3CNQS

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
CVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3cnqS00
2XRMA 2WUWE 5JXIA 1NLUA 1IC6A 4CG0A 3DE1X 5CW1A 2SICE 2GKOA 1MPTA 1T1EA 1OT5A 2Z58A 3DWEX 2SBTA 2W2PA 1T1GA 3LPDA 1ST3A 1WSDA 4H6WA 3LPAA 1UBNA 2IY9A 2ST1A 3DW3X 4DWWA 1Y3DE 1OYVA 4WOCA 1AF4A 2HPZA 3A3PA 5B1DA 2PRKA 3QFHA 2ID8A 1Y4AE 2WWTA 3HJRA 2SECE 3VHQA 5FAXA 1PFGA 1GTG1 2ID4A 1P8JA 1BFKA 3I34X 4NE7A 1WMEA 1P7WA 1TECE 1S02A 3DYBA 4LVNA 5B1EA 1SIBE 1SBTA 2XTJA 3H42B 2DP4E 3L1KA 5ARDA 3TI7A 3D43A 3F49S 3DVRX 1AV7A 3T41A 1TM1E 5ARCA 4ZARA 4HVLA 4OMCA 1S01A 1TM4E 1AU9A 1GNVA 1SUCA 1PJ8A 1CSEE 4J94A 3WHIA 4B5LA 3ZXYA 4C3UA 3AJ8A 1ZVKA 1GCIA 3Q5GA 1C3LA 3PRKE 4RYDA 4CFZA 1SN7A 4NE9A 1V5IA 1C9JA 3DVQX 3EE6A 1VSBA 4M1ZA 4LVOA 3A3OA 2Z2YA 4Z2AA 1P7VA 3DE7X 1SIOA 3F7MA 4AKTA 2ZWPA 1DUIA 1IAVA 4JP8A 2E1PA 2QTWB 4I0WB 2Z30A 1SCJA 1Y1KE 3WIVA 3SQOA 3DE3X 1YU6A 1BE6A 3VTAA 2B6NA 1BH6A 3Q40A 1LW6E 5I9SA 1TM7E 4H6XA 2W2OA 3EDYA 2X8JB 3I2YX 1AVTA 1KDYA 2Z56A 3D9QX 3OSZA 5K7SA 1SCDA 2PKCA 3F7OA 4KG7A 1C9NA 4MZDA 5AVJA 1R6VA 1AK9A 1Y33E 4KB5A 1TO1E 4FONA 1SELA 3AJ9A 5AMXA 1Y9ZA 1GTL1 1AH2A 1HT3A 3DE4X 4K8RB 1BE8A 4YN3A 1GT91 2DQKA 2DUJA 1EA7A 1XF1A 2P4EA 1R64A 2Z2XA 1AQNA 3I30X 1TK2A 1NDQA 4ZOQI 1SCAA 1T1IA 1Y3CE 2Z2ZA 1KE1A 2W2NA 1SIUA 2HD4A 1SUPA 1NDUA 1Y4DE 3AFGA 3EIFA 4OMDA 1C9MA 1THMA 1SBHA 5AQEA 2IXTA 2X8JA 1BJRE 4WOBA 1YJAA 1GA6A 1WMDA 3DE5X 2W2QA 3QMPA 1SUAA 2WV7A 1ST2A 2PYZA 3LPCA 2W2MA 1WMFA 3WIUA 4HX2A 1SBCA 1SUBA 1SUEA 4AKSA 1Y3FE 5FFNA 3P5BA 1CNMA 2TECE 4NMXB 5JXHA 1Y48E 1SPBS 5AVKA 4DJ5X 4DZTA 1S2NA 2V8BA 3I37X 5FBZA 2PWBA 1SBNE 3A3NA 4BWGA 1YJCA 1GA1A 1TMGE 1SCNE 1SUDA 4OV6B 2ZWOA 2Z57A 1KDVA 3BPSA 2WUVA 3BGOS 3GCWA 1KE2A 2SNIE 1WVMA 2G4VA 3DVSX 2ZRQA 1TM5E 1A2QA 1SH7A 1BFUA 2PQ2A 2PMWB 3VV2A 1PEKE 3DDZX 1Y34E 1YJBA 1SVNA 3GCXA 1JEAA 4C3VA 3LXUX 1PTKA 1MEEA 4H6VA 5JXJA 1GA4A 1Q5PA 3QTLA 1DBIA 3TI9A 5JMOA 1TO2E 3ZXXA 4GI3A 1GTJ1 1R0RE 1Y3BE 3DW1X 1V6CA 1GNSA 1KDZA 3WQBA 3DE2X 1TM3E 3GT3A 1ZVJA 4CFYA 5SICE 3CNQS 4KPGA 3PTLA 3SICE 3VYVA 3UNXA 1SCBA 3DE6X 3DE0X 3CO0S 3TECE 5JXGA 1EGQA 1SBIA 3GT4A 3VV3A 1OYOA 5ARBA 3VSBA 2PWAA 3BX1A
chains in the Genus database with same CATH superfamily
3O83A 4ZYTA 2Z98A 1IATA 4B6SA 1U0OC 2E7ZA 3TVYA 1QHSA 6YASA 5KS2A 5AKEA 2MINB 5JXIA 2IOYA 2IYFA 2JFWA 4R3NA 1LPNA 3LO8A 4Q5IA 4UHKA 3QZUA 1VI5A 5DIZA 1A9PA 3TMAA 3HNRA 3ADOA 1IXZA 3D1LA 3OF3A 4OJNA 1N3LA 2D5BA 1UKAA 1W1UA 3IIEA 5A4AA 5AJYA 4UOZA 3L92A 3NBAA 4GBMA 2ZSDA 4AS1A 3IMEA 4HZIA 3ZHUA 2LP4Y 2VEOA 4MQBA 3EZ7A 4O4HF 1X2EA 1EM6A 1DEKA 4EQZA 4MHTA 3D81A 1EQUA 3G9QA 3NTQA 4MEAA 3UO8B 1DUSA 5K5EA 3E05A 2C3UA 4CV3A 1STOA 1YI0A 5KMGA 4KRGA 1Y98A 4C0AC 2JBWA 3BXFA 1ZH6A 4O4LA 1FUYB 2YJ3A 3W2IA 1CF4A 4DTIA 4Y2XA 5J23A 1AGNA 1Z17A 3R23A 4JLMA 4ZHQB 1SC4A 2V8OA 3KQMA 3T5TA 4KHPB 4GX2A 1MABB 3GRFA 4PZLA 1YI1A 3E9QA 5ADUS 1LJLA 1XPUA 1UBNA 2YBEA 4GOXA 4BBPA 3DTNA 5JADA 1XALA 1SEPA 1UKCA 1J2RA 5KOJB 2COUA 2X7HA 2ZUTA 1XFDA 3IO3A 3N8IA 4OQFA 4ZRMA 3V5NA 3OOSA 5C5EA 5FTJA 4RH1A 4G89A 5ALEA 2VYND 1SVKA 4OK3A 4DAOA 4ZRDA 1UR5A 3C15C 5FI5A 4XRGA 5HBGA 2H17A 3EPJA 2NSYA 4Z4IA 5AFSA 4QUDA 5BVGB 2XAUA 4BVKA 4KAXA 4IQGA 1MB9A 5LBUA 4G84A 5K8UA 2WA1A 2ZJ8A 4KQWA 4G1MB 4DY4A 2XYHA 1RD4A 2RHTA 5AK6A 1OFTA 1VSTA 1A04A 1SBZA 2W58A 4K6KA 1B0UA 5F1OA 3V1YA 4CM4A 3T1TA 2C5EA 1IQRA 4HTAA 5A3RA 3ON5A 3GJSA 2Q49A 8ADHA 3GT7A 1ZLXA 4C04A 2Q3HA 3N0TA 4ZJPA 4BWYA 4DV1B 3UJ9A 1C4OA 4CTJA 1V43A 1LV8A 4KN8A 1RYDA 4BB0A 3GP5A 4BNFA 3AILA 2XUKA 1Z4NA 4M8NE 1S02A 4CQMA 1K7CA 1FPMA 1TTTA 5JSFA 1WHSB 3IUNA 1HH4A 4PZ0A 4DA7A 4YCMA 3PDJA 1HEUA 4GPIB 1MB3A 3UT5B 4W63A 2LCQA 4C0SA 4DB2A 1QIKA 3H9QA 5B1EA 3KZOA 4R3WA 2C7RA 3RRBA 1JILA 4AFNA 3EOAI 2CYCA 3N07A 4C7KA 2XKJE 2DZDA 2C58A 4M49A 3CJTA 1BMDA 3JARB 4NYMR 1LW7A 3BGVA 1WDLA 3HVHA 4UQPA 3SY8A 5F9FA 3A7EA 2DP4E 1CB7A 2O2ZA 1WZNA 2Q1XA 4BNUA 4GBJA 1JU4A 4N3NA 2C7GA 5KIAA 3O90A 3RS3A 1KY4A 1YZYA 1U8UA 2P0EA 4BO2A 3SD7A 2FZCA 3AT1A 4MGKR 1CNFA 1BVRA 4L5IA 1KI4A 1US8B 4EFLA 3T41A 3W8RA 2EHDA 4FCVA 5BP7A 3GVCA 5C8YB 1R0BA 4FBGA 1U94A 4O8CA 4RFSA 1DI0A 3G7NA 4BPRA 1NOIA 5CTJA 4TTAA 5LDHA 1BD4A 1JLSA 4I9NA 2ACKA 3N58A 2WMYA 2I3DA 3EVBA 4LNUA 5E2IA 3CVJA 1AHNA 1B4DA 1F6WA 3EVAA 1UFOA 4J1TC 2AJDA 4JYAB 1P4GA 2MYPA 1MT0A 4E5UA 2A88A 1UT6A 1XV5A 4MX8A 3DC2A 3ICQB 2O1SA 3KKZA 2XDQA 2BUBA 4E14A 2ZAIA 5HE8A 4F5WA 1DUVG 4JR0A 5E7IA 2HMSA 5GM2A 1TUBB 4R98A 5CFQA 1X7XA 1FVXA 3Q3HA 1HF3A 1TT5A 3LOQA 5GM1A 3A28A 1J8QA 3AUXA 4MVWA 3CUSA 4R0MA 4IWNA 3ZIAD 2HEIA 1PEDA 1E7YA 5ENDA 2BE9A 4C6HA 1G8JA 3IXQA 1I7PA 1NHWA 1E94E 1C3LA 3PUHA 2IFTA 4RYDA 1XMQB 3TOZA 4GPEA 3G1TA 1K63A 2AB0A 1H8HD 2P30A 1GPLA 3DL2A 1XCMA 3G68A 3IPYA 2YXEA 3W5UA 1H3EA 2V3WA 3ZQ6A 5BV2P 4ZZ3A 1M2FA 1NBAA 1TQ4A 2ZR7A 3L7OA 4J0JA 3IIJA 2RH5A 3IT0A 4F3TA 3U1VA 2AE2A 3O2SB 4L78A 4D26A 2O2XA 1KZ9A 3KQKA 4KXVA 3N39C 1H93A 3Q5DA 4IYRA 4KO2S 1P7VA 2PZKA 3QX8A 4N3BA 4D4HA 1PDVA 1ML4A 2C98A 3F7MA 2HMAA 1D9ZA 3QLEA 5LNK1 2P3SA 