3CONA

Crystal structure of the human nras gtpase bound with gdp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
156
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase NRas
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal structure of the human NRAS GTPase bound with GDP.
rcsb
total genus 56
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3conA00
3LV8A 5C4GB 3CUEF 5CLLA 5B30A 2FSGA 4BEBA 1KY2A 1AKEA 1F2TB 1GAJA 4ZO4A 2YWHA 4RY2A 3QG1A 3AKCA 1NJGA 3E1SA 4HSEA 3SN6A 3B13B 2REOA 4AIIA 3GFOA 4HZIA 2PH1A 4PZZA 3KKOA 4NCKA 2YWEA 4B73A 4B32A 1JR3E 1QVRA 4U00A 2BOVA 4TL6A 4UXHA 1IJEA 1QHIA 3AF3A 3T1QA 621PA 4FI3C 4XTRA 4JZKA 3D8BA 1E79D 2BM1A 4OQFA 3AKYA 1FUUA 2E87A 1KI6B 2F3RA 2GZAA 3LO5A 2N1BA 4FXPA 4M2LA 1G7TA 1YZTA 2R9VA 2WAXA 3L0OA 3QXJA 4KFSA 4D2IA 4GRAA 2CK3A 5IHPA 1QG4A 1RRGA 2P6UA 2JLXA 2NQ2C 4FWIB 2V4ZA 3QBVA 5JRZA 4A8JA 2CK3D 2NO1A 1IOZA 1G291 2WZQA 1WMSA 4NMMA 4HAZA 4M9XA 4A82A 1PLKA 3AF0A 1LW7A 2R8RA 4GPTA 2DCUA 5KNDA 3KB2A 1XXHA 1Z0JA 3SYNA 3KTAA 4Q1EA 1UBCA 3D6TB 2WWIA 4DIDA 4EUNA 2REXB 1E0AA 1IY1A 1E1QA 3AP3A 4A1FA 3THYA 3HR7A 2WMNB 2QI9C 4EJSA 3T06B 4RD3A 3CKLA 2Z5FA 3G82C 2IXGA 4G5GA 2QRNA 4M9QA 1N6NA 3ZD6A 1JPNA 3AKEA 1W1WA 4DLZA 2FSHA 2ZJ2A 4JKYA 2X77A 4RD2A 4JJKA 4V03A 1Z08A 3D31A 3DM9B 4RFVA 1Z63A 4WBSA 3U4QB 2V6IA 2BWJA 2JLZA 5B58C 1P2VA 2WBLC 3A8TA 1UM8A 3T35A 5EXTA 2LWIA 3BH7A 1EX7A 3KJIA 1G19A 4BE7B 3U4QA 1ZNZA 3H4MA 3L2OB 2HCJB 4TMVA 2A5DA 3AVTA 3AVVA 2YZ2A 4C0QC 4B43A 1II9A 2AWOA 4RD4A 3TUZC 4HATA 2C99A 2JJ8A 4LDJA 2R6CA 4E09A 2OCPA 3KKNA 3OE7A 4MKIA 1TQDA 2R6DA 1XPUA 4B2LA 2ORIA 3ZZUA 2C96A 4HUQA 2BMJA 2WV9A 2XX3A 3B78A 2Q9CA 2QROA 1NMXA 5J5CA 4DRZA 4G1UC 2C78A 4LWZA 4PC2A 1DAMA 4JKIA 2XNSA 1FQJA 4PC6A 5J4YA 4TLCA 1DAEA 3IHLA 2IWRA 3SR0A 2JIZA 1JQLB 1IN5A 3OEED 2ZR0A 4HEJA 3D3QA 4G5OA 2YVUA 