3CONA

Crystal structure of the human nras gtpase bound with gdp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
156
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human NRAS GTPase bound with GDP.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase NRas
total genus 56
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3conA00
5HE8A 3ZZTA 3GLHB 1JR3E 1F2UA 1US8A 4JVMA 3X1YA 5GVSA 2ZI6A 2IYRA 2G1JA 3GJ5A 3M6AA 3BWDD 2WHXA 4AG6A 1GM5A 4DSNA 1I4LD 2V55B 2KE5A 5EXTA 2XSZD 1NNEA 4CEHA 3BXZA 2XB4A 4IRUB 4ZI3A 1YU9A 3FOZA 3WYGA 2IXFA 1OFHA 1AK2A 2IXEA 2XB2A 4JJZA 3K53A 4RD6A 3MWJA 4XWKA 5HR5A 4MQBA 1XPOA 1N6RA 2WSSA 2O8CB 1J70A 3GLHE 2GBLC 2QA5A 3OZXA 3AUXA 4PZLA 1OIWA 4LJ4A 1COWA 3T5DA 4FWTA 3V00A 2HT6A 5FOTA 4A0FA 2ZUCA 1QHGA 4Q7JB 2A78A 1OFUX 2QP4A 1G16A 2WJVA 3TLXA 3NVAA 4RFVA 4F7WA 3KXIA 1NKSA 3LW8A 4NCHA 1C9KA 4W9MC 5IF9A 4M22A 1XMJA 2E1RA 4FINA 3FE2A 3MG9A 4TTQA 4JVSB 3ZZ0A 1OPXA 2ZI4A 2R65A 2B7BA 5E3HA 3PUVA 4H1UA 5AJXA 5KSPA 1E2FA 5CYPA 1HE1C 3BH6A 2OXRA 1A82A 3RWOA 4JT2A 4B34A 4A92A 1GNRA 5AUNB 1R0XA 5CB6A 1YE8A 4LJ7A 1MABA 4QJ3A 5D3QA 5HCIA 2EW1A 1OYYA 3LFUA 2ZRAA 1QHYA 4WBSA 4NYMQ 2ORWA 2C77A 4V0ME 2KI5A 4Q48A 4RD1A 1FTNA 5BW8A 1IN8A 3F8TA 4S35A 3VTKA 4MA4A 2NTYC 1ZUIA 3W90A 2Z4RA 3AP2A 4FI3C 4W7SA 1XJQA 1VG0B 4TLCA 3AVQA 4URUR 1JEEA 1DAKA 5E4FA 5HE9A 4DHEA 1TF5A 4TL6A 4Z54A 1FX0B 3CW2A 4NCIA 4A82A 4TYPA 3DPUA 4P31A 4XVQA 4CEIB 4BEBA 3AVVA 5EXPA 2FFAA 2WMOB 2D2EA 3L0IB 5EZ5A 2A5JA 3TE6A 1D6JA 5FPTA 2ORVA 2LKCA 1YZTA 2QPAA 4PO1A 2ZE6A 2Q3HA 4RFSB 2XSZA 3BS4A 4Q1AA 1Y3AA 5FL7D 2FMXA 3PG5A 3VR5A 1GILA 3GJ0A 1GKUB 2R6DA 1KI6A 2B21A 1X86B 2V9PA 4POAA 1S3SA 5F3WB 4YQFA 3MGCA 3FFAA 2CBZA 2BIFA 1FP7A 2K5UA 2CE7A 4HAWA 2GXQA 3QY0A 1A5TA 2PMDA 2QBYA 1W48A 5FUXA 2F1JA 3RRZA 3C15C 3AF1A 1XEXB 4R9UC 1KI3A 1XD8A 3IIJA 4Q19A 3HWSA 1GDDA 3L0SA 3KTAA 3IO3A 2O0KA 2PT5A 3AP3A 4DSOA 4ZCMA 5BN5A 5IDVA 1VG1A 3SI7A 3W6PA 1G3MA 1K5GA 1XD2B 3R8FA 2H8KA 3TSOA 2NO1A 1XXHE 4YDSA 4CDGA 3FVQA 4Z51A 3CH4B 5JCPA 4MKHA 1E4VA 4NYMR 2J0UB 5D3MB 4LHXA 1OXSC 1Y63A 1P3JA 3AVPA 2G9NA 3NDBB 1NMYA 3PUXA 5CDFA 2X1VA 1Z6AA 3K9LA 2FSFA 5FOUA 4LV8B 1W36C 3RS7A 1XWIA 3ASZA 421PA 4FIDA 3F0TA 4V0MA 4JYCA 2GWHA 2OAQ1 4M8NE 4HAXA 1P72A 4Q1EA 1OH5A 2HF8A 3SYKA 2WTUA 2XNSA 2RGGA 4OK3A 5DNYB 2QE7A 3CRMA 5TXGA 4Q4HB 4Q47A 4LV6A 2C95A 2FG5A 4IDNA 5DN6A 1H8HD 1RRFA 5J4YA 2Z6VA 1XEWY 2RGDA 1G4UR 4I4LA 1NY5A 2FV8A 2WJHA 4TMXA 3UG7A 1F48A 4GSYA 1UKYA 4OBEA 3SHWA 1DAGA 2PLRA 3RC8A 4K8OA 5EP2A 1QHIA 1ZM4A 2PZGA 3Q9LA 2H5EA 3OF5A 4KV9A 2O8EB 3EW9A 1IJEA 1COWD 2KSQA 1NRJB 4F4CA 5J47A 3H86A 4C30A 4NP6A 4G5RA 3OE7A 1E98A 5KPJA 1N6KA 3RAPR 3CNOA 3RSOA 4LJ8A 1VG9B 1K8RA 3MJRA 1ZM3A 1G4AE 1G5PA 1G3QA 2FSIA 1OXXK 4CF7A 5BYJA 2AFHE 3MCAA 2XGJA 4M1KA 3U3MA 1WRBA 1ZD8A 1ZUHA 1MO3A 2C99A 4JJKA 3C41J 4Q18A 5CJ2A 5EP1A 3DKPA 5J40A 3IIMA 2F43A 2CHQA 2J59A 2QT1A 3SFVA 5KPDA 4OI0A 5FBRB 1EFCA 1NY6A 3PITA 4JLDA 2OILA 1GITA 1WP9A 4ACBA 5JJKA 3IBYA 3KFXA 3KJHA 3MUFA 4HDQB 5HKKD 4ASUD 4ZKEA 1TTTA 4QBHA 1F5NA 1XNJA 3KUDA 4M9XA 4JBXA 4NH0A 2AKYA 3OEHA 3I8SA 2I1VB 4Q01A 1TQ6A 2GJ9A 4QNRA 3FDIA 4CVNA 2GEUA 2HYIC 3EA0A 4QHTA 2DWQA 1GZSA 3PFIA 1BYIA 3QG1A 2ZETA 1G7TA 4DT1B 2BCJQ 4HI0E 3RWMB 1DTSA 1GTVA 4XSHA 1G41A 1A2BA 4UNPA 1G18A 4B2LA 4X8HA 3CWZA 3SNHA 2HJGA 2O52A 2ZE8A 2DHRA 1E6CA 3UXMA 2GVDC 4Q21A 1H8HA 2ZU6A 2DBYA 2F1RA 1NI3A 1VCIA 2BMEA 4Q4LA 3I32A 2W83A 1Z22A 2JLSA 2ODWA 2X2EA 1DG3A 5LBIA 2REOA 3AUYA 4FWIB 4TQUS 3HP1A 4LWZA 3AVWA 1QRAA 4Z1MA 4BUJA 4ZV4A 3HU1A 2N42A 3CPJB 4MKIA 4GOXA 1DEKA 1TUEA 4N0DA 2P3SA 4BWYA 3DOFA 3VNUA 1BO6A 1F2UB 3A36A 4PX9A 4GI7A 1R4AA 5KUTA 1IY2A 3H1TA 3PVSA 4G5SA 2DFNA 2UVQA 3K0AA 4ITRC 3FFBA 1ZIPA 1G20E 1F6BA 4CZ2A 2O8FB 3TMKA 3QENA 2Q9AA 3ZGXA 1W0JD 3QXCA 4FMDB 3ICQB 4AKGA 3PUZA 1KNQA 1W5SA 3FKQA 1E0KA 5BXQC 2JGNA 4JL6A 2C9YA 2ZM5A 2JATA 3GLIB 2Q3FA 4P32A 3B9PA 3BAFA 1W4CA 2LCFA 3OIUA 4BLOA 2GRJA 2KBFA 2WVJA 4YDHB 1S9DA 2BBOA 3U44B 2CL0X 1SXJA 1AQYA 3IKJA 3KKOA 2FGJA 1SHZA 1SVIA 1PUIA 4BFVA 4BZXA 4DLYA 3RDPA 1UM8A 3TVTA 1LFDB 4DIEA 4AIIA 4Q1FA 4RFSA 1OFTA 1D9XA 1T0JB 4WXPA 2PCJA 2VP6A 1XB2A 3CO5A 3U5ZB 2ZI9A 3TQFA 1FNMA 2BCGY 4JKIA 5EP3A 1KJWA 4EIWA 2V1UA 4TN1A 3WMFA 1YQTA 2YWGA 3P4YA 3LWNA 1JPJA 4A6PA 1PZNA 2Q6TA 2V7QD 1FP6A 4PHTA 4YLGA 1K5DA 3PR1A 5DI3B 3EX7C 1P75A 1IBRA 2AXPA 3EARA 3K0EA 4CT4B 3OIVA 3CF0A 3GJXC 3R8CA 1GG2A 1ESMA 3W6OA 3UKDA 2IUSA 2JJ1A 2QGZA 1GSIA 4ZDWA 2PLFA 2IK8A 4Q4AA 5C46F 4QBGB 4JLAA 1SVWA 1NLFA 3P4XA 4LV5B 2R62A 2QAGC 1KIMA 2O0HA 3BFVA 1YR8A 1PUJA 2W2TA 1LS1A 4OQMA 2RGNA 3G0HA 4M9SA 1VG8A 2NG1A 4I81A 2GEDA 1XF9A 1TADA 4PSKA 4ZIRB 4M2LA 2PBRA 4G1UC 4PQFA 4R2IA 3ZH9B 2YYZA 3GEEA 1Q22A 5K8TA 2VHCA 1JBKA 1HT2E 2F6RA 2O8DA 4LYAA 4AURA 1VDZA 4P3YA 4M9QA 3AH8A 3WBJA 1KI7A 5KNDA 1N5IA 4NCKA 4C2TA 4AWXA 4HYYA 2GBLA 3CX7A 4DLUA 4DWJA 4B3FX 5CM9C 1BH2A 1BMFA 4D4KA 3QXHA 5EE3A 1L4UA 1Z29A 2FE4A 1ZU4A 3A1VA 2GCNA 4P0TA 5L3SB 4XIGS 1J2JA 3NH9A 1G7RA 3UMRA 3NG1A 5LDDC 4PC2A 4Q7LA 4D6PA 1DAEA 1T6NA 2C8VA 2QPOA 4IXMA 3R9IA 3K9GA 