3CONA

Crystal structure of the human nras gtpase bound with gdp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
156
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human NRAS GTPase bound with GDP.
rcsb
molecule keywords GTPase NRas
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3conA00
2MSCB 5IDVA 2CL0X 1CTQA 5B64A 1FNMA 2F1HA 5FBWB 5C4GB 3NG1A 5LDDC 2NO6A 3GLIB 4XSGA 1N6RA 1KO5A 3AP3A 3GLHE 1U0JA 3K0AA 4IDNA 1KOFA 4LYFA 1XMSA 4E03A 2CBZA 2EFGA 4NCKA 421PA 1OHHD 2HV8A 2BMEA 1IOZA 4JMPA 5G53C 5GJWC 1MT0A 1U8YA 3KUCA 4IDHA 3DO6A 1IN4A 5DE3A 4OQFA 4NP6A 2DFNA 2MMCA 3OF5A 4DDUA 4TYYA 4MQBA 1WDTA 1NLFA 4LJYA 3ZVMA 2D06A 2ZRDA 1KIMA 1QRAA 3AF3A 4RZUA 3K9HA 4NDZA 3FOZA 2IS2A 4PAQA 3PITA 5DGXA 5EP3A 3UWKA 2O8EB 5L3VA 1XTIA 2IYXA 1Z3IX 3D6TB 2WWWA 5KOYA 5DN6A 2GCNA 3FPAA 1DADA 1PLLA 3OIUA 4B2LA 1R5NA 4BASA 4URVR 4JSTA 4B6FA 1FTSA 1NI3A 3DKPA 1NY5A 3THXB 1G4AE 3QKSB 2CCJA 4LY6A 3A1UA 1UKVY 2AD5A 3NH9A 3QF4B 2R6DA 4D4KA 3IILA 5DYGA 1EESA 2VA8A 1S4QA 1IQPA 1X1SA 3HYRA 4LHYA 4B3GA 3EZ9A 1KI1A 4UXJA 4OHVA 1F2TA 1CJKC 2ZJYA 4C7OA 821PA 2CK3D 4GL2A 2C9OA 2ZUCA 4JJKA 3R8FA 3KKMA 3RC8A 1E0AA 2YYZA 2VQSA 1M8PA 3JZAA 3FKSA 2OG2A 3KB2A 1AA9A 2QUZA 4B3XA 5DIFA 2IWRA 1HE8B 1ZM9A 2UKDA 5JWOA 3AGQA 2PJZA 2XB4A 3A8TA 3V9PA 1RE0A 2XX3A 3CF0A 2IA5A 1A2BA 3UKDA 2QM7A 3CKLA 4PC1A 1KSJA 3CRQA 1YZQA 2KWIA 4Q4HA 1JQLB 2XJ9A 4FMCF 4TWZA 2A5FA 4TTQA 4US0R 2GILA 1WXQA 2JLUA 1D2NA 1H8HA 2P6NA 1UF9A 2ZITA 1G5PA 3AVWA 2J59A 3FKQA 3UG7A 1OB2A 1SGWA 2GCOA 3ZQ6A 5FPYA 3WYAA 1TEVA 1J70A 2PCJA 4NCIA 5FOSA 1UBGA 5GJVC 3AKCA 4HLUA 2CXXA 4JL5A 1OIVA 1OH7A 1YZLA 3AVPA 4DCNA 2RGXA 4AKEA 5IRCD 1ZAKA 2CVFA 1OFIA 1GOTA 2BBOA 3FMIA 5HKKA 3G0HA 1CULC 3IHWA 3EPLA 1Q3HA 1R0ZA 1QVRA 2H17A 4CYMA 4URXR 4DUGD 4AYXA 2KSQA 4JLBA 4DSOA 4BLRA 1E2HA 2ZRPA 3FMOB 1ZNYA 3X1XA 1Q1EA 2JLSA 2Y8EA 1VMAA 1DE0A 2BCJQ 4PX9A 2VYFA 1AKEA 1IN7A 4RSGA 4KCGA 4MRSA 4PZZA 5FUXA 1TQ2A 2WJIA 2PBRA 2KB0A 2GAAA 2QQ0A 3AEZA 5FPHA 2HUPA 1Z83A 3BS4A 5IHPA 4UNNA 2ZRFA 2OM2A 4NYMQ 2C8VA 1E9BA 2RKOA 3K53A 4IOJA 2IWHA 5SZIA 3ZS8A 1ZNXA 2QPTA 1KO4A 3PG5A 3AP2A 4MKFA 4Q7LA 3X1ZA 4LYHA 4ZDWA 3O8CA 1E4VA 2PZFA 3BFXA 2CLCX 2ODBA 1IXZA 1E6CA 5G41A 1KSFX 5EXXA 2ZU0C 2VEDA 4YDHB 4HB3A 4QG7A 5HCIA 1A82A 1KDRA 1OE0A 3BOSA 2QMOA 3NBXX 1LTQA 2B8WA 1P60A 2C98A 3NHBA 3MFYA 4V02A 3KQUA 1WCV1 3SYKA 5JJIA 2FN4A 3LO5A 1DEKA 4RCYA 4TSFA 2BMFA 2GEVA 3T1VA 3P20A 1F2TB 4ESHA 3SEAA 1E96A 2PX3A 4DDWA 1FQKA 1ETUA 1J90A 1W36D 4OK3A 4Q01A 1AZTA 2V1UA 3LA6A 3LDAA 2WSSD 1P3JA 1Q1BA 2GBLA 5JRJA 1GKYA 2P65A 5KYKA 4B73A 2QP9X 4OQXA 1KJYA 1M2OB 3SQWA 2C5LA 5F2EA 3CZPA 3GLGE 4WIAA 4LBWA 1P73A 1TU4A 3CNOA 4P4SA 1RVDA 2GXSA 2C96A 5KNCA 1EFUA 4Q4HB 2F1IA 2ZYVX 5TXGA 4EJSA 4WXPA 4DC9A 3GJ0A 5H1YA 3VX3A 1CEEA 2B92A 4OQNA 3TQFA 2ORWA 4Q66C 3NBFA 3B60A 2GCOB 2JDIA 3AVUA 4B2PA 5KSPA 5FBVB 2F9LA 2XAUA 3B1ZA 1A7JA 1E32A 1F5NA 1QBKC 3REGA 2GXAA 4KLNA 4HAXA 1N6IA 4M1TA 1HEIA 2OCPA 4B33A 3U3RA 4PPNA 5F3WB 1DPFA 1KI3A 1SKYB 3RWMB 4R98A 1CIPA 2WWXA 4CT5A 2VH5R 3HWSA 2A9KA 2IXGA 3IHLA 2ZTSA 4JL6A 1UM8A 1SHZA 3MMPA 4MGZR 3TAUA 4G5SA 2FSGA 4Q47A 5EUQB 5G3ZA 1XTKA 5L3QA 1NF3A 1WB9A 2ZRBA 1YRAA 3D7MA 3S1AA 2V7QD 1HH4A 1XPUA 2ZSFA 4M53A 3REFA 3SJCA 4JLMA 3TMKA 2REOA 3QPWA 5EXSA 1GWNA 2W6JA 3IKJA 4JZKA 2RGDA 1T6NA 4S35A 5CK4A 4A8JC 3GJ4A 3QNUA 1YR9A 2C78A 3BIFA 4M1OA 1N6PA 2Q9CA 1IHUA 1BMFA 1N6KA 3GEHA 4Q5IA 3SE0A 2IYLD 2OXRA 2MMGA 1G7SA 2PH1A 3B1WA 4L5BA 4Q1FA 4WOPA 1XTSA 3LLUA 5J47A 5UKDA 3Q85A 1E2PA 1CBUA 3LLMA 4ZDJA 3K70D 1SXJD 4XTRA 2XTMA 3WHLA 2R62A 2RCNA 4Q7MB 1IN6A 3QI2A 5KHOC 2FWRA 3VMFA 1UKYA 1GILA 2D4HA 4NONA 3ZS9A 2YZ2A 1SVOA 3W9YA 2FSIA 3WBKA 4ARZB 3IQXA 2WAYA 4JLDA 2IS6A 2DYKA 1Z28A 2ZAOA 3BB1A 5J4LA 2WM9B 4MYHA 1PZNA 2VIIA 5TDHA 2ERYA 1UEJA 4FMDF 1W1WA 3FVQA 5EE5B 3RRNA 1NG9A 4AKHA 1JR3D 1US8A 4IHQA 1FUKA 3AP1A 2GDJA 3BWDD 1TEXA 2AWNA 4QGFA 1DAIA 1E0JA 4NYJR 2F3TA 3W5JA 3L0PA 3P4YA 3KQNA 1XZPA 1TX4B 1MO6A 1XTQA 2BIFA 4MDEA 2J0SA 4MGKR 5FUWA 4B6EA 5F9HA 2ZU6A 3Q5DA 2ZJZA 1Z6AA 3FFAA 3HYTA 3UPUA 3Q8XB 1XMVA 1G4UR 2JLQA 4B71A 1QDEA 3CBQA 3GJXC 3F8TA 4R2HA 4MRNA 1G9XA 1W49A 1EWRA 1JEEA 3NBYC 3RABA 2O8FB 3K1JA 3IPYA 3E1SA 2GJAA 2JAQA 3LBIA 3Q5EA 5CLQA 1E2FA 1TF7A 1KTVA 4OBEA 1OT3A 1XDBA 1B23P 4AURA 2JLRA 4W9MC 2QBYA 2ZQ5A 1E9CA 4GT1A 1XCPA 1UADA 2Z4RA 1WQ1R 1YZKA 1T9HA 3Q7QA 4C9BA 4NPHA 4NBSA 5FBLB 3FMPB 3KJEA 2XB2A 1JALA 1OHHA 4KXFB 1FW6A 1G7TA 1HT1E 1FNNA 5DI3A 5KDDA 4CEJA 1LW7A 3TAHA 3JVVA 2OCAA 1CKEA 1JAIA 2Q6TA 2AHOA 3IBGA 2A7QA 3RS2A 2JJ2A 3I8SA 2ZR9A 3IIMA 4GOJA 4MYUA 3ECCA 1J8YF 2NG1A 5L3QB 5FFMA 4Q9HA 2PMKA 2R9VA 5SZKB 3KFVA 2IHYA 4Q19A 1D6JA 2WSMA 1ZD9A 1VG8A 3U7EB 3SS8A 4WZ6A 3AUXA 1TU3A 5EP4A 4DCVA 4A6XA 4GNKA 1NN5A 3K9NA 1T5LA 1FFHA 2NPFA 3GCGA 1G5TA 1YJ5A 2W0MA 3CONA 4KJZA 4LUCA 4Q18A 4Z8YA 1G3IA 5J4VA 2PCLA 3CX6A 3ZD7A 4ZO4A 1GL9B 4YQFA 1R8SA 3ZD6A 1SXJE 2HXYA 2YWEA 2VSFA 2CK3A 5EP1A 3CNNA 1G7RA 2F43A 1P2TA 2CDNA 1UDXA 2QQEA 3TUIC 5LPNA 1OB5A 2NZJA 4TL7A 4F7WA 3B1VA 2ZVQX 3KKQA 4N0EA 4HLQB 3TW4A 5D3MA 1FTNA 