2VJNA 3LJKA 2B4YA 4C0JA 2O7VA 2ZBVA 4EGFA 1NVWQ 4BU1A 4I8DA 1P2GA 1X1RA 2VF2A 1K97A 3A4MA 4GR9A 4OGFA 3SOZA 4QU0A 4KGZA 2ZRKA 1JR2A 2E1PA 2P1ZA 2JL1A 4NYIR 4XKJA 5AWFC 221PA 4LCBA 2VYVD 3WK5A 4YRCA 4CDRA 2OFXA 2J67A 3UOGA 2J9FB 4ZC1A 2C99A 3V8PA 2R8ZA 3WBFA 4MV1A 5BUSA 3LQFA 3F6BX 1WE2A 4JLPA 1FB5A 3SQOA 3JQRA 3O95A 1OROA 1VJ1A 2NO4A 3DE3X 2R3SA 5F4ZA 2ZUFA 3SNKA 1MVNA 2FVXA 4LHYA 3FE2A 1BH2A 4YJFA 3VYRB 4AJ9A 4ZOCA 2P79A 3D0KA 4H4EA 4P3KA 4FCWA 5JEDA 1NQVA 2DJIA 2VRCD 4YACA 3VJLA 1U3TA 2YC4C 4D80A 3LVRE 5FOWA 3OU7A 3VPSA 3LTNC 2XD4A 1UODA 2ZRGA 2HHCA 3KYCA 3DXZA 3TVTA 2IEIA 1OXXK 4OI1A 3EIOA 2D00A 1J0DA 3RBVA 3R0ZA 3IUYA 5EJAA 4M6WA 3RLFA 5T4HA 4PO1A 4YPVA 5K05A 1J6UA 1I9GA 1Q7CA 5CX1B 1Q16A 5AOCA 3F0TA 3PWTA 3AR5A 4UEWA 5B4UA 5L7TA 1F7UA 5CA0A 4IMRA 3SIRA 4JP2A 5I9TA 4HWPA 1C3OA 3EDYA 2CL6X 2V6FA 3G2NA 3I2YX 4A27A 1AVTA 5JJ5A 4KQMA 1UANA 5ALDA 2UYCA 1X6VA 4FGZA 2PMKA 4B6GA 4EO4A 5KYVA 3TB4A 2IL1A 2OLJA 5FUMA 1I3OA 4KG7A 4U2EA 4X1KB 3FJ1A 3FWPA 3AUSA 1YI8A 3PUZA 1AK9A 2IEGA 3EFOB 4D0RA 4QFCA 3ZW7A 4IEIA 3RCBA 1NQTA 3VH3A 4B75A 3BRWA 2W2KB 3RJZA 2J3HA 4CEJB 2X6RA 3RAPR 2FSHA 1HDXA 1AH2A 3HVIA 2G3YA 4R05A 3KZ1E 2GCIA 2GD2A 3NUZA 4NZYA 3D2CA 3K92A 4EY5A 3EQ9A 1E63A 4RAQA 4RDIA 4F7WA 3PQ6A 3KFLA 3LCJA 3EASA 2HHJA 3FPSA 1NP7A 1YCHA 5AKLA 3V4ZA 2BTQB 4IYJA 4PQGA 3SFTA 4Q02A 3WIBA 4CYMA 3I01A 2ZIZA 5GGXA 4EG8A 2KE5A 5GINE 4QIHA 5U1PA 4F92B 3BE4A 4O25A 1R6UA 1E1YA 4DG5A 1FRVA 2B8EA 3QYAA 4RVUA 3B6ZA 3TPCA 3UMCA 3N87A 3KOUA 1PZMA 3RS8A 1B42A 5D5QA 4B3FX 2HOQA 2FUKA 2VP3A 3IP1A 3C7CB 1VCMA 3V8BA 3HXLA 1Q1EA 4HEA6 1C3VA 4QFBA 3ZBPA 3AR7A 3DB2A 3Q1KA 2EZ9A 3MW8A 4L5AA 5AHWA 3HLKA 4JY7A 5AYVA 3WLTA 1SOMA 2G63A 5EIFA 1M0TA 4OATA 1U8ZA 1KH1A 1TK3A 2DQZA 4DV3B 4I55F 2NAFA 1KORA 1UEXC 2XZDA 3ND6A 3P9RA 4QYIA 4AKEA 4QQFA 4D8VA 1XZBA 4LJLA 4V0NA 3ROFA 3S8YA 4PSKA 1SUSA 2C07A 1UF9A 1U8XX 1S7CA 1U2GA 2J0UB 1J2EA 1DAMA 4X9XA 3T5CA 3MRXA 4NJOA 1MAAA 1PU2A 2O4CA 3F6SA 2QSYA 5E4FA 1FY2A 2Q27A 1H1LB 4BP1A 5BR4A 3QVLA 4YFVA 1WULS 2PBRA 2GZ2A 2TYSB 3C3MA 4AJNA 4DLLA 4BFCA 4YAIA 2F1RA 4B3CA 1GXSA 1FYWA 2WWFA 4B3DA 2WU0A 1ISMA 3G2JA 2HTFA 4IWXA 1BHSA 4CODB 1ZUHA 2XGMA 1DAPA 1O96A 4DUGD 3W5AA 1CEQA 3UT6A 4CR8A 3HB9A 4O5AA 3L9WA 4MR9B 4Y8VA 3M7IA 4PIPA 1UJ5A 1W5AA 4GR5A 2YWDA 5AO9A 3GZ4A 3DHWC 4I08A 5EFOA 1I13A 5TE9A 1NZJA 1PFWA 4DEYA 3X1KA 3OQNA 1QU3A 1LI7A 1E7MA 1SBCA 3GUUA 3KCNA 4EUFA 3N7AA 3IT3A 4R6XA 5IKEA 5KTTA 2PXAA 3BIJA 3H11A 4IHJB 3SXUA 1C80A 1B2RA 1KNQA 3E35A 4NYMQ 1T6XA 2H3HA 1AA9A 2NV0A 1AG9A 1XTZA 4UNSA 2HIGA 2YXBA 1YZFA 4TL9A 3OUUA 5ENVA 4A8HA 4EENA 2PU5A 2FZEA 5LB4A 2CXPA 5J3JA 3LZCA 4FI3F 5BPFA 3NAQA 3LQQA 4FIZA 3RC3A 3LYLA 3MN1A 3P0EA 4RC9A 3BWDD 3HFRA 4ETWA 1MO4A 4M7WA 2ZJ4A 1QGDA 3C8ZA 2VQ3A 3L3BA 2ZWOA 3FMVA 3BPSA 5CHYA 2BFPA 3ZK7A 3RRZA 3BYZA 4HMPA 3Q3CA 3CGWA 1UIMA 2JZNA 1WM1A 5LQSA 1L8OA 2FLKA 3VTKA 3L0BA 2BYTA 1KE2A 3HKCB 5B5SA 4EB0A 2ZUEA 4EEKA 1HZZC 1QIEA 4XFJA 1WVMA 2IYVA 2NZ2A 4RS4A 2Q4RA 1GZ6A 2J3JA 3JQAA 4GHWA 4V3BA 2H0AA 4MVJI 2WM2A 1G4AE 2X8AA 3VHXA 3HL4A 2IZ1A 3CPJB 2FEWB 2RIRA 2ZYUX 4AO6A 4F72A 2NV2B 2Z9CA 2ZW9A 3KZXA 4DA6A 2A57A 2EBWA 1AZSC 4UHHA 3AVQA 3GFGA 3L2OB 5K8LA 5CVCA 3NATA 1QF6A 2EFGA 1V5EA 3DNPA 3HADA 4NHEA 2WJIA 3WS7A 2P4HX 4GWGA 4D4JA 3VR6D 5E3JA 2B7CA 2O2CA 2XOEA 2Z8XA 4YC7A 4UE3S 5AKJA 3VV2A 4TZKA 3OX3A 2AK3A 4XIFA 2ZIXB 1FX1A 1IN4A 1JHQA 2BI7A 2A0UA 2ZYVX 2IC5A 3AJRA 2AT1A 2D7CA 3WK8A 1P73A 1DJPA 1K7YA 2CNWD 2JLAA 3HEBA 4HLUC 3HUUA 3HC7A 1THZA 3UW3A 1I1NA 2EX4A 2I2BA 4J2HA 3H4TA 5REQB 3UZUA 3J7AC 4QBHA 3PICA 3FVWA 4QX6A 5AJTA 4QGFA 3R24A 2CVHA 3B1KA 3GGDA 5KQSA 5DTQA 2WTMA 1UKBA 1JIXA 3H5NA 5ISMA 1Q0ZA 2G1UA 5FUYA 2QMOA 3UKJA 4BGEA 3S5UA 1GNLA 4EJ6A 1SXHA 4IJ6A 1Q0SA 3KV3O 4N0EA 2M9MA 4RSHA 4WL0A 3D0OA 3K0CA 1M74A 1L3IA 4XEUA 2F3UA 2NU7B 4RENA 5JC1A 3FKJA 4J0EA 2OB2A 4KE9A 4XVQA 4IGAA 1V26A 3LDFA 4DLUA 1WDMA 2WJPA 3KNZA 2BZ1A 2CNKA 2PSDA 4LGYA 2HDOA 1TC1A 2PDAA 1PWEA 4WMLA 4YJGA 5B12A 5B2EA 4GI3A 3LY7A 4H1UA 1YFJA 1FDRA 1P5JA 3WYAA 1W1WA 1MIOA 1Z3IX 1M34A 3LQ1A 2F43B 2I6QA 1B6SA 2CVQA 3UYKA 4UEQA 1KDZA 1T8TA 1U9IA 3NKLA 2MSNA 1VGRA 1JLHA 3RSHA 4KWCA 3LCMA 4E1VA 4ENRA 5AKKA 1H6BA 4FCCA 2AN1A 3ASVA 3E9MA 1SG9A 1FMFA 4NH0A 1EB9A 1VJRA 4WA8A 3PHJA 2H7YA 1H8ED 1RTTA 3IDAA 1LBSA 3K16A 4ZJZA 1RHQA 1HL7A 2CZCA 3AVPA 3QWIA 5IU6A 3JS5A 1M10A 1ZM3A 2QEQA 1MRNA 4JIMA 4ZO4A 2GR9A 2V98A 3RSGA 4LZAA 2A6PA 1QMGA 1IUPA 3DAGA 4KR7A 4LQ4A 3DUFA 2QTHA 2QL9A 4MUIA 5DGDA 3TCNA 1L7AA 4WBNF 3L84A 1EGQA 1SBIA 1U04A 3DEAA 3ICCA 3Q3JB 4F3CA 4HDMB 2B6HA 2CHGA 1RP1A 3EC7A 3JW8A 2FN3A 2QK4A 4I5DA 4JEUA 1X1SA 3VSBA 2PSEA 4G1EB 2LD4A 5KB3A 5F7ZA 1RI2A 2ZRPA 4FKMA 4RV5A 2W6ID 1X7HA 4D44A 1MBZA 3Q7IA 3B6MA 2VYQA 2WNHA 3OF2A 3T5GA 1ZGCA 3KZNA 3MRSA 4DOMA 2G07A 4CQNA 2QJRA 4IH1A 1RCUA 2AN9A 2P2YA 3W2HA 3WYDA 5H4GA 3OLXA 1JEQB 3BFXA 3NOXA 4K1XA 4K6HA 1XU7A 2BM0A 4LZNA 5CM8B 1U2TA 4KQCA 5DHQA 1BXKA 5CW1A 4KFRA 4TOIA 1NVMB 3V3TA 1G6KA 2Q2QA 3WLEA 2QIOA 2J0QA 4KSYA 1KPHA 1QH8B 5FO0A 1DT5A 1VIYA 1K8RA 