2B8TA 1RE0A 2HCBA 5FR2A 3VKHA 3HJNA 2HEIA 3BORA 2CE2X 4MUBA 4E5UA 3DM9B 1GWNA 2ZJZA 4JS0A 3GLIE 2WMNB 2BKEA 4O0MA 3T5GA 1XTQA 2BWJA 2EFGA 4MUAA 3TSZA 3L43A 2X2FA 4HLUA 3EPJA 3OE7D 1VYVA 2AHOA 3IO5A 1CF4A 4AD8A 1ESNA 2DFKB 2FFQA 2PJZA 1DOAA 2VPPA 3QF4B 1G5TA 1E2MA 4JLNA 1Z0JA 4V02A 4CW7A 2O8DB 1J8YF 4DKXA 5EE9A 1VHTA 2OXCA 4KSCA 4UNSA 1OH7A 5KHOC 3SQWA 3NH6A 3CNNA 3CPEA 3LO5A 4KITB 4CIDA 2G83A 1VPLA 1AZTA 2Q9CA 3I3SR 5FUWA 4ARZB 1AZSC 4KVGA 3THXA 1D9ZA 4E03A 1XDBA 1QHHA 1TQ4A 1UF9A 2CL7X 1G291 1YRAA 4DSUA 4EAQA 2HLDD 3B6EA 1R8SA 2YV5A 4OQXA 2F3TA 4X8MA 2WBLC 1LY1A 4OI4A 2WKQA 1XTIA 2A5GA 1WE2A 4M53A 3R9XA 1GL9B 2Z4SA 5FOVA 1E32A 2IHYA 3Q5DA 3N5CA 3KZ1E 2J9RA 2CDNA 3S1AA 1KMHB 1LNZA 2OAP1 5B57C 5CDFE 2ANCA 2PL3A 4TZ6A 3M4YA 1Z5ZA 4UXJA 2A9KA 1AGRA 4K46A 4UNNA 2GK7A 2BVNA 4JYBA 1RJ9A 3B1VA 2P65A 2VSFA 3R7WB 4A6XA 4CEJA 1YJ5A 1E79A 4RZ3A 4TYWA 3LXRA 2CEAA 1ONBA 1KSJA 1YVDA 3RNLA 3AF0A 3AKCA 3TBKA 2OFWA 3SJBA 5DO9A 1MRNA 3QJYA 2RB4A 2J0VA 1SVKA 4LBVA 1JEDA 1RRGA 1TU3A 4Q1BA 3MWKA 3ZLJA 1E2EA 3NKVA 3SJCA 1ZD1A 5JSZA 1NJGA 2F9MA 3WNCA 2ZJAA 4PPNA 4OHVA 3F5FA 4PAOA 4B33A 5CM8B 2XZLA 3PJRA 1TNDA 2IL1A 3PENA 3TKLA 3T1TA 2RGCA 2JLRA 4Q4JB 2GZAA 5TVKA 4TYYA 1YZQA 5C2JB 1G17A 5GADl 2H18A 4OJKA 3NIBA 3U7FB 1P60A 1QBKC 4QBIA 1HQCA 2P5SA 2GCOB 2V6JA 4ILEA 4LCBA 4M1MA 2NIPA 4XWAA 5JBQA 1NL3A 1CIPA 4C9BA 2WWWA 3KKPA 4D80A 1G8YA 4FN5A 1KSFX 2QNRA 3U3JA 2JAQA 3E2IA 4OK5A 2W6IA 4LSGA 1HE8B 3EIEA 3AQ4A 1MR3F 4HLUC 1W4AA 2VSXA 4CRWB 2ANBA 1JJ7A 2SHKA 2ZS9A 2HLDA 4Q7MB 4L16A 4RD2A 5KNBA 3GFOA 4YMWA 4B3CA 1A4RA 4BPBA 2Z43A 1XPUA 1CRQA 3QKRA 4FD2A 2VHQA 4HEJA 4HUTA 3QKSA 4A8JA 1E1RD 2QI9C 1ZYUA 4KFUA 3K0FA 2FPMA 1RIFA 2FN4A 4UNQA 4MRVA 3VHXA 1L7VC 1TQDA 1F2TB 2BOVA 2JA1A 3C14C 4XTRA 5DYIA 2NO9A 1FOEB 1CULC 3B5JA 4NYIR 4JL5A 1Z06A 3IEUA 4AI6A 3B7GA 4PHGA 2WSSD 3K9NA 2JJ1D 3KKMA 3PUWA 1W36D 3AM1A 1KO7A 2ATXA 4M1WA 1ZCBA 3LW7A 2JLVA 4D25A 1B23P 1RRPA 1G19A 1XZPA 4TYNA 1G9XA 1IY1A 3A37A 3QI2A 2ZYVX 2ZYUX 3L8YA 2OZEA 1M1YE 5H70A 1J90A 5A0FA 4GZLA 1SKQA 5JJLA 4JBYA 4D26A 2A2ZA 4C7OB 2PT7A 1IHUA 1OHHA 1P2TA 3A8TA 3EXAA 2GAOA 4DSTA 5EE1A 4NE2A 4Y0VA 4PR0A 2ZR9A 3WHKA 1GRQA 3AF4A 2GESA 2AWOA 1GAJA 2YC2C 3B1WA 4DLZA 5L3VA 1FX0A 1ANKA 2ORIA 2YHSA 4KO8A 2RGBA 4HUQA 1DAHA 2CNWD 5BN4A 4B3GA 1QF9A 1E4YA 1QHSA 2J87A 4YMUA 3J81k 1KI8A 2AX4A 3N70A 1KSGA 1E99A 4EPWA 1XJCA 3X1XA 1XCPA 1BIFA 2ZEJA 2ZI5A 3DVLA 4GOKA 4W5HA 4UXHA 1WQ1R 1KDPA 3DEFA 4LBWA 1E2IA 1IN4A 2FA9A 3D8BA 1UPTA 1E1QD 4G5GA 4L9WA 4MRPA 2JJ8A 3VR6A 4LDJA 5DLQC 3LVRE 2BBWA 1E0SA 2GZHA 5FBQB 1VMAA 3DOEA 1R10A 1E2QA 3SDZA 2BJWA 4G01B 3THYB 2D3WA 2QMUA 3KKNA 3PV0A 4EQ6A 1KY3A 1ZU5A 4JMPA 2MMCA 1T91A 1E0JA 1R6BX 4B75A 1V5WA 4LHWA 4LPSA 3CR8A 2IS1A 2ZRGA 2QROA 4BLRA 5DH9A 3U4QA 4CGZA 4C0AC 3SQXA 1NIPA 2QBYB 1T8TA 5HZKA 1KY2A 2EQBA 4UNRA 1XFAA 2GAAA 4RVCA 4CEHB 1WCV1 3M1IA 5HPYB 5JECA 2LWIA 5J4LA 4IFEA 1OYWA 1Q0UA 3C5HA 4D82A 3B8HA 3DZDA 2FFBA 3QXJA 1M8PA 3HYTA 2ONJA 3TVDA 1S96A 1CJMA 2ZROA 5TB5A 3PEUA 1VCOA 2DB3A 4BLPA 1ZNWA 3QPWA 3PEYA 2BMDA 2G0NA 1N3BA 4LBYA 4EUNA 2EFEB 3C5CA 2HV8A 2RCNA 1JB1A 1HURA 2JLUA 1M74A 4MITA 1VIYA 2GCOA 1Z07A 3ZJYA 5LD2C 2DR3A 4GBMA 3DMDA 1AKYA 5TDHA 2C96A 2FWRA 3GFTA 3RRYA 3GFPA 1KSHA 3QOFA 5FTMA 4EJSC 2QQ0A 1NN0A 4NCJA 5K8UA 1I4DD 1PLKA 3FHOA 1MH1A 2OUKA 1CS4C 1XPRA 2V7QA 2WJYA 2B92A 2WIBA 1JAHA 3TQCA 2XOKA 1Q44A 3QF7A 1RFLA 1KDTA 3LNCA 1KJYA 4GFDA 4TWZA 3VR3A 1PJRA 2P6NA 5KDOA 5JRJA 1N6LA 3M0EA 1EWRA 3QKRB 1XXHA 4O3MA 1O3YA 3AKDA 1E9AA 2BM1A 1UKEA 4A8JB 4LI0A 2W58A 1FFHA 1SXJE 3BOSA 5JS8A 4AKIA 2QU8A 1TMKA 1XCMA 4MKGA 4JLPA 4TT3A 2HJVA 2O8EA 1M7GA 3C8UA 1YR9A 3ECCA 2ZI7A 1SXJD 1NVUQ 3TW8B 1MV5A 3B85A 4MYCA 2XTMA 3K0CC 4TT3D 1BS1A 4ASUA 2QEQA 3ICEA 5FBWB 4A0HA 2ZRIA 3TRFA 2IYXA 2IA5A 3ZS9A 5FI1B 4KYUA 2NO0A 1NG9A 2J0UA 2G3YA 2W00A 1S2MA 1KAGA 5L3RA 2QAJA 2BMJA 5FUYA 5K8IA 3ND8A 4H1VA 1OLOA 3ZVLA 2BC9A 4TZ0A 5EE0A 1D2EA 2KJQA 4XOIA 3EZ9A 2WV9A 2ZJ2A 4DRZA 3O8RA 4A2WA 1JJVA 4TL9A 3WHLA 5DYGA 1K6MA 1IXRC 2WSMA 3U2QA 2ZRKA 2D62A 2IS2A 4Q7KA 4W5WA 2CVFA 4S2EA 4ZO4A 4EPXA 3IBGA 3EZ7A 4LK2A 2REXB 2FEMA 3FMPB 4MGYR 5FPSA 4KVAA 5FPKA 2IYQA 3KQHA 5FOXA 4HUQB 4ESVA 3RS0A 1XTJA 3OFNA 2ZQ5A 3DHWC 1VKJA 3CRW1 4DIDA 2ZJ5A 4GPTA 4HAVA 4EKDA 4GT1A 4DDWA 3QUSA 1HUQA 3W5IA 1WBDA 1HA3A 2R8RA 4QM7A 4YONB 2FPLA 1Q1BA 4Q66C 3B2EA 3LLUA 1W49A 1Q3HA 1E9DA 1M2OB 4W5JA 4RD0A 3SZRA 4D81A 3U61B 3ZDQA 4OHWA 5AUQA 1EWQA 1R8QA 1NVWQ 4I1SA 3ZVMA 1ELOA 4G0NA 2VIIA 3MSXA 2QORA 3E70C 2CMKA 2FNAA 2FEOA 3QXXA 1Z2AA 4NDZA 5FOSA 1X1SA 4LY6A 1G6HA 4OQFA 1VYUA 1DE0A 4KBFA 4XJXA 1YZKA 5FUVA 3RRMA 3L2OB 5B2ZA 2PCLA 4MGKR 3BFXA 4XVRA 2XJ9A 2JJ2A 3T35A 3CZQA 4OYHA 3QKUA 1XX6A 4MKFA 2C5LA 1R5NA 4KFTA 1AA9A 1PLLA 3TR0A 2YVUA 1CR4A 3HDTA 2JLZA 4BFTA 1T8UA 1NSFA 3LVQE 4QNMA 2ZRNA 4Z8XA 1OIVA 3T34A 2MSEB 2V8OA 4N1AA 1KO1A 3NTUA 4AKHA 3U44A 1ZUNB 3IUYA 2P5TB 5JCZA 4M1OA 1X8JA 2RGNC 3E1SA 1Q20A 3BRWD 1G8FA 5C18A 1H65A 4BFXA 1Z8FA 2CCGA 3BK7A 2QM7A 3AF2A 1V43A 5GJBA 4GNKA 3B13B 1YZLA 3L0PA 3QE0A 4FMBB 4V0OA 2YNMA 1DAMA 