1X3SA 4MRRA 4GRAA 4DLXA 2ZSAA 3K09A 4WZAE 2QROA 3EAQA 3CWZA 3TNFA 1IY1A 3GLGA 3MWKA 1JR3E 1S1CA 2J45A 1S3GA 3B1YA 2ZI3A 2DHRA 1RYHA 1R5BA 2VL7A 3W90A 2DFKB 4V03A 5CIWA 4KLZA 2SHKA 1P72A 2B8TA 3EARA 2HF8A 2OILA 3BERA 1T91A 3PEYA 1N5LA 1LB1B 2ZYUX 4HB2A 2UVQA 4XH9B 4TYWA 1G8GA 1W2GA 4JYCA 2O8CB 3IO5A 4BECA 4M21A 2XOKD 1ZBDA 1F60A 3CPJB 3HR7A 4I1VA 4LZZA 4OI4A 3OHMA 4ZCIA 3PUZA 2ZSDA 3RSLA 3VFDA 3ONWA 3QF7A 4DUGA 1P9NA 3WHKA 4DIEA 2BEKA 1W4BA 5JMTA 2QAJA 3I32A 5DNYB 4Q1BA 4HDCA 5GJCA 2QBYB 1NBMD 2QAGB 3HPRA 4F4IA 3C5CA 4HLCA 4C0KA 2WTUA 2E9SA 1NJGA 1U2RA 1WMSA 3GP8A 2QM8A 3RS3A 1Q44A 4WA7A 1P9WA 4KI0A 1P2SA 3CLVA 2GA8A 5DI3B 2B6HA 4OK5A 4HAZA 1W0JD 3NC0C 4RCZA 1OXXK 3PXGA 2AKYA 4QXAA 3HDTA 1QVAA 4FI3C 3C41J 2BWJA 4K46A 4LV5B 4YMSA 4JVLA 4US1R 3SFZA 3EW9A 4KVAA 5BW8A 5JJKA 1N0UA 1W7AA 4TMTA 3A1WA 3GMTA 5CJ2A 1E2KA 1M7HA 2I1VB 3IIKA 2V3CC 2Q0HA 1XBTA 1SVMA 2V6JA 2HYDA 5H8WA 2YHSA 1KSHA 1Z29A 3E2IA 3IGFA 1KI4A 1KSGA 4HB0A 4CRWB 1OFTA 2ZS7A 2RGAA 2DCUA 5L8VA 3L0IB 1S3SA 3KX2A 1Z6XA 2GJSA 1Z07A 4QC2A 1CLUA 4L16A 1U81A 3PQCA 3QSYA 5FTMA 2A5DA 3CRVA 5JEEA 2Z6VA 2G83A 2YOFA 4LV8B 2JGNA 4C4PA 5AUNB 1W2HA 2F43B 1I2DA 1FUUA 1IBRA 2WSSA 3GEEA 1J8MF 4PXAA 1Z47A 1ZNZA 5KDLA 3W8RA 4N3NA 1EFTA 5D3MB 2Q3FA 3ZVRA 4B32A 1DTSA 3TJZA 3KKPA 1E0KA 4OI2A 3U44A 1BYUA 2W2VA 1OH8A 4IVQA 1RRFA 3WMFA 1I2MA 1Q12A 1TUEA 3AV0B 3R9IA 3SYLA 4ZCLA 3U6KA 1P6XA 2YKGA 3CH5A 4B48A 5CLLA 3ZLJA 3RS0A 3I5XA 3NDPA 1DAGA 4M2LA 3PV0A 3UMRA 3SDZA 4JKYA 2ZREA 5L3RA 1B0UA 2IL1A 1IONA 1OXTA 2W0SA 2YJTD 4IOKA 2AK3A 2HEIA 2VPPA 4YXWD 2EVWX 3W6PA 1ZM7A 3L43A 1UBFA 2VP2A 4PR0A 2VF7A 3T1TA 2FFBA 1I4TD 2J0VA 5CK5A 3ZVNA 1MV5A 1OLOA 3K0CC 2R6GA 3WBJA 1PUIA 4CZ2A 1VCOA 1ANKA 5IT5A 4NTZA 3ZDQA 2GXQA 1AIPA 3C15C 3M1IA 4IEIA 2LKCA 1XEWX 1E9EA 2FSHA 5M04A 1QG2A 4XSHA 1MO5A 4TLBA 3VR3A 3GJ6A 4NE2A 1ZM4A 3Q72A 3LH5A 2CHQA 1Z0DA 1NBME 4JBWA 4G01B 1XJQA 4IEEA 2EW1A 3LY5A 1NIJA 2VF8A 4L15A 5FTKA 4QGGA 4QGHA 2V7QA 2JLXA 3AVTA 1GL6A 2EQBA 1R2QA 1N0WA 4BFYA 4D4JA 8OHMA 5SZHB 2IUTA 4C0SA 4ABYA 4Q4AB 5E95A 2W6IA 4PQYA 3CPEA 4ZPXA 5EE0A 4A2QA 5JEDA 5JLJA 3R8CA 3ZJYA 2AL7A 4UJ5A 4OQMA 3LX8A 3C5HA 4WBSA 2I4IA 2JEOA 4Y0AA 1GNPA 1TNDA 2OFXA 1MR3F 5C2JB 1WRBA 2YVUA 3QKRA 2J7PD 1Q22A 1NMYA 3CM0A 1GVNB 1XX6A 2G3YA 2YWGA 4FWIB 4A4DA 4A0RA 2ONJA 3SYNA 4TT3A 1UPTA 1VCNA 1Z08A 3QENA 1SXJA 3RVBA 5K8IA 1Z5ZA 2IF0A 1ZMXA 2RMKA 3DL0A 2BV3A 4TTRA 2BBWA 1YZUA 1JPJA 2IYSA 1R7RA 2EYUA 4JIMA 2OFOA 4A0HA 4DSUA 3V00A 4B2IA 4A2PA 2ZYWX 1G16A 1BO6A 4PFSA 4PSKA 4EPYA 4Z54A 4DCTA 2BJVA 1ZW6A 3Q7PA 2AXNA 2X2FA 4G5QA 2Q9BA 2PZEA 4YMUA 1DAMA 3AUYA 5FOWA 4RJLA 1JR3A 2A5JA 4QKQA 5IF9A 4A2WA 1W36B 1JECA 2FF7A 2W58A 1E2LA 3MCAA 4RKEA 1KK1A 2YOGA 2YNMA 3DEFA 3WMGA 1GRRA 1FP6A 2JJ1D 2I1QA 4JLKA 3OIWA 1XPRA 4RKFA 2VTKA 5FR1A 3L8YA 4OJKA 3SFVA 3F5FA 1DELA 1L7VC 2QTFA 3FHCB 3U44B 2XEXA 4LV6A 4MITA 5JS8A 3AKDA 4QBHA 4JLVA 4Q21A 4AKIA 4M0LA 1AM4D 3U6BA 4OHZA 3TVDA 4NU0A 4LSGA 3SU8A 4NYJQ 1MKYA 2ZI9A 5CB6A 3D3QA 4B35A 2BEJA 1V5WA 1E3MA 4UNQA 4KU4A 1A1VA 4M1WA 1VYVA 1OFHA 3B6EA 3I3SR 3GQBA 5BN5A 5JI2E 1E79D 2Q3MA 3GFTA 1N2CE 3TVTA 1XEXA 1T5IA 2JIZA 2ZPTX 5FH9A 4MRPA 4AD8A 1OKKD 2FFAA 3KQKA 2X77A 2Z0MA 3I8XA 4EPRA 1IAQA 3FB4A 5AJYA 4DDTA 2RB4A 3KTAA 1HYQA 3F0TA 4HYYA 4QOSA 2P6RA 1DS6A 2JCSA 4ACAA 1GFIA 1U8AA 2GVZC 3EZFA 1I4DD 4QHTA 3I4LA 5FOTA 5TB5A 4LJ5A 1N5IA 4RD6A 5JFGA 1V43A 1F2UA 2J9RA 1BYIA 1PLKA 4JVMA 4L9SA 1AS3A 3W34A 3EZ7A 2O5VA 4DVGA 1W4RA 5FR2A 1HURA 5BWMA 3WRXC 2HT6A 4L9WA 1W48A 4M4SA 1CJTC 3WXMA 4AKGA 3QY0A 1F48A 2C9YA 1XCGB 4ZIRA 3GFPA 1XZQA 1DAHA 1OJLA 1ZCBA 1NP6A 3WMEA 3KL4A 3QKRB 5GVSA 4V0ME 4DLRA 3CR7A 2DWQA 5EJEA 4PSVA 1O87A 3K70B 4ESVA 1E4YA 3OE7A 3QVVA 5FL3A 4A36A 1ZINA 1FZQA 3OIVA 4DLZA 4R71A 1GKUB 1CP2A 2C77A 2KBEA 2CL6X 1D5CA 1YZGA 3QKUA 4DEXA 3GLFA 1UEIA 4B3DA 4LJ4A 1ZVQA 4G5OA 3RRZA 1AS0A 4BPBA 2P3SA 2OUKA 1ZC3A 1ZIPA 1VPLA 1UKZA 3CX8A 3QXJA 1KYIA 1CJMA 1DOAA 1F6BA 1E94E 2N46A 4RD2A 1GIAA 2PEYA 2VHUA 2FFHA 2YC4C 3KJHA 1GAJA 1NL3A 1U94A 2P0EA 3NC1C 1E9AA 1AGRA 2G77B 2D7DA 1FMJA 2IEYA 1JQJC 3LW8A 2P5TB 4RD1A 2H8KA 1RZ3A 1ZC4A 1ZUNB 4OL0A 1G3QA 5DLQC 2QMHA 3BE4A 2ERXA 4YMTA 4XWKA 4RVCA 1ONBA 1CR0A 4HZIA 2ATXA 4KAXA 1QHSA 2XOKA 5BYKA 4N0DA 5JCPA 2WJHA 3T15A 1QHIA 2H7VA 2IBMA 1N3BA 3PUYA 3B78A 1Q3TA 2H92A 4AIIA 1OXSC 2OHFA 3RWOA 2DR3A 4AI6A 1KZGB 4BGDA 3SN6A 3IQWA 4P3YA 1QHXA 1XNJA 2YOHA 3I1FA 3AF1A 1NBMA 4BFXA 1OW3B 2ZXUA 3DM5A 4MDFA 3UMSA 2ZAMA 2DPXA 1VECA 4DLTA 3K0AB 2IUSA 1XEXB 4EDHA 4EPTA 2ASEA 1T0HB 4Q9LA 3P27A 5FOXA 2H57A 2WKPA 2QA5A 1HE1C 3SHFA 2F1JA 3MWLA 2QAGC 1W0JA 2XITA 1JB1A 2IXEA 2AWOA 3KTAB 1QHHA 4B34A 5AUQA 1KKLA 3BORA 2W00A 4M1YA 3VR5A 5KUTA 2A78A 4GPTA 4GSYA 2GTPA 2G9NA 2WWHA 4G1UC 1W5SA 2ZE5A 2Q3HA 1AQYA 1EG7A 3N2EA 1F2UB 4NYIR 1Q0UA 2QGZA 1P7CA 3EA5A 3HU3A 1DBSA 3M0EA 2G1JA 5C4MA 1WBBA 3BD9A 2NO1A 3A1TA 4WZBE 3AKYA 1DAKA 2FMXA 2LKDA 2X8AA 5B30A 3B85A 3F3YA 4ZIRB 2VP0A 3EPHA 4BLTA 1WP9A 4C7OB 2R65A 1AGPA 3QBVA 3LNCA 1P75A 4LK2A 4F92B 3PCRB 3UATA 1XMJA 4HZUA 2N1BA 3VNVA 2AD1A 1T3HA 