1I4LD 4BWYA 2QAGB 1ZIPA 4Q00A 4Q7KA 1G8HA 3RS2A 1N0UA 3NXSA 4WXRA 4EPRA 1RZ3A 3K1JA 4BQSA 1GG2A 1NJFA 3AB3A 1CR4A 1GRQA 1GKIA 5FOXA 2QT0A 1OKKA 4HB0A 2FU5C 2QMOA 3RRMA 4C0KA 4KBGA 1DAFA 1Z6XA 1TL7C 4PZLA 3W5JA 3BB3A 1KDPA 2J45A 4IDPA 1VCOA 4GFDA 1MH1A 1NY6A 5HZKA 3L0SA 1Z22A 2F9MA 3OESA 1YZUA 2CHVA 4KODA 2J46A 4JLNA 3DMDA 4TL9A 1KSFX 3OEHA 4Y0VA 1GIAA 4AURA 1QHYA 3VHLB 2LCFA 1M7BA 2W6JD 3FFAA 1N5JA 1ZM2A 3QPUA 2QL6A 1VHTA 5JFGA 1P9NA 1UFQA 2DFKB 4Q9LA 1J8YF 3TUIC 5KYKA 5EP3A 1DO2A 1M8PA 4ZKEA 1PZNA 2V6JA 2ZS7A 1IY0A 3ICQB 2F1RA 5HCNA 1KI3A 5F98A 5JJLA 1IAQA 4EPVA 2W2XA 5JRJA 1II8A 3P4YA 5FTKA 1FUKA 2DY1A 4DKXA 4URVR 5K8UA 3DL0A 3OAAD 3GJ6A 3A1UA 1TUIA 1TTTA 1P9WA 2QTHA 1UF9A 2FFQA 2C9YA 2GBLC 3QOFA 4D6PA 4HB4A 1A82A 2JLYA 1YQTA 2HT1A 4DEXA 1ZD9A 2BKEA 5FOSA 4PQRA 5JS7A 2H5EA 4QRHA 3TH5A 1R8SA 2VQSA 2ZJ8A 1ZUHA 4ZKDA 4S2EA 4FMCB 2BJWA 4JL6A 3BXZA 4MYUA 1W36C 1C9KA 4IOJA 3FTQA 4KSBA 1KK3A 1LF0A 4A9AA 1GWNA 1EFTA 4DBLC 3ETLA 3N2EA 5EXXA 4V0ME 3OEEA 1AQYA 1RKBA 4XOIA 1T9HA 3L43A 1Z0KA 2WTUA 4RKEA 2FPLA 4A8JC 4IDNA 2P5TB 3GJXC 2GJAA 3ZS9A 4XTCS 1NMYA 5FUYA 2W0MA 4BZXA 2GETA 2FDCA 3IILA 2BM0A 3U3OA 4QBHA 2DWOA 5DI3B 4GNKA 2EU8A 5HE8A 4JMPA 2CLSA 1S3GA 4MRPA 2EWWA 2XAUA 2DWQA 1HURA 2IHBA 2VP4A 1GFIA 5CK4A 4LI0A 1ESMA 4MRRA 4PTLA 4XWOA 3ZDQA 2PZGA 1V43A 4Q02A 1E9CA 4EPXA 4C7OB 2BMDA 2G1KA 3SFZA 4DVGA 3V4RA 3PCRB 4S35A 1NN3A 3I62A 2Q3HA 5JSZB 2XZLA 2NO0A 4FCTA 3X1YA 3AVYA 1MABA 4XD7A 2ZQ5A 5JLJA 4U5XA 3A1SA 3GP8A 2ANBA 2BCJQ 1HYQA 1E9BA 3B6EA 3GJ5A 4HDOB 1XTKA 5CIWA 5AR1A 1N5IA 4QGFA 1CTQA 1TEXA 1UBGA 1NN1A 3VU9B 3KKPA 1Q1QA 4JYBA 1SVLA 1F5NA 1U8YA 2PL3A 4X8LA 3SU8A 3H86A 3PV0A 1GVNB 2GXUA 3THYB 3EC1A 3LVRE 5FL7D 2WWHA 4POAA 2AFHE 2B7BA 3B2EA 3CRW1 4LBZA 3EZ2A 5EUQB 1Z8FA 5KU1A 4TMWA 1ZM3A 1U9IA 2ZR7A 1IQPA 3NBYC 4A0HA 1QDEA 3H1TA 2F1HA 4URWR 