2NO7A 3Q8XB 1MOZA 1KO5A 1G6OA 1TAGA 4EPYA 1U94A 1P73A 2H17A 2MSCB 1Z83A 4L9SA 4A4DA 1NP6A 1R0ZA 2AKAB 3VFDA 2ZAOA 2C9OA 1P9WA 4PANA 2VL7A 2ZJYA 3IHWA 3O8BA 3GPLA 1GNQA 2CLCX 2YOGA 5DI3A 1CXZA 1MKYA 2F9LA 4JLKA 1XXHB 2HCJB 1E96A 4OHXA 4DCUA 1SKYE 4MGZR 2H1LA 4DEXA 2QT0A 3KX2A 5GJVC 2ZE5A 3W5JA 3EPKA 4Q4AB 2J1LA 1LV7A 2QAGB 2RHDA 3VU9B 2MMGA 1E2JA 1TEVA 3EZ2A 1X6VA 4MRSA 1FUUA 4R71A 3IPYA 2RH5A 4DEYA 3UMFA 4PSAA 3MLEA 4A8JC 1E2DA 2GJAA 2ZPTX 1EGAA 1Q57A 1ZM9A 2XOKD 3PCRB 4DCSA 3CZPA 1D8TA 2B8WA 1SXJB 5F2EA 4RKFA 3HR8A 2IYVA 4TLBA 3T61A 1NMXA 1XU4A 3I92A 5G41A 4BFSA 3GLGA 3TUIC 3E5HA 4EDHA 3F3YA 5AWFC 4RKEA 1N2CE 4WVFA 1OFIA 1R0YA 3FKSD 4X8OA 5CK5A 1H8ED 4YXWA 1OH6A 1E2GA 1QZXA 1T9HA 2RKOA 4B35A 4B32A 5L3QB 1OV4A 4Z1MD 1IXZA 4HLQB 5H1YA 1P6XA 4LHYA 1OE0A 1NBMA 1DBSA 2WKPA 1GOTA 1N0WA 1Q1EA 2ZR7A 3T15A 4EJSB 4BRUA 5ELXA 1PLJA 2XXAA 2DFLA 2ZYTX 3ZQJA 5SZKB 1KO8A 3KDSE 4FCTA 3MD0A 1OKKD 2XNDA 5G53C 5FL7A 1UBGA 2GF9A 5L3SA 2IF2A 4LPKA 2IWHA 2QQEA 3RLFA 4LX0A 2VRWA 1W36B 1E94E 2N1BA 1RZ3A 3AKYA 3FMIA 4MRNA 1YKSA 4KFRA 1EK0A 1E9CA 1S4QA 4G3XA 4C0LA 2G0TA 4IVPA 5DHFA 3WMEA 4AYXA 2A5YB 4IOJA 3N2EA 4JLOA 3W9YA 3KB1A 4LHVA 2OE2A 4PO8A 1NMZA 4Q9KA 4M1TA 1UBEA 2ZSFA 4NBSA 4WA7A 3ETLA 3NBZC 5TY0A 4LHZA 2L0XA 3BGWA 4IDQA 2D7CA 2OBMA 3BH7A 4MRRA 3LD9A 4IJMA 1NVVQ 1KZ7B 2VSOA 1OF1A 4HDCA 1II0A 2OV2A 4IEEA 2WOJA 3CONA 4PQRA 4B3BA 4C4PA 4A15A 1UAAA 4Q1DA 4TSFA 5E7MA 2VBCA 1ZIOA 4HB4A 3CBQA 2AK3A 4M0LA 4ZI2A 1ETUA 2I4IA 2QN6A 3Q3JB 4BLSA 1KTVA 1GRNA 2P0EA 2X8AA 4Y0AA 2QUZA 5KDDA 2JCSA 4YMTA 4YMVA 3THXB 3CF6R 1SXJC 2P67A 4B2PA 1QHHB 2HYDA 3QPUA 3NC1C 3SFZA 2OM2A 1EFRD 2EVWX 4GOJA 3MFYA 4QFMA 4QC2A 4PPQA 4B48A 2R6GA 4P4UA 1M7HA 3GJ8A 1N5LA 1WB9A 1KMHA 5AJZA 3NBXX 3LV8A 1TU4A 2FZLA 2IBMA 5FTJA 2WWYA 3EPHA 4Q5IA 4BFYA 2VP5A 2NZJA 4CEJB 1NLZA 3CIOA 1VCNA 1UBCA 2ZS8A 2QZ4A 2C2HA 2N46A 2KB0A 4EPVA 4XD7D 5IT5A 4MYTA 1NBME 3QEJA 4C0HA 4DLSA 2ZRJA 2V54A 1TPZA 4LJAA 3UANA 1EFTA 2AL7A 3T06B 4KODA 2IYZA 2WJGA 3PEWA 2WWIA 3QBVA 4C0JA 4IVRA 2O8BA 3LY5A 2OEPA 3U7EB 3C7KA 2EWWA 3EC2A 2IS4A 3UWOA 2C9CA 1ZJ6A 4E09A 4TL7A 4RZXA 2IYSA 2NZ8A 2QRNA 2ZRFA 3SN6A 3K9HA 4WZAE 4B76A 1ZC4A 1ZMXA 2BDTA 1QVAA 3TSWA 5JHHB 2VYFA 1OJLA 5D3MA 1P62B 4QRHA 4JVLA 3SE0A 3KQLA 2ZVPX 2R6AA 1P7CA 5AJYA 3AP1A 1EFUA 1CBUA 5CITA 4B74A 1BYUA 4GP6A 1MRSA 1WDTA 2A3RA 2J7KA 1R0WA 4L8GA 2ZSDA 1W0KA 4D0LB 4Q03A 3EZ6A 4ZKDA 4URWR 2IW3A 3WYAA 5FTLA 4KBGA 4PSVA 3TAHA 3WNBA 1Z63A 2NQ2C 4DUGD 1CJVC 4OK6A 4US2R 1TQ2A 3A1UA 3MMPA 2WKRA 2ONKA 2CHVA 1Z6TA 1VIAA 2UZIR 5J4HA 3FTQA 2GETA 2DWOA 1FUKA 5BN3A 4C0BA 3QKSB 3UIEA 1Z47A 3BC1A 2QTVB 1E3MA 3Q7PA 1WMSA 4EPTA 4IDOA 2VHJA 3BFKA 1Z08A 3RANA 1LF5A 1N5JA 1CR1A 4O25A 4QGFA 1FTSA 3OEED 1ZW6A 2CHGA 4A0RA 4ZDKA 1SVLA 1OT3A 3OIYA 2OCBA 4Q9IA 2Y8EA 3TAUA 2TMKA 2ZAMA 4UJ5A 2BEJA 3OEHD 5KSYA 2EU8A 1I2MA 2J41A 3IGFA 3IPXA 4PPGA 1L8QA 1OB5A 5K8LA 4GL2A 2QAGA 3QXSA 1E9FA 2VO1A 4ARZA 4KSBA 4DB2A 4PPFA 4V0LA 3I62A 3R9WA 3ND9A 5AR1A 1SULA 5B58C 4QG7A 2RGAA 3A58B 4RD3A 4TMZA 4DCNA 1A7JA 3ONWA 2G1KA 2R6CA 4LC0A 3PUYA 1LS6A 3DM5A 1OKKA 2XNDD 3QPVA 2GHIA 1HV8A 2WJJA 2PX3A 2VLIA 2VF7A 2R9VA 4LOAA 1OSNA 4C7OA 2OCPA 4FW9A 2QTHA 3P26A 1IXSB 1JR3D 1W2GA 2Q21A 5GJWC 3FWYA 3ZS8A 1ZC3A 2OCAA 5DI9A 3HPRA 4NCNA 3JVUA 4YXWD 1Z0FA 3H4MA 2ZJBA 1MO4A 3GCGA 1B0UA 1YHNA 2ZRHA 3CNLA 3K0FB 5JEEA 4LUCA 3DMNA 4JIMA 2ZSEA 4XWOA 1GKYA 5GVRA 2Q9BA 4QXAA 4N3NA 2CCKA 1YZUA 1CU1A 4Q02A 4O2RA 3NHBA 3RSLA 3AVOA 4E07A 4N0EA 1RW4A 2GXUA 5SZIA 4OHZA 1P4SA 1W2HA 2QP9X 1F2TA 3H84A 4TLDA 2WWXA 3RABA 3O47A 2CK3D 5DISB 3T1OA 4LJ9A 2PMKA 2RHMA 4RD4A 1XTSA 1DPFA 1KI4A 3EIHA 2D74A 4BQSA 2PJRA 5G3ZA 1FNNA 1T4GA 1XTRA 2VP2A 1SGWA 4TMTA 3DKVA 2RAPA 1H8EA 2HXYA 5FFMA 3NBYC 3SU8A 1G7CA 2A5DA 2VP4A 3VU9A 5E7IA 5JS7A 2C78A 4CT5A 1ZRHA 4JLJA 4QL3A 4TQ9A 1DELA 3KL4A 3T1VA 3IEVA 1KOFA 2WWGA 1E1QA 2ZIAA 5GJCA 3TIFA 2YWFA 1EESA 3X1WA 4DCTA 2JASA 2ZRDA 4R7ZA 1VTKA 1LTQA 5B64A 3THWA 1CLUA 2A7QA 4D4MA 4DVGA 1CR0A 3KXLA 4HZUB 1P9NA 1D5CA 2BBSA 1CR2A 2PX0A 1CEEA 5EXXA 3NXSA 2PEYA 3VAAA 1N0UA 4B3DA 2VA8A 3UG6A 1DADA 3W8NA 3U7GA 5EUQB 1OXTA 2W2XA 1YR6A 4P33A 3BB1A 4EFLA 3D7MA 4KJZA 3W8RA 2FSHA 4BE7B 5JWHA 1OHHD 1N6IA 1Q3TA 1Z28A 2DY1A 1S9HA 1IAQA 3OAAD 1DVRA 3VR1A 2Q0HA 1U2RA 5DN6D 4L4UA 3PXGA 2OLKA 4TTRA 1ZP6A 3AKEA 3THOA 2ZS7A 4D4JA 2IYWA 721PA 4L15A 1E2HA 4B6FA 2JLYA 3B1ZA 1W0KD 5M04A 1E9EA 4M9ZA 3GLGE 1D2MA 2ZRPA 1GIAA 2O8BB 3HU2A 5LD2B 1KDRA 3LXXA 1S1CA 2GVZC 3JZAA 3B82A 2VF8A 3ZVNA 4ZCLA 5JRZA 1JXOA 1NVVR 1T5LA 4TYQA 2JJ2D 4A36A 1Z0DA 2Q3MA 1IM2A 2X19A 1Q1ZA 3LAWA 2ODBA 3IIKA 2GTPA 3FPAA 2AD5A 2GILA 3NC0C 1US8B 2BV3A 1I2DA 2GK6A 4D0NA 1Q1QA 2E87A 1UDXA 3I8XA 1QHXA 5KSOA 3CRVA 1N6NA 2HXSA 2QSZA 3VKWA 5FTKA 4PZYA 1II8A 2BHRA 3K09C 1E9RA 1C1YA 4HZIA 3TUZC 3U60B 1AS2A 5G40A 3ZVRA 4NHOA 5L8VA 2GF0A 4RZ2A 4B44A 2OBNA 1JAIA 2GJ8A 1PV4A 2ECKA 4KFSA 2O0JA 3L0OA 1XMSA 2FZ4A 4HDOB 1F3OA 1W4RA 2QPTA 1NLYA 3P27A 2O8CA 1XJ0A 5JHGB 3X1DA 1CTQA 1I4TD 1GKIA 1KI1A 1GVNB 3G5UA 3OFND 4LJ5A 1NG1A 4NONA 2WWFA 3L8ZA 2IC5A 5EXSA 4AYWA 