2BVNA 3THYA 1E2DA 5KTYA 4ZI2A 1E1RD 2XNDA 3B13B 3GLFB 1YZTA 5FBQB 5TY0A 1Z0IA 3AVYA 4E09A 3G82C 2O8DA 3VX4A 3K9LA 2GF9A 1PVOA 4NCNA 4D6PA 2ZRMA 4Q1DA 4D25A 4HLDA 1YZNA 4F4JA 4DBLC 4LOAA 1D2EA 1UFQA 1Z0JA 3M6AA 1U98A 1Z0KA 4I81A 2EYQA 4JLNA 2ZE8A 3ZZTA 1GNRA 3OEEA 4PANA 1AS2A 2AFHE 3KXKA 2CMKA 4QBGB 3MWJA 2ZETA 3WNDA 1DO2A 3KB1A 4JLOA 1E99A 3GLHA 1C1YA 4JS0A 4W5WA 4W5JA 4U5XA 4W7SA 5DHAA 3N70A 2R6AA 3CH4B 1XXHE 1SQ5A 1BS1A 4XWOA 4KFTA 1G3UA 4XTCS 2Z83A 1NSFA 1KK2A 4BRUA 1I4LD 2N42A 4A9AA 2F9MA 1XTJA 1XPOA 4LBZA 2ZROA 5CITA 3LXXA 3WRYC 3ETLA 1E1QD 3TUJC 2H18A 5KDOA 4DLSA 1EWQA 5EP2A 1TF2A 4PZLA 2QTVB 5JS7A 2FU5C 2V55B 1NIPA 1YQTA 1W47A 2QORA 1IJFA 2WZQA 3BB4A 1YRBA 4LBYA 5DHFA 3UXMA 5EE9A 3P26A 3QOFA 2GESA 3B2EA 3IUYA 4HEJA 5AWFC 4BLPA 4P4TA 3Q9LA 1JJ7A 2VP9A 1VIAA 3NXSA 3KQHA 1U9IC 3UG6A 4TLAA 2CLSA 4BEBA 4EIWA 4TLCA 2GF0A 2O8BA 4XVRA 2VSXA 4C0BA 2IX3A 2QP4A 1U90A 1JXMA 1DAEA 2FV8A 3T12A 2A2ZA 5A0FA 6Q21A 5L3SA 1DARA 1GP2A 3H86A 4TYQA 2WKRA 3A36A 4B74A 4TZ0A 1J2JA 2XGJA 3K0EA 4PO9A 1N0VC 4C2TA 4ITRC 4GI7A 4HAVA 1R8QA 3A4MA 1KDOA 2RGNC 2CNWD 3HP1A 2WAXA 2FPLA 5FUYA 4JKIA 4P31A 1ODFA 1NVVR 4NL4H 2ZRCA 5D3QA 1Z2CA 4NCJA 3OEHD 2QT1A 2CL7X 3SI7A 3WP1B 4I1SA 3Q3JB 1A4RA 5AK0A 4X8LA 5KU1A 1GTVA 2JJ1A 3EC2A 3BFVA 4HZUB 4X8HA 3T5GA 5CIQA 2PZGA 2WVJA 2FA9A 2ZS9A 1D9XA 3TR0A 1W36C 4HUQA 2L0XA 4UQOA 4H1UA 4P4UA 2QZ4A 4P4SB 4F4CA 2RGEA 2OCYC 3FMFA 4I1UA 4Z1MD 1KI9A 3AKEA 2O8DB 4PO8A 3FFBA 5JECA 2CCKA 3PFIA 4EJSB 3ZH9B 5EZ6B 2ECKA 1KI8A 3NEJA 3THWA 2GEDA 4JLAA 4QBIA 3DDCA 3NIBA 5KSOA 3N5CA 1GUAA 2DY1A 1SVKA 2OE2A 4Q9JA 4IVPA 4LWZA 2UZIR 3PIRA 2VP4A 3U7GA 5AJWA 1E79A 1G8PA 4DSNA 4Q48A 3TIFA 2BKEA 1T0JB 1NG1A 1E2EA 2O0JA 2CHGA 4LBVA 3ZIAD 5CDFE 3B9QA 1OYYA 1NSTA 3GLHB 5CB8A 1EFHA 4TZ6A 2CE7A 2J41A 4CVNA 5CJPA 1XMIA 1XWIA 1KZ7B 1VCIA 1MABA 1W4AA 2OESA 1KNXA 1HT2E 4O2RA 1E9SA 2VRWA 4IOLA 2D2FA 3MSXA 3SJBA 3GLIE 3AVXA 2J1LA 4AYWA 3I72A 1KI7A 5JRZA 3EIHA 1TQ6A 4CGZA 3S1AB 1NMZA 3P1JA 1FX0A 2OV2A 3PEWA 2NOAA 4XIGS 4TLDA 3PJRA 5FPKA 4GDFA 3BH6A 1DO0A 4LHXA 3A4LA 2CE2X 1TQ4A 1T3SA 1II0A 4LHVA 4LJAA 2ORVA 4OK6A 2WIAA 3CO5A 4TMKA 4WAUA 1XCMA 2PL3A 1SVWA 3SNHA 3V4RA 2ZM5A 1O3YA 3KFXA 2O8BB 1JAHA 3WY9A 4MGIR 2WOJA 1N6OA 2CJWA 3DHWC 2V54A 3SJAA 3W5IA 4DRZA 5DN6D 3QG5A 621PA 5HZHA 1XD2A 2DFLA 1P9RA 5DSZA 3VR1A 4QM6A 4DLVA 4IOMA 5L3SB 3FDIA 1HA3A 1AJEA 3H2YA 4TN1A 1JJVA 1XTRA 3EASA 1Y63A 1YKSA 3P32A 5HR5A 4DKXA 1KI6A 3ZVLA 3QPVA 2ZI5A 2DFTA 4YONB 1R5OA 1VYUA 1QZXA 4H1VA 4KSCA 121PA 4DB4A 3BGWA 3QXHA 2OLKA 2CVHA 2REXB 1US8B 2VLIA 2QL6A 3DZ8A 4FINA 3TW8B 4EQ6A 3PUWA 1CR4A 3RSOA 2OFWA 3EA0A 4TQAA 3C16C 2QPOA 2QG6A 2PLRA 1NKSA 4G0NA 3EX7C 2OSBA 4TL8A 1E2JA 4HUQB 3MGCA 5LBIA 2WPDD 5HZKA 4QRHA 3HJNA 3U61B 2OZEA 3GFOA 1OXVA 2R2AA 2MSEB 1KMHA 1H8HD 3X1WA 4I1OA 3THWB 1XXHA 1KDPA 4CDGA 2ZRHA 4PPGA 5AJZA 5TMPA 2RGBA 4XD7D 5JZVA 3SQXA 4ACBA 3DMDA 4EFMA 1G6HA 2P6UA 3KUDA 4Q4JA 1CRQA 4YMWA 3IDQA 2FJUA 2OT3B 1X6VA 2OO7A 2NTYC 3ADBA 3R9WA 4NHOA 3SJZA 2FPKA 4D81A 2IW3A 1G18A 1S9HA 4CEJB 1VG1A 4KITB 2GJ9A 2GK6A 2XTNA 2BMJA 4A15A 5A5GA 1EXMA 3W3ZB 2MSDB 2ATVA 3V4FA 2QY9A 1E9RA 2QRNA 5FTJA 4A8JA 4RY2A 1MRNA 2G0TA 4PC3A 4GP7A 2A5YB 1FP7A 1FX0B 2P5SA 2VP5A 3LQQA 3W8NA 3K0FA 3D8BA 4BUJA 3LVRE 3EC1A 3TKLA 4RD0A 4B3FX 4QBFA 1XFAA 4PHFA 3GJ7A 4CW7A 3VU9A 2KJQA 2XJ4A 3T1QA 4PC7A 3RRMA 2PJRA 2QSYA 4NYIQ 4QHYA 1LY1A 2D62A 4BFTA 4AYTA 1Z22A 2QI9C 4XJXA 1RPZA 4MKIA 1AQUA 2WOOA 1S0UA 3BBPA 5E3HA 3B82A 2OCBA 1C4OA 4C0LA 5HCNA 5F98A 2XTZA 4DLWA 4TTPA 5HTKA 3B8HA 3U4QA 1ZRHA 2WWGA 3MD0A 1S9DA 2CJWB 1MO3A 2HLDD 1QG4A 3LRPA 2H16A 4MYTA 1EX6A 1XD2B 4D4MA 1OV4A 4BLOA 3BRWD 1E1RA 5HE8A 1G6OA 4FN5A 4JT2A 3A58B 2O0KA 1Z0FA 4JL8A 4E22A 4ON9A 3GLGB 3H84A 1KI6B 2OAQ1 2EWWA 3CF6R 3AVVA 4IKEA 2CLDX 4GP6A 3I5YA 2I3BA 1G21E 1JBKA 3L8ZA 2WJVA 2R44A 4F91B 3U3OA 4AK9A 3QE0A 2RGCA 4MH0R 2B7BA 4BQSA 1Q21A 5LB2A 4ZDKA 3SBDA 1G291 4EQ6B 2IHBA 1UJ2A 4LC0A 3KKNA 4GMXA 2R6CA 1W0KD 1G1MA 3DMNA 4H9GA 4MGYR 4M9ZA 4RFSA 1KO7A 1EX7A 2RHMA 4GOXA 4IDPA 4E07A 3I61A 4PZYA 3CW2A 2F1RA 4BFUA 2EFCB 4O2LA 1KMHB 4HLUC 4UNSA 1NVXQ 4URZR 1XXHB 2D74A 3J81k 5FI1B 3CRW1 2Q21A 1YE8A 3IO3A 4R9UC 1CR1A 4A6PA 2ZVPX 1Z8FA 1E1QA 3GLIA 1N25A 1SKYE 3RDPA 3MWYW 4M1SA 1EFRD 4Q4JB 4FD2A 2O0HA 1M34E 2ZIAA 4FIDA 4QGAA 2ZI6A 2HYIC 4KVGA 4L4UA 3WYGA 3TBKA 2NO0A 2IYZA 4JBXA 1LFDB 1G19A 4II7A 2NO9A 3TH5A 5KNBA 2ANCA 4UNPA 2FZ4A 2WJYA 3NTUA 2BMDA 1YVDA 4U00A 2WIBA 2WV9A 2WWYA 2J7KA 3FHOA 4Q1EA 4OI0A 1OH6A 2O8EA 4G3XA 3G5UA 3OESA 3LD9A 4Q00A 1S1MA 3VR6A 4ERNA 1ESNA 1WF3A 1Z6YA 3SZRA 4JT4A 2FFQA 4A0GA 5EZ5A 4KFSA 3THXA 5C1BA 3CF2A 3K0FB 3D31A 3ZGXA 3L82B 2ZE6A 1QF9A 2ZRGA 1ZIOA 3VU9B 2IF2A 2A5GA 2CNWA 1NY6A 4V0LA 2AN9A 5HE9A 1T8UA 4TYPA 3HU1A 1LS6A 1Y3AA 1G8YA 1G5RA 2J46A 3OEHA 4C0QC 3ADCA 1IXRC 2ONKA 3LV8A 5P21A 1UBCA 1CR2A 1VDZA 3DZDA 1CS4C 1ZM2A 3FYHA 4TMVA 3U4QB 4HAUA 4D82A 2ZRIA 3VR2A 4D0NA 3ADKA 1NVVQ 3IIJA 5JSZA 4GZMA 3QEOA 4J0QA 2WICA 5JJLA 2EFDB 4IFEA 2YINC 1TADA 5CYPA 4DDVA 1JXOA 2OBMA 4Z1MA 1TPZA 5LD2B 2ZRJA 1II9A 