1KBQA 2FG6C 4WLVA 1DCTA 3REOA 3KXIA 2B1IA 2A0YA 4HPWA 4NH4A 5EA2A 3STYA 3KUKA 2IGTA 1VQ1A 5D6NA 1S3IA 2OZPA 1POWA 1SBQA 5JAHA 1KOFA 4TTQA 4H4DA 3SHQA 1S9DA 1NBEA 2F9LA 2IYRA 3GW8A 5ALUA 1YHYA 2WYUA 3B7WA 5DLEA 4BVGA 1CJBA 3FHLA 2FN7A 2I2CA 2JKVA 3PQ2A 2UUPA 1PJ2A 5I3CA 5KTRA 5DEIA 4DCVA 3IDSA 3SC2B 2WWVD 1ACJA 5DM60 3Q7SA 1UPBA 4GXNA 4LBWA 4U7FA 4UULA 5TEVA 1N2IA 2CYAA 1DT3A 3DC7A 2OUIA 3GJ7A 5IT5A 3I2FA 3C98A 3NDBB 3MMZA 4EY4A 1JG6A 2L42A 2H4JA 3FOCA 2BRUC 5JQWA 1BQ4A 2EFCB 1COWD 3CR7A 4BO3A 5CVTA 3T5AA 1AN0A 4F6CA 2E4WA 3PP8A 4JLKA 1M1YE 4DV5B 1C8BA 3NBMA 2YHIB 1FE8A 1PFQA 3M4ZA 1DWUA 2WLSA 3FXAA 4EPXA 1NXQA 1RWOA 2VA8A 4IJQA 1TJ4A 3LVBA 4F4FA 2G09A 2HJ9A 2IEYA 3LUBA 2OYCA 3NCHA 3H0KA 3INGA 3WLSA 1OYVA 4F3KA 1Q19A 1I2BA 1OBCA 4CPDA 5ADWA 2J9RA 1VCOA 3PFWO 4EHBA 2JFZA 5TV2A 1ZI6A 3CZ9A 5EPEA 6LDHA 3ZWPA 1VE3A 2UVDA 3G0HA 1OOEA 1T2AA 3HKDA 2NM0A 3RASA 1A76A 1GZUA 4BLVA 4TMXA 3VC7A 1G0OA 2P6NA 4OLHA 1J07A 1W44A 3J81k 5EERA 4KQHA 1P4HA 5HBRA 4XFKA 3V8NA 4BUCA 5AW0A 3DLAA 1BMTA 4GLBA 3C74A 3KQVA 1JAYA 1ZN2A 2OZLB 4N6NA 4X8MA 3Q3IA 2GNPA 4DPLA 1P0MA 1QZUA 2R6ZA 5DYWA 3X2SA 4HS4A 3I28A 3NHAA 2PZLA 4FOTA 1ZOPA 5I7AA 5GOTA 4N82A 1DO2A 3HXTA 4CMAA 4BLSA 1VYHA 2JJ1D 2WINI 4JQZA 4R2WA 3AR8A 1BHO1 5HJ7A 1JJ7A 4M1YA 4Q01A 2JFUA 1W2WB 1Y80A 1OKKA 1C8VB 5DFAA 5BYBA 1E1CA 4HEJA 3ZKAA 1VLLA 4WKOA 2AXQA 1E9VA 2GLXA 5HTKA 1MB4A 2L69A 1FLDA 3QBVA 3TFWA 3GGCA 2AEJA 3EXFB 1RRFA 4PM4A 1W0KA 5I8ZA 1PUIA 3FKSD 2VBGA 3FOZA 5CW2A 3RJ9A 1RWQA 2Q8NA 1PJ4A 2QXTA 3JAWB 1O0BA 3T4EA 5I45A 1SU6A 2VTBA 1G4UR 3P9CA 3GRCA 4J2TA 2ODWA 3U44B 2IYYA 2C20A 1U8CB 4EHDA 1K8XB 3AF5A 4KXQA 5G1OA 3WO0A 4DILA 1C81A 2B69A 3FSGA 3RKSA 4TLDA 1OXBB 3RIGA 2JFFA 2GKGA 3X1DA 4ESVA 1AU9A 2IP2A 1ZGZA 2VF7A 1J0CA 1J1ZA 1HE4A 1YCDA 1VG9B 2DSNA 3OFKA 5ALKA 2Q41A 3MAJA 4D9JA 3EY9A 3VUFA 4DY6A 5ECDA 1OH5A 4A0RA 3WBBA 3ZTWA 4K9NA 2O7NA 4MRPA 1H9AA 2VNIA 5EUQB 1E18A 1X8JA 2ZLBA 3TRJA 3AJ8A 2DKFA 1ZGJA 2QUKA 1NLFA 3IBGA 3NFYA 5EY5B 2P78A 1K1EA 4C01A 3IB3A 1T4BA 3LDHA 2QPAA 1GLGA 3MC1A 2OZVA 4I1PA 2GUWA 4HNQA 3ZD7A 1DEXA 4FBLA 4HSGA 1RXSA 3BB1A 1C30A 1H69A 3VR4A 3GUYA 3O4JA 3ZDCA 4YQFA 3MA0A 3MEQA 3ELDA 2QUZA 4HXFB 4QELA 2IWRA 1OY1A 4JB3A 2VXCA 1KBOA 5BR8B 2QZ9A 1GCOA 1R74A 5FWXA 1BHJA 3MINB 5ALQA 1O5OA 1X7YA 3VC2A 4DIKA 3QE2A 4M0FA 4IFIA 1V5IA 4UREA 2V59A 4W9NA 2CWWA 4M89A 2VZ9A 1JBKA 1FFHA 1L4HA 5AM2A 3E70C 1U1CA 2J31A 4H35A 4JLOA 4RGYA 1BMQA 4V24A 1DQYA 4RKFA 4JUAA 1RM0A 3MJSA 1JIJA 3FNIA 4ARSA 1L4NA 4YJHA 5TF0A 2IY7A 5IFKA 2V9CA 5KVVA 1YL5A 1NBMD 4Z51A 2V45A 4CIAA 1M6VB 1WV0A 2CE2X 2WWRA 4S0XA 2H1FA 3QVOA 4W5HA 2F4VB 2VDRB 1WXHA 5C18A 3OD1A 2O8EB 2VNSA 4ZKDA 2C2OA 2H63A 4GP9A 4MCAA 3A1UA 3LRXA 3IVGA 1TYBE 1LBHA 4OU4A 3TRFA 4AZ3B 3NBUA 2QYSA 1C9YA 2W90A 5K0NA 4ZN6A 3KT8A 1RQNA 1AS3A 4GP6A 1MNQA 4H3HB 4TKUA 5GIPE 3NT5A 3N1UA 3B5IA 4HEQA 3MT0A 2H00A 4O0LA 4HLQB 4YMSA 3AEYA 1UMDB 1KSGA 2F4NA 2P2DA 1TLLA 1JRLA 3I1JA 3WL7A 4MQFB 4OBXA 3T7DA 4U0KA 4JBYA 1N1MA 3VNQA 1T8PA 2ZWVA 4CUJA 4Y9RA 3AJDA 3G5LA 2WD7A 3LC7O 1RWXA 4JYMA 1G42A 4URUR 4FNGA 4MHOA 1HT0A 3TD2A 1WEKA 2VC2B 1D0IA 3TCXB 4IH4A 1Q0HA 2ZWMA 2VJMB 4HWGA 3D3JA 2G1AA 4DSAA 4WADA 5IDWA 5E2AA 4FP9A 3EPRA 1G2OA 5K03A 1UZNA 3AEUB 4EZIA 4DIFA 3QMWA 5SY4A 2PZAA 3IDFA 5I48A 5L4LA 1KJ9A 1V1RB 5H3HA 4XGIA 2AQHA 4AXBA 1BIFA 2EZ8A 2H0QA 3P1JA 4ZREA 3PQ3A 4ZTUB 1LLFA 2BKAA 4DMCA 3QMMA 1FTGA 3MPUA 3S2YA 2PO7A 4FDTA 2V7WA 3UAYA 4EY6A 1T43A 1XPJA 3OSZA 2XA2A 3MLEA 1HR0B 2A92A 4UAJA 5GY7A 2WQ6A 1SVWA 2NO6A 1L4UA 4ND8B 3U81A 1NRWA 3GUHA 1Y33E 5IWCA 4PG6A 4UBNA 4Z7NB 3NAGA 5AHOA 3L43A 3EDQA 2IEZA 2IA5A 1ZIOA 2R60A 1EFTA 1UWKA 2BGRA 1QQAA 3KDPA 3N86A 4NICA 2QP9X 3SZRA 4EUHA 2PJZA 1ZD8A 1TO6A 4LRWA 1RLOA 4XIGS 3I2IA 3P9XA 4MW0A 5KDOA 5JIBA 4PTZA 3V1NA 2QRGA 2FDXA 2OOSA 1J8YF 2UYHA 1JJFA 2QNIA 1RWVA 3FVRA 3VDNB 1S2OA 3ADCA 3IUSA 1VDMA 1Q44A 1IJKA 2QMHA 2WJ6A 3TEMA 1KI9A 3F1LA 4QLBA 1GNQA 1CYDA 3Q9LA 4M0EA 4HH3C 3I30X 3B2NA 4HQNA 1OWOA 1VL5A 3B1YA 2ALJA 3MZ0A 4NNOA 4B71A 2VCYA 1TIPA 4FWBA 3AYXB 3EZXA 3ZHXA 3WFZA 3UJNA 1Z63A 1Y4UA 2AEMA 5DI3A 4BV8A 2FQXA 2VUHB 2FX5A 2CK3D 2VSFA 4ZV9A 3SC4A 5CYGA 3IOMA 1EFAA 1YC2A 1XLVA 4AJLA 4C05A 4EQ6A 1XZEA 1OWPA 4FFLA 3FTFA 3H04A 3UC5A 2WJYA 5TX7A 2HWYA 1IXRC 2GN4A 2YV2A 2DPHA 1LSOA 2PX0A 3CSSA 3MPOA 4A2PA 1OTYA 4Q3NA 1UINA 4BMSA 1D7AA 2CCKA 4E46A 3HKBB 1IFXA 2I3ZA 1CU1A 2YUTA 3CU5A 3PX2A 3PVCA 4G0YA 2IV3A 1V8BA 3WGUA 4M8SA 4AK9A 1EHIA 3EWAA 3H5LA 3NTRA 1KERA 2X5KO 3FLEA 4MQ6A 2WG1A 2J6CA 3VKUA 4AMGA 1UC8A 3H5WA 5BWOA 4R1PA 5LDGA 1R7RA 2HRBA 1FEZA 2RAVA 3K0EA 3TBKA 4PYNA 3VJRA 1UBRS 1FZQA 3IP7A 5D7BA 5EWLB 1XCOA 5JD6A 1I01A 1SKYE 3AB3A 2HU8A 1YZVA 3GRUA 4MYRA 3W9YA 1A2BA 4CL3A 1QKKA 1JA0A 3KVOA 4FGJA 3VPDA 5JHHB 1N3IA 3LU1A 3EVFA 1LK0A 2HTEA 3LQYA 2VPTA 2X77A 3PNSA 4P2GA 4WASA 3S55A 5J47A 3ROXA 2D1QA 3I8OA 3R3ZA 4ZDKA 2CLLB 1QH9A 2KHZA 2YCBA 3F5FA 3KPJA 3O8OA 4OGWA 4A82A 5KWIA 4K81B 1OI3A 3B6EA 4C6SA 4EJ2A 3THXB 3FYSA 2O0KA 4KVAA 6ADHA 1EK6A 3UJAA 5FTWA 2GCGA 4RPJA 4NQZA 