3V9PA 1FPMA 3JVVA 2AD1A 3L82B 4OKSA 4WXRA 1EX6A 1KK3A 2BJVA 3FMOB 3WY9A 5CK4A 2W0MA 5AUPB 4F4JA 1ZVQA 4IXNA 1IONA 4C0QC 3ASYA 3MWLA 3HPQA 2ERXA 1RYHA 1TUIA 2EFHB 3GEHA 1E69A 1KK1A 4M1YA 3RS2A 4UXIA 2KBEA 4MGIR 4HAYA 4UQOA 3LDAA 1BOFA 2ODEA 2WIAA 1FL9A 1YZGA 2J0QA 1U0HC 1FMLA 1NJFA 2WOOA 3PEVA 3QNUA 4G5OA 4QHYA 4KCGA 2XTZA 2H57A 5H68A 2O8FA 2CK3A 5AUOB 4OHYA 5FL3A 1E79D 4OQNA 3VHLB 5C1BA 1M34E 2JDID 1JI0A 4XSGA 3P1JA 4KXFB 1CRPA 1ZNZA 3QKTA 3EWSA 5BWMA 2P6UA 2X77A 3NEJA 3RS3A 1CJTC 1LB1B 3IQXA 5LPNA 4MDEA 1LVGA 2HUPA 3CUEF 1JALA 2DCUA 3KJIA 5CB8A 2REBA 1JR6A 1J99A 2F3RA 1T3SA 2ZRMA 3IQWA 1AKEA 2EYUA 4FCVA 5AJVB 4KU4A 1E2LA 4IKEA 4QGHA 4DDVA 1JR3A 4HB3A 4FXPA 3ADBA 1AQUA 1GP2A 4JL8A 3I61A 3EA5A 1OXUA 2VTKA 1QDEA 1SKYB 4U7DA 1KKMA 4ZDJA 2J45A 4CEIA 3Q5EA 2WAYA 4MYHA 4HZUA 3K70B 4ERNA 1W44A 4O2LA 4QJ5A 3QQ5A 5H8WA 1W1WA 4P4SA 1FZQA 3O8CA 1HT1E 2A5FA 5SZHB 1C4OA 4G5QA 1U9IA 3IILA 5UKDA 2FU5C 2RMKA 3LRPA 3SJAA 2ZRLA 3SS8A 2J3EA 4WZ6A 4BFWA 2QTFA 3GLFB 1T3LA 4IFBA 2OSBA 3AB3A 4KYIB 5AK0A 3T1QA 2J7PD 4U5XA 1ZM2A 2UZ3A 4DC9A 4NTZA 2CVHA 1YZNA 1G8PA 1P2VA 4BLQA 1E2PA 1GNPA 1NN1A 5EQTA 1HEIA 4A1FA 5C4GB 2E9SA 1QG2A 5IHPA 3ZD6A 2ZSBA 2A30A 2IYLD 2ZANA 3VNVA 3N2IA 3RYTC 4QHSA 2H92A 3GP8A 3EPLA 3V4RA 1ZAKA 2OBLA 5FI0B 3EG5A 3KKQA 1E9BA 2VHUA 3TK1A 3RS4A 3U3KA 2PH1A 2V3CC 4QGGA 3QSYA 1N5KA 5EZ6B 1SVSA 5KYKA 2H16A 1Z0KA 2ZXUA 3SJZA 1P2SA 3AVYA 1U8ZA 4BFZA 1IY0A 2QMHA 5KSZA 3A6PC 3EWAA 2ZU0C 2OT3B 2QM8A 1DAFA 4URYR 5E7JA 1KI9A 2ZUDA 3FHCB 121PA 5CYOA 5BQ5A 1G5RA 3SHFA 2R2AA 1GUAA 5JI3E 2ZVQX 4I1OA 1UBFA 3TH5A 1NN5A 5DSZA 1SVMA 1YR7A 3DO6A 3FB4A 4AKEA 4RZUA 5KO2A 4TTPA 1XZQA 5LB2A 4JSTA 5A4JA 2JIZA 4DJTA 1R5OA 5KDLA 3VX3A 1Z0AA 2J46A 1G7SA 4AK9A 2JLXA 3TUJC 4AY2A 1Z6YA 3CRRA 3X2SA 2IYTA 3GD7A 4DXAA 3AVXA 5DE3A 4TL8A 2IX3A 2XXAB 3CX6A 3O8DA 5KOYA 2QP3A 2XEXA 4PAQA 3CKLA 3IHLA 2VEDA 3ZQ6A 3CH5A 3ADDA 1HYQA 1HQYE 3BH0A 3H2YA 2OESA 3LQQA 3DDCA 2FDCA 1GL7A 4JKYA 1TF2A 3UATA 5JJIA 4LZZA 1D2NA 4KI0A 2QMOA 4IOLA 4WAUA 4ZCIA 2EWVA 3KJEA 3H0KA 1NBMD 4U00A 3CWQA 2ATVA 2OLJA 1GFIA 2DYKA 5FOWA 4MYUA 2G6BA 1G8HA 2O5VA 2EFDB 3W6NA 3CPHA 1RVDA 1FW6A 1II9A 4B3XA 1WXQA 4HAUA 1A2KC 2IHBA 3BBPA 2QG6A 1BKDR 3GLGB 4JLVA 3VX4A 1G3IA 4NPHA 2QL6A 4ABYA 1ZNYA 4OQLA 4PQYA 1FMJA 3K0SA 5HCNA 5L3QA 3HR7A 3HYRA 5FBVB 3D31A 4URXR 1EFRA 3BERA 1BMFD 5CLLA 1G3RA 1KAOA 3WRXC 2F43B 4EJSA 2WM9B 2AWNA 4I99A 4QKQA 1U0LA 2AK2A 3ZYCA 4A2QA 4LYFA 2C98A 3TNFA 2Z83A 2H7VA 4H9GA 4DLVA 4KLNA 5EJEA 3WP1B 2VH5R 1TF7A 1RC8A 4GP7A 1N25A 1WF3A 1KK0A 2PZEA 3S1AB 3WMGA 4TSFD 1U81A 4URVR 4JLMA 1G3UA 1KI6B 4M4SA 4US0R 1RJ9B 3R7WA 3WBKA 2ASEA 5J5CA 1W0JA 3D3QA 1HY3A 2OFOA 3CRQA 2D4HA 5P21A 4WOPA 1XEXA 3IDQA 2HT1A 4QBFA 4I1VA 4Q9JA 3THYA 3NDPA 1AN0A 1N0VC 2JIZD 1JPNA 4EQ6B 4NMMA 3KB2A 5ANRB 2IWRA 2OHFA 3SC3A 3TW4A 1X8KA 4JZKA 2GJKA 2QENA 1FQKA 2B6HA 4HATA 3AVTA 3VKGA 5JI2E 2V4ZA 5BYKA 1IOZA 1J8MF 4HB2A 4AYTA 3GLFA 5KTYA 4C0KA 621PA 2ZUBA 3BIFA 5FR1A 1KGDA 2F1HA 1E9SA 3RVBA 4RCZA 3KUCA 1JXMA 1SZPA 2AR7A 2C04A 3GJ6A 5FH9A 2AXNA 4F38A 3R20A 5LB4A 2HF9A 3SEAA 1ZNXA 4FCWA 3SBEA 4PHFA 1S1MA 2QSYA 1RPZA 2BKUA 4TMKA 3TGPA 3QVUA 4IEIA 4L5BA 5JZVA 2NOAA 1U0JA 1UJ2A 4HLDA 4DUGA 2FF7A 1MT0A 2MSDB 2Z5FA 3LH5A 4JBWA 1L2TA 1SQ5A 2GCPA 4YC7A 2JEOA 5IK2D 3C16C 2D06A 1S0UA 1O87A 2CLSA 2FFHA 4PAMA 1XMIA 3UMSA 1F60A 5A5GA 4PTLA 1S3GA 1XMVA 3ZIAA 4IDHA 2ZITA 4R2HA 4II7A 4ACAA 3LBHA 2YKGA 1N6PA 2NGRA 4JT4A 2IUTA 4B2IA 1JNYA 2RGXA 4M21A 1FQJA 4QGAA 5F98A 3DZ8A 3LX5A 3WXMA 4FMDF 4AG5A 1R2QA 2XZOA 1TL7C 3QVVA 2F7SA 1E1RA 3A4LA 1VHLA 4E22A 3ZD7A 2FPKA 4A0GA 2IYYA 1P5ZB 2BEKA 2GXAA 4WIAA 2AN9A 3OIWA 4OL0A 1VYTA 2QY9A 2EFCB 2J5XA 3SOPA 4IHQA 2KWIA 1MO5A 2W6JD 4F91B 3CF2A 1GL6A 2V6IA 4R98A 1YRBA 4PO9A 4DLXA 4DB4A 2W6ID 3MWYW 3OESA 4PC1A 4C2UA 4PC6A 1QHNA 2OO7A 2IXGA 4IOMA 1U98A 3GLHA 4B73A 4KAXA 4BZQA 5IRCD 5EE5B 4BECA 1E2KA 1U8YA 2JLQA 5E95A 1UFQA 1KMQA 1GRRA 1ZBDA 1KZGB 3KXKA 3D6TB 3LBNA 3OAAA 4JLBA 4B71A 4UJ3A 2IT1A 4DDUA 1IN7A 1HH4A 2VHTA 2ZTSA 1TX4B 3Q72A 2B7CA 2ZYWX 2IYUA 2ZJOA 1U8AA 1W46A 2WJIA 4JVNA 2D2FA 2P2LA 4LRWA 5G3YA 4C3ZA 4DDTA 4UKDA 3WP0A 3KQUA 3LQRA 5HZHA 4YMSA 3KJGA 3QEOA 1CJKC 1JQLB 4PZZA 4U02A 1W5TA 3PQCA 5CIQA 4XVUA 4V0KA 1U99A 1XP8A 2LKDA 1LF0A 2OCYC 1R5BA 3QIAA 5TARA 3EAQA 3I5YA 5JLJA 3FGNA 4LJ6A 4P4SB 1XCGB 4PFSA 5EP4A 2WPDD 4HLCA 4ON9A 4FMCB 4IOKA 3VR4A 1X3SA 2JDIA 2BMFA 3X1ZA 4DBLC 2CL6X 3ADKA 1KO4A 4XH9B 1W7AA 1UDWA 2YWEA 1Z6XA 5EUMA 2XX3A 1XBTA 3WYFA 1Z6GA 4ESHA 4D2IA 4NZYA 5AJWA 3NBFA 1ODFA 1SVOA 3LBIA 2BM0A 2GXSA 4PC3A 1P9RA 2VP9A 1Z2CA 2YZ2A 3K0AB 1ZM7A 3LX8A 4WW0A 4F4IA 1Z3IX 3CLVA 4KLZA 5JMTA 3U4QB 3EIQA 2NMVA 2ZJ8A 1UKVY 2NO6A 4A9AA 3NHAA 4K81B 3RS5A 3EASA 4BFUA 3W34A 1U9IC 2I3BA 4P4TA 3B60A 1KYIA 1JQJC 3FHTA 1AM4D 1T3HA 2XJ4A 5HTKA 4V03A 3KQKA 3GLIA 1J7KA 4Q9LA 3ADCA 5KNCA 1VECA 2IS6A 4MDFA 1LW7A 2QMEA 4AC9A 1SHKA 4Q00A 2ZI3A 3A4MA 2I1QA 3ZZUA 1DAIA 4D4LA 3LLMA 3JZMA 3VR2A 4NKRA 1N6HA 4Q1CA 2W0SA 3REGA 1NKTA 2ZRBA 3AEZA 4NL4H 4OI2A 1CP2A 2WAXA 1XEFA 2XTNA 2ZSAA 3CM0A 3SR0A 