2WHXA 1RYFA 2D7CA 2GBLC 2IC5A 2XZPA 4M9XA 2HT1A 1XJ0A 5CM8B 1K6MA 4JBYA 1U0LA 5EUMA 3ADDA 2EU8A 4CEHA 5J40A 3OFND 4EJSC 2ZJ8A 4OHYA 3ZZUA 2QRZA 4EUNA 2P2LA 1R10A 1NVWQ 2FOLA 2V6IA 4Q7KA 4RFSB 4UXHA 3ZIAA 4HAWA 1COWD 2G88A 1OXUA 2R8RA 2VSOA 4YC7A 2FX3A 2A30A 1NLZA 2C95A 1G8HA 3PUXA 1OFUX 2F6RA 1NRJB 4PO1A 4HUTA 4BFSA 5K8LA 1PJRA 3DPUA 5DO9A 5DI9A 4IFBA 4C30A 1P4SA 3EZ6A 3CPHA 4M1KA 1QHGA 2ORIA 4FXPA 4KYUA 3RRYA 1R0YA 3K9GA 4C3ZA 2QENA 3BJIC 4PPFA 2VHJA 3PUVA 1KO8A 4GMDA 2IYWA 4OJQA 1RKBA 4PAOA 1LS1A 5KPDA 4V0NA 1CJUC 2G0NA 1P2UA 1X1RA 2RAPA 2WJJA 3LAWA 2ODNA 2NIPA 1RRCA 1GITA 3AF4A 2IYQA 2RH5A 3CB4A 2JJ2D 4PTLA 3MG9A 3U2QA 1ZP6A 4ZV4A 2ZUBA 3E5HA 3FE2A 4BWYA 3LVQE 4LYJA 5JI3E 3KDSE 1W5TA 1X8LA 3E70C 5F9FA 1SXJB 3KQLA 4EPXA 4KYIB 4TMXA 1TAGA 4D0LB 3LBNA 1KHTA 1RW4A 3FGNA 4TQUS 4ASUD 3GJ5A 3LBHA 1H65A 4HB4A 3LFUA 4IVRA 1ZU4A 1HTWA 1RRPA 2GVDC 4XOIA 1II8A 2GEUA 3N2IA 4JJZA 4YLGA 4AG5A 1F3OA 3AVOA 1GKIA 3CIOA 4IW3B 4OQLA 4EPWA 4BZQA 1T3LA 2C99A 4MUAA 1SVSA 1UAAA 4EFNA 2PLFA 1T4GA 3QBTA 2GZDA 4URUR 2ZUDA 1XD8A 1HY3A 2WBLC 2BKUA 4I4LA 2BC9A 4MKGA 5DISB 3U3MA 4O25A 4X8OA 2WWFA 1TTTA 2WMNB 2DWPA 2PMDA 4K81B 4LJ7A 3VKGA 3NWJA 5JSZB 4IJMA 3IEVA 4V0KA 1IN5A 2WPDA 1XEFA 2FG5A 4PAMA 3RS7A 1M74A 5GJBA 4E5UA 4Q4LA 4KFRA 1CU1A 1R6BX 1WE2A 3EXAA 3K0CA 3ZZ0A 2HJGA 1Q20A 2ZRLA 3JVUA 1TF5A 3VAAA 1A5TA 1T8TA 1ZNWA 1AKYA 4XD7A 4FCVA 1H8ED 4CEHB 1L2TA 4QNMA 4URYR 1FL9A 3W3AA 4BE7B 3EWSA 3CWQA 4B47A 2AXPA 3I62A 2YWHA 1KY3A 2AX4A 4PQFA 2YWFA 4QJ3A 3WNCA 5FL7D 3WYFA 4FWTA 2YV5A 1M1YE 2LWIA 3T1OA 4PHTA 2OAP1 3DM9B 4UJ3A 1G20E 4PC6A 2FDCA 1NLYA 2CHVA 4EKDA 3MAAC 4IXNA 4R2IA 2JLVA 4M1MA 5TVKA 1E98A 3EZ2A 3ND9A 1NNEA 2QN6A 1N5KA 2KE5A 5CM9C 3EIEA 5EE1A 1RRGA 1DG3A 1PUJA 4ZI3A 2ZRAA 3TUZC 1E0SA 4DCSA 3LX5A 1VIYA 3B1XA 4B75A 3ZYCA 3ASZA 4FW9A 4KV9A 4PPQA 3RANA 2FH5B 1OIXA 5BXQC 5HPYB 4ILEA 1R0XA 2PX0A 2FNAA 521PA 1J99A 2V9PA 1QHNA 4Z51A 1NKTA 2XZLA 1JPNA 5J5CA 4M22A 3ND8A 5G3YA 3VNUA 3BK7A 2FEOA 2HLDA 2FEMA 2RGGA 2WKQA 1E69A 1KO1A 1SZPA 3NH6A 4ARZA 1E9DA 1ZJ6A 3TK1A 3P4XA 3NBZC 4LHZA 1W4CA 4BEJA 1SVIA 1RIFA 1GG2A 4X8MA 1II8B 4K8OA 2TMKA 3IEUA 3QXCA 2AR7A 3RS5A 2OLJA 2K5UA 1HUQA 4YDSA 4Q9KA 3I73A 4URWR 1ZM3A 3M4YA 4RZ2A 4C0JA 3K09C 2WJGA 4AG6A 4NZYA 2WWIA 3EG5A 5TV2A 2BM0A 4YXWA 5FOVA 2FPMA 1CJVC 1SKQA 4RZ3A 1MRSA 3KJIA 1IY2A 3NKVA 2NMVA 1N5JA 5KSYA 1TQDA 1W0KA 3K8YA 3QKTA 4MRVA 2XXAA 3C7KA 4DWJA 3QXXA 1NN1A 1RC8A 4KBFA 3SC3A 3IPXA 5IK2D 4HI0E 4Q1AA 1KAOA 1KK3A 2ZANA 1E2MA 3AF0A 5BYJA 4B44A 1M7GA 3MJHA 5H70A 3U7HB 1X8JA 4LYAA 1KK0A 4Z8XA 3TR5A 4EFLA 5J4YA 5ELXA 1X86B 1TL7C 2V1XA 2O8FA 4A82A 1LF5A 3HR8A 2NGRA 2J3EA 2VHCA 4CEIA 1M7BA 2BOVA 2W2XA 4OKSA 5FBRB 2AKAB 1EFRA 1DVRA 2AK2A 4LPKA 4AWXA 5JCZA 2ZEJA 2E87A 4JVSB 2HCJB 5KPJA 1GRQA 2C9CA 2O52A 3RAPR 3FHTA 3SHWA 4QM7A 2IYUA 3NEYA 1BH2A 5EXTA 2JLWA 1YR6A 4HAYA 3A1VA 3KJGA 1FMLA 4HDOB 2GJKA 2QT0A 5ANRB 1QHHB 1Z06A 2BM1A 2JASA 5BQ5A 4N1AA 4F38A 1LV7A 3U60B 3O47A 2J7PA 3T5DA 5CYOA 4A1FA 3BB3A 4Q03A 2EFEB 1YR7A 4PHGA 2XZOA 2ZRKA 4PSAA 3B5JA 4BLQA 4V0MA 2QSZA 4AC9A 4DSTA 2QTHA 1CF4A 4WW0A 2W6ID 5EQTA 1ZYUA 3H1TA 3QG1A 5JHHB 1KY2A 3AGPA 4HDQB 3RNLA 4EAQA 1KJWA 4FCTA 4OHXA 5AR1A 3FTQA 1GZSA 4GZLA 3TRFA 2XNSA 1G3MA 1AN0A 2HJVA 2ZJBA 4A92A 3L0SA 2QP3A 2RHDA 4TT3D 3AM1A 2AFIE 3VHXA 2JJ8A 3RYTC 1D8TA 1ESMA 1OYWA 3FWYA 3SBEA 1ZCAA 4OHWA 4KO8A 2IXFA 2FSFA 2H1LA 1Q1ZA 3O8DA 3C4JA 4P0TA 3THYB 4DLUA 3AQ4A 1NMXA 3PR1A 4FMCB 3VTKA 4TYNA 1KJZA 5B57C 2ZR7A 1KMQA 3THOA 3TLXA 2F3RA 2GHIA 4D80A 4DIDA 4Q7JB 4DT1A 2ZJ5A 2F55A 3GD7A 3UIEA 3PEVA 1KNQA 3OAAD 1K5GA 3KKOA 4DXAA 3ICQB 1L8QA 2XSZD 2QE7D 5AJVB 5LD2C 3OFNA 2HF9A 3RHFA 4M9QA 2O8CA 2IYTA 2F7SA 5KSZA 2HDNB 4QHSA 4BFZA 2FGKA 2W83A 4MKHA 4R7ZA 1OKKA 3R7WA 4B3BA 3TGPA 2XXAB 3VKHA 5SZJA 4I99A 1COWA 3CUEF 3NVAA 1K5DA 2QGNA 1HQCA 2VHQA 1J7KA 5FPTA 1DAFA 2VP6A 3PVSA 2JLZA 2J87A 3GEIA 3NHAA 4KBGA 5K8TA 4ZKDA 2QAGA 1Z63A 2ZSEA 4CEIB 2Z43A 4V0OA 4LDJA 2QPAA 4MUBA 3B7GA 2JIZD 2NZ8A 1JNYA 5FOUA 2GWHA 221PA 2B7CA 1P61B 2BBSA 2DBYA 4KODA 4LGMA 4ZKEA 4D2IA 4TMWA 3VKWA 4LJ9A 2ZJ2A 1RJ9A 5FUVA 3T34A 2V8OA 2GXUA 2B21A 3ZQJA 1L4YA 1BOFA 3X2SA 1CXZA 2ODEA 3CZQA 3DVLA 3QUSA 2DWOA 4NKRA 4TL9A 1IN8A 1KKMA 2BBTA 2NO7A 1IM2A 4F93B 2IK8A 4OI1A 1D9ZA 1P2VA 2REBA 2UZ3A 3O8BA 4KHZA 4CT4B 4ASUA 1VCMA 2GCPA 2IS1A 1ZUHA 2ANBA 3T35A 3A1SA 4B43A 1P5ZB 1BKDR 2YC2C 3K70C 4IDQA 1SXJC 1VHLA 3BAFA 2ZE7A 4TQ9A 1OF1A 3C14C 3A4NA 2FGJA 1Z6GA 2OEPA 5J4KA 1ZD1A 5AUPB 3QPUA 3UMFA 1N6NA 2GZAA 2QMEA 2LCFA 1VG9B 1S2MA 1ZU5A 3QQ5A 2OBLA 5FTNA 2D2EA 3LWNA 1YHNA 3OE7D 3OIYA 4IRUB 2V4ZA 3X1YA 5EE3A 3FKSD 4WVFA 2E1RA 3CNLA 4DCUA 3LW7A 1E2NA 4LPSA 2EWVA 4LJ8A 1VKJA 1OPXA 2VHTA 1MO4A 2QNRA 3JZMA 2OXCA 3GJ3A 3WP0A 2KI5A 4BFVA 1X8KA 1GNQA 1SULA 2H5EA 2WMOB 3TSOA 4QJ5A 5C46F 2A3RA 1SHKA 2IYVA 4UXIA 3L2OB 4DT1B 3K0SA 3EIQA 1XB2A 4P32A 2ZJOA 1TMKA 1HV8A 2ZRNA 5E7JA 3UANA 5J4HA 2GJ8A 4FCWA 1LF0A 1N6LA 3VHLB 4M9SA 3EPKA 2QEQA 3SR0A 3AB3A 1U0HC 1H8EA 4US2R 1AZSC 2BHRA 1FOEB 3LQRA 4XVQA 2JA1A 4GOKA 2G6BA 3MRSA 1XRJA 4JLJA 