDB 3DVRX 2W4MA 5HS6A 1BEEA 3VKVA 4D80A 5FULA 1G5HA 3JAWB 3QZUA 1PLJA 4R69A 4LA4A 2HU8A 2PWZA 5LMNB 2X8LA 4CW7A 3WMXA 2ZW9A 2C2OA 5BSEA 1SKQA 3F47A 4JYAB 2QROA 1U8AA 2Q50A 4O5AA 2HLNA 1ZM3A 2G8NA 3UUGA 1ZQ9A 3NDPA 4GR5A 5FBZA 3UPTA 1K3TA 1GZ4A 2H2IA 1P4SA 5FNZA 4EHKA 1BOOA 1ZQ1A 2PIAA 4KXLA 1NMXA 5JHHB 4LXTA 1RZRD 4ZC8A 4WX2B 3TQHA 1KAGA 1J0DA 3Q11A 1BG6A 2QB5A 4ECEA 3K0KA 5CXXA 3CT6A 1TQ6A 1JDJA 1VBFA 1RYZA 1ZUWA 2GN9A 2OAGA 3QOWA 3RI3A 4AN0A 2AXQA 3PUKA 2PGJA 5DHUA 5ALWA 3X2FA 1Y1LA 3HHEA 3KBBA 4W1SA 3ROFA 5JH7A 1UANA 2O3TA 3DWEX 3K1JA 4TTJA 4LC1A 3WDKA 3RS8A 2TRSB 2I29A 4HDKB 1EK2A 4N40A 4C01A 5E8JA 5JCOA 1ADJA 1MD9A 3QK7A 3SVLA 3FHLA 5EPUA 4Y2XA 1YBVA 2A3RA 2ORWA 2E82A 1UZAA 2QTMA 4K46A 1PT8A 4UBLA 5C46F 1T8RA 4Q21A 5JMPA 5KCZA 1OH5A 1IXKA 4G0PA 1GGKA 1JIJA 3ZQKA 2CEAA 4JOCA 3DDHA 3DTNA 5EIBD 1QWOA 1QH9A 5HE8A 1COWD 2B20A 1EJ2A 1HZZA 2FAXA 3AEXA 4BKUA 1SXIA 4TLLB 3RTGA 3KNZA 1YWGO 1IG3A 1XDUA 3ANTA 3NHFA 2CDNA 4IAOA 2QSUA 4L8YA 1AMOA 4O3MA 4P33A 1DBRA 1KMNA 2QM7A 2WPDD 1R8XA 4JT8A 4QDXA 1V47A 3ZXUB 4B74A 5CDUA 1PR9A 4G0VA 4IDFA 4ZQBA 3EHDA 1BKSB 1LDGA 1DKNA 3GDHA 3AQ4A 3AR7A 3Q6MA 3SX4A 4N9QA 1MNAA 4LYHA 2NTNA 1VGQA 1XNRB 2HJWA 4MV5A 3ZPXA 1M5TA 3UCFA 4BMVA 3IAM1 3SP1A 3OD5A 1LS1A 3NWOA 4UQLA 4PBTA 4FGJA 1I5EA 1ZP6A 3LECA 1NUQA 2X3FA 3A0UA 5DNDA 1NVFA 4ZT4A 4DQDA 5B55A 4IYJA 2AW5A 3UHFA 5MN4A 4HFJA 1T4MA 4GZLA 4MVJM 4U7PB 3RCBA 4PX5A 1RLIA 1Y6GA 2O19A 1QH0A 1FP4A 1TLLA 4J0FA 2Z57A 4PSAA 3RTEA 4EEXA 1ZI9A 3O38A 4Q3CA 3ONWA 2JLWA 5EN4A 3N6VA 2LP4Y 5C35A 4WJZA 1PTJA 2C59A 2ADMA 2Z6AA 2AR9A 4JC5A 3WQHA 3FFTA 1ML4A 1OHHD 4OUDB 1OTYA 2K87A 5U9CA 1P2UA 3GEBA 3KEMA 2QAGC 1GRCA 4X3CA 1XZAA 4CCSA 3U4QB 2JFZA 1WX1A 1Z73A 2AOWA 1B2LA 2LUOA 1EA7A 1E6MA 3L02A 1SVWA 2FPSA 2H2HA 3P2EA 4OQDA 4PYLA 2WSSA 3OX3A 3SLRA 5LIRA 