2QNRA 3GMTA 5FBQB 1AJEA 2F3TA 3RYTC 1JEEA 3QEJA 1NVXQ 1DE0A 4KLNA 2QGNA 2O8DB 1M7HA 1KAGA 2IYVA 1YRAA 3BFKA 5FFMA 3KZ1E 4GZMA 1I2DA 2IXEA 2EYUA 5J47A 1WBBA 2XZPA 3Q7PA 2BBWA 2F55A 1CXZA 1FMLA 2WVJA 3UXMA 4JVMA 3MWKA 4K46A 4PZYA 4NCJA 4AYWA 1VHLA 1P61B 2F43A 4ILEA 4L5BA 5BN4A 2YC2C 4JL5A 5BN3A 2RGNC 4OJKA 3BH6A 1KZGB 3PEVA 3U7GA 2ZRCA 4U02A 2ZJOA 1GKYA 3I1FA 3TK1A 1KMHA 1P4SA 4JLBA 4M0LA 3RVBA 4KITB 1TNDA 1W4RA 5J4HA 1I4TD 2QQEA 2V1XA 1UJ2A 5AJWA 5GJWC 5FTNA 1E94E 4D4KA 1Q1EA 4A0GA 2ZRJA 5JSZA 4V0MA 1RYHA 3PENA 1NLFA 5F9FA 1CR2A 2VH5R 4IVQA 4GT1A 1AGPA 1XCPA 4ON9A 3QQ5A 3NEYA 3FOZA 2WAYA 1GRNA 1TF2A 5DISB 1VYVA 4BFWA 1GL6A 1I4DD 3A4LA 221PA 4GI7A 2RHDA 5BXQC 4ERNA 1XPRA 3MGCA 1Q20A 1E2DA 2ZUCA 3C14C 3T34A 421PA 4YXWA 1F2UA 5EE9A 2QP9X 5LD2B 2PCJA 1RPZA 3LLMA 4AY2A 1G4UR 2DHRA 2GF0A 3K09C 5CB8A 2RB4A 2JJ2D 3LQQA 5JWRA 3Q8XB 4DUGD 2ZYWX 1XCMA 5FL7A 5SZKB 4PQFA 4LGMA 2AN9A 5KPJA 3VKGA 3FGNA 2QSZA 3A1VA 4M1MA 4WA7A 4G01B 4JLJA 2J3EA 1XNJA 4DCTA 3MD0A 1OIXA 3QXCA 4NCHA 2ZETA 3PUYA 2YYZA 1IN8A 3ZQ6A 3TVDA 4B6EA 3U60B 4PHGA 3M1IA 2ZPTX 4O2LA 5L3QA 4NYMQ 2V1UA 4LYFA 4K81B 5DN6D 4OK3A 1QHGA 1E2HA 3UMRA 5H70A 1QVAA 2BC9A 4YMTA 2QGZA 1UBFA 2KBFA 4LK2A 2ZRFA 3IEVA 3L82B 2VSOA 1COWA 2F7SA 4OHWA 4A0RA 3P26A 2QG6A 2CE2X 2G88A 3LFUA 1H8HA 1VCIA 1Q1ZA 1E2GA 3THOA 3ZYCA 2UZIR 3WRXC 2QPAA 3WNCA 4DDUA 4Q9JA 3U6BA 1MT0A 4DSUA 4DUGA 2ZE7A 5DYGA 3KQKA 4NDZA 4KO8A 3IGFA 1G9XA 1DEKA 2PLFA 2FGKA 3HPRA 1EXMA 4TQ9A 3RS7A 4ZI3A 4LJAA 3BWDD 2AL7A 5F9HA 3P27A 3TR0A 2V54A 4LCBA 3LAWA 4NE2A 2XEXA 1W46A 1E2EA 1S1MA 5FTJA 1CIPA 1JQJC 2IW3A 4H1VA 3REFA 1T8TA 1EGAA 2QY9A 5HTKA 1G3RA 3WBJA 2P65A 1HQYE 4NHOA 2JLSA 2ZRPA 3SNHA 4CEJA 1F2UB 4OK5A 1E0KA 3K9HA 3QXXA 2B21A 3MWYW 2O8CB 1XMIA 3AVOA 2W83A 3LNCA 4BASA 1CJKC 2GF9A 4Q4HB 3FMFA 1KK1A 3CIOA 4Q7JB 1AA9A 4LJ8A 4HLDA 1UKYA 