2JK1A 2AQKA 2VHZA 3TBFA 4U2BA 2R25B 3A27A 3SM3A 3TNYA 1X2BA 4MDEA 2QYOA 3I37X 3UFBA 4DSTA 3UAGA 4IOJA 1VJTA 4PZ9A 2PLNA 3KQTA 1SZDA 4J16C 2JLWA 2PEZA 4H18A 4P5EA 4MVJA 1OU0A 4NEGA 2HPHA 1BKYA 3IELA 5GIOE 1L4KA 3DBHB 3QKRB 5EYPB 1NW9B 4W5WA 3DEFA 4RJTA 2Q8QA 2DPXA 1F2UB 2HI0A 5DWDA 4ZAZA 3ZY3A 3I6IA 3K4QA 3WBJA 5CJJA 3WOVA 4GG1A 4C20A 2ZDQA 3OJWA 3EN0A 4IF4A 3TIGA 2PKQO 1AGRA 3ZY6A 1YRBA 1WW8A 2JLSA 1LC0A 1E2MA 4KO1S 1ZK1A 3U7QA 3SEFA 1UBKS 3ZNQA 1YQXA 1I7LA 1MQAA 1RC1A 1V47A 2QRJA 5JAUA 5EOVA 1ADGA 5HZGA 1KJWA 1RJWA 1A5BB 2P65A 2ZI9A 2PV0A 3OF5A 1N5MA 2BCEA 3B53X 5KSPA 1Y3HA 5IXSA 3P2MA 4A23A 3E6AA 2X40A 1G18A 1NVEA 2HK6A 4ILKA 3JWHA 1NT2A 3JYHA 4JU8A 1S3FA 3SSMA 1PEKE 2O4UX 3IAHA 4MLZA 4QGBA 5GWXA 1E32A 3DDZX 4JBLA 4R71A 2C31A 2B8WA 3U09A 4RKYA 1JHZA 3C41J 3ROGA 2ZI6A 3FRIA 1CS4C 3HB5X 1GGVA 2KM1A 3ZV6A 4WN9A 4CI0B 1RHMA 1EVKA 2V4UA 5H81A 2YJ4A 4C5CA 3FYHA 2ATIA 1DB3A 2P3LA 1Z88A 1ZXBA 1II0A 3ESXA 3Q0EA 4JYBA 5DGXA 4J7XA 1T4GA 1VCHA 2ZB8A 3K1YA 2O54A 5CFOA 4N6OA 4EJFA 1V95A 1PJAA 5C3MA 1XEXB 2FLWA 3JWJA 1XWIA 1X77A 3VI4B 1IH8A 5LA6B 3DT6A 1GZDA 1YIDA 4TM7A 1B1AA 4QYXA 4QT4A 4ZMRA 4S05A 4IIXA 2OFPA 2VR1A 3O31A 3ASZA 3A9RA 4I1OA 4DZRA 1MGOA 2TS1A 3UGKA 1W30A 3G88A 3PXEA 5JJCA 3U4QB 4OGLA 4R40A 2X5XA 2FFQA 4P4UA 2XXAB 1LPAB 4FD2A 3FFBA 4MLPA 5JWRA 1Q50A 1JI0A 4AVYA 4YV7A 1XCLA 2JC3A 1CJCA 5ICCA 1RP7A 4E1BA 4WNCA 4YT5A 5HG0A 1MJHA 2DWPA 3IOBA 1WKCA 1I3LA 2AOTB 2FGKA 2IIPA 3NKVA 4IOLA 4ETIA 5KOIA 1XNRB 1S2DA 5IK2A 4UAUA 3SBOA 2YCLA 3EZYA 4ND4A 1GAWA 1T8RA 3VU0A 3WWCA 3DT8A 1Z6XA 2E55A 2QVBA 2UV8A 1QJCA 3RS2A 1XYVA 4UZSA 4Y9SA 2AF3C 4ZALA 5SICE 4AF8A 2CE7A 3QVMA 4BRUA 5CBPA 4W5OA 2EFJA 2AWOA 1L7OA 1UP6A 2V5AA 4QJ4A 4D3DA 5LXTA 5JYEA 2CYBA 1KR5A 4FYPA 1PX0A 2P5UA 4MMXB 4N48A 4XPZA 3UMFA 1K4MA 2J0EA 2ISCA 2J07A 4KGVA 5J59A 3SEQA 5JSQA 3LUJA 3PSAA 2EOAA 3WTCA 3TQTA 2Z43A 3E9EA 2PWAA 1WL8A 1DC6A 5HFNA 2GJ9A 5JZSA 1E66A 1EVEA 1TU4A 5SYNA 9LDBA 2X9LA 2O07A 2ECOA 1MW9X 2AI3A 3HSYA 3JQGA 3HTXA 4D57A 3NM4A 1Y5IA 2Y1KA 1UDBA 3AF4A 3FI9A 1V8PA 2IZZA 3AKEA 1PT8A 1M0SA 2Q3FA 3OPNA 4LKOA 2Y9PB 4ODIA 3A4TA 4BNWA 1IEXA 2DHRA 2Q5CA 3N8KA 4TVKA 4HQFA 4CG0A 4KUEA 1WA5A 3USES 1WCIB 1ES9A 4Z4QA 1QDUA 1YMUA 4QLAA 2QIPA 3KPVA 4PPFA 5LZ8A 1OGJA 4C88A 3WWYA 4F4IA 3ETHA 2ZI5A 4O4JB 5H1YA 1KS9A 4IP0A 1SB8A 2WPDD 2Z95A 2JCYA 2CL7X 1XTQA 5A3VA 4FLEA 5LQCA 1XYYA 4YLGA 3ED5A 3MS4A 4JUDX 1OYWA 1RQXA 1T2DA 2DOKA 2FMIA 2J3KA 2LBPA 4Z4EA 4N9WA 1G3IA 1L5VA 4N6GA 4MUNA 3HP7A 2QW0X 5F98A 2QVLA 4P4TA 4KKVA 4XM0A 2YXPX 3GLHB 2GCNA 4LXQA 1OLUA 2G88A 2NU8A 3ZLBA 4Y6LA 2J6BA 1U3CA 2BP7B 2JGMA 1G8YA 1RWNA 4IHQA 4M8IA 3PDIA 1D2HA 4RWEA 4DW8A 1ODJA 1IY2A 1K66A 1QKIA 2BR5A 2WZBA 1E1QD 2WAXA 1NC3A 4PC7A 1PZHA 1GTMA 2QM3A 1XEFA 1Z7GA 2YZNA 3GK3A 3KWLA 3PNMA 3PQEA 1AV6A 1HEYA 2FR8A 1ZC4A 1U2EA 4XQ0A 4Z0PA 3HBNA 1EESA 3UJ6A 1TQDA 5ECGC 8ABPA 5FDFA 1O7JA 4BMXA 4R54A 2ONCA 1K68A 3OBBA 4RLSA 4E2YA 5TMPA 4A15A 1YT5A 1CUHA 4X7RA 2J59A 3H2YA 1TUEA 4GQBA 1H22A 5JLAA 4RPGA 4IGEA 3SSNA 1OZFA 3FAZA 1T2FA 5EWJB 5EP2A 3WL4A 1S96A 3GEDA 4OOEA 2NUPA 4M1WA 3IURA 5B3LA 1JS1X 4ZZ1A 1G3RA 4E5KA 2BSQA 1OV4A 2W4QA 4CBVA 3EZNA 3PC6A 3GJ3A 2D5AA 1AKRA 4JLJA 4LK3A 3ZV7A 2GGSA 4NE7A 3UAZA 1IHUA 2P0YA 4FYWA 4F2PA 1CFZA 1NG9A 1ZH2A 1G41A 2O3RA 4WQMA 1MQSA 1P77A 4KQXA 2A78A 1XNHA 1YULA 2WIJA 3WK7A 4BJHB 1WVGA 3DZFA 2ETXA 1IJEA 1UFKA 3HCOA 3KLOA 4D9NA 3BTUA 4XUCA 1EUDA 1YVRA 1N57A 3KKOA 4JMLA 13PKA 3B6IA 4RTPA 3E03A 3MT7A 5JAIA 4D25A 1NLMA 2QJTA 1OBVA 1A5ZA 1CY4A 1G4HA 3MOGA 3F7NA 5U4XA 3C4QA 1RI1A 3UJCA 3BC1A 5EQJB 2AFVA 5LQJA 3H0CA 5AW4A 4PLGA 3GLTA 2VHUA 2CLCX 1IHDA 3BWYA 1OXTA 3CZ4A 2OC9A 4MAFA 1QS0B 1Y42X 1T1JA 2GAFA 2V9PA 3Q87B 4D4MA 4MUFA 5BQPA 1GOTA 1ZD9A 2HLPA 2L2QA 3RHSA 3O94A 3WRXA 3ZIUA 2D2IA 3D4LA 2X2OA 4Z8YA 1YRQA 2NO1A 2UUCB 5LYJA 2AKEA 4NQRA 4E15A 2AH5A 3DMPA 3FYUB 1D0SA 1D6MA 1YO6A 1NJ5A 2MHCA 3H1EA 4XDYA 2PMCA 1FYDA 3ENKA 3BRWD 1GPUA 4BNHA 5IH3A 5BN3A 4LDAA 1XMPA 4J0QA 5CFNA 3GPLA 2PUCA 5B3KA 2F9FA 2DU8A 1GNVA 1W4CA 1GQRA 2XT0A 4IQ8A 2IHZA 4Q3AA 5CVJA 3D1VA 5E9AA 4GI5A 3ORSA 4EH1A 3GGOA 4ND2A 4YREA 1JMVA 3EGIA 1JZQA 4FZRA 4JA0A 4OUDA 3ESBA 1XU4A 3COWA 3FFWA 2RHCA 3KALA 4L85A 4MXDA 4HXYA 3HA7A 4HMQA 2CDRA 1E6WA 1V39A 1E3EA 4ND5A 5JS2A 4AJHA 3THYA 3OE5A 1DEOA 2IYEA 3IFSA 4N3GA 2H1OA 2GPJA 2M32A 1CQPA 1JBEA 4IEEA 4YQEA 1L4BA 1ZA1A 2ZBGA 1A3CA 1WHTA 2OOKA 3RARA 3KOOA 5LMUB 3HG7A 4ND3A 2XV1A 1E4OA 1I33A 2J30A 1C7QA 2G7ZA 2J3MA 2XOXA 3NRJA 1AO0A 2YXLA 1GZ5A 4AQYB 1YB1A 5LQAA 1JQBA 2BH2A 4XEHA 4EI7A 2QW1A 2HAEA 3TR0A 1TK9A 1Z0KA 2JAWA 2JI4A 5L3SB 2QD2A 4O4HA 4IIBA 3D5QA 4OHZA 4PAWA 1PZXA 2C9BA 2QE7D 4UU7A 4UUPA 4B35A 3I9OA 4HWTA 3BK1A 3QHPA 1GAEO 2VAMA 3EK2A 4FUQA 5TMEA 4DT1A 1ISRA 1Q92A 2WVHA 1JT2A 1QCCA 1ODCA 4Q9KA 2Z2YA 2BMEA 4CEIA 1QRAA 1KK0A 3F4BA 4XWTA 6ABPA 3C14C 2HO4A 3DE7X 4XTCS 2PUVA 1TTHA 1ZSNA 2BBWA 3DEKA 4Y6SA 3C7AA 3HDTA 1ZW1A 2C2KA 2BKLA 5CP8A 4F86A 4WXHA 2FW8A 5KHOC 1GVNB 1MV8A 3HGTA 1N92A 3TQCA 1DQSA 3H2ZA 1PR3A 2NQ2C 4ZYYA 3IUQA 