2Y9MB 3E9RA 1A4UA 2CHUA 4NRDA 1ZM9A 4Y98A 1TQ4A 4ZXPA 3CR3C 1IK6A 5F98A 4LDJA 3U1BA 3DXXA 2F3QA 5AKKA 2AZTA 2IZZA 4PLPA 4DVGA 1HT3A 1XJQA 3H5IA 4Z8YA 1YE8A 4A8JA 3PX3A 4AUMA 2ZYSA 4PG6A 4RVUA 3DOIA 2H65A 3H65A 5BSKA 1B7GO 1MG5A 3QU4A 1GV0A 1UMBB 2F1KA 4J1TC 1F38A 4EEKA 1NVDA 1QE3A 1XD9A 3AW8A 4R4JA 4ED9A 5CU7A 3ASVA 3G1UA 4A92A 1CP3A 1KP2A 1Z15A 1DC8A 3G0DA 3WZ2A 4TVOA 1PR5A 5K45A 4FE4A 4L0CA 1IXYA 1ZIPA 1FP6A 5EHNA 1N3IA 3S1LA 1ULSA 2J3EA 2VP4A 3AERB 1V7ZA 1Z6TA 2G77B 3O1IC 5EP3A 2X9VA 4JLDA 3AKDA 5FXMA 1IOWA 5FOQA 1JHXA 4Y2UA 1PU2A 4KIFA 5AVJA 5KJEA 1U2DC 2P68A 1DFIA 3L77A 2G0AA 1Y7TA 4CE6A 2P4EA 3BF7A 1PR4A 1L9XA 1XC7A 2RKBA 3EPJA 3U4AA 1N0VC 2BHNA 3UUWA 1MIOB 4DR2B 3GQVA 2G0TA 5LWHA 1XV5A 3QBJA 2Q46A 1BN6A 1KZ6A 1EK1A 2D00A 2WD7A 3TQRA 3ZN2A 3FFXA 3RUDA 1YBAA 3R3UA 1KF0A 3GGOA 5HF5A 2QY6A 4GRIA 3M4NA 4WZBB 4A73A 3WDLA 4BMXA 3LYLA 5FTMA 4P38A 2O50A 4AZWA 2PYIA 5J2TF 5T64A 5A3SA 2OHHA 4Q19A 3QA3E 3FR7A 1Z3CA 4W1QA 1TTQB 1ULUA 2KSQA 2QUBA 3WO1A 3LC1O 1L7DA 5FPTA 1F2TA 2ID7A 1P77A 3GY0A 4UFOA 1F8XA 5K2OA 2V4UA 3AF6A 1RAIA 3FN4A 4DC1A 4D46A 4OIMA 1K68A 2RG7A 4PXSA 5E9AA 5I01A 4B6SA 3O8CA 1KI6A 2FPMA 4GX2A 5G02A 4ZU3A 1MRSA 2I5PO 1CUHA 1TIPA 1J20A 4ZCMA 4L5IA 3HP4A 3IB6A 3GD7A 5C80A 1I6KA 1SIBE 2IBMA 3HNPA 4EY3A 2ONZA 1VG1A 4H7JA 1WRBA 4XQ9A 4CPDA 1URPA 2HM7A 2WIAA 5BWCA 3PFIA 4J76A 4DL9A 3DOOA 5HQ3A 5DNVA 3G7UA 2VTEA 4EL5A 2XTJA 3HCRA 3LL4A 4ER5A 2PZFA 3W9YA 2CF5A 1P7VA 4I6EA 5B7GA 3IAM6 5LQCA 2ILVA 4Z9YA 3ZGYA 3ZX4A 1SR8A 1SOVA 3HUEA 1ZCZA 2CL5A 3OJEA 5IUNC 2FWIA 2P9BA 3AUTA 2EQAA 2HNAA 2OESA 3KHTA 3EVZA 3F97A 3MFYA 4I1VA 1RLOA 3NORA 2DWOA 5BT9A 3ZHXA 4LHEA 3B1ZA 3PQ8A 3ZNPA 4XJVA 3OCJA 2YYSA 3NIBA 5CA0A 4N0DA 3KJGA 1T6BY 1IBSA 4HDOB 3Q2OA 3HU3A 1W73A 2WM9B 1RQRA 4PG8A 2NSDA 1LC3A 3QUAA 1QQ7A 2TMDA 2EFJA 3N0XA 