1OW3B 2XZPA 3A1TA 3THWB 1OIXA 3SYNA 2JLWA 1NVXQ 3CR7A 4BASA 5J4VA 4RJLA 1NF3A 4TLEA 1AGPA 3RRNA 3U3OA 1DS6A 4J0QA 4TLAA 2DPXA 1KK2A 3K1JA 4I1UA 1UKZA 4BGDA 3P32A 2Z0MA 4FMCF 1OH8A 5CJPA 4LYHA 3FYHA 3TJZA 1N6OA 2GKSA 4IDPA 3BE4A 4DCVA 2ZR0A 2ZE7A 5JFGA 1ZD9A 1UEJA 1X1RA 5F9HA 1E2NA 1WBBA 2WICA 1AJEA 2CJWB 4A2PA 3EZFA 4ZPXA 2NPFA 3P20A 3BB3A 4NU0A 3REFA 3MAAC 4OJQA 2DFTA 3NWJA 4DZZA 2F1IA 8OHMA 2F55A 1HTWA 2G88A 3U6BA 2OFXA 3B1YA 3T12A 5F9FA 3TR5A 4LJYA 5C4MA 1MO6A 4QM6A 1MABB 2IF0A 4XD7A 1EXMA 1VCMA 2ZRCA 4GMXA 5HKKA 4ZIRA 3MJHA 3KTAB 1QVRA 5DIFA 4EPRA 2VP0A 1Q21A 1M7BA 3GEIA 4GMDA 2YINC 2CCJA 2RGEA 3UK6A 2XITA 4LYJA 3W3AA 1TEXA 1XTKA 4DLTA 3A1SA 4BEJA 4B43A 1XD2A 2YOFA 4PC7A 5J4KA 2XAUA 3GMTA 3HU3A 4HAZA 2YOHA 4LGMA 1DG1G 1KI2A 1QG4A 4TQAA 4NYJR 2QE7D 4XTCS 2OG2A 1KNXA 4JSYA 1E0AA 2GNOA 4B6EA 5B30A 3ZIAD 3CB4A 4IVQA 4MH0R 4V0NA 4F93B 1G8GA 521PA 4US1R 4HB0A 5IK2A 2FOLA 4BRWA 4D0GA 2ODNA 3U3RA 3OEEA 2R6FA 1NIJA 1XEWX 2IUUA 3RC3A 4BZPA 1S8FA 2NPIA 1P61B 4GRAA 3BB4A 2W2VA 3I5XA 1OB2A 3NEYA 4ZDIA 1W4BA 1ZINA 3U7HB 4QOSA 4CYMA 3GJ7A 2FSGA 3SYLA 1RKBA 821PA 4KHZA 4Q4HA 1L4YA 4HSEA 3UWKA 1IJFA 4EFNA 1NSTA 1RRCA 2VQSA 1EX7A 1Q12A 2CXXA 2FH5B 5KU1A 2GA8A 4C0SA 2ERYA 2V1XA 4DLWA 1JECA 4WZBE 5CLQA 4EFMA 3B9QA 1XRJA 2FX3A 3I4LA 4NYIQ 4RSGA 2GDJA 3K0CA 5TV2A 1G64A 5JEDA 4BLTA 3G82C 4RCYA 3SBDA 5JWRA 4TMVA 1CJUC 1KJZA 2GEVA 3GJ4A 3B1XA 3U6KA 1EG7A 3K70D 3A1WA 3QF4A 3KQNA 2CLDX 1DO2A 5TMPA 2QGNA 2YWHA 4PHHA 3I1FA 3AGPA 2IEYA 3UPUA 2P6RA 1UEIA 1G1MA 1PVOA 1OXVA 2WPDA 5FBLB 3WNDA 6Q21A 2DWPA 4TMWA 2FJUA 1UADA 1G21E 3GJ3A 4PXAA 3V4FA 4DLRA 1II8B 2PZFA 3MRSA 3VMFA 1X8LA 2GZDA 3OHMA 3PIRA 3QG5A 4LBZA 5JWOA 2EYQA 2G77B 2UKDA 4QJ4A 5FPYA 1T5IA 2YJTD 1DARA 3GLFE 1AS0A 1KHTA 2AFIE 3RHFA 221PA 3B78A 3AVUA 2YC4C 3AGQA 4M1SA 4URZR 3VQTA 3K09A 3K70C 4Q9HA 2W6JA 3CX8A 1KKLA 3BD9A 4LC1A 2QRZA 1XD9A 3FKSA 3A4NA 3KFVA 1RYFA 4NYJQ 4GDFA 3DL0A 5CIWA 2HDNB 1CKEA 1Z0IA 2J7PA 3EC1A 1EFHA 3C4JA 5FTNA 2FGKA 4GZMA 3Q7QA 1NN3A 2WWHA 5DHAA 2D7DA 1M6NA 1T0HB 1IN5A 4IW3B 1A1VA 2R44A 3BJIC 4DT1A 3LA6A 3K8YA 3W3ZB 1IN6A 4B47A 2PEZA 5SZJA 3I73A 1P2UA 4OI1A 2IEZA 4Z8YA 1DO0A 2C03A 2WZQA 3Q85A 3AV0B 1W47A 1R7RA 1ZCAA 1KDOA 5JSZB 3AF3A 4F92B 2J0SA 1AIPA 2BBTA 4Q4JA 4RY2A 2CNWA 2GJSA 4X8LA 5FPHA 3QBTA 1U90A 3WRYC 3GQBA 1WA5A 1AS3A 3FMFA 5DGXA 2CJWA 3I72A 1IQPA 2ZREA
chains in the Genus database with same CATH superfamily
4B0PA 3L49A 3ZZTA 1X1EA 2YZMA 3GLHB 4IIJA 2J9XB 2WU3A 3MOIA 1M2VB 3NBQA 4UU1A 3AR9A 3D3JA 4LI3X 3X1YA 5JV5A 3M1LA 3N75A 4DDHA 5TQ2A 4LKRA 2ZAIA 4NV1A 3ZY5A 1NP7A 1KFKB 3IKMB 2O5EA 3OMWA 4HQFA 4L7QA 2REQB 1KPIA 3Q4GA 3W8EA 5JZMA 1UWVA 4BMPB 4LZPA 3FOZA 2VWPA 4DCCA 3GT4A 2F1OA 4DGQA 3KT3A 4LYEA 4OGKA 1C9EA 4JOQA 3K9CA 4L9AA 1MU0A 1KJIA 2WFLB 1MEJA 2H2GA 2WSSA 3Q7EA 1E58A 2GERA 2G7MC 5I4BA 1A2QA 3UHOA 2GBLC 2V3WA 1AV6A 4IIDA 3O2NA 1OIWA 2G4VA 2C88A 3GEMA 5IJXA 3V00A 3IMFA 5B1SA 4D4HA 2RH9B 2QIOA 1L5GB 4KHPB 3MMNA 4Q7JB 4AJ1A 2A78A 3EISA 4JP1A 1P5HA 3T4XA 1E1NA 1OFUX 3TLXA 5DNUA 1QGDA 3FDZA 4GLJA 4KQKA 3T5PA 4RFVA 1GR0A 4YCBA 3TBHA 1V39A 1Z2EA 1AC5A 3KXIA 3VR6H 3QOWA 3L79A 4LXYA 2GI4A 1C9KA 2JPDA 5BNZA 3ADPA 1IBLB 3TTSA 1XMJA 2PUWA 3T0IA 4TGLA 1GGJA 1SM4A 4UCQA 3MG9A 1NYTA 1ECPA 3O83A 5M5BA 2ZI4A 3TOXA 1N2HA 2HDOA 3G2QA 4H1UA 5E3HA 1C8BA 1RKQA 2PSEA 2H2HA 3HXMA 4U8HA 1C4WA 2MDTA 3NHSA 7YASA 4JT2A 1E3SA 4B34A 2Y4OA 4IINA 1GNRA 3OMLA 2X0JA 1P29A 1MAWA 5AKEA 2YXLA 2AE1A 3WIDA 4ZVRA 2BGKA 2KPOA 2QVZX 1LLDA 2PGIA 5DX8A 5HCIA 5JO9A 2ZJ1A 1CY4A 4DM3A 2P9TA 1DJPA 1I5EA 4MVCA 2M6RA 4V0ME 3ENQA 2F3UA 1M6VB 3P94A 4K5QA 4Q48A 4QEZA 1E1LA 4WCVA 1Y6QA 4OG2A 3PZRA 2VRNA 2XB9A 3VSBA 1HDRA 1RI2A 2O2CA 4P5DA 1IN8A 5IM4A 2EW8A 2IXBA 4R0NA 3F8TA 4PZ9A 2QTCA 1ZUIA 2E4WA 1GG5A 4FYYA 1U5BB 2CYAA 3FPJA 4URUR 4DOMA 1JEEA 3NKFA 1KORA 4OYLA 4NBLA 4ZHQF 5FPQA 4TTAA 4CQMD 3BEOA 1EDEA 4B4UA 4NCIA 4E33A 4TYPA 3SYRA 3DPUA 4FZRA 4XVQA 3UK7A 1XI2A 1Z5GA 2WUFA 4XRRA 1PX2A 2XECA 3IBFA 4FEAA 3BN3A 3GMDA 4AY3A 1YI1A 1I8TA 5EXPA 4TN5A 2ZYRA 5EZ5A 1TM7E 1U2TA 1POXA 4CG2A 1SPXA 3KKKA 3CZAA 4B7UA 5B1IA 1MV8A 3EY9A 5KVAA 1VM6A 3HDGA 4LNUA 3TTTA 2R1VB 1JLKA 4E11A 4PONA 1QS0A 4AICA 4BVGA 4DARA 2O4CA 5JO0A 2Z8YA 3V4LA 1A72A 1NTOA 1VQ1A 4TZTA 1GILA 3COWA 2PYIA 4N7RA 2L19A 4FZ3A 4POAA 1HO3A 3T7TA 4JP2A 1T36A 1QIKA 4B8WA 4CBVA 4Y9DA 4YQFA 1I2AA 5ARBA 4A3SA 2EZ9A 3ZWYA 9ATCA 3BTVA 2CMDA 4KE9A 3V6MA 3NATA 2D0IA 3NQ41 5EIBC 1QYVA 3IQHX 4HAWA 8MHTA 3QY0A 1NBWB 2X0EA 4TUYA 5FUXA 2F1JA 3C15C 4UBLA 1ZVMA 3TLAA 3H3XA 5IZCC 1FLNA 1KI3A 1M34B 1GDDA 2JFWA 2O50A 2EKDA 3L0SA 5JNLA 4KW7A 7REQB 2ZBPA 3F9IA 1VXOA 1NW7A 4FFSA 4UM9D 4ZCMA 4PYJA 3GXBA 4FUQA 1YQUA 5BN5A 1WHTA 3QNMA 3WB1A 3SI7A 3WWPA 5K7SA 2DX7A 1L5HB 1SUEA 2AA3A 4YGXB 1GV0A 1XD2B 2X41A 3ZZNA 4H6XA 1V6AA 1VCHA 3STHA 3UQYS 4CDGA 1SG6A 1EVEA 1TXGA 4OU4A 3CZ4A 2P40A 4WI1A 1TZKA 2AOXA 1K1EA 4O8ZA 4R5HA 1E4VA 4NYMR 5DBFA 1AU9A 3X1JA 5D3MB 2WTMA 5JZ9A 2VHVA 1ZW1A 4GX5A 4KAFA 3TRJA 4R1UA 2DFPA 2JGLA 5CDFA 5AI0A 3YASA 8ATCA 1HDIA 1X7WB 3PQDA 4H77A 4N39A 3VZCA 