2GZ1A 1Q0TA 3JQBA 3GUZA 2ZBPA 2IZ5A 2I6TA 3QKSA 5GONA 5LYYA 3K35A 1DG3A 4J43A 3QELA 5LZ4A 3KSRA 1CZRA 3C8DA 3IOEA 2WRZA 4JBNA 4N5NA 3EWIA 1NUTA 3KG2A 3IEMA 5KQMA 2WUDA 4HNSA 1QF7A 2A1UB 3BA6A 3EWSA 2NXEA 3P32A 4D9MA 4E7PA 5JSZA 2HBQA 4JASB 2WG0A 1KMQA 1ISSA 1E2JA 3LW7A 3GLFA 4H27A 1VKOA 1ZOOA 1DBVO 1F1JA 5TSDA 4MI6A 3SEAA 1GU1A 3B36A 3B9QA 3JTEA 2VCHA 3LT5A 4ZVNA 1E2PA 3OTOB 4G5RA 4QOSA 4WOPA 4CMIB 4RZIA 1DXQA 5CVUA 1FFWA 4NJMA 1JFTA 1V9CA 3AJEA 3OZVA 3IQXA 3SKVA 1Y5LA 4CL8A 2ZXUA 3D4PA 1PNTA 2ZRJA 3DDUA 2V7VA 5E6SB 3DCYA 1E5TA 3FVQA 3TD9A 4US2R 3USZA 3DBRA 1TA4A 3LUKA 5IHXA 2WU8A 1QVVA 5KVCA 2Z4RA 3RSZA 3FPBA 3HA5A 1E1DA 3CWCA 1BCRB 3HZZA 4KYTA 4Y1RB 5JNWA 1OI2A 2JJ8A 1CVLA 1MHPA 4KN9S 5EJEA 4RESA 1N2HA 4IHJF 4ACBA 2QA5A 4MKHA 5TPWB 1RWPA 1P61B 1R6VA 4B7XA 4AJ1A 1WB9A 5ALNA 3PG5A 3U4AA 1OXKB 2PXCA 5I01A 3GEBA 2JI9A 2DPYA 2BM8A 4P3YA 1R12A 2GXQA 3VSDA 1GTL1 2OKCA 1IULA 2GN0A 4XM2A 2OZEA 1AKTA 1V0JA 1FRZA 4U5XA 1J97A 3UG7A 3GIWA 3V9PA 4CT0A 3Q7PA 2OLKA 2PH3A 1UBEA 1LVGA 5EVCA 1X1QA 1PLJA 2A5JA 3B5JA 4YN3A 5HQJA 5DLDA 3W7VA 1AD2A 3BTOA 1F51E 2R97A 2H2HA 1NVAA 4JIGA 3KOZA 1XF1A 2C5BA 1A27A 4L0MA 2EL7A 4A2WA 4B0OA 5KINB 2OV1A 3QY9A 2HX1A 3DV0A 4GOMD 5AM3A 2I4NA 1Y6FA 4R8RA 3HEMA 4JNKA 4WLOA 5KSWB 5K0EA 5EE5B 3NUGA 3VYUB 1M0EA 2LDBA 4QE3A 5KO2A 3HABA 3QI7A 4F93B 3QOYA 3W2FA 2QRKA 3P2YA 3EARA 2QI9C 2X0NA 4Z0NA 1NWHA 2CLFB 4LQLA 4RJ2A 1F14A 1YK0A 2I34A 4CR6A 4BO0A 2D59A 3AR6A 5CB4A 4YAEA 1QORA 1SUPA 3CRVA 3ZKWA 5FTLA 1K92A 3I1YA 1ATIA 3V1KA 1Y8ZA 1KI6A 4HGPA 4UHBA 4B4WA 1IBCA 4ARUA 5KMGB 4LTDA 2VJAA 4QPZA 3ICPA 3RYFB 4KITB 2C7OA 4O4LB 5JS7A 2O3TA 4N0QA 3AINA 1V35A 2W6OA 3BXHA 1NV8A 5F33A 3OKAA 1PJ3A 1OX6A 3GJYA 4RO0A 1VKHA 1XJ0A 1V3TA 2OLEA 3AXSA 4YQZA 2XWBF 3G6KA 1Z5ZA 1MR3F 4N3CA 1ZMOA 2PGNA 3KHTA 4QGHA 5G4LA 4PVDA 1P9RA 1M33A 3ZX5A 2XCQA 3BHNA 2PIDA 3LDUA 4I1RA 5AKYA 5EKTA 5EKSA 2A67A 3LX4A 4BO4A 4C4YA 3ABOB 1XEWY 2GPYA 3OJ0A 4TLLB 5DGCA 5EWMA 5L6MB 4ESEA 2JH3A 3NHLA 1TVMA 2Q5HA 1F8FA 2AFHA 2OCAA 3NOQA 4B7AA 4PYJA 3CVVA 4J03A 4M22A 3PL1A 4CJXA 2NNWB 3QGMA 5B7QA 1J49A 1AUXA 1WZCA 2YRFA 3O7WA 1HDGO 3JATA 2WPNA 2ZVPX 1KAEA 3E9RA 3NEPX 3AONB 2X58A 3WQRA 1XQYA 1BU5A 3OT1A 4ARVA 4HX2A 2GTPA 5JAOA 4XGKA 3SG0A 4LX0A 1Z13A 4IVNA 2FKNA 1GJRA 3R0IA 1BG6A 2E5WA 4R8VA 3U2QA 2P2NA 3G8YA 4CM4B 1JIQA 3ZV3A 3SM9A 4QYMA 1H2ZA 5B1SA 4W5RA 1PVVA 1I0IA 2NTYC 1N8SA 1VG1A 2UZ4A 3DD5A 2GDJA 3GNTA 3M5DA 5J9FA 3F74A 3KYIB 3S1AA 1CEEA 4WCFC 3A3NA 4BY9E 3ITNA 4LBYA 1U99A 1W2HA 1S8FA 1YJCA 4EHHA 1L5MA 2HU5A 2AXNA 5HCUA 5JASA 3NWBA 3ABRB 1N5KA 1XI2A 5EEGA 4R9RA 2NO9A 3GG2A 5DXFA 3ZXIA 2ZUWA 2QBYA 3UUWA 4DCPA 4LF6B 5CNIA 4XWWA 3JAKB 2AZDA 4IZIA 3DF9A 2VDMB 1KEEB 2X0JA 1CY1A 2I6FA 4RL4A 2LZ0A 3SZOA 1E3LA 1H5UA 3BMQA 2VNJA 1H6DA 1NLYA 4II2A 4R3UC 1BO6A 1D7OA 4GXQA 4DR3B 3HDJA 1NUPA 4X97A 5G0TA 1YBAA 3V2IA 3CF0A 3ER6A 1TM5E 2QLBA 4HRAA 3TO5A 2NTEA 4REQA 3HXOA 3QQ5A 1ICIA 1RADA 1OJ7A 1U6JA 2GSWA 2IXDA 2KJQA 2ZJYA 3IA7A 4W82A 1QCYA 5HYVA 5KNLA 3MBKA 4BASA 1NONA 2EZTA 1WY7A 1IY1A 1Q0PA 5BW8A 5ED4A 3L1JA 1L5FA 4B2PA 1GM5A 1ONBA 1KFBB 1POXA 1VI6A 2XMCA 4KXNA 5EXXA 5JFGA 4J7UA 3RJMA 3G9ZA 3OAAD 1QLWA 1YJBA 3AP1A 3K0AA 3P0JA 2PZMA 2QW8A 3A37A 3EHDA 4LNUB 1BKDR 1FMTA 1M75A 3L0DA 5LQRA 1KY3A 5LQKA 3MOSA 2RI1A 4AZVA 1ZAYA 1WAMA 2Q6IA 2Y68A 3M6FA 1KVTA 3C45A 3LYAA 4Y2HA 5K8JB 2O7RA 2QL7A 2BV3A 1GSAA 2WF8A 2XDQB 4RADA 4PPGA 4AY3A 4JI1B 2J0VA 4KVGA 1SQFA 3W4IA 2V7QA 1V2GA 1G20E 1X7XB 2VN8A 3LHFA 4NPCA 1U2GC 2OL4A 1NXPA 1TT5B 1I7DA 1CP2A 1XQ9A 1W29A 1QHGA 3P4UA 2B3TA 1CFJA 1X94A 1IG0A 1XXLA 3BGIA 1K5DA 1VIMA 4HH4A 1KZ7B 2C4VA 3PDCA 4QO8A 1TO2E 4KIJA 4ISBA 4IGKA 3ZHTA 1YACA 1OLSA 4DIEA 5K8TA 1QP7A 2GHIA 1U28A 4J6FA 1RYFA 1V6CA 4OQDA 1GNSA 4TMZA 5KYNA 1KDTA 1CUCA 2EIHA 3C6KA 1LRLA 4JFAA 4KDFA 4KIUA 5ALFA 4JX9A 5EZYF 3I6YA 1TM3E 4I55A 3OTHA 4LHVA 4WBXC 3TLYA 4C78A 4BMDA 2J7KA 3GT3A 3KAJA 3VVLA 5LBIA 2GM3A 2RJOA 2OXRA 2QMZA 3AR3A 3QBEA 2GBFA 2RK3A 3DDNA 4X7BA 1V71A 4HYYA 2YYSA 5FL3A 2R8EA 3I01M 4ZT2A 1T2VA 4TS1A 3RAGA 3IO5A 1NUSA 4B48A 3DZBA 4LF4B 2GRJA 1IOZA 3ND7A 4R8MA 1XZCA 5A4FS 2GS9A 1SKUA 1ZQ1A 2GBIA 3CX3A 2VAWA 3IPAA 4KLCA 3KYJB 1PNRA 4BNXA 1XA4A 2QD4A 2VWGA 5KKNB 5DCYA 3DHVA 4YI3A 1W0KD 3MNFA 4TZ0A 1RRKA 2GO7A 2QLTA 4HRVA 1RIFA 1JNYA 4DV7B 1A4XA 2G6TA 3W1VA 2XUZA 4Y2PA 2UYYA 3N5KA 2BHRA 2JA2A 4DJEC 3QU4A 4YRBA 5JISA 1RSZA 4LHWA 3HJCA 2NMVA 1SQSA 3FSGD 4O02B 1SA0A 4CZ2A 4BZPA 3RVPA 2O3UA 5A1TA 4DBLC 3R09A 4M60A 4R84A 2B8NA 4ZOAA 4Q4JA 5KPDA 4YJFB 2W83A 2WJHA 1LSUA 3A1WA 3M8KA 1KQ3A 4FFOA 3K9FC 3A14A 3BJEA 4I9HA 5EESA 2CLIB 3DE1X 2LKDA 4W9MC 2FOIA 4MPPA 1AZWA 3K70D 1Z18A 1LSJA 4PR3A 3F90A 3KYCB 4Z0TA 5T4EA 1PJBA 2CV0A 1IN6A 3LBFA 3PCXA 1VDZA 4FPXA 1G5QA 3WLOA 2JAHA 4ZI7B 1O2DA 2CBGA 2ZANA 4M6WB 4A4DA 4FEYA 5B1YA 1DKOA 4YROA 3E9NA 1T9CA 4MKGA 2H0RA 3CE9A 5EI5A 2QN7A 3QITA 2O0HA 1ZU5A 1EM8A 1HTBA 1SRQA 3KVRA 2XNKA 1CT9A 1C3OB 1OCEA 1G6HA 1MJNA 3CB4A 4WCFB 1I7SB 2ILVA 4QPPA 4FOOA 4QGSA 5C1OA 3IUBA 3P52A 1WY5A 4BAUA 5E6UA 2R4TA 4Y2TA 