2G6TA 4J3FA 4Y9UA 3VU9B 2Q1YA 5DULA 3SEZA 1R16A 4WCFC 1WXIA 1I51A 5E3JA 1MJGA 1J22A 2HA2A 2ZIFA 3MTEA 4IHKA 4UBIA 1QH8B 2W6CX 5F3RA 4F56A 4M53A 2A0YA 3CT4A 2WWYA 4OEHA 1U3WA 2PKEA 2QLBA 4WFJA 4RD2A 2J59A 1VL8A 5JQGA 4WXEA 1MX1A 4I1RA 1R0RE 3GNLA 2OZLA 3SBDA 1JG6A 3NRJA 4M0CA 4RVFA 2HX1A 4WKBA 5ISMA 4QUIA 1YB6A 4WD3A 4ZT5A 4CMAA 4DUGD 3RK0A 2VQFB 4NI5A 2I3DA 3C3PA 4MV4A 4U2KA 1EHCA 4GZ3A 5H0IA 1XEXA 3TDKA 4XW2A 2V3CC 1H1LA 4Y6OA 2ZXFA 3BD6A 4MVJH 2C58A 4OD0A 1MJFA 3QLTA 4FIDA 2GJKA 4HGRA 2PMWB 2C83A 2O6LA 4IGEA 5DBOA 2D4HA 2OO5C 5U4XA 3GHYA 4DA0A 4DGSA 3U7QB 3INGA 4J1QA 1FE8A 1ATZA 2HJSA 4EYQA 1VBNA 3I72A 3G5TA 5FWXB 2C0QA 3N53A 4W1RA 1TAQA 3S7ZA 2VHVA 3KXLA 4CL8A 1Y81A 3DD1A 4F6CA 5C4IA 4B87A 3CNBA 3FCAA 3A1CA 5EFOA 4NOLA 4WXYB 4EQZA 2NT4A 1GPMA 2YXPX 3RS5A 3GG9A 1GUZA 1N2SA 1PO7A 3ENVA 1T5SA 3NX4A 1HSZA 3PZRA 4R01A 5ALIA 1XN4A 1XTTA 2WWHA 3RRBA 2HUPA 2KM1A 3FMFA 2CJFA 1Y6ZA 3QVXA 4LMAA 1VIYA 2MHCA 4RM3A 1A9OA 1BSVA 5ADWA 3IESA 2HT1A 1UBUS 1WCXA 2FPKA 1CYEA 2Y0CA 3WLTA 2VHUA 1TADA 1KYYA 3UAVA 2GLTA 5TVKA 4CN8A 3ZY3A 3ZE9A 2O9JA 4RADA 1EFAA 4DCUA 2PD4A 2WF6A 1YDGA 5DX0A 3ADOA 2ODTX 1EI9A 2CDRA 1GSOA 5JC8A 1ELOA 4OLAA 5F23A 4IRUB 3WGOA 3IODA 2NU8A 4BN4A 4BBZA 4G85A 4J94A 4NFLA 4BTLA 2NPIA 3BRWD 4IQ0A 4RK6A 1QQTA 5LBUA 1TUIA 3PGKA 1Q0TA 2H7XA 2Z3ZA 3VHQA 4XUGB 5MHTA 4MAAA 4A6DA 4IIJB 3AKYA 4JMPA 1YDMA 3IVMA 4K9QA 3X1WA 2FWJA 1X8LA 1K0FA 2ZSFA 2JANA 3G1WA 5EWLA 1PGJA 3EOZA 3IQIX 2H9YA 2YFQA 1SBNE 1FSSA 3AHGA 4UAJA 4MYRA 2J3JA 1HYBA 2NUTA 2E9SA 2FH5B 4DN6A 1SD1A 1SBHA 4TYNA 3WS7A 5DV9A 1ZSVA 3N8IA 4P7FA 4ETWA 3AO0B 4U7HA 1PHRA 3LTNC 4G5FA 5JFOA 1XFAA 2PD3A 4JB0A 1M2JA 1EE1A 1P5HA 1EP1B 3PHIA 4KPGA 5E2AA 1H3NA 2HIMA 3ROEA 2B1GA 3JD3A 4JVMA 1LLUA 1KOJA 2WAYA 1WUTA 3PLNA 3O2JA 2NT3A 5EP4A 2YW2A 3KUKA 3ONNA 1Z8HA 2OCGA 