1ZUIA 5JBQA 1P62B 2G1KA 3KXLA 1TUIA 1G8FA 1Z0AA 3R7WB 4LI0A 1XF9A 5BN4A 3WNBA 3C8UA 5FL7A 2JATA 1U99A 3QEJA 5BN3A 1R0WA 5HKKD 2ODWA 4JLPA 1OH5A 4RD4A 1MABB 1NVUQ 1QHYA 1U8ZA 4M8NE 721PA 5DH9A 2GKSA 3VR4A 3W6NA 4PHHA 5H68A 4KFUA 2NPIA 5A4JA 2JLYA 3MUFA 1EGAA 1U9IA 4GFDA 4NYMR 4Q1CA 3CRRA 3CR8A 4S2EA 4POAA 1S96A 4Q4AA 3U7FB 2ZJAA 3EPJA 2R6FA 3UK6A 4RFVA 4W5HA 3U3KA 4MA4A 3BFKA 2Z4SA 1OIWA 2GRJA 3H0KA 1VHTA 3UWOA 4QJ4A 4TL6A 2GAOA 1RJ9B 3VQTA 2Q9AA 3RLFA 1E9FA 3QJYA 3AH8A 3U5ZB 4LRWA 4B3CA 1MH1A 1G7CA 2ZYTX 4B76A 3O8RA 4D26A 2J0UA 3QIAA 2IUUA 5LB4A 3TSZA 5FTLA 4L8GA 4ZCMA 4DB2A 1XU4A 1G17A 2RGNA 4BFWA 5GVRA 1RFLA 4HSEA 1XD9A 4DJTA 4AY2A 4JVNA 2J0QA 4XWAA 3AF2A 1Q1QA 3PEUA 2ZI4A 4LHWA 3SOPA 4C0AC 4XVUA 4RZXA 2EFHB 1ZD8A 4D4LA 4RD3A 1LNZA 3U3JA 1VG0B 4NCHA 1GRNA 1S8FA 4TSFD 4NH0A 3R20A 4FMDB 1UBEA 4UNRA 4WXRA 2NQ2C 2Z5FA 5JWRA 1JEDA 1NN3A 4MYCA 1IY0A 1R4AA 4O0MA 1NN0A 4PC2A 2W2TA 2CCGA 4LC1A 5AJXA 2P67A 1W46A 3GLFE 1EK0A 1UKEA 2ZI7A 5JHGB 3OZXA 3TE6A 4A0FA 3PENA 3EWAA 2VO1A 1KDTA 4JYBA 4KSBA 5EXPA 3GPLA 2XNDD 3BC1A 4DZZA 2OBNA 1WBDA 1C9KA 4P33A 4TLEA 5IK2A 1KI2A 3I92A 1CRPA 2X2EA 4QNRA 5CDFA 1YU9A 3CRMA 4U02A 1JR6A 1N6HA 2HCBA 3L0OA 1DG1G 3GJ8A 2JDID 4LJ6A 2IEZA 2ZR0A 3TSWA 4NMMA 4DLYA 2DB3A 4TMZA 5E7MA 1A2KC 3OEED 5E7IA 3MLEA 2GK7A 2PEZA 1VYTA 1FQJA 1KGDA 2BJWA 4OYHA 1EFCA 4LCBA 4C2UA 1AK2A 1G41A 2BCGY 1IXSB 5GADl 1KAGA 5AUOB 2GZHA 1BIFA 2GNOA 5K8UA 2CEAA 2FE4A 3KXIA 5KNDA 5FPSA 3NDBB 1ELOA 3H4MA 3RS4A 4BZPA 1GM5A 1FPMA 2PT7A 4A8JB 1WA5A 1LVGA 4HATA 4Q9IA 1D2MA 2KBFA 4DEYA 3DOEA 2QMUA 4PQRA 4G5GA 5B58C 2IYYA 4GBMA 5FI0B 1L4UA 5TARA 3KZ1E 2PT5A 3QKSA 1E2QA 2W6JD 5E4FA 3QF4A 1GDDA 1E2IA 5G40A 4YMVA 2IYRA 2J5XA 3X1DA 1G3RA 4D0GA 1VTKA 1BMFD 3QVUA 4U7DA 4FMBB 1K8RA 2C2HA 2ZSBA 4Q02A 3AVQA 4EPVA 3QXSA 2J0UB 4IDOA 1NJFA 2IS4A 2GETA 1Z6TA 4LX0A 3R9XA 4CIDA 4BLSA 5JWHA 1GL7A 3T06B 2C04A 4IXMA 3HPQA 4C0HA 5B2ZA 3LXRA 4DHEA 5C18A 2VBCA 4O3MA 1GSIA 1PV4A 2C03A 1W44A 4JSYA 1E2GA 1XJCA 2BDTA 3T61A 2QU8A 4QL3A 3HU2A 1PLJA 1YR8A 4QFMA 4UKDA 3BXZA 4BZXA 3ICEA 3BH0A 3OAAA 2X1VA 1OSNA 3A6PC 2XSZA 4G5RA 2IT1A 2QE7A 3CX7A 5KO2A 4CF7A 1Q57A 4ZDIA 1IJEA 1UDWA 1Z2AA 3W6OA 3B9PA 3DKVA 5DYIA 1XP8A 1SVLA 1G64A 1MOZA 1XEWY 2D3WA 2FZLA 3IBYA 4BRWA 2X19A 4Y0VA 3MJRA 3RC3A 3DOFA 3A37A 1JI0A 2ZS8A 3ASYA 1M6NA 1HQYE 3BH7A 3TQCA 2HXSA
chains in the Genus database with same CATH superfamily
1Z34A 2FF5A 1QQ6A 3EVZA 3L8MA 5JS2A 5FBWB 1M8JA 5ALUA 3HI6A 3OZRA 2JZNA 1FYWA 3C3DA 4AKTA 4A0SA 3AP3A 4EI2A 2I7TA 1U0JA 2VSYA 3V34A 4G0OA 2CBZA 4Q4CA 3DC7A 4C7KA 1IVNA 1E9VA 1OHHD 1YO6A 2HK6A 4O08A 4I9UA 4OBXA 3FGZA 3HEBA 2AG0A 1GUDA 3JPYA 2H31A 1MX3A 3T4UA 1N2EA 3DO6A 1YQDA 1C41A 1VM6A 2B9EA 3I5MA 3EDCA 1WW3A 4FYHA 4JP3A 5KYVA 2V0GA 2D06A 4L8VA 2IS2A 1GNVA 3C7DB 2C58A 5DGXA 5AVQA 4OVKA 4HC4A 2O8EB 4NICA 2H1SA 1Z3IX 3KJFA 2WWWA 3N7TA 2NAFA 4BASA 4XUCA 3NHFA 2Y1KA 5JSUA 2GPWA 3T7SA 4B6FA 2GH1A 3DKPA 4CFYA 1NY5A 5FWNA 1G4AE 2HM7A 1G9SA 3A1UA 1NAHA 2AD5A 3NH9A 3UY4A 5JPDA 3UMMA 2VJYA 4D4KA 4YIHA 1EESA 5DYGA 5SY9A 3BMOB 3QBDA 2YCBA 3O8OB 4EG0A 1FFAA 1I32A 4UXJA 4ER6A 4OHVA 3LX6A 1F2TA 1CJKC 4O4JA 821PA 2CK3D 3L8CA 3OSZA 4OFXA 4OH1A 2YXDA 4LC9A 1YZFA 3Q98A 4GL2A 5AKHA 3SZGA 4D9EA 3WZLA 2HY7A 3F8WA 4C04A 3HBAA 3R8FA 1RJFA 3IH5A 1GPYA 1DCKA 4GGOA 1CS0A 5HDBB 1E0AA 2VQSA 1GQ2A 2DP4E 3R9XB 3KB2A 3J7TA 2XGOA 5LQSA 1XZ8A 3CWCA 4PICA 1ZM9A 2UKDA 3G5MA 3CEHA 5H3HA 3AGQA 3QELB 1EUDB 3E15A 4DG5A 3V9PA 2RBEA 2XX3A 4BNDB 1A2BA 1UDRA 2FK7A 3CRQA 3E0XA 4OBWA 1YZQA 5B1DA 3DAPA 1JWLA 1IJKA 2AC7A 2KWIA 2P7IA 2YJ6A 4FMCF 4Q4HA 5ETJA 2A5FA 2J3MA 3DVSX 5CB0A 4DZRA 4KRGA 2JLUA 1D2NA 1JVSA 1XHLA 2GM5A 1NONA 3S2YA 2J31A 3MRTA 4B6QA 1XMQB 2UVPA 3UW1A 1DX6A 4ME6A 3NU1A 4A10A 1L7NA 3VC3A 3EXIA 1JDZA 1DC7A 2N1MA 3KM0A 1J2EA 4HBGA 1IAVA 2PUBA 2B1JA 1Q0RA 4TWIA 1SOVA 2YN2A 3ENNA 1SMKA 4NMXB 4DA8A 4K6KA 1KZ9A 4CMIB 3AKCA 3ZJ4A 1OIVA 4NQRA 1M5UA 2OOSA 1PS8A 3KE8A 1YZLA 3NAMA 4G63A 4GLJA 5E38A 2UYCA 1OH7A 4LDAA 3I1IA 2B69A 4BDSA 2BBOA 2EGUA 1CUWA 1HG1A 1ZAYA 3W1EA 3UO8B 3NM5A 4FKZA 3DMTA 3OJLA 1NF2A 1C8BA 1JKFA 1R0ZA 4D3YA 2X15A 3HVHA 1QVRA 3O90A 4FJ2A 4RA6B 4CL0A 3UHOA 1U28A 1K88A 5C7IO 2V45A 4AYXA 1DQRA 2KSQA 2ID8A 3F8SA 4KH0A 2VT6A 4HQRA 1QANA 2ZFUA 4EGAA 2NO5A 3ANTA 4F4FA 5C52B 3FMOB 3Q0EA 1Q1EA 2JLSA 2YY5A 1X70A 3T3EA 1D1QA 3K31A 3AYZB 1ADCA 1J20A 4L75A 5FUXA 5HX7A 1OYOA 1E7MA 3L93A 1QOZA 1TQ2A 2WJIA 5GQSA 2KB0A 2GAAA 4D5GA 1BWSA 3C70A 5HDQA 2R60A 4YROA 3RJ9A 1BRMA 2R11A 1YS2X 2QTAA 1KMMA 2RKOA 4IOJA 4BKQA 4DJJA 1ZK2A 1KO4A 2BEVB 1AUPA 4MKFA 3QFCA 3X1ZA 4EJ6A 1YFZA 4IJKA 4N03A 4ZDWA 1MA0A 4DPKA 1E4VA 3FSGD 2ISCA 3A2LA 3KTOA 4GR4A 2CLCX 2ODBA 4YV2A 4BO9A 4RPJA 3ABQB 2NW6A 4MK4A 2W37A 1WEHA 2YDYA 1KSFX 3EY9A 5CFNA 3NHLA 2VEDA 1EBUA 4QG7A 1PJ8A 3PNKA 1YE3A 1OE0A 4K6FA 2QMOA 3R09A 2ZZKA 2B8WA 4QU0A 3I4FA 1EM6A 5JJIA 2JRCA 2FN4A 4TSFA 4NABA 1ECPA 3T1VA 5HJ7A 2QT9A 3QUQA 4DMFA 3RV3A 4AY3A 1J9ZA 1QDLB 3KSZO 3VKVA 1T2UA 4G1FA 4IUDS 1T3ZA 5CCBA 2PX3A 1K7CA 4R9NA 1J90A 1OTYA 1W36D 2GEKA 4OK3A 3CLRD 