1UT5A 3O2NA 5K01A 1O5IA 3P0FA 2V7TA 1JIVA 3RTBA 3I12A 1VMIA 4UE6A 3LPAA 3PEEA 2Z08A 3KTAA 5T7BA 1P2UA 2QD5A 1T4DA 4H3VA 2J41A 3SXPA 3MBOA 1HE8B 2G1PA 2JGLA 3SS8A 2QDXA 1DTEA 5IFLA 5I7RA 1O6GA 2IUEA 2J3DA 1SU8A 3OLQA 1G3MA 2R1VA 4DWWA 5KTKA 1UWLA 1RKBA 2HA2A 4NDZA 4K26A 1HT2E 1MJ5A 4M98A 2CUZA 1F7VA 4KFCA 4JEMA 2RSLA 3U1BA 3UK2A 3PYXA 2ZIWB 1TCAA 4MWGA 1KI3A 2AG1A 3DDSA 3ZWNA 1GGNA 4ZDIA 2IOFK 2YUIA 3M4NA 4FYKA 2XCLA 4TKVA 5COBA 4EL0A 1WUKS 1L5OA 1U5AA 2ORWA 1FNMA 3LX5A 4NBSA 1U9IC 4E11A 1AKUA 1QH0A 2WZQA 3ETJA 3VHQA 5F35A 3AOEA 3L8YA 4P92A 1GTG1 2DR0A 1RE1A 5ULLA 4QASA 5IJWA 3GJ5A 5EJ9A 1OAOA 2XADA 4LFAB 2HREA 4TZ6A 4O0MA 3N2YA 2IZ0A 4QUHA 1SUWA 2IYQA 1N7HA 1USKA 3B48A 5IASA 2W8ZA 2JHCA 2PBLA 4HO1X 1DC4A 2C4MA 1QDEA 1U4SA 2VJLA 3BWVA 2Q07A 4W1QA 2PJUA 4Y2JA 5BQXA 5GJCA 2EDAA 5ED0A 3UCFA 2OR3A 3R3XA 3UMGA 2BHTA 3O38A 2Z4TA 5IT4A 1TKBA 7GPBA 2IOQA 3EEBA 4AUKA 5AI0A 3TG8A 1N6OA 3S99A 3CG4A 1JR3A 3IBYA 2A7QA 1UJBA 3ZK8A 5TJ9A 1O8CA 3ZWYA 1KP3A 1GXSB 3NEJA 4W5TA 4DLBA 4ZKEA 5P21A 1KYTA 2G06A 1Q6YA 5FQOA 5KTOA 3NCTA 1O96B 3ANTA 5H5JA 4US1R 4OP1A 3S1LA 3F49S 4WTOA 2Y9MB 3NIGB 2EJUA 2Z8YA 2R1ZA 1OU4A 1WKVA 3IEPA 4DVGA 3HR7A 2JCBA 1HE2A 2GOYA 4JOCA 2CUKA 2OKGA 2PS0A 3RHFA 1EDDA 3MQFA 3WRVA 2I4LA 1KEPA 5LU9A 3HMKA 1XMOB 1XP8A 2X4LA 4OMCA 5A03A 2K4MA 2RJ3A 2V5UA 4LHXA 4N03A 4WBNA 4MGEA 1CSEE 1KTVA 3KLMX 1GZHB 3V97A 2CJXA 2ACVA 4K03A 2VQSA 2R8YA 2FMKA 4I4NA 3ZCTA 2WSSD 1M6EX 4CN9A 5J2UF 4IJUA 3SZ3A 5TGDA 1OFUX 2RGCA 4YT2A 3CCFA 1KFJB 1Q11A 4DEVA 4CKCA 4YAGA 3UTDA 1GYRA 2GT1A 4LYEA 1KYQA 3EA4A 1U6KA 1R88A 3RSCA 5HF6A 3SCZA 5F7OA 1AK1A 2CBXA 5SYMA 3CURA 1AA6A 4MVXA 2BFCA 3HB7A 2YVLA 4UD2A 1JEEA 3BM5A 4P9NA 1P8AA 5M29A 1OTXA 3NNDA 1Z68A 4GMDA 1QHFA 3ROKA 1T3GA 3TG2A 3EEIA 4XH9B 4ZZ2A 1ZZGA 2IDKA 4PSUA 4R5MA 3VHXB 4E09A 5MN5A 3L8MA 1V25A 3GRPA 4ADSG 1PN3A 3QXSA 1YIOA 2YJNA 3T3OA 3KKNA 4G67A 2LRHA 2W71A 1DAGA 2NO7A 3GWZA 1HDIA 4M1ZA 4YMWA 4D81A 4JJ8A 3KB8A 5JTUA 1IBMB 3BD8A 5DE3A 1LTHR 3O84A 4XSHA 4JI5B 4AS3A 1PNQA 2FEPA 4Q48A 2O2IA 4UTXA 4ZT7A 3E27A 1SR8A 2Y0EA 4YDSA 4HDKB 3WGGA 1FP4A 1WPQA 5AVQA 2YIMA 3M5CA 3LGAA 3O3MB 3A1EA 2BFOA 4E12A 5BQ5A 1RI4A 2GN9A 3O1LA 4G65A 2A4MA 3RNLA 1EGVB 2IBTA 4F0JA 3TFOA 3GAMA 4UC0A 5FJIA 5BQFA 2UUBB 3ROMA 5FUWA 4B4DA 2WHPA 3NHSA 2PS1A 1LPMA 1ZN8A 3A1DA 5IWAB 3T15A 3IBCA 2FPGB 1AF7A 1QP4A 1KF0A 2WIGA 1U8AA 1J0AA 3AG5A 3QXGA 4OOFA 1JX6A 4DG9A 4DXAA 3LBHA 4P3OA 1V5FA 3W6NA 1WUHS 3P0IA 3IESA 4GZLA 2JHFA 2YMPA 4NV1A 1XZNA 3L41A 2PMEA 4DCJA 3QLJA 3OEYA 4EHFA 4PRLA 3CN7A 1YRLA 3KKPA 3AQ4A 4QHYA 1HKUA 3X1YA 3KKLA 5FPKA 5JI2E 2DC1A 2QUIA 4NBRA 1CNEA 5L3ZA 4YJGB 2Y4OA 2XA9A 3GFTA 4KYIB 4PHHA 4REMA 5H16A 3L4SO 3SR4A 1LZLA 1MIOB 4Z54A 1M34B 5IXJA 5MFPA 1GHTA 2IF0A 3ID6C 3TLJA 3HY3A 2Q62A 2PS9A 4MVJD 3KSAC 4JL6A 1JH8A 5DK6A 3MLBA 4RF3A 1ZEMA 3G0CA 5FTMA 2FPOA 1AOXA 3FCXA 4LMAA 4QICA 1FTYA 2HMUA 3CBGA 4DR2B 3L7AA 4PBSA 2W2OA 2A9KA 1E9BA 1YE8A 4GKAA 2CN1A 1VP3A 4K9SA 1EE1A 1ZCAA 2GYWA 4UUMA 3MILA 3D9QX 2PWPA 4LF9B 1XZ8A 2JVKA 3FTCA 2BGWA 3EF0A 2OM2A 5DNDA 4FYMA 3V8MA 3T38A 5G0SA 4ZDJA 3B89A 4HCJA 2H2FA 2FPIB 4ZEXA 2A5FA 1ZH8A 3PXXA 3H4VA 4KRYA 4P3PA 3ZWCA 3RQSA 4AP5A 3MTEA 1IDOA 3FCCA 3CRNA 4KB5A 3K70C 5E0OA 1IUOA 4BX9A 1M5TA 1CUEA 3TXYA 1DG9A 1LLQA 4RK6A 3VYSB 4AUMA 3AJ9A 3DR5A 1SC9A 4ER7A 1VZ2A 3CW8X 2MDTA 2ZJ1A 1ZP6A 1P60A 1U1DA 2WIBA 3AR4A 4I99A 1GO2A 2DUWA 4OAQA 3FZEA 1BE8A 3WQSB 4B2IA 1IOVA 2RAFA 3FCUB 2IV2X 1E61A 2DUJA 2UDPA 4U63A 4WINA 3GLIE 4YRRA 3ACCA 3WGIA 1VLQA 2HWWA 2XVZA 5A7HA 5AICA 4QPNA 1LY1A 4UVEA 1RW4A 1T5IA 2HCFA 2JIPA 4EI9A 3V55A 1AQNA 2GA9A 4UUNA 4DV2B 1RXIA 4XFDA 4L9SA 1NDQA 4BRSA 1TLFA 2H51A 3HJNA 3N5CA 3R0QA 4IWYA 4W9NC 5INTA 1I9CA 2FTKE 4YJ3B 2IHNA 1V9SA 1RPNA 5EQTA 2FZLA 3TGPA 1FVHA 5EN4A 1XOIA 1FSPA 1NAHA 1KTIA 1E8MA 4WRRA 2GZ3A 4OQMA 3KQLA 2RC6A 2NPIA 1NN3A 2AYZA 4IV5A 2P5SA 3E7WA 3KAQA 3GX1A 1DDOA 2AFRA 2V3VA 1KRWA 1TMKA 2DF8A 4AM8A 2Q4OA 3PIRA 3IAM1 1G6Q1 1KY5A 2D74A 1Q2UA 3IT2A 2AR7A 3NGXA 3BGSA 1SM4A 2RFLA 3E82A 3IIIA 3MCVA 4GX0A 1RS0A 1HLDA 1RQGA 1XN1A 4KZPA 5AK3A 3AVTA 4LJ9A 4TTPA 1ZO8A 3RUDA 5A5GA 4D9HA 3BIOA 3QYJA 1TEXA 4BFVA 4RCZA 1WNFA 5CH3A 4LDRA 4UUAA 1EWKA 1SNYA 1TMOA 3R5XA 4BLRA 2IYWA 4RLFA 2V0NA 4LJAA 2YVUA 4X1IA 1WF3A 2BR3A 4P35A 1Z25A 5EG5A 4K86A 3PLAE 2ZCVA 4YMUA 3PHBE 1K5PA 2FZVA 3QU2A 3GGSA 4PXYA 3ZDDA 3KPYA 5EC8A 1H66A 4HDOB 1EZ4A 3ZCQA 3S2SA 1KZ4A 2PKQP 3RVDA 5BVHB 4XOUA 1NMXA 3QI2A 3DOIA 1W76A 4M9RA 4YTEA 4OBEA 2Q4TA 2ZUSA 2G17A 4RD2A 5CDGA 5KQGA 5TQ0A 2FSIA 3L6RA 4TPKA 1EXVA 3U4MA 5TVKA 3KYBA 2ZKIA 3ZY5A 1R37A 3HACA 2OGZA 3DOUA 3RRFA 3T1HB 3NBYC 3EXG1 5ERYA 4RK7A 4DJ5X 5JNLA 4M36A 4MICA 3AEQA 2DVMA 3QFFA 4DSOA 4QUEA 1P7ZA 4PBTA 1LK5A 4MRSA 4BEBA 4JOQA 1IZ9A 2YWEA 1SCNE 1SUDA 3BICA 5M34A 2LVBA 2FG7C 1XMVA 1JHXA 2Z57A 2ZT5A 1FDOA 4EHNA 2B4QA 1EFCA 1O6ZA 3GFQA 5H83A 4CMEC 3TTSA 4TWBA 3BCHA 3FSEA 2IS1A 4J49A 4I2NA 2SNIE 3F2IA 4QBFA 1BNCA 4MR7A 3I61A 2EW1A 2Q3CA 1E1CB 2BFEA 1T13A 1MGPA 2WMDA 3IUPA 3OP4A 2CHQA 2TMDA 3VC3A 1H2XA 