1NC1A 4Y98A 2B9VA 3OQIB 5HJEA 4B3SB 5BPFA 4WASA 3CLSD 1VPEA 2H0QA 3OCCA 4FIDA 4JOBA 5GZ6A 3K9FC 1SC9A 2JG3A 4ZCTA 4M8NE 1X7XB 4KO3S 4HAXA 5BWCA 3SEFA 2BCEA 3LK7A 4OEHA 2W2OA 1X8XA 3CN7A 2XNSA 2NUAA 2I7CA 2RGGA 3HO6A 2QE7A 3VBEA 5K4GA 2HQRA 4WK4B 5DNYB 1W34A 2CNNA 4Q47A 4RXUA 1SCDA 2R7AA 3U56A 1MB4A 3B53X 2WF8A 4NRDA 1RRFA 2IE8A 5J4YA 1SXQA 3H9EO 2Z6VA 3HLYA 3N6VA 4OSPA 3QH4A 2RGDA 1G4UR 4Y6RA 1MXHA 4F9FA 3UG7A 5TR9A 2EX0A 2QTVA 1ZMRA 2GMWA 3OIFA 4WBXC 3RC8A 3BGOS 3KVRA 4JI8B 3MIZA 2DZDA 3RTDA 4DR4B 3GEGA 3VDQA 2JIQA 4DC1A 3DV2A 1SOUA 2D6FA 2O8EB 1UK9A 5E9QA 1COWD 3GJSA 1QIGA 2D54A 2XCRB 3Q7IA 4REQB 4JB2A 4NP6A 4UPEA 4CTJA 3MYYA 5EWLB 4DYVA 1LSOA 1N6KA 5JCJA 3RAPR 3LJKA 4UU7A 5CAEA 3OZTA 4N47A 2FWPA 1PSWA 1K8RA 3MJRA 1ZM3A 3GLKA 1NHWA 4QYIB 1G5PA 4D0SA 2FSIA 1OXXK 3DTNA 4G4IA 1RADA 4HWSA 5DZSA 1M2JA 4FGWA 5BV1A 2C61A 2C99A 1MO3A 1JHZA 3BPSA 3NB0A 1ZK4A 5EP1A 1LRLA 3Q41A 1FYFA 1ZI6A 4OFXA 2WAMA 3ZDRA 3T4PA 2IIVA 5CNIA 1ZL2A 3SICE 1GTZA 2F43A 4TKUA 3ETJA 5KPDA 1UMCB 2GN0A 3DDOA 1L7BA 5FBRB 3N39C 3NXKA 4GX0A 5JIBA 5K2MA 5JJKA 2LTAA 4HEQA 3P0HA 3A9SA 3HV0A 2X1MA 3IBYA 1E2BA 4FYKA 3MUFA 1Z33A 1FTGA 1JIVA 4X1KB 4DWVA 1WL8A 5FNVF 1TTTA 3DYVA 3F1KA 1F5NA 4JBXA 2X8JB 2AKYA 1P4RA 2VHWA 3UZUA 4QU5A 1DJOA 1CJSA 1MUUA 1WZIA 2I1VB 3EZXA 3H97A 2C4TA 4Q01A 1J8DA 1HBJA 2XCQA 4QNRA 3T99A 3FDIA 1N75A 3WL6A 1B43A 4CKWB 3U4CA 4B4VA 3S8MA 1YB4A 2PWBA 1FXWA 2WB4A 3HXTA 3MGAA 1F8UA 2MU1A 1G7TA 1GSHA 4OBBA 4HI0E 1LJ8A 5AP9A 4XSHA 2UVDA 1G41A 5I7SA 1KR2A 1H22A 3F74A 5ETJA 2XB6A 3CWZA 1EM8A 2HJGA 3T6KA 3VPFA 2TS1A 2DHRA 1E6CA 4WJZA 4W5OA 3HSSA 4KH1A 2XCTB 4PXSA 4BE9A 1X7GA 4Q4LA 2O2IA 3B3AA 1NOIA 2ODWA 3AJ8A 3HDQA 5ITVA 4LHEA 3UMGA 3PD7A 1DG3A 5K05A 2XYHA 2HIAA 3AUYA 3GZNB 3HP1A 3REQA 1LI4A 3AUJB 5TPZA 1BEEA 2FCRA 2VAVA 3HU1A 1B73A 1U9ZA 2Q6VA 3PWKA 4XPIB 3TD9A 4EUFA 3K1AB 5I7RA 2PBFA 5JXGA 3NOVA 3ZGZA 1JYEA 1LD3A 3DOFA 1YS1X 4NJMA 1M1NB 3NHPA 1HLPA 3PQ7A 3AUFA 3H1TA 4D8WA 1RQGA 5ESWA 3K0AA 3RK0A 4U0KA 2PVPA 1ZIPA 1G20E 3O1HB 4QUEA 3T7EA 1DDOA 1G55A 2XUFA 2YVLA 4Y6SA 2O8FB 3V55A 4IDAA 2J6HA 2Q9AA 5T4HA 3U80A 1JQEA 1GPDG 4NDAA 3NASA 3HKCA 5NULA 1HG0A 2GPSA 5LIPA 5BQOA 3U16A 2PH7A 4AKGA 1MPTA 3W5CA 1M0WA 2NLOA 5HK8A 2ZM5A 3I23A 2JZCA 3A06A 4MARA 3GLIB 1VSQA 2QI9F 4DZTA 3IELA 3OIUA 1W1IA 5KQSA 5TQ0A 2FUNB 2DRIA 3W2HA 3PXCX 2HMTA 1ZUNA 1S9DA 1CB7A 3C6MA 4UHFA 2V9ZA 3OO0A 4R4JA 3UMVA 3ZHZA 4EKNB 3OCYA 1SXJA 1AQYA 3IKJA 4YCJA 5IXSA 2E5LB 4XA8A 3PTZA 2ZLBA 2RGUA 3KKOA 4BFVA 1JU9A 2Q1YA 1PUIA 3KSUA 3NM5A 1QIFA 5IP5A 5TJHA 4I5FA 4AECA 2P79A 2B30A 5BSRA 1GSAA 1JKFA 2W2LA 5DXJA 4HAIA 3WIBA 3CO0S 5EJIA 1NQWA 3EGOA 1Y1QA 4ZQEA 1JAYA 3TQFA 2I2BA 1L4BA 4AG3A 3HUTA 1L4HA 2HBZA 3JR3A 2V1UA 5EYPA 5A02A 4YMGA 1YQTA 3P4YA 1G2OA 1KVSA 4BMDA 1AKQA 4Y8VA 1D2CA 1IWOA 4UDXX 1UJ5A 1FDSA 1HQKA 3K94A 2V7QD 4QJIA 1FP6A 3KOWA 1KARA 1K5DA 2FSPA 3ON5A 3PR1A 2YWJA 4BMCA 3X1KA 1PW7A 3K0EA 4GIBA 4J1SA 1Q83A 4DW8A 4ENRA 1HRKA 5TPWB 1GG2A 1GQYA 1ESMA 1X15A 2A84A 2Y3IA 4LXHA 2OWEA 5CW2A 5C81A 3PB3A 1P44A 3SC6A 2NSDA 5L4SA 1OZAA 5KC9A 2RKWA 4ZDWA 3CPSA 1M2NA 3SIRA 2GBCA 2IK8A 5C46F 1HMYA 3U37A 1SVWA 3PGKA 1Z74A 4ZXFA 5ITWA 1F12A 5JNSA 3DLCA 2O0HA 1ACJA 3Q8KA 3TE7A 1E7RA 3K7EA 1H2RS 4M9SA 4OHKA 5B3AA 5A7HA 2WLTA 3JYOA 1YOVA 3WR5A 3TM5A 4MJXA 1DEXA 3B70A 3BMNB 3F8WA 3QVSA 4PSKA 4TROA 3VZRA 2PBRA 4G1UC 4DBZA 5FB3A 1PJBA 5MN5A 2UYHA 1I94B 2YYZA 2ECQA 3FNGA 4F3CA 5EJ7A 1OWMA 3CYFA 1G63A 3D9QX 2AZMA 4H59A 4AY6A 5EJMA 3V9AA 4AURA 2FN9A 1VDZA 1JU4A 4M9QA 2AF3C 3H5AA 3O4JA 3DF7A 3W5VA 1GGNA 1N3LA 1N8TA 1B8OA 3DE4X 3EXIA 1N5IA 4HFMA 3WWZA 3AERB 1L4MA 3F7MA 4HQ0A 4HYYA 4AWXA 4BNLA 4DILA 3O8QA 3WAGA 1G5HA 2HBRA 2F8SA 4JP8A 1CQJA 4LXIA 4YT8A 2IXTA 3BMOA 3SFTA 2R66A 4ZRDA 1SUAA 1L4UA 1AB5A 2A4KA 2FE4A 5ECWA 2XUDA 1CX9B 1VL2A 3G0CA 5I7OA 4DV0B 3KOMA 4CL8A 5LDDC 4PC2A 1J20A 1QIEA 4C4OA 4D6PA 3U7IA 3WQBA 5A4AA 1T6NA 1OU4A 2WP8J 4IXMA 1DBIA 3HCDA 3P9IA 1B6GA 4YO7A 5FR2A 3VKHA 4HEA6 1K3UB 1RRMA 1DLIA 3HJNA 3PQEA 1WSWA 5K6AA 3O7MA 3O21A 3MWDA 1JEYA 2CJFA 1OPRA 3RSFA 1SQ0A 2ZJZA 1GPUA 1ISFA 4JS0A 3GLIE 5EKTA 2DSTA 2V5UA 4K87A 4C6SA 3ZCRA 4LYGA 3I34X 2OORA 2OM6A 4HWTA 3A9WA 1JSCA 2OY0A 3T5GA 3L43A 3OWHA 3R2JA 4CF6A 2YS6A 4JSRA 1VYVA 5K0FA 1CF4A 3DCIA 3HYSA 3QFHA 1PT9A 3E3OA 2FFQA 3WV5A 1IZ9A 2PJZA 2GNAA 2VPPA 3D7KA 1G5TA 4DE5A 4JLNA 3DMTC 3E48A 5K3EA 3DBVO 5L45A 4DKXA 1R3UA 4NI5A 5K1ZA 5JVDA 3K1AA 4UNSA 3AETA 4GS5A 5C3MA 2DJ5A 2OXEA 2C8JA 2EKPA 3CNNA 3IHTA 4UCWA 5F52A 3D3WB 4EA8A 4I66A 2P5UA 4DCMA 5K45A 4CM8A 2WHEA 2VG8A 3SZUA 1AZTA 2Q9CA 4JT9A 5FUWA 2OZPA 3VYSB 1K5HA 1NV8A 3QE2A 4CWAA 1TQ4A 1SO8A 1UF9A 1BU8A 3GU3A 3O8NA 3AZQA 1YRAA 3RSSA 4DBVO 4BTLA 2F3QA 2HLDD 5MFPA 4Z0HO 4LJRA 4OI4A 1RWNA 5IWCA 1XTIA 4H7JA 1Y9ZA 4L07A 5AW1A 4X9XA 4HNVA 2I8AA 1L3CA 1GPMA 4DM7A 2RI1A 1F4LA 3COYA 2OO5C 3Q5DA 3TQSA 2C54A 2ZBRA 5B1DA 4ZZ2A 2UUAB 2K7FA 1UK8A 5CDFE 3QA3E 2PL3A 4FX5A 1Z5ZA 3M83A 3LWBA 3BGIA 1D1QA 4G0PA 2GK7A 4JYBA 1MB3A 5A6SA 1C0IA 3B1VA 2VSFA 3OPQA 1A5BB 4I7EA 1YJ5A 1XZHA 2HLNA 1O5IA 3KO8A 4CEJA 1KRWA 