2V1UA 4TGLA 3LDAA 4B4DA 4PGGA 5JRJA 4BIIA 3QA3E 5KYKA 1P0FA 4JYMA 2D1RA 2Q4DA 5BUQA 3ICOA 3GLGE 4KQ9A 1EDBA 2PZLA 1JBQA 3CNOA 1NUPA 4MV1A 3G2QA 3Q7IA 5ITSA 2P0YA 5KNCA 3RVQA 4MR8A 4NENA 2ZCVA 2XUZA 2X8JA 1XZMA 3G2LA 4OP1A 1SXHA 2IXBA 5I7RA 5H1YA 1CEEA 3H16A 2BZ1A 3HSYA 4P7KA 2D6FA 1PE0A 4PCVA 4NATA 4QPDA 1I94B 1J2TA 3B60A 3OPNA 3AVUA 1WXWA 5DP2A 3IUPA 4GPIB 2VKQA 3MIZA 5CU7A 3ZHXA 2DZDA 5J3JA 1F5NA 2C5EA 2PGLA 1XZCA 4Q3AA 3ZCQA 1B0PA 1N3YA 3PNBA 4M1TA 2BCEA 2OCPA 3UMJA 5ES4B 1PL0A 5IXJA 1DZIA 1ZIDA 2P2CA 4PPNA 1SKYB 4R98A 1CIPA 1XXLA 4HNRA 4Y98A 4CT5A 1XE3A 4XCXA 4BATA 5A2GA 2DBVO 3ICVA 5KHLB 1FXWA 5JU6A 3TFWA 2ZTSA 4JL6A 4HGNA 2KLHA 3KHSA 4JR0A 1OAAA 3OPYI 4LZJA 4WKPA 3WAKA 3OT5A 1SHZA 3TAUA 3ZTYA 3RBZA 3AF6A 3QVSA 4B1FA 1MAHA 2C9ZA 2EF1A 3QYJA 3VO8A 1OR8A 4CUJA 2XGGA 3IKMB 3BRSA 1ZLXA 2H59A 1U6KA 1YRAA 4Z7NB 2HIAA 3VPXA 2ZSUA 3G1UA 4F7DA 4YJFA 2XHEA 2ZSFA 3LUHA 4CR6A 4G26A 5JZBA 1ISMA 4CLOB 3SJCA 4JLMA 1GJRA 1VIVA 2OHXA 3QPWA 4XA8A 1L5MA 5GP1A 2VRCD 5EXSA 1P74A 3K9FC 3IKJA 2RGDA 1EM8B 3E4DA 5CK4A 3WL5A 5I9IA 3MQFA 3PT5A 1YR9A 3C5VA 3F3KA 4IGAA 1U3TA 1E64A 5ALKA 5FI5A 1QU3A 2H2GA 1IHUA 5ALHA 2Q5FA 5JT1A 4HYQA 1O5IA 3SE0A 1L8XA 2E6KA 2IYLD 3B1WA 3NWPA 2LD4A 1LPBB 2H2FA 5ALOA 5K05A 3TF5A 4MS1A 3RFXA 2W43A 2AOTA 4OFWA 1SXJD 1X1DA 1N75A 2XCSB 2VDUE 4WCFB 3S40A 2A8YA 5EHIA 5AFSA 1LA2A 5U4QA 3H5OA 2OYRA 4C4OA 1PSWA 2NXEA 3IT2A 1EZ4A 3MB8A 1UKYA 2D4HA 4FFDA 2Q62A 1F3LA 3GJRA 2YZ2A 3OT1B 5C35A 3JAMA 3W9YA 3BD6A 4WWHA 4XASA 4ARZB 2H4HA 3GRKA 1BJTA 4HGRA 1WPRA 2C5SA 2GHQA 3JW8A 4QDKA 4YAOA 4Z49A 1Z28A 3BB1A 1RZUA 2WM9B 2POQX 5J4LA 4MYHA 5M29A 3NT5A 4OXKA 3RC7A 3TDMA 2CV0A 2NADA 1PEKE 1UEJA 2GERA 1WEKA 3H6GA 2HFJA 4LYYA 3E27A 1N5RA 3OF2A 1E1DA 4QTXA 4RK5A 4MLZA 5GY7A 5JQGF 1NG9A 4RVDA 4Q3CA 5CXUA 1RYZA 1FUKA 1USGA 1Z88A 4MVJE 3RT9A 3BWDD 2YNMD 4IL5A 1TEXA 2AWNA 4KEAA 1DAIA 3L0PA 3P4YA 4TXMA 1XZPA 5KYGA 4LF7B 1GPWB 3G0CA 1XTQA 3Q41A 4R51A 4EF6A 2CFOA 5FF9A 2VK8A 3AL3A 4UBIA 4MDEA 3S0JA 2I03A 5TGZA 4GPAA 5FUWA 4B6EA 4O29A 2ZU6A 1OLUB 3Q5DA 4AY5A 1IOLA 1Z6AA 3FFAA 1JDUA 5K4GA 4PLWA 3A4IA 3Q8XB 1ONOA 1O94D 1XMVA 2JLQA 4JUAA 4G07A 5BMVB 4B71A 5I4CA 3F6RA 3GJYA 4YASA 3SJ7A 3DWFA 1RZRD 4BNTA 2FEXA 2DVMA 1UPFA 2C2GA 3NBYC 3RABA 3RE1A 1PZGA 3RV4A 2O8FB 3B3GA 2JAQA 1P77A 3LBIA 1P4HA 1W4LA 2P9ZA 1K68A 1KTVA 1UP7A 1ZLYA 3GPCA 3Q5EA 4I55F 2V0CA 1GFSA 4JQYA 4Q0MA 4EW2A 2JLRA 4DCMA 2AI2A 2DPYA 4GT1A 3IRVA 4RZSA 1YK0A 4W8HA 4DQLA 3AUSA 1JJIA 2CB0A 4P58A 1YCFA 2UAGA 3C97A 3LZ6A 4YRCA 4XVCA 3D3KA 3IL2A 2PRJA 5JDIC 1DQSA 1LW7A 1D6MA 1CEQA 4XIYA 2OCAA 4ZYLA 4MP8A 2CFCA 2Q6TA 5TVGA 2C7GA 2A7QA 2O3SA 2BFEA 2WT8A 2JIRA 3AESA 1CVRA 1TZ2A 4MW5A 3WHIA 1LZLA 1KEKA 2AKEA 2Q99A 3EULA 4CKEB 3VMMA 3MPUA 4ZCSA 2FZKA 2OCGA 2XHZA 4KQCA 4RPHA 5CW1A 2PAFA 3FDZB 4DNFA 5L3QB 2IP1A 3P0HA 3TINA 4YPVA 4D7AA 5SZKB 1CLEA 1X1BA 5E3IA 2WSMA 2C3UA 2H5IA 5G4LA 1ZD9A 1CUYA 1VG8A 1DBPA 3ELWA 3SS8A 3LT2A 1DX9A 3IUJA 1RLJA 1PVDA 2DUJA 3Q8MA 1ZW1A 1POWA 2I4OA 3FGPA 5EEHA 1YGPA 2B4TO 3COZA 4KIUA 4XPIB 5TS3A 5T8KC 3I37X 2WLSA 2Y6VA 3DONA 1MV8A 2W7TA 1QYCA 5LQCA 4LWPA 1QSGA 4K2AA 4YQFA 2Q6LA 3ZD6A 3OQBA 4MPPA 3RU7A 1DXYA 4BP8A 3HO1A 1JGTA 2WAAA 3EGXA 3NJ4A 3KR0A 1JSZA 1P2TA 5KYYA 1J7JA 4JB8A 3WLMA 4C89A 5LPNA 1XGKA 3KHTA 1KVQA 3KKQA 4WMLA 2ISQA 1Z0SA 2YJNA 2D0DA 1S2OA 4LGYA 1KH2A 5GM1A 5CYGA 5KVVA 4AP6A 1X3SA 3CLTC 2C8KA 4ALNA 3DL4A 4WZAE 4AS2A 3PKZA 3MRXA 3A2MA 4OREX 4Y2VA 2YXLA 5KYXB 3KRTA 4DR2B 4E4TA 4N9QA 3WI7A 5J2UA 4AJIA 1A8HA 1QRDA 1Y6ZA 3MWKA 4NV0A 3GLGA 1CVLA 1GA4A 1HC7A 1RZVA 1WW8A 3HV2A 2XUFA 2VYCA 2DHRA 2AIRA 3W90A 3K1AB 4EKYA 4DUPA 5AXCA 2G25A 3M6VA 2FRDA 2SHKA 1XRPA 3W5SA 2OILA 4A8HA 3PEYA 2OUIA 2J85A 3QX7A 4HB2A 4W9NA 4XH9B 4Y1RA 1YC2A 5FPQA 1NULA 1GLGA 1G8GA 4ZK2A 4QUAA 5CHEA 4XDYA 1W2GA 2YR0A 2YFYA 4R01A 4BECA 3PZBA 2VRNA 2BFPA 2Z58A 1PK9A 4PAWA 4RUKA 4M7RA 4OHUA 3E2PA 4LNUA 3HR7A 4OI4A 3TOCA 2PPLA 2A57A 3RSLA 3T54A 2AF3C 3LNTA 3ONWA 5REQB 4BE9A 1LBHA 4UATA 2C82A 4RHEA 4DGSA 5GV8A 5JMTA 3LBYA 4CMHA 2CXQA 3MEQA 4ND8B 1YS1X 2HO5A 1L3CA 1U7WA 1EDOA 2OPBA 3R5KA 3FM9A 3W5UA 4U7GA 3ZWVA 1TMYA 5L7TA 2Z56A 3BTSA 3RADC 4NFHA 2JGRA 4L02A 4KWIA 2DQYA 4RQAA 4E6PA 5ADHA 3GP8A 5HF8A 2DERA 1U7TA 1YUBA 4QYIA 1P9WA 1R88A 4D4GA 5JD6A 4LRYA 5DI3B 1D03A 2B6HA 2CLEB 1T26A 1VQ1A 2J9ZB 3AJDA 4HAZA 4NULA 4Y9TA 3HCRA 2SKEA 3NC0C 4ZJUA 4RCZA 5AKZA 3PXGA 2AKYA 2FX2A 2JCYA 3HDTA 2APJA 1QVAA 3KUXA 3UCXA 2HCFA 3HKDB 5HFNA 4LV5B 5CVCA 5LZ7A 1QYRA 2FW6A 4PLZA 1J39A 4US1R 4KVAA 4BQQA 5BW8A 1W7AA 2I65A 2QVBA 3G23A 1E2KA 2I1VB 2X0DA 1VC2A 2V3CC 2Q0HA 1XBTA 2AFIA 2HYDA 1JTFA 5BRNA 2YHSA 3MCVA 5JARA 2VNAA 3FY4A 1IY9A 2VJLA 1KI4A 1ZSVA 3E2IA 4FZRA 5J63A 1KYQA 5DNAA 2ZS7A 3GGDA 4GD3Q 4G0QA 1S3SA 3KX2A 1WD5A 3CN9A 4UUAA 1UFKA 2OR3A 4QC2A 1U8FO 3LUKA 2JF0A 4L16A 1N1DA 5ESWA 3PBKA 5P8WA 4E4YA 2B35A 3IS3A 3PQCA 3QU5A 4UEJA 3L1HA 4D9KA 3D5QA 4YBRA 3DJYA 4LV8B 3ANNA 1KA9H 3IXMA 1KU6A 1I2DA 2IXTA 4ND7A 4RELA 1CCWA 4CUKA 4DG8A 1IBRA 2WSSA 1HDZA 5A7HA 4CF6A 1CE8A 1XTPA 3FUVA 1RWBA 2OMKA 3ILHA 