1U7PA 1MXHA 1ZIDA 2FUG6 4UBKA 1DJQA 5C53B 4W99A 2X0EA 1C1DA 3RVLA 3U9LA 2NXNA 1U9CA 1LUAA 2HK7A 1U3UA 3BSWA 4FT4A 5HX7A 2HNAA 1Z0SA 3W6UA 5C32A 5HS6A 4BZWA 3SSOA 4CLOA 3R9WA 3L4BA 1VL8A 3GL9A 5KSOA 4UHCA 1K6EA 3UWPA 2VTBB 3D5TA 4KQJA 4G0UA 4PPQA 1RLMA 4UCFA 2C8JA 3A1CA 4CG2A 1HDYA 2R85A 4V0OA 3PNLA 3IALA 1WBJB 4DQ0A 1AC5A 1NX6A 2FAXA 4W1RA 1L5KA 3E7PA 2AZXA 4FE3A 3LVQE 1PRYA 1C3JA 4N1AA 2YZ2A 3EGXA 3PRJA 4TRMA 3ZG6A 1YXMA 3ZHVA 2EGUA 4KBYA 3Q8MA 5HKKA 4CIWA 4DDTA 3CHYA 3DCNA 3MWDA 1N78A 1Y8RB 1E98A 2DR2A 5C8DA 4DGQA 5JCXA 4ZPJA 16PKA 2CL5A 3K70B 2FETA 1GG5A 4K8OA 1PE0A 3G2OA 2PL9A 2WZCA 1PGNA 4FDLA 1I3KA 2Q5IA 3PNOA 3GLKA 2W70A 4D8XA 5JXJA 2HA5A 1ZD4A 4JP3A 2ZJ0A 1G8SA 4GPBA 4WIAA 3TKYA 2WJJA 1C30B 3KE8A 1FX0A 4L27A 4B7CA 3FWZA 5AK5A 1M7BA 1ONOA 4EPYA 1C2YA 3AR2A 4RQTA 2C4UA 2N1BA 2J87A 3FPAA 4ZVOA 3WAKA 5FWXB 3PGMA 3PUWA 3L6CA 2VG8A 5DBEX 1R00A 2D4HA 3PGA1 1X7YB 4D8WA 3JD3A 3DEZA 1Y3BE 2CMGA 4KZKA 2QGNA 2H2AA 4DKJA 5SZIA 1MJGA 4PPYA 1UP4A 4WEOA 1NRXA 4AB1A 1T9HA 1UBSB 1J56A 3GCZA 1UQRA 3H0EA 5IM5A 1OGIA 4QREA 3WGOA 1G21E 3R9KA 1ND5A 1Z6TA 1UPAA 2H1CA 3KU4A 5JRDS 4XUEA 2WU3A 1P6UA 1JNXX 4LMPA 3B78A 3P96A 5CFMA 2I54A 2I0FA 3JR7A 3N2GA 3PT9A 2G8NA 3FCEA 5KKAA 2NIPA 3SR3A 2FRXA 4DA4A 5ALSA 2D0DA 4TN5A 4XARA 4TTJA 3FX2A 3EXEA 2UZIR 3O8NA 2H7CA 4MTLA 4EY8A 1LTKA 1ZR2A 2PUFA 4JB2A 4WZBB 3OT5A 3P4YA 3NHWA 4WJKB 5JXGA 4GQAA 5I3ZA 2V7EA 2POCA 1VJDA 2VYFA 3AVUA 1OYOA 3IMGA 2BEJA 3WGKA 5ARBA 4RTQA 1FW6A 1LDMA 3MJVA 1RI5A 3E8MA 5FL7D 3NH9A 5HUQA 1CR6A 1J9EA 1B3RA 2V6MA 4E51A 1R18A 4DXDA 1NGSA 5K0ZA 5KYKA 5KAPA 2CV1A 1MAHA 3K8YA 4RA9A 1HQKA 4Q4HA 4A8PA 2I2AA 1VYVA 1K3TA 3LIPA 4IFTA 4JJGA 4DKXA 1RXWA 2P1RA 5A1JA 1CV2A 2Z3ZA 4PW0A 2WD7B 2FPXA 4KL8S 4Y2VA 4FQ5A 3TTYA 3ESYA 4RHXA 1JWBB 1OR8A 2X6TA 1PQPA 2PNFA 3C5HA 3MWEB 4Y2RA 1HDRA 3G7SA 4B83A 5LPNA 3A9TA 2PYDA 2H5LA 4XJVA 3N0VA 4MSUA 4X92A 4NEHB 2CZQA 2QQEA 3PGJA 3MS2A 3TR6A 3C3EA 3ND5A 4D3XA 4F45A 3KQSA 4S0ZA 3NIFB 5C1BA 1YASA 1Q14A 3RPEA 2I2XB 3RHZA 3KWJA 4ZK6A 1DC8A 2GPTA 4KFSA 3MB8A 5HUJA 5A6SA 4IHKA 3H5OA 2BPOA 3LG2A 4L9WA 1SG0A 1A7UA 1N9ZA 2C0PA 3SYRA 1Z38A 1XHEA 1R27A 1JQAA 2C1EA 2BLLA 4MDFA 5TQVA 4YXWA 3PXGA 4ARAA 4WUTA 4JI0B 3IAS1 5F5LA 1A8HA 3KOMA 5JNTA 1CJTC 4GDFA 4ARZA 1G19A 3DWEX 2ATEA 4ZV7A 1W7AA 1EUYA 3VR0A 3MTAA 1SIWA 1WSDA 4PYIA 5LQDA 2IK8A 4YXFA 1ZRNA 3T9AA 4CV0A 3OCYA 3QHAA 1PGPA 4LX8A 4QAJA 2IZ7A 1UAGA 1UMKA 3PD0A 1HLGA 2V7PA 5AJXA 3RBZA 3LI2A 3MSXA 4HBGA 1MO6A 1PUJA 3DP9A 3WYFA 3K15A 1FDIA 2H3EA 4MVJM 1G8GA 1Z4LA 5BV0A 2EBFX 2QDKA 2W22A 3C8UA 3QVGA 2G67A 5JSKA 1HURA 1FLVA 2XTZA 4MMZB 2JH9A 2X5JO 2RK4A 1I8TA 3VR5A 2ORVA 2UUOA 5CDFE 4ZAXA 4XJSA 1AQUA 1M1ZA 3TOSA 4EYEA 3TSOA 1PGJA 4FCTA 4G4IA 1GL6A 3BAFA 4NU0A 4YB8A 2WJ4A 4YALA 2I2WA 3WJ1A 4DAEA 3IR6A 3A11A 3NOVA 1HNNA 2JJ2D 2QVGA 3I72A 3SR0A 1ADFA 5C3UA 2I4TA 3BXXA 4WXEA 1IRIA 2WVGA 1ISHA 1VMKA 2ID8A 3HHEA 4BLQA 5DI3B 3IKMB 2PUBA 4B3XA 2Z4SA 2HC9A 4P31A 2G77B 4LJ6A 3T4PA 5A3QA 1UPXA 1AUQA 3SHVA 3S44A 3CN9A 1UXGA 5L95A 2GZSA 1Q77A 2NW6A 1C3EA 3G5TA 1W5TA 2VT3A 3AW9A 1UDXA 2HHAA 3WV5A 1QHHA 1CUZA 1IQ0A 3KQHA 1I32A 4PZDA 1OB2A 1NN1A 3RRMA 5K6AA 3VR6H 5DI9A 3ZNOA 2NZXA 3HS3A 1PBTA 1AO3A 1XK7A 1NMSA 2Q4DA 4KQ9A 4NX2A 4JJ7A 4PLWA 3WMGA 4CN8A 3BERA 4R69A 1QRSA 2CDAA 2WP0A 4G0QA 4ZCTA 1AXGA 2HDHA 3GOQA 4UTOA 5IJZA 2CFIA 2WQ7A 2XBMA 1V8OA 1GQOA 2D2VA 3CWZA 2GF2A 1SY7A 4FYHA 3PQ4A 5EZSA 1RXYA 4TGLA 3IKTA 4XTRA 1ORIA 2VJOA 4D8UA 4ZI3A 1IN5A 5FRDA 2KSQA 2P3OA 3WSWA 1S1MA 2XTJA 3TPZA 3PXAA 2AGVA 1RZ3A 2C1XA 3QSGA 4HLCA 4L57A 4E30A 5C7OO 4RDHA 2DHEA 2HQOA 3FB1A 3M1LA 1RAHA 3N74A 3ESAA 1M8FA 1UJNA 2PRSA 4ND6A 1QX3A 1GKUB 5FADA 1U98A 2GWHA 5ERGB 4BCCA 3OE7A 4AMVA 3W90A 1RU3A 1TM1E 4PAOA 2EV9A 3DLCA 3HP4A 5BNZA 2ZE8A 3O8OB 3CZPA 3O8LA 4NIMA 3ZUGA 2EEZA 3KQOA 1JQLB 2VF4X 3HWRA 4N01A 2G70A 5DLPA 1U4OA 1GU0A 4YRKA 3FFXA 4OHYA 3LA8A 4TWRA 2X3FA 3R40A 1MFZA 1SQ6A 2QRQA 4PYMA 2VCEA 1PGQA 1Z16A 2UXBB 2ONKA 4E88A 1RBQA 1VLZA 2E21A 2NZJA 3IXLA 4OHFA 4I3HA 3DHEA 1N3YA 3TQQA 3WHIA 3P5SA 2GEBA 1YHNA 1DX6A 4GKKB 3QXJA 2CFRA 4Q1DA 3R5HA 4IDGA 1GPKA 4DVJA 5C8ZA 2NSDA 1E59A 3T35A 4M76B 2R6HA 5FULA 4HGNA 3I1FA 4JCCA 1P9OA 4OBWA 1RAIA 1WHSA 2QKYA 3DZDA 3QEMB 4MQ4A 4DMUB 4YAJA 5EMJA 1W25A 4F4DA 3E22B 5EIAA 3UT5A 2QRLA 1P1RA 4P4SB 3P7MA 3VU9A 1KK1A 3NHJA 2EFEB 1O94A 3A4LA 3DGEC 5DRYA 4CFZA 4TYYA 5DZSA 5HF5A 3QV1A 1W4LA 1IK6A 1G66A 4MUEA 3UPUA 6NULA 3NHMA 3TSCA 2ZOSA 1JIUA 1XDBA 2DWQA 1UBHS 2FR8C 2RKWA 3QKIA 4MAAA 1NVGA 1BEZA 1Y3IA 2YN4A 3FOAA 4MUKA 1H85A 3EE6A 4QTUB 2JDIA 4QXAA 5AKXA 5JNSA 1G38A 1ZY2A 4JX8A 4MTCA 4C14A 4D0GA 1BVHA 2XJ4A 2HLHA 3QJGA 2XMQA 3LOPA 3GR6A 3VH1A 4RIGA 3OJEA 4V0QA 4ZTBA 1U5CA 4L4RA 3X0DA 2VOJA 2ZTSA 3WQQA 1D2RA 2O7QA 4OX9Y 3EXHA 5CLLA 5BURA 4A7PA 4QTTB 5YASA 3MWLA 3V32A 1A8UA 3WWEA 5DYIA 3MQ2A 3DAYA 4BC1A 2P2LA 5E4TA 4WN9B 4DBZA 1T9GR 1FU4A 2CHVA 4U39A 1WZIA 1QH1B 4R1MA 1UM8A 1VM6A 1WXWA 3B60A 3O26A 4IX1A 4AU1A 2QTZA 3EGWA 2PLAA 5EKDA 1DLIA 2G4LA 3THOA 2Z30A 1DGQA 1Y1KE 3C7KA 1ZYUA 