3I9V6 2VYVD 3LXRA 4TYWA 2CEAA 4ZAFA 4O2AB 3HM9A 1ONBA 3S55A 4CUZA 3RNLA 3DLHA 3TBKA 2OFWA 1S89A 1GPLA 1NATA 5DO9A 2Q2QA 1UQRA 3H18A 1A9SA 2O7QA 2PIAA 2Q5IA 4LBVA 1RRGA 3SZLA 4LX8A 3SJCA 1WU7A 1ZD1A 1LX7A 2F9MA 3WNCA 4BKRA 1RU3A 4PAOA 2YL2A 2HMSA 2XZLA 2CVZA 4GF5A 1ZK2A 1AXRA 1N2BA 5ALOA 5KYUB 2BFCA 4RORA 4OGWA 5TVKA 3L8DA 3ZZ1A 5IVPA 1UANA 1YZQA 3AZOA 1O2DA 2G9QA 5JAQA 4CG1A 3M6WA 1P60A 1TZJA 1VBKA 1QBKC 2A1UA 2RHBA 1HQCA 3ZWKA 2DULA 1T8YA 3Q1KA 4MV8A 3PE6A 4ILEA 3IXMA 4LCBA 2Z3ZA 4M1MA 3ZKWA 2VQEB 4ZGBA 4OOFA 1U8UA 1ISJA 2PSDA 3KKPA 2QE6A 3E4DA 1KSFX 4KN9S 3EVEA 3OBIA 4R1TA 1AQNA 1MW8X 4NF2A 5SY9A 3RIXA 2NN3C 3IUBA 4O5AA 5EXEA 3N8KA 3EIEA 3HZRA 3DFIA 2WA1A 3DSRA 3TD6A 3X0DA 2Z2ZA 5ICMA 5LJIA 4RYDA 3ORQA 4P4GA 1Q16A 2EFYA 1W4AA 2W93A 1YRLA 3DULA 4MYRA 2ANBA 1K6XA 4B31A 3QU2A 4BPBA 1ZHHA 1XQYA 4L16A 5TT1A 1NRIA 4YMWA 1RCUA 1MVLA 1U0EA 2A86A 2ID8A 1CRQA 2Z43A 3EJ6A 3PHJA 5AI9A 5BNIA 2IBSA 4KGZA 2CT8A 3GAFA 3A1DA 2NU9B 4BV3A 3GNQA 2AEMA 3IJRA 3O8QB 4JP5A 1DWQA 4BQEA 5KX5B 5G0VA 1ZYUA 4H08A 1IPHA 2P1RA 5AO9A 1R4ZA 5JMPA 2JLCA 5IN4A 1HF3A 1V1RA 4OJTA 2FPMA 3JQ7A 5D8DA 1HSZA 1TGYA 3TW8A 1SD5A 3F2IA 4RV4A 4WADA 3JS5A 3EXFB 1EQUA 2A7XA 4MRVA 4ZOAA 3RUHA 2XV1A 3FPHA 4WXHA 4AZ0A 5JDIC 4PG6A 2VDUE 1TA4A 3HNOA 4MPTA 3H65A 1F2TB 2BOVA 3C14C 5HBGA 4X92A 3PFNA 1QR2A 5DYTA 3GUVA 4YP6A 4M6WB 1P80A 4ITUA 4E5YA 2J8ZA 1BXZA 2WKSA 4PHGA 2SICE 3K9NA 3KKMA 1W36D 3BDVA 1KO7A 1YGYA 4WD3A 4YHHB 1G19A 4GZ3A 4XGRA 1NMSA 3QVMA 1G9XA 3A37A 3IDSA 5KREA 1BG6A 3HO8A 3MFQA 4R1QA 3UV3A 1NJ1A 1Z7WA 1M1YE 3R7SA 5A0FA 4D9NA 4ROSA 4GZLA 1APBA 4QYMA 1I3MA 2WFAA 3KXPA 4G4SP 3UAZA 5FAKA 2PT7A 1BWQA 3B6KA 1IHUA 3OICA 2DWCA 4BX8A 5T7BA 3TPCA 3DLPX 3EXAA 1T9AA 2Z5VA 3EBOA 2W43A 2APJA 5HSGA 1U3FA 4LWPA 4OPMA 1JLLB 1PWHA 1U31A 3CINA 3NVDA 3WGHA 3WHKA 4Z9FA 5HTOA 4ZEXA 5EQJB 3RVQA 2GESA 3MLAA 5L3VA 3B1WA 4DLZA 1Z17A 4KO8A 2YHSA 2HHLA 3M7IA 4JB8A 1KU0A 5CA0A 3ZNPA 1U7WA 2JFYA 5KHLB 2EF1A 1T1RA 3GUZA 4DNPA 3H1AA 4R8MA 1XQ1A 3WGVA 4JR0A 2W9XA 4Q15A 4G5HA 3I4CA 3MTAA 1JQ5A 5DLEA 3N70A 5CRIA 4BNGA 3WJ7A 3X1XA 3V1KA 1BIFA 3OP1A 2XXBA 4JU8A 4W5HA 1QCYA 1J5XA 3IHKA 4FDVA 4WERA 1KDPA 4LBWA 4XWTA 5L4NA 4E5SA 1ZJJA 1R4MA 2TMDA 5D00A 3DZIA 1C8KA 4G5GA 5JC1A 4LTMA 3VR6A 1A9PA 1RQRA 2H85A 3AYXB 1L7NA 3LZCA 4FFBB 3UHPA 4EEXA 4F6LA 2H1FA 1C1DA 2ZUUA 5DLQC 1E0SA 1VJDA 4MQMA 1AKRA 1U4NA 1VMAA 1R10A 3OA0A 1ISSA 1E2QA 4LOHA 2BJWA 3MJCA 4JROA 3THYB 1MJ5A 1GFSA 3VYVA 3E3AA 4KN8A 1I6KA 1DIOB 4JMPA 2JIPA 4FQ8A 1QYCA 2MMCA 3WTCA 3S68A 1UFRA 2XD9A 1R6BX 1V5WA 2H5JA 3C74A 2B2CA 4P5EA 1DI0A 1B16A 4V38A 5G0TA 5IXJA 4BLRA 5JYDA 1XAIA 4FWBA 3ZU6A 4O2AA 5K0BA 4CGZA 2K2WA 3K9BA 3SQXA 2R7KA 4X7RA 2QBYB 1T6YA 4IMPA 1T8TA 2BW0A 3ANMA 1E1YA 3DHEA 4Q37A 2X42A 3HLTA 4ROTA 3TXAA 1OU0A 2WKWA 1FP4B 1WCV1 2RJ3A 4CEHB 4LDAA 1EE9A 1I6WA 3H16A 4N82A 1UBSB 4D7AA 1RC0A 4BV9A 1ZSYA 2AX3A 3P0RA 1QOQB 5TB5A 4AX4A 2ISQA 1ZNWA 4LBYA 4EUNA 3DZHA 2FUG1 3C5CA 1DV2A 3LQ2A 1JB1A 5DSXA 1FFCA 1HURA 2X40A 3A1CA 2DVMA 3HDHA 3R0VA 3K16A 4HX5A 3TR6A 1M74A 1GQQA 1DC3A 2UVPB 4MITA 1VIYA 3ZJYA 2WG2A 3PRJA 1OD6A 2DR3A 4GBMA 2AEJA 1MQAA 2J3JA 4Z7OB 3HVJA 3DUFB 2AG1A 3LT5A 1G20A 2JRCA 1BOOA 3ICVA 1O77A 3PC6A 1Z5UA 4IMRA 5JH7A 3HSKA 2Z8ZA 3OT1B 4L2IB 5E6RA 1PLKA 3ROTA 5LWQA 2X0IA 1CS4C 3GELA 1F17A 1KP9A 2V7QA 4UCXA 2B92A 1TD9A 2PS1A 3E2PA 1R6VA 1U0TA 1Q44A 3LT4A 3M4XA 4N7MA 4R2WA 5F3DA 5AXBA 2QRJA 5HF9A 3BBLA 3OLWA 4IAOA 5KKNB 2Y1WA 3BA1A 3BGVA 3MGBA 4IHAA 1E20A 4F60A 1G2PA 4R41A 2Z8XA 1SEPA 5JRJA 4GEGA 3M0EA 3IALA 5LBTA 5BURA 4I36A 3PEEA 3OLYA 1XXHA 2IGBA 3MIIA 3NHUA 3HYNA 3QLVA 1E5TA 1L5VA 5DCLA 1OCEA 2W58A 1SXJE 2NU9A 3BOSA 1W88A 4LI0A 3R5JA 3TZHA 4AKIA 2PO7A 3DA8A 3IA7A 4LF7B 4TT3A 4BBPA 2YUIA 4KMSA 2O8EA 1M7GA 1N2ZA 1T9ZA 3C8UA 3ECCA 2V74B 4Q05A 1SXJD 3AUUA 4DQUA 3F1LA 3TW8B 4DR2B 3HHPA 2HFJA 3B85A 2CNOA 5EQFA 2X6RA 1UDAA 4Z3KA 3U4AA 1VLMA 2BGGA 2JEZA 4OVKA 3M6LA 4A0HA 2NP6A 4CTMA 5EWJB 5AVJA 4BBJA 3TLCA 1OX4A 2VF5X 4YCSA 4FYMA 4M87A 4NR0A 4L57A 1TI7A 2IZ7A 1BXGB 2QAJA 5L3RA 3EA4A 4JNCA 1QZTA 2OHJA 2ZBUA 4MPJA 4EG4A 1Y8RA 2QS9A 3O31A 1Y7PA 1BC5A 5THQA 1AUOA 2ZDGA 3M3PA 2FKAA 3JRNA 3IAXA 5EE0A 1D2EA 4PM4A 2IPXA 2OB2A 2ZB7A 1QPBA 3C85A 4XOIA 2G7ZA 3N58A 4DRZA 3KXDA 2RFLA 3RG8A 4LQ4A 3E5MA 4I5DA 5HGJA 1ZR2A 1WPQA 2XA2A 3HE3A 3HJFA 2FR0A 3UFBA 3BGDA 3MB5A 3WHLA 3QEBZ 3SSNA 5DYGA 3GCDA 4K6CA 2JH8A 2ZRKA 1FPQA 2ZZMA 2IS2A 4Q7KA 5L7YA 1DAPA 2CVFA 1JLLA 3EGIA 4ZO4A 1TYBE 1WM1A 5SY6A 4UE2A 5C3UA 4LK2A 5JWRA 2DHDA 1N34B 3ZTWA 4XX0B 3FMPB 1MO2A 1NUSA 1OFVA 5FPKA 5LP1A 4EYEA 5B12A 4IFTA 2IYQA 1RWXA 3RWBA 3ZI0A 1ODJA 1J8QA 3TZQA 4HGYA 1E6LA 1K2VN 3H4VA 1BE8A 1NUAA 1VI5A 5ALZA 5ENDA 5IUJC 5IKXA 4DIDA 1DMRA 2ZJ5A 1ZH6A 4GT1A 2OHXA 1RLTA 1HUQA 3I1IA 2Q6LA 3QUSA 5EI5A 2W11A 1QYIA 5CBPB 3CZ5A 3JQQA 2XWPA 3W5IA 1MC5A 4ETMA 4NS1A 3UV7A 2R8RA 4YONB 1KEWA 1PR9A 4QBKA 4ML3A 3B2EA 3PIIA 1I3KA 3F6SA 2IOQA 2QYHA 1M2OB 2C2OA 1FCJA 4D81A 2V4UA 3ZDQA 1YFKA 1MAVA 4CTOA 3CC8A 1XG5A 3QLEA 4FNGA 4G0NA 1XL0A 4YLEA 4C6HA 3ROZA 2I99A 4E15A 3AL0C 1SCJA 