4C6RA 1CJCA 2C9MA 1EFTA 3KE9A 4MVJA 1KETA 1OCEA 3U44A 3ZHUA 1RWQA 1BYUA 2YHAA 3GGGA 3PQ4A 1OH8A 1NI4B 1TUEA 3AV0B 1MJGA 1CUJA 4ZCLA 3W2IA 4GBGA 1P6XA 4ZTBA 1TM7E 2QUHA 4B48A 4F96A 1L4BA 5CLJA 4LF6B 1Y3BE 3RVMA 4YUAA 2VH1A 3H97A 3UMRA 1H6DA 2GLXA 4U7HA 1OAKA 5L3RA 3QWAA 2ZJ4A 2FPUA 3OM0A 4CIYA 4IOKA 3BICA 4JP5A 4NBNA 2HEIA 1XLWA 1UPCA 4GRDA 4IUBS 2ZUUA 4N5HX 5LOVA 4IO0A 3HK2A 2R8ZA 1H05A 1M2FA 1YACA 3L43A 2VP2A 4GL4A 4MR7B 1YWGO 4I46A 4MQ4A 2FFBA 4PR0A 4C88A 1AG9A 3BMCA 3K0CC 1DBIA 3WBJA 1Y5MA 3C6QA 4Z5XA 1JJFA 1UWKA 2X3YA 4GXTA 2HWXA 4CZ2A 3CEPB 5J2TA 3TZBA 4C5CA 1NE7A 1NP7A 1IZ9A 2J6HA 4G24A 1Q0HA 4I08A 1O4WA 3BHIA 3DUWA 3FW1A 3KUUA 4JXJA 4FB4A 4GSKA 1XEWX 2FSHA 3CINA 4X5OA 3DAHA 4N65A 5AW5A 1QG2A 1TTQB 4TLBA 3LL7A 4FFVA 2K4MA 3IAAA 2AZXA 3Q72A 2F8MA 2WMDA 4EI9A 1NBME 4G01B 1QZTA 2MYUA 4NH4A 5T3UA 1NIJA 5FTKA 3R6TA 4L15A 5DEIA 4YQEA 3IAS1 4QGGA 1G6Q1 1MEJA 1Y8QA 3DMTC 1GL6A 5DBHX 5CX1A 4UOEA 4F12A 1DKNA 1QOQB 3CUYA 3QGMA 2X40A 3RSSA 1U28C 1BMTA 2QQ5A 3OQ6A 1B8PA 3ILYA 2GZSA 1ZI8A 5YASA 4JJEA 4KUGA 5DNCA 2Y1EA 4OLBA 3RK1A 5JEDA 1QIKA 1ODTC 3R8CA 1TJ4A 1H93A 5HG0A 4UJ5A 4DV0B 4CDMA 1O6CA 1F0KA 3FWKA 3AOEA 4WBSA 2JEOA 4JD5A 1LK0A 1TZBA 2V7UA 4PNEA 4AMGA 3PGLA 1KZ1A 1Q22A 3IULA 4H7IA 4ED9A 1JG7A 2ONJA 4ZYUA 2Z5VA 4YR9A 1Y6FA 1VCNA 3K9BA 3QENA 5GOTA 3FHJA 1GTG1 1Z5ZA 3O2QB 3DL0A 4ZEXA 3FVWA 4B85A 4G8JA 4JJAA 5I51A 2IYSA 1M1NA 1R7RA 2FMFA 2CW5A 2OFOA 1QR6A 3V4ZA 4DSUA 2RGRA 1KMIY 4Y6SA 2ZYWX 3ZE6A 1G8JA 4JQZA 1KC1A 3MBOA 1NJ1A 2AZMA 3H4TA 5DXAA 3INTA 4Z86A 4ES6A 1ZW6A 4OL9A 4BGIA 2BMWA 5IC4A 1GZ3A 4HOYA 1LDEA 2E5WA 4YMUA 1DAMA 1GAQA 2HU8A 2XWQA 3PHLA 3P2EA 2FP4A 5CP8A 4UW9A 4NEHB 3QLEA 4A2WA 4URFA 7MDHA 4RKEA 3BILA 4JC8A 4X61A 3DEFA 4ZWNA 4DY6A 1LPSA 2JJ1D 3OFVA 2CZQA 5DTIA 1TVEA 5FR1A 1Z56C 2VTKA 4OJKA 1XPRA 3FJOA 1DELA 3PGA1 5BYBA 1NMSA 3FHCB 1I14A 4WNAB 5K0CA 4LV6A 1XJ5A 4BNLA 4H7HA 3Q3EA 4Q21A 4QZVA 4AKIA 1HDOA 5H83A 2GO1A 2QRPA 5EFZA 4CM6A 4NU0A 4LSGA 4WY8A 2I6SA 3R76A 1R4MA 3SU8A 3DOIA 3D3QA 3GRPA 1TUBA 3CVJA 4ODIA 4B35A 2AMFA 3LA8A 1OROA 3TEMA 3ENKA 4UNQA 5JLAA 1A1VA 3OQ1A 1OFHA 1O9HA 1FE8A 1FNDA 3O84A 5JI2E 5KTTA 2W4QA 2WYIA 1E79D 3KS9A 3REQA 3VR0A 3GCZA 4UDXX 4CLDA 4XFDA 2ZPTX 4MRPA 2Z3VA 1OKKD 4AD8A 3D4NA 3KQKA 1DLJA 2X77A 3V5NA 1N8TA 3O94A 1XMXA 3QW2A 4F04A 1IAQA 3PXAA 2ZBQA 3F0TA 4HYYA 3DTVA 2UXDB 1NJSA 2WHPA 3QNWA 3O21A 1C4XA 1V9CA 3MCWA 4E2YA 5A5FA 4E30A 3EZFA 3BXGA 3H5RA 4QHTA 5CT6A 4HMOA 4J29A 3EMVA 3I4LA 3HLTA 4U63A 3BL8A 5FOTA 1IEVA 4QVGA 3W05A 4F0JA 3IPRA 2PU7A 3ZU4A 3BIJA 3OZDA 5JFGA 1TGVA 1CDZA 1V43A 1F2UA 1GN8A 3QLVA 2J9RA 3PRHA 3GROA 2P90A 5ALVA 5EZYA 3A05A 1G0NA 3GYBA 1U3UA 4EHJA 3BWCA 4DVGA 3GGSA 1E60A 5ITVA 3VNRA 1WSBA 3KD2A 3PDJA 3VXKA 1CJTC 3N28A 3WXMA 5IYZA 5EKDA 3UK2A 4YRGA 2VF5X 4H0NA 1SEVA 1PGQA 2JH8A 4INOA 4ZIRA 3N76A 3TXYA 3RUFA 4ENRA 3AEKB 4K86A 1OJLA 1IHYA 5JNUA 3PRKE 2VT3A 3MS2A 4XW2A 4EGSA 2R85A 1J0BA 3CKMA 3E9MA 3CR7A 2Z2XA 1K6XA 2DECA 4R3NA 2JFQA 3TTWA 1O87A 4C01A 5EJEA 3K70B 3VPDA 2GAFA 3SVZA 1C3VA 2AS0A 4B5KA 1IXYA 1ZINA 1FZQA 3H2KA 3GJZA 3O4JA 4DCPA 3DZBA 1X7HA 3NGLA 4LDRA 1YZGA 3DAGA 3D2BA 3SIPA 1YAJA 3GLFA 1K92A 1UEIA 4B3DA 4KNYA 5MN5A 1ZVQA 2IDKA 3CZCA 4G0YA 4G5OA 4INPA 2QL7A 1AS0A 4KIWA 2P3SA 3CX4A 2I7CA 3WGVA 4YYZA 1ZC3A 5LSAA 1AB5A 5IKXA 4KNWA 3C48A 5AVRA 1AUXA 5EHXA 5HK9A 1KYIA 1P0PA 4MW2A 3T1HB 9MHTA 2G7MC 3OBBA 4R2LA 3S29A 1RR6A 1KEEB 3TX2A 1HFKA 1PJSA 4FXOA 3SE7A 1U94A 2BW0A 1AGRA 4CLRB 2G77B 3PHGA 3I28A 3WQSB 4EKGA 3G1TA 3GY0A 1JQJC 1Q0PA 3BREA 4EGQA 3PTLA 1H2YA 5BSWA 1NXVA 1RZ3A 1ZUNB 2DQZA 2Y2VA 3OD1A 4UM9D 3A7EA 2BTQB 4RVCA 2C29D 4INJA 4XVHA 1H6CA 1H1TA 2I2BA 2SKCA 1RKUA 2HADA 4GM1A 3MYYA 5BYKA 4E5VA 5A02A 2FW8A 4X1IB 3RCBA 5JCPA 4G1EB 3T15A 3VDRA 3EEOA 2ONCA 2XBLA 4YRZA 2IBMA 5HKAA 2XYGA 2ZWVA 4CR8A 1XNRB 5JASA 4AJOA 1P3DA 2B1IA 5AHOA 1DTWB 2FR8C 3OUTA 1T5TA 1H23A 5BVHA 2OCDA 2JK0A 4BGDA 1ONPA 3RTAA 3G17A 5K0JA 1QHXA 1XNJA 2IOFK 4NEQA 3AF1A 1NBMA 5BN5B 4F8YA 2I22A 2ZXUA 1RI2A 2O3UA 4QFCA 3MELA 3ZJUA 1VECA 4EPTA 3AR8A 4DDMA 4RHTA 1P1HA 1C0EA 2IQ5A 2ASEA 2IUEA 4NNOA 1PX2A 4Q9LA 3UWDA 3DDHA 5BOSB 3P9QA 3FWNA 3SHFA 1D4FA 3NAQA 4MW1A 1YK1A 4KFCA 3QHPA 3KTAB 1JJAA 1FXWF 1L7EA 2GTHA 1TZJA 2RI0A 1BHQ1 3SSAA 1H1LA 4C29A 4BX8A 5LZ4A 3BORA 3VR5A 4M1YA 3TG2A 2A78A 4Y18A 5DTQA 2H2IA 1C9YA 2Q29A 3TSYA 2G9NA 2GTPA 4L73A 1XJWA 1ZJ5A 2V5AA 3D7SA 2JGFA 3KHUA 1JRLA 1KEWA 2AR9A 4MMXB 5BSVA 2Q3HA 2ZDQA 1AQYA 2QTRA 4KI7A 4HP8A 2XGSA 4MW9A 1NW5A 5CDTA 1HE4A 3NHMA 5K01A 4LQ4A 1MXHA 4V0RA 3EA5A 2BFNA 1L7MA 3M0EA 3JVEA 1QYXA 3AK4A 1Q2XA 3T5CA 3T3DA 1A98A 4R1NA 3HTXA 1WBBA 2VJBA 5CG2A 3HBNA 4K40A 4Y2SA 2NO1A 5C8ZA 3F7OA 1FLNA 3KOYA 4N12A 3KTFA 3NYIA 3PWSA 3AKYA 1DAKA 4MWZA 1BE6A 2FRVA 4WKOA 1G2PA 1SG6A 4H08A 4BGVA 3UC5A 4KBYA 3UB3A 4ECEA 3OPXA 2J3QA 3BWVA 3GOQA 4UAJA 3EPHA 4CV1A 3BVPA 4DV1B 1AGPA 2E55A 1I1OA 4XUDA 1P75A 2MYTA 4LK2A 4HDAA 2ZJ3A 4REQA 3PR3A 4HZUA 5K0TA 5I3ZA 3KG2A 2AD1A 3SLGA 2FQ1A 2CYCA 1I7DA 3CE6A 5TGTA 3O8QB 3BYZA 1E1RD 4M1QA 2XNDA 4DA9A 2G70A 1HTTA 1L7OA 5FBQB 