3AZOA 4MWZA 3A1NA 5FPHA 2E0IA 3D6HA 4WBSA 1U3GA 1I24A 1N0VC 4Z7OB 1LCIA 4TMWA 4PCAA 2WYWA 3OC6A 2ADFA 3O3NB 1T35A 1MLDA 4KGXA 1EYZA 1ZKMA 4IVPA 3TQIA 3V9AA 2PV7A 3PENA 2R6CA 1FQOA 4DIBA 1RVV1 1FOEB 1XWWA 3W34A 1X9HA 2NTNA 4F2WA 1J90A 3N70A 3QE3A 2YRXA 2HO5A 5AIAA 4M1MA 1M73E 3NTVA 3WQHA 1Y8CA 4HUQA 4DNOA 4X66B 2L82A 3V6LA 4KU4A 4DLVA 4OHXA 2H4XA 4H6XA 1NVBA 4V0ME 5CDFA 2OFWA 3T7KA 3DOCA 1GPNA 1OFHA 5FV7A 3QYPA 2QMEA 4UBLA 5HQ3B 2X8JB 5GZ6A 3LECA 4GE0A 4YDQA 2Z56A 5U4QA 1JG4A 2VK2A 4GOJA 3GELA 2JK0A 4L4XA 5LP6C 5LXTB 4B5KA 1KDRA 2R79A 2VHTA 1VLHA 3ELBA 1E79D 5IN4A 3DMFA 4QOHA 1J0EA 3OQJA 4ALNA 4D96A 1E96A 4KI0A 3M6IA 3EGDB 3TIXB 3OQMA 1Y5MA 1XR3A 2VDKB 2JNWA 3LWDA 1P0CA 3EODA 1BVUA 1GU7A 1XCBA 3G13A 3ODGA 4UDOA 1LX6A 3ZZ0A 5M2QA 3GAFA 5CYPA 1CZOA 3Q3EA 4TMKA 1SD2A 4WA7A 4DFDA 4GLFA 4HAZA 3AVWA 1D4ZA 1LFAA 3IV9A 2IXAA 5BNTA 5J1SB 1W88A 5KJ1A 1Y1QA 1BJTA 4RU1A 2VJPA 3C3AA 1EA7A 3B38A 3DFKA 3ND8A 1U9JA 4MNTA 5IC4A 1IBLB 2H4FA 4AKHA 4Q82A 2H5IA 2H11A 3LTEA 1E3MA 2Z2XA 2PFKA 3OKPA 1I4OA 3TRDA 2FRDC 3AIKA 5G1PA 1M1YA 1R0YA 3ZN2A 2WD8A 4ZQFA 2VJQA 3B20A 4I9FA 3RTAA 3N6XA 1PR0A 4J90A 3EZ6A 5HZKA 2VUSA 4OQXA 1M5RA 4MI1A 5HQ3A 3CMMA 3NDPA 2BOVA 5JDIC 1X80B 2I4OA 2UYQA 2V7QD 2XVXA 4QXRA 4RX1A 3RS7A 2HD4A 2XUHA 2UAGA 3IP3A 2P69A 2IOFA 4MS1B 5IKOA 3URMA 5CX1A 3S81A 3EIFA 1J9ZA 1V37A 3L7MA 2HKIA 4Q16A 1GYPA 2ATCA 1VGVA 4JKIA 5AW6A 3GA0A 1JHAA 1GRNA 4AJEA 1W36D 1EXDA 2AX4A 3FMGA 1C7IA 2EQ5A 1YD7A 3GJ8A 2OSVA 2FZ5A 1ZI9A 3VOAA 3LF2A 3WG9A 1JECA 1MC4A 4WFJA 4URFA 1NOKA 1OLUB 1C4KA 4X1KA 5B3JC 1U9ZA 3VR2A 1I6KA 1P1JA 2OUKA 3B3FA 4D97A 3P9IA 3EFOA 1GA6A 2IEBA 4LC1A 3PDIB 4MV3A 4QA9A 5HDQA 3BH0A 4KUHA 4UZEA 5I4CA 4PINA 3NM5A 5F5XA 1PK7A 3FY4A 3LKVA 4EVQA 3FHCB 1HNXB 1J39A 4CEJA 5FBWB 2ZPTX 3ZKWB 3ILXA 3ITDA 3B2QA 1LTQA 3OIUA 4MW4A 4MIOA 4LMBA 3NNSA 5M04A 3R5KA 2COKA 2JLBA 1HNZB 1T8YA 4JNCA 3MJHA 4YYEA 1E1RA 3GGJA 2BTQA 1D1PA 4MS3A 1Q7BA 1MX5A 2RI0A 2GB4A 2XVYA 3O4IA 1Z0UA 5TDHA 2E89A 1QQTA 1Z34A 3LP5A 3MTIA 1J2YA 3QTBA 4UCQA 2W43A 5CR9A 4RGVA 3NKFA 1QXSA 2AMFA 1T34A 3G89A 3M9WA 2NPFA 2NUPB 1X8LA 2SKDA 3AU9A 2EWVA 5PNTA 4CFSA 1G1AA 3PJRA 4G86A 4H1TA 2X76A 1J7KA 3MFQA 4TSFD 1OZ0A 4QOEA 1YNSA 5IEBA 2QI9F 1FUUA 4F5YA 2R7NA 3A10A 2PWBA 3RVQA 3VVBA 4BDSA 1PW5A 2C95A 4Q9JA 2CNBA 3VAZA 2BJWA 3DOOA 4V03A 1RC8A 5IW8A 1B6GA 3PXCX 1NULA 1UDWA 3BMCA 4KNYA 4G1BA 1QGOA 4G81A 1ZQ9A 4OAOA 4B6EA 1OLOA 3FH0A 4BJ6A 4I6GA 3RO7A 2FMUA 3GCWA 4IXMA 4BFZA 1EUDB 2Y1GA 1R4MB 4MVYA 2M98A 1DKQA 2XDAA 3FMIA 1MX3A 1A96A 1UZMA 2R2GA 1WUJS 3ABZA 4HAOA 4TSKA 3ZJUA 3KLNA 2M6LA 5B30A 4E2ZA 2YFHA 3W06A 1U5BB 1T3TA 3DYIA 1KK2A 2QUAA 3HV0A 2F59A 3HUTA 1NU6A 2H5JA 4L75A 4BBJA 1YSCA 4EATA 5HUHA 3CH7A 3LKZA 1YS4A 3COJA 1PLLA 2SHKA 1F8YA 2XQFA 3ILSA 3K9BA 3HPQA 3O03A 1ZICA 4PGAA 4UEOA 3AETA 3SQDA 3PU6A 4EEZA 4MB6A 2PQ2A 3IQWA 1HORA 2DWUA 1R50A 4J2OA 4YJDA 1KZ6A 4RQAA 3ZTYA 3NOOA 4QYWA 4YRLA 3H83A 1YF3A 5LYJB 3L8EA 1OHHA 1WO8A 3OJXA 3EVZA 3A26A 3R7BA 3U6BA 3VPXA 4IHJA 1IJBA 1PD0A 5DOZA 4BKOA 5BN3B 4DHEA 1JYSA 5LP6B 1E6MA 4L5BA 4RZQA 2CXQA 3DTVA 1GR0A 1H0RA 1PFKA 3B70A 3MJTA 4CMCA 1JEAA 4IMPA 4L0QA 4ZI7F 1P2BA 1VJGA 2WKQA 2QSUA 4HL6A 1Z06A 3LUGA 1JSRA 4ITUA 1JR6A 1PTKA 5LWQA 2GJ8A 2OCGA 1JMKC 2FCRA 3HSKA 3IUEA 3O9VA 3WL6A 1KJQA 2XR1A 3U56A 3THYB 4BJ1A 4B85A 3KT0A 3OM9A 3WWDA 2WHRA 3CMCO 3PWKA 1GPBA 4HH0A 3RVRA 5KDLA 4MO2A 4EA9A 1WHTB 1JA1A 3LFHA 3RS9A 5AW8A 4YRSA 1GPMA 3WLJA 1UKZA 4B7ZA 4DG8A 3A3YA 3DL0A 2LXNA 3HKCA 4OHWA 4F9EA 3GJ4A 3AFIA 5HE9A 3VUEA 3ZXXA 3EBPA 4K6CA 1BE1A 5L40A 4L4UA 4BVEA 2HU7A 3OIVA 1QO0A 4O4HB 2VTDA 5E38A 1JWLA 4CCYB 4L76A 3PDHA 3WKAA 3GVXA 1F06A 1P74A 3ZVLA 1PWZA 4KLZA 3DE2X 1OBHA 4X3OA 4X3PA 2CJPA 5TMBA 1KEVA 4DT1B 4JI8B 2FUEA 1R6TA 3AG6A 1D2AA 1NTRA 4F97A 3IHWA 5JJIA 1JQ3A 1YZHA 1EG7A 1EFKA 4Q19A 5HA5A 2ZREA 4CEIB 1SHKA 3MAGA 5KU7A 1HG0A 2X42A 4U2DA 1DMRA 3UAXA 3PQDA 3WISA 3Q9SA 1JR3D 2YS7A 2GEFA 5FWDA 3PR1A 5BOVA 4ZODA 1Z2PX 4YFYA 2CMFA 5REQA 4BGUA 1JJVA 3E23A 1U7ZA 2D2XA 4Q0MA 1IOWA 1TKCA 4XLTA 5GONB 3QKSB 4JUFA 4JC0A 4DA9A 4QPCA 4DMFA 3THWB 2A0KA 2QTVB 4TL6A 1KYVA 2HRZA 3LMKA 4UQOA 3W7BA 1AZLA 2MWMA 2WTAA 2OHJA 3OJOA 1KU6A 4K6GA 5TQJA 1GZVA 2QM0A 3HI6A 5FIUA 1SKMA 3UPTA 5EXDA 5UKDA 5TC4A 1CUYA 4LXGA 3QH4A 5JSZB 2EKLA 2DFKB 2O19A 2V65A 2RBGA 2WUWE 4MPJA 3GLFB 8OHMA 5KAMA 1Y6QA 4QJ3A 2WWGA 3CLUC 4IMIB 4S2EA 3BHMA 3KSDO 1KO4A 4CIBA 2YC2C 1A8IA 2PMFA 1FMCA 1NR7A 1U7TA 1LXCA 3D0RA 4QDUA 3SQNA 1N2GA 2WAMA 1G1MA 5JXWA 4JI7B 2F43A 2ZU0C 5DNAA 1KGDA 5CU7A 3DDOA 1WP9A 4EYSA 3CXRA 3G5UA 4DMLA 5C31A 3K30A 1RIIA 4IH9A 4C06A 1N77A 1WXEA 3DBRB 5LVAA 5AHXA 3OKCA 2BKEA 3OTIA 5G41A 3L7DA 1ZNWA 3S70A 2AFIE 1Y0BA 5DW0A 4KDRA 4LE1A 4EGSA 2B0JA 4D9BA 4L7QA 1HSOA 3K5PA 4M0CA 5CUQA 5C5CA 2OBYA 4Q6WA 4I4CA 3ZCPA 1JHPA 1SHUX 4AN4A 4DM3A 1OJLA 3FPGA 4YAKA 1E1NA 3IVCA 3HO8A 2I3GA 3U49A 4BTLA 1M0WA 1KH3A 4E6PA 5HRCA 3D54D 3PBKA 3ADDA 1ST3A 1E0AA 5FOTA 4LV5B 1CJUC 3S7ZA 5ADHA 2BCJQ 1YTUA 2JKYA 1D2EA 4ZO8A 1SVIA 1WG8A 1A9XB 4DCMA 3FOFC 2G1JA 2OGUA