5D2CA 3V32A 5HKAA 5IMSA 4YJ2A 1WV0A 1JI0A 2YMPA 5COAA 3SZLA 4EVIA 5B1EA 1AB5A 1ZGCA 3F78A 1AQLA 1N3YA 3SYKA 4RQBA 3AY6A 3B3JA 4G9BA 5G1PA 1WM1A 2RGRA 4JELA 1PFYA 2PT6A 3GAMA 2YBDA 4PC2A 2ZBRA 5SY9A 3RVRA 3BHJA 4I08A 5CCEA 4PAMA 2G1JA 2C82A 3WB9A 4YRRA 3CS3A 3FNHA 3SZOA 1JIKA 2GF0A 2IXAA 5I7SA 5LZ2A 3JTEA 4HQOA 4ACBA 1F60A 1L5NA 1FX1A 1SZCA 3VGJA 4DLBA 4QZVA 1EH5A 1QFYA 3AJ9A 2BFWA 3AHHA 2BL4A 2FW7A 3EXG1 3LKBA 5F5XA 1NVMB 3O8RA 1LY1A 2C4HA 1H2RS 1CUUA 1JU4A 4PHCA 1W88B 1LSUA 2YHIB 1SHLA 1TYZA 4RGYA 4XZ3A 3RJZA 2DUWA 3DBVO 3ZQUA 1DAPA 4A9AA 5CFZA 4C7OB 4BN0A 1A98A 4KBFA 1XTUA 4Y18A 2FX5A 4OK5A 2H1WA 1PEKE 1Q57A 2C2WA 2I22A 1OX4B 3I8OA 4O1HA 3A6FA 4R2KA 3JQPA 4ZQFA 3WLFA 1DMRA 5A5EA 5AVKA 4B3IA 4C20A 1JXQA 3PYMA 2QLFA 1N0UA 3NO4A 4G63A 4QU0A 5C1IA 4ZI2A 2C7OA 1KKUA 2ZYWX 3GG2A 4H60A 3QI7A 2I2AA 3H8JA 2R751 3RE1A 3KQQA 4HAIA 1ZOPA 3IFSA 4GVXA 4HS9A 2QAGA 1YULA 4PLYA 4FJ0A 4MS4B 3LWZA 2YRWA 5C7OO 3ZKWA 3JARB 3W1VA 2VKQA 1G3UA 3OQOA 1C30B 3MJ4A 2XYVA 1Z74A 2Z2JA 1X77A 3AXSA 4WZZA 5I6DA 1XVTA 2WUFA 4EF5A 5HGXA 3T7JA 3NHBA 1WDTA 4AKGA 1PZEA 2XMQA 3RG2A 1Q2UA 1Z08A 5CTJA 1TC1A 1UIMA 1P39A 4BVHA 2ZR9A 4Q37A 4JI1B 2OGUA 4DPLA 5BW8A 5J4HA 3E61A 4Z9AA 5LUAA 1YASA 1FMCA 4J1TA 4RCVA 4KPYA 1IWBB 2FSHA 4D4LA 1NVXQ 1GL7A 3QPWA 2WF5A 1T4CA 2G4CA 2PUHA 4UEJA 3A6LA 3ZJ5A 4CM5A 4LOAA 1QRDA 4R05A 3G0HA 1RVV1 3DZJA 3F8WA 4DMKA 2BUBA 3EGOA 2Z8XA 2O7SA 1NJ5A 2GM3A 2FMKA 3ND8A 1VIDA 2CBGA 2O0MA 3QY0A 5BQ3A 2OC9A 4K9PA 2X9LA 1SB8A 3N6RA 3N2LA 1H9CA 1ZO8A 4LTMA 4MEBA 2YDYA 1YJQA 3NT5A 3DGEC 3CKMA 3OHPA 4FXOA 1KS9A 3LQYA 1QZUA 1TA0A 4YCAA 3KV3O 1NT4A 4GYWA 4TLCA 4C3VA 1MG0A 3OQHA 2BEUA 4FLMA 3BFJA 4QEDA 4ZQIA 4CEIA 4MA4A 1QK5A 3CN7A 3DPSA 4IH9A 2HA6A 5ESDA 2JFNA 2X0KA 4PPQA 3FUTA 5EERA 1GFWA 3MS7A 5HM8A 2W6NA 4LWQA 4EI7A 2F3RA 1IQRA 4TZ0A 