1Z0IA 4URHA 4X24A 1JE0A 3HVKA 5TY0A 3DPIA 1R9MA 2DH5A 2FWPA 2O07A 4Y0NA 3SNKA 5JYDA 2GASA 1D3AA 1IHOA 2PS0A 3K9LA 4KWCA 4HYTA 5AOCA 1CZHA 3C2QA 5EJMA 1Y9DA 3NV7A 2W70A 3TO5A 5EKSA 1F51E 1MORA 1BFDA 4MV7A 4OQDA 5J5AA 1YZNA 3COYA 5KC8A 3EHDA 4F4JA 4LOHA 3AU9A 1IE3A 2WLTA 4LOAA 1E8DA 2EWMA 2JBAA 3EXIB 4IWNA 5EAIA 3L92A 1U98A 4JLNA 4D6YA 2ZE8A 1XQVA 1JZSA 4PZPA 2PNJA 3B12A 3OEEA 2WD7A 4KPUA 2FPWA 2MSWA 2CMKA 2ZETA 2RG7A 2GB4A 3H1PA 2PE5A 1E99A 4Q15A 3QTTA 4JS0A 3E7PA 4U2GA 4W5WA 2VJAA 2VYNA 1VSUA 2W2MA 5IMSA 3C3KA 5FEUA 1BS1A 1VGRA 4W9NC 4ZZ2A 3TZ6A 1WXFA 1Y6QA 4XWOA 1G3UA 4XTCS 2WYOA 1VE6A 3F1KA 1WSWA 3CPSA 1J9GA 1YS6A 2PHZA 1GV1A 4HVLA 1IATA 4U9HS 5KJ1A 2PUVA 4A9AA 1CY8A 3LY8A 1XTJA 4YNBA 4LBZA 4UMVA 4Y67A 1LTKA 2ZXEA 5E4YA 3OZVA 4UVIA 1T43A 4JP2A 4BO0A 4D3ZA 3TUJC 2AYXA 3JQAA 1YBFA 2G9QA 4AS3A 2X6TA 5JXIA 3TLAA 3HJHA 1YQTA 1KU0A 2FPPA 3EFOA 4LBYA 3TLGA 4IQGA 5CBPA 2R1VA 4Z3KA 2YYAA 3IUYA 1QPGA 4HEJA 5I7OA 1NRXA 3B52X 1RHJA 1JJ7A 1FRZA 1XRQA 2V5UA 1WETA 3W2GA 2XCUA 1NXQA 5JG7A 4I5IA 2FP3A 1DBQA 4PG4A 4BEBA 2OBBA 1J2RA 2ZSIA 3DEHA 2O8BA 4C0BA 2GPAA 4CLEA 2IX3A 2QP4A 5AICA 2QSUA 4RQUA 4BMOB 4EZEA 2PKCA 1DAEA 1GU1A 5AKEA 1P17A 3NQ41 4KN5A 2C4KA 1P7YA 4DC1A 3GVXA 3M4ZA 3W7BA 5JNTA 1A3CA 4AJ2A 1V35A 2A0WA 4WHMA 4W5TA 3A36A 2XGJA 5KWJA 2RBKA 4C2TA 1Z5GA 4M9RA 3QKWA 4OHPA 2F4VB 4UHBA 3A4MA 2FZEA 1NJ8A 1AK9A 1MW8X 5FUYA 2NZVG 3FYUB 2ZBDA 3H11B 3EXHA 5B3LA 3CLTD 4AW9A 1Z2CA 5LXTA 1TGYA 3DP9A 2XE8A 5ILQA 5IEJA 4PR3A 1U0OC 4Q9AA 2CL7X 2QYHA 4BFCA 3CIFA 1E5XA 5IJ0A 5AK0A 2X0JA 4ETIA 4RHFA 5G4KA 3OZ7A 2QK4A 3S8YA 2FW9A 4CIBA 3BFVA 3GRRA 9LDBA 3VR2D 2J4FA 4PF1A 5DBEX 2CNDA 4HLNA 4PIMA 3RYCA 3W06A 2ZS9A 5KBYA 2FPGB 5B4UA 1EIZA 3NWOA 2OCYC 1KI9A 3AKEA 5T57A 1XNQB 3VO2A 3YASA 4IV5A 3ZW8A 3WLSA 1WCIB 3D54D 3HB1A 4WFIA 5JECA 4Q3NA 4GECA 5HGJA 3C6KA 3THWA 1ZY2A 2GEDA 4EG6A 1NSYA 2QR3A 4D99A 3N5CA 4QE3A 5KSOA 2OE2A 1SVKA 1GDTA 4IVPA 2UZIR 1TT7A 5EKUA 4IYJA 2IVZA 5BORA 1JLLA 2GQ0A 2H51A 5IDQA 4TZTA 1BDMA 2Y1OA 1BXRB 4YFYA 2CDAA 5DU2A 3WG9A 4DSNA 1YB4A 3EVTA 1DV2A 1T5DX 1YBAA 3FF1A 1QP8A 1PW5A 5EVCA 4LZNA 1EEXB 1DC4A 5G1PA 4DCJA 3NRCA 2CHGA 4LBVA 1PX0A 3ZIAD 3B9QA 3UPDA 1JQDA 1QAQA 2Q27A 5AVUA 3AFHA 3DWIA 3MTEA 3P9SA 4CVNA 3BQNB 1AKVA 1JMVA 1XMIA 4ND2A 5H80A 4CTKA 5F2KA 2CV1A 1KZ7B 1VCIA 4RHXA 5A06A 1KNXA 2VHYA 3BT7A 4PS1A 2JCVA 2ONZA 3UA4A 4R0NA 1C4KA 1YAHA 2J1LA 2VLBA 3KVYA 1O54A 1ORWA 1WDLA 2JB9A 2AH5A 2EQ5A 3D0QA 4NBUA 3NHPA 2ZT7A 5F3DA 2AI1A 4F3KA 2W93A 1SK9A 2WSLA 4NXNB 4CGZA 2QJWA 2XT6A 3DHNA 1NUHA 1NMZA 5ESDA 4YJFB 1MJGM 2JAOA 2O50A 1BVYF 3G2IA 2EBHX 1JDNA 4PYMA 2BGIA 1XAJA 2AUNA 1A2QA 2C3YA 4XIGS 4OGWA 3SPXA 2VOJA 4TLDA 5DOVA 4YFVA 3GLSA 4PNZA 5AVKA 2GR9A 3FYDA 1A9TA 2JLAA 4MUIA 1ULAA 1U11A 2PKRA 2X7HA 5DLDA 4QUHA 5B1EA 3M70A 1FFBA 2SKDA 4NPAA 1DRUA 1S8NA 3P9NA 2ILVA 4FZ5A 1WZNA 2WIAA 3R40A 4TWJA 4U2KA 3E8XA 4Y6QA 3SNHA 4MUFA 3L4JA 3IAM6 1O3YA 1C3LA 1OWPA 1QGOA 2SCUA 1RSZA 3DF9A 4MGIR 1V8FA 4GQAA 2CN1A 3KWJA 2WOJA 2J3DA 2CJWA 3DHWC 3E03A 3AOEC 4IMJB 3W5IA 1RYDA 621PA 4RTLA 3PC4A 1XD2A 3FN4A 4P86A 5COQA 5HZHA 3H0CA 5DSZA 2GD2A 4NBWA 1P45A 1JLHA 5DCYA 3WL7A 3E3MA 4IHJB 4B4VA 1P2GA 4LYDA 4DLVA 1ZR2A 1AJEA 2C2ZA 2ZZMA 5ALSA 1E7WA 1UINA 3IJRA 4AJEA 3EASA 1ZXBA 1CERA 3P32A 5HR5A 4HQNA 5F76A 4AS1A 1WTCA 4EHAA 5AHKA 4NMHA 4DMUB 2Y0CA 5A0VA 2ZI5A 5TQ0A 3MTAA 4LF8B 3EZYA 2ADFA 5CNKA 4MWOA 4KSCA 121PA 2GAJA 2D4AA 4KGVA 2LW7A 1YR1A 2O8VA 3SJUA 2JHAA 2REXB 4L5CA 4LRQA 5T4BA 4GPBA 4GKJB 2XMCA 2EF0A 2R66A 3FA2A 1JFSA 1M2VA 5ALFA 3TW8B 1RLOA 4HO1X 4HNVA 1QB8A 4EMTA 1Y48E 1XKXA 3VU3A 4RIHA 1PFGA 1AHHA 5D1HA 1Q1NA 2P2SA 2WFMA 4ZGBA 3UAXA 5EKTA 3W79A 2CMHA 2UV8A 3JQQA 1Y34E 2RHLA 4EAAA 5CB4B 2BGJA 2WPDD 1NW9B 2PD4A 4YP6A 4IQFA 3G88A 2XYQA 2EL9A 2OZEA 3CF4A 2B20A 1AQIA 2PWBA 2R2AA 2Z9CA 1KMHA 4G0MA 3X1WA 1RC0A 1JF8A 1DFHA 3DMFA 3KNZA 1YS7A 4D4IA 1YQQA 4AJLA 2P2ZA 2NXWA 4MLPA 4I50F 3CLKA 2LZ0A 3WJ1A 2C7OA 1DC8A 1XZFA 2P62A 2Z08A 5IBPA 2Q1UA 4F56A 4YV0A 4XD7D 4ACBA 5E9AA 3DMDA 1TDJA 1NF9A 1JW9B 3ROZA 3FTEA 2CUZA 3GLQA 4O4IB 2R1TA 4GMHA 3K71B 4FK8A 1RADA 2CUTA 1Q74A 4J7UA 1MCZA 4YI5A 3PPWA 3QWHA 5H16A 2AV6A 2FPKA 2W6NA 5J2TF 3SJZA 3V4SA 4D81A 1G18A 1S9HA 5J58A 3JWIA 2UZ4A 1VG1A 5C7YA 2WU0A 2GJ9A 1UT6A 2BMJA 3F1LA 3TG8A 3KLNA 2HZBA 2B25A 4QJBA 3HB0A 4F11A 1JFRA 2VHVA 2XUJA 2QRNA 3MGKA 3DBVO 1H4VB 2B1RA 5FTJA 3KOOA 4A8JA 1R50A 5CVUA 4ZCRA 1MRNA 4YRSA 1PEAA 2PSEA 5DHSA 5LC1A 3IAUA 2IOHA 2P5SA 3K5PA 3LQQA 1H85A 4PGFA 4S1PA 3W8NA 2GS9A 2YWBA 5BNWA 3D8BA 3LVRE 3AT1A 4CTOA 2Q5QA 1LRJA 8LDHA 5I47A 3ILSA 2A9OA 1R5JA 4Z0HO 3SYTA 4HNUA 5ED4A 3RGWS 1NVMB 2Y66A 3LYAA 4QBFA 3WYEA 2K6GA 3NR2A 3PB3A 4L7VA 4Q82A 2XRMA 2QSYA 4NYIQ 5KTMA 1Z22A 1NFFA 4XJXA 4BYMA 3BBPA 4K9MA 1S0UA 3B82A 2OY0A 4ZK6A 2ACEA 2XTZA 2ILTA 3U4DA 4DLWA 3EGXB 1QH8B 1T9ZA 5HTKA 1CUEA 5KYYB 4F2GA 3B8HA 3U4QA 2M6KA 2OL4A 1F5SA 3IESA 4O02B 1MO3A 4DIFA 1W5FA 1EX6A 5JXWA 2C8JA 1OV4A 1TTPB 4BLOA 2WFZA 3SYRA 4CCSA 1F1BA 4I3GA 5MGBA 4Y6LA 4B3JA 1EIWA 3AUKA 4OSOA 5JS6A 5I7AA 4K3VA 2DR0A 2FN3A 4LNHA