3QXXA 1BFDA 2FDXA 2W6QA 2WTBA 4CR8A 4NDZA 3Q98A 3FHJA 2J6IA 4RZQA 1VYUA 2GOYA 4I55A 3EGVA 5FUVA 5JSKA 2Q2VA 3A9TA 3L2OB 3RRMA 2Q62A 5CUQA 3K71B 3OFSA 3T35A 3QKUA 2XT0A 1ETHA 1KGSA 3OCVA 4MHSA 3RLIA 3U39A 1QHFA 3UHFA 4IXTA 1R5NA 3HDVA 1TKRA 3WK6A 5CCEA 2C2GA 3ZD8A 4YV0A 3GUUA 4UFNA 3RIGA 2YVUA 4YK7A 3DDWA 3F98A 3SHOA 1C4KA 1DJNA 3HDTA 4BFTA 3BAZA 2EBUA 3LVQE 2ZUTA 5BQFA 1J49A 1C50A 2PUEA 2ZRNA 1A9OA 4Z8XA 5IZCA 4D9GA 2V8OA 3UJBA 2QUIA 2VT2A 2DOKA 4AKTA 1K9SA 1KC3A 3U44A 1RXVA 4AKHA 4R40A 2SCUB 1Z4KA 3ZCVA 1G8FA 4UDOA 4QVGA 5KNBH 1FIUA 1H65A 3P9PA 2VPZA 3BK7A 1C3XA 3RFUA 4LOKA 3BL6A 4P4NA 5ECDA 5AKGA 4KGVA 2NO7A 1ZQ1A 2I34A 2PUHA 1MOZA 4TV8B 4C0WA 4PLFA 3N86A 1G6OA 2YDXA 1TAGA 1W1UA 1TLLA 2G4LA 3QJGA 4GAEA 3MSCA 2OGTA 3ITKA 3K1ZA 4R3WA 5CB4A 4X7MA 2H17A 3WZMA 3OOJA 1M0SA 4A4DA 4QA9A 4GE0A 5EPUA 1R0ZA 1TMGE 2AKAB 4H3HB 3T3GA 3UMCA 3D6AA 3WB2A 1N0HA 1PGJA 2ZAOA 4I5IA 3FCCA 4RJ2A 2VL7A 5C52B 4Q4CA 4CL3A 1TJPB 2ZJYA 3UT0A 3O8BA 2YIJA 1KFEB 2YOGA 4BNXA 4JI2B 3MUNA 1XXHB 1D1PA 2TSYB 3GVXA 2RH4A 2H1LA 2JANA 1E1DA 4RA9B 1XVVA 4HNUA 2QTNA 4DIUA 3EPKA 4KL8S 3ORFA 4WLFA 1CIVA 5KQMA 2RHDA 1VJ5A 4Y6QA 4CKBA 4EM6A 3R7LA 3NYIA 2NYRA 3CZRA 1TEVA 4FOOA 4MRSA 3VJMA 3U3ZA 3VU9B 4R71A 1VP3A 2FTKE 3DW3X 5LUAA 4DEYA 4CKCB 1RC1A 3OECA 2BGUA 1GGVA 1FMFA 3ZJ4A 2V98A 1Q57A 1L4GA 4X1OA 3BMNA 2EOAA 3CZPA 1R0BA 5F2EA 1PFYA 4C43A 5GZ1A 1OC4A 3T61A 2FZGA 2IYVA 3IVMA 3VPHA 5A04A 4PZCA 1HWYA 4DTCA 1MTZA 5DASA 2G4CA 3GUYA 1I7DA 1KS9A 4WVFA 3Q15C 1C7FA 3KAQA 4X8OA 4MLZA 4GI1A 1RYBA 1E2GA 2VDKB 1NA5A 3KM0A 4YYEA 5L3QB 3OQ6A 2B94A 5DN9A 2X8LA 1OI3A 4MPPA 3KLNA 2PL1A 5ELXA 1N0WA 1UZNA 3NTXA 3ORSA 3T15A 4BRUA 4Z5XA 1PLJA 2XXAA 4CQLA 1RQLA 1MQSA 2ZYTX 5BV2P 4PEVA 3RVLA 3VHQA 1QIIA 1T0PA 3L07A 5IX8A 1O54A 2HJ9A 1OKKD 1QGOA 5G53C 3ZWPA 3UYKA 3DWIA 3LY9A 1FYEA 4DCJA 1UBGA 5HM6A 1JMYA 1HLFA 4EQZA 5L3SA 2UXCB 1SN7A 2IWHA 5AW9A 1KAMA 1PUXA 1GCOA 2VRWA 3UXYA 3REOA 1T1SA 3AKYA 3DJYA 2DUUA 4RETA 4D46A 2FJPA 4QDXA 5A9SB 4ENQA 4YUZA 5IBQA 4G8CA 4KFRA 4EG7A 2Y71A 1YBFA 3T95A 1HI9A 4Q3OA 4YV1A 4G3XA 3IOMA 5JNRA 4EHBA 3H5TA 2P9JA 3DG9A 4HX2A 2ZUVA 3WMEA 1M8GA 2C7OA 2JGAA 4AYXA 3ZE9A 2NU8B 3QX8A 6AT1A 2DWUA 3OE5A 2R68A 1RXEA 4LHVA 4Y9TA 2X5JO 1X42A 4Q9KA 4M1TA 4NBSA 4WA7A 3EXEA 1VKZA 3U4MA 3FBWA 3GA5A 3NBZC 4K40A 1YJQA 1SY7A 2OBMA 4P84A 2EJCA 2GPAA 3K30A 1HDEA 1N92A 4MJ7A 4IJMA 2VSOA 2ZXFA 3I8OA 4IEEA 4PQRA 2GF2A 1ABEA 3CONA 4H15A 4NZ9A 1KZ6A 3CXRA 5DU2A 3GR6A 5E7MA 4G4GA 5D87A 3HXKA 4N5MA 2C9DA 3CBQA 1ZCZA 1V47A 2AK3A 2UUOA 5JLAA 3CR3C 4X1IB 5DBHX 4ZI2A 2QN6A 3MQ4A 1SQGA 4JLSA 4KE7A 1AUPA 1GRNA 4J76A 2P0EA 5CX1A 4BWFB 3QMWA 4YMVA 3QFCA 1O9HA 1R0KA 3UJHA 3V8PA 2P67A 3DHVA 3BULA 4RVOA 3L7NA 3DTYA 4YJHA 2GCEA 1QLHA 2DTDA 1XCOA 3SIWA 4F4HA 3AOGA 2DUJA 1XTTA 1I6LA 1K3FA 1GEGA 2GYYA 2J4DA 3HVHA 1MC4A 4QC2A 1X19A 4FHEA 4C7VA 2V5AA 2OAEA 1CDOA 1WQ3A 4Y30A 1TK9A 1TM4E 3D4LA 1H2YA 3KK0A 4IF4A 2P78A 3RSHA 1GFZA 1NF9A 4M0FA 3AQIA 1Y1PA 2FZLA 3EPHA 3ELBA 2IKSA 4Q5IA 5JYCA 1MENA 2JCYA 3DDZX 4BFYA 5KYTA 3T3EA 2NZJA 4X64B 5I51A 3O94A 1FSFA 4JUFA 5A3QA 2N46A 1QJCA 4XD7D 5IT5A 2AHRA 3FJOA 5C7YA 1WCWA 3AEKB 4FBLA 4BUCA 2AC4A 4OXQA 2NUPB 2BISA 4EH1A 2ZCVA 1G6KA 1TPZA 1XZJA 4LJAA 5LQAA 4HDNA 1NQ5A 2B36A 3RRXA 4HXYA 4QO8A 3MZ0A 3QBVA 2JI4A 3JX9A 4HDMA 3RGWS 4EUHA 4D43A 5IJ9B 1L4KA 2OEPA 3C7KA 3HNPA 3V5NA 2XUGA 5G4KA 3S2SA 4DJJA 5HKOA 1H2HA 1SOWA 3WL7A 4LZJA 4UM9B 3CW9A 2G9UA 2C5EA 1TU0A 1FDOA 3KQWA 3C43A 3K9HA 4MVJE 3RQIA 4U3JA 4CLRA 1V5EA 4B76A 2W71A 3RS8A 1H1LA 5JHHB 1V95A 2VYFA 2QQFA 2AYZA 2AI2A 2QXYA 3E0QA 4QRHA 4JVLA 1KZ9A 2YIVX 2ZVPX 4KLRA 4ADSG 1O58A 3KQLA 5I45A 3LZDA 1EFUA 1ADJA 1KJ8A 2O8NA 4FR0A 2VDWA 4XQ9A 5K51A 3HGQA 4KQXA 1XTVA 4IV0A 1CDZA 1WDTA 1X7DA 2A3RA 3DO8A 3OHSX 4I6JA 1LJLA 1QP8A 2DF8A 2YJ4A 1TM3E 4D0LB 4BL5A 5AHKA 1E3WB 1ENZA 4QIHA 4OXNA 2BRUA 2P6PA 1GEEA 4IQGA 4WJKB 1P1FA 3PIDA 5IVIA 5KZMB 2HTEA 1CJVC 4OA5A 4OK6A 1VE5A 5CPBA 3A1UA 4MO9A 4NNOA 4KH0A 2VNHA 2ONKA 2CHVA 4CPDA 2H59A 1VIAA 3EC7A 2GEJA 3EK2A 4P54A 1AK1A 3QWAA 5MGNA 3L7DA 2DWOA 2IY7A 1KEZA 4E08A 1AQIA 1L5YA 1PV1A 4RQTA 4JOCA 3WIEA 5IEBA 4ZP1A 1S02A 1J97A 2VPQA 3KUXA 3FCUB 1WIWA 2C4HA 1E3MA 1NE7A 3RYCA 5J2UF 1UFKA 4PAWA 3F5DA 3EVAA 4IDOA 2VHJA 3BFKA 2VJMB 4YJ2F 5BSMA 4QGFA 5GP1A 1CPYA 1FTSA 3V6LA 3ELWA 3OEED 4HR7A 4TRJA 5L53A 2FW8A 2OCBA 2Y2UA 1GZHB 1XLWA 3K5HA 2BEJA 1BEZA 1RM4A 1BZYA 2X6TA 3CLUD 5EZYA 2PVSA 3IGFA 4LJKA 1L8QA 3W5HA 3VVLA 1LDMA 1QV6A 2LDXA 2ENUA 4NNJA 5LMUB 4Z86A 2QAGA 4FFDA 1E9FA 3V4PB 9LDTA 3EB9A 3DDNA 4PPFA 3AEQA 3I62A 5A62A 3OO1A 2W2NA 3GLSA 3BSSA 4QG7A 3ZGNA 4Q82A 4RD3A 4RPJA 4KPUB 1O1YA 3H3FA 4DCNA 4F1KA 4YRGA 5E3JA 4LC0A 3V42A 1LS6A 5K5EA 1OKKA 2GHIA 2NNWB 2WJJA 3LLCA 4YECA 5H9VA 3WYEA 2VF7A 2Z57A 3WLSA 3G1WA 2H5IA 3EDCA 1OSNA 4AZ3B 4CM6A 3QTBA 1PV2A 1R9NA 2VN8A 4YYZA 4FDAA 5BSEA 4C7OA 4PG5A 4JB0A 1UMDA 2RK6A 4ZO6A 1W2GA 1PJAA 3A6ZA 6REQA 5FF9A 1EXWA 2M1ZA 4ZQGA 2QLLA 3ZXIA 4XR4A 3UT6A 3V2HA 1MG0A 3N87A 3UAGA 2R751 3CNLA 1KQPA 3K0FB 1PZGA 3DMNA 3JQ8A 4JELA 2NVUB 3V46A 4JCOA 4ENPA 4D9CA</