1NN5A 4BO6A 1U7OA 1H9BA 1X92A 4M2LA 3GFPA 3G5AA 1IEVA 3NJ8A 1N8SA 2FZKA 1GTSA 4WN9B 2QF7A 1HDCA 2Q3MA 1CBUA 3H3XA 2BM8A 1V8PA 3GD5A 1R0SA 2P79A 4J90A 4Q02A 5DSXA 5U4QA 4EG6A 2HW8A 1E1CB 1U0NA 4OXRA 5HS4A 2J9GA 1A71A 3IEVA 3R2JA 4TKUA 3AZOA 3IEIA 5BPFA 2PZ8A 4F3KA 1P6QA 3CE9A 2P4HX 3W5CA 1Q6YA 2OECA 4YO8A 4F97A 1OH8A 3DOCA 4P4UA 2X8BA 4OBBA 5BW6B 3HCNA 2YHSA 1XLTA 5DI3A 2C1ZA 4ZCLA 4I8DA 1FYFA 1L2TA 1GIAA 1GLVA 1P2FA 2OV2A 2H3HA 1ST2A 2R7MA 3C8HA 4WZ6A 5D3ZA 4BV3A 4FOOA 5IT5A 3RJMA 2BGWA 2BEJA 1R5NA 2AOUB 4I9UA 1X9GA 4K88A 5CEJA 1QPZA 3LU1A 4NATA 2AYXA 3JYNA 4AG3A 3BWBA 4RPJA 2E0IA 1M2FA 4NZZA 1KAEA 4CFZA 1GFIA 2QAJA 1VA4A 3G85A 4PX2A 1M6EX 2JB9A 4Y1RB 1JHPA 3VISA 1FTYA 1X7XB 1QFXA 1U1EA 4B48A 3LX6A 1NA5A 2XTAA 2Z9BA 3G68A 4IDHA 2P0YA 2WLTA 4UUBA 2HBQA 3SR3A 3W2TA 4LV5B 1JB1A 4RKYA 2Z5VA 3MGCA 1OROA 3TQIA 4RDCA 3AV3A 2ZSDA 1GN9A 3MC1A 4WA7A 4MKFA 4V0QA 2HHHB 3E1SA 4JKIA 1ADCA 2OG1A 5DGHA 1HE4A 3ROZA 1K2WA 1NYRA 2ZRDA 4BX3A 2H0QA 4LN1A 4AF6A 2VPWA 4L78A 4B7CA 1NXWA 4DM4A 5GP1A 1I10A 3PWKA 4PC3A 1KWKA 1JFLA 1IULA 1JILA 2AFHE 2EZ9A 4KLAA 1G20A 2FRVA 3Q5EA 4PYJA 3RHTA 3OZCA 4MV1A 4DQKA 3TTXA 3ZWAA 4BVBA 3IXMA 4DDVA 4ZEVA 2ADOA 1GTRA 1N1GA 4HAYA 4OMDA 5ER9A 1XKXA 2EC5A 2VSYA 3OO0A 4MS3B 2CV1A 3ANYB 2VCYA 3LG2A 4LGYA 1QLJA 2OO3A 4RHCA 1E0KA 4RF5A 4KK4A 4EHBA 3DVAB 5IFKA 4Z4EA 1PVVA 1RTKA 3VH3A 4DSZA 5BNZA 4F0JA 2HV9A 2FZEA 2XQVA 4ML3A 3ZGNA 2JASA 3IUQA 2JZCA 4N41A 3PLAE 2BF4A 1SWVA 1VE3A 2IY7A 2NU9B 3ZD8A 4R2IA 3SIRA 4DG5A 2QMEA 1Y9AA 4TV8B 3DTVB 1M6YA 2W2MA 3FTQA 1UJ4A 5CM2Z 3PIDA 2CJPA 2C00A 2MWMA 2WJVA 3A3KA 3GBVA 1QG0A 2QLTA 3GP3A 1GZ3A 4FFMA 2I3BA 4RACA 5DM60 3ADBA 2A9VA 4FGZA 4D4KA 1J2YA 4INAA 3ZBPA 4U7DA 2OO5A 3IV7A 3QXSA 1MVNA 5FTLA 4ZOLB 5LQRA 3PJDA 4JBXA 1XQ1A 3NTLA 4CQMD 5E95A 4YR7A 4V3BA 4DV0B 3OPXA 5MFPA 3OFSA 2HRZA 5E38A 3RVSA 4EI8A 1FFHA 3HPQA 3OIFA 1QGOA 5IKPA 3UHAA 4C6TB 3W90A 1L5RA 3KJFA 3ZEAA 4YT5A 3MTAA 4X7PA 3V9AA 1ZN9A 3HZOA 3Q6NA 5JG7A 2FPUA 4MP6A 4EZIA 4QEKA 2GHTA 4YAKA 2Z4RA 1MFPA 1UQUA 3WIBA 5C8ZA 5CBPA 2X0JA 3BJRA 3L4BC 3ZIDA 4GI5A 1RQNA 2GH1A 5TX7A 1E3EA 3NH9A 4JBWA 5HKKD 1I32A 2OQ2A 4S12A 1ZD4A 1JJAA 1KQNA 3RJTA 2BBSA 2VPPA 2PH7A 3JR7A 3MUFA 4PZUA 4YDHB 4JWKA 1G3RA 5CJ2A 2COUA 3PFCA 3DEIA 3GX1A 4FBGA 2QX7A 5IDYA 1DIBA 4FJ2A 4EUFA 3TVTA 3TOVA 3P2YA 4C08A 3PHCA 3OLXA 1HLFA 1XTBA 3EOBI 5JTTA 2RGXA 1KEWA 4J4BA 4D5GA 3ZHOA 3GXOA 3LUAA 1JPUA 2XCOA 1E9SA 1DCKA 4MW6A 1U5CA 2I62A 3ZBTA 1PZGA 4TL9A 2NAFA 5FOVA 1J21A 3GGCA 1HDXA 5J4VA 1BHJA 2YZKA 3OICA 1ZA2A 1UP4A 2FV8A 2GMWA 3LVRE 4IQFA 4KQJA 3GOHA 3WWCA 1ORWA 1VKHA 2BFEB 3G23A 2CSUA 1TOAA 4HL6A 3UAGA 3ZLUA 3DT8A 3R4CA 1NF2A 4Z9BA 1ZY2A 2OT3B 3GAZA 1HFKA 1QCZA 1ZVMA 2Z8YM 2WG0A 3G89A 3UJAA 2LRHA 2WDZA 2CJYA 3PUYA 1QTNA 3TCKA 3UIEA 3TNYA 4GR9A 2AX4A 1E5TA 3HA3A 4Q9KA 2PKYX 2B9VA 3NANA 2JIDA 2W6OA 4ZVSA 1E7YA 3TDMA 1R6XA 3GLGA 1BXRA 3M3HA 4NBKA 3D1LA 2IJGX 4QVIA 2AFHB 2JJ8A 4M22A 3QHAA 2AC7A 1GGNA 2G07A 3QVUA 2VUHB 3LHSA 4LSMA 3A1SA 4QYSA 4AO7A 3IERA 4EJSC 4J0EA 1G5RA 2UV8A 5EGSA 5JVDB 1XZIA 2WV7A 2YXLA 4RCZA 3R9IA 1I01A 4L3VA 3NXSA 4L6AA 5KOJA 3ZVKA 1W47A 5TGDA 3WHIA 3CE6A 1LDMA 1B2RA 1FYEA 2IL1A 3X43A 1JVBA 3PEVA 4M88A 2QQEA 2AF3C 4PQGA 2HWKA 2W43A 1YZKA 5CDGA 3DL7A 3V1LA 5KAPA 1DFGA 1ZMRA 3GJ3A 3E81A 1M8KA 2BFPA 2E4WA 2E87A 4UUAA 4EGSA 3OE4A 4AJ9A 5KYNA 1BDIA 4DJDC 2I54A 4HN9A 2NNWB 4H31A 4W5HA 4GLLA 3QV1A 5FPYA 3PEEA 4UREA 3IAFA 1Q0UA 2PWPA 4AJ1A 4TSRA 3H1FA 5TE9A 2WF7A 3UJCA 2PCLA 1X8XA 1Z5WA 1LXCA 4G2NA 4GX5A 3H9BA 4UTOA 3ROMA 4KIUA 2XNCA 1IN1A 1UJCA 3HPRA 2VL7A 4JP8A 2GEUA 2A1TS 1UT8A 4RQTA 3RVJA 1P0MA 2AG0A 5E7MA 5IJ9B 3VVCA 1SQ0A 1CZHA 4UOZA 2C9BA