3LRPA 2NPIA 1UEIA 2VLIA 1G5RA 4IDQA 3TJZA 1AM4D 2BMEA 4I81A 1G3MA 1XU4A 2O0KA 4PR0A 2FF7A 5DYIA 2NTYC 3Q5EA 1R0WA 2QT1A 1KTVA 2C5LA 3FYHA 2FPKA 3TMKA 2P67A 4GZLA 5DIFA 5FI0B 4AYXA 4HB3A 1KJYA 4AKGA 2P2LA 2BV3A 2SHKA 4I4LA 4HAVA 2WOOA 4WIAA 4OHZA 5DNYB 1CJTC 3CX7A 4N1AA 2PLRA 3U6KA 2CVHA 2GCNA 1TADA 1EX6A 2C77A 2HJGA 4LYJA 2NO7A 2ORVA 1P3JA 2WJGA 2AKAB 3WMFA 4MRSA 3A6PC 3ZIAA 4MITA 2ZS9A 2GZDA 3DEFA 3DPUA 3U61B 1IXSB 2AR7A 5L3RA 3O47A 3GJ4A 1E9EA 1R5NA 5BWMA 1OIWA 1ZU5A 4Z54A 821PA 1YZLA 4EPTA 5IF9A 1IHUA 3CRRA 1QG2A 1J2JA 1MR3F 2ZU6A 4P3YA 1E1RD 2WMOB 4B33A 3AF2A 4L16A 2VYFA 5E7JA 5JBQA 4EFNA 3IUYA 4V0OA 5FTMA 3P1JA 1YZGA 4TQAA 4E07A 3IIJA 4EPWA 2GK7A 2ZIAA 4JLVA 1WRBA 5ANRB 5FBLB 3CF6R 4OHYA 4JL8A 3ZH9B 5J4LA 5JECA 3TSOA 3DKPA 2V8OA 1KO7A 1VYTA 2D3WA 4QM6A 1GM5A 3CRMA 5TB5A 1U8ZA 2W6ID 4WXPA 2JLUA 1P60A 3SC3A 1JNYA 2GNOA 2XB4A 3ZVLA 2QU8A 1FOEB 1W36B 3VNVA 4B6FA 2C9CA 2Q9AA 1D2MA 2XNDA 3GLHB 2X19A 1S2MA 2AD5A 1WA5A 4ZPXA 2EFGA 1DG1G 4TT3A 2NO9A 5IRCD 2CHQA 2WPDA 2YC4C 2GCOB 2ZROA 1E2LA 1FP7A 5FBWB 4CGZA 1E4YA 1GNQA 4F4CA 4BFVA 3SHFA 2WOJA 2R44A 4W5JA 2OSBA 4L9WA 5CM9C 2ODWA 3MJHA 1XBTA 4PC7A 3DVLA 3QKSB 2OCAA 5BYJA 1D8TA 2CL6X 4BLRA 4DXAA 1HT2E 4ACBA 5E3HA 4UNQA 4N0EA 1NSTA 1RYFA 2IYSA 4QGGA 5C2JB 4OBEA 1Z2AA 2V7QA 1OXVA 4IW3B 2AKYA 2IHYA 2IS4A 4ZIRA 5LPNA 1LB1B 2RGEA 2ZSDA 1D5CA 1U0HC 3D7MA 3QPWA 3WNBA 1EFHA 3CZPA 2OFOA 1F6BA 4Q01A 4QGAA 3TUJC 1PUJA 2HF9A 2F1IA 4XD7D 3WYAA 1WDTA 4BLOA 4ZIRB 5IT5A 2QBYA 1NBMA 1RFLA 2HLDD 2G83A 4GOKA 4YMWA 5TY0A 3UMSA 4CYMA 1ETUA 2FOLA 1T0JB 1F48A 1NN0A 1FNMA 2QM8A 5HCIA 4DT1B 4PPQA 3KXKA 3AM1A 3GFTA 4PX9A 4HLQB 2P5SA 4KFUA 3HYTA 1R4AA 4HZUA 3WYGA 3A1WA 5CK5A 1P5ZB 4XSHA 5BW8A 1KI8A 4QBFA 3HU1A 2CJWB 4IVPA 1E69A 4DIEA 4YQFA 3IBYA 5TMPA 1OB2A 4RZ3A 3CR7A 3DM5A 1YZKA 3I73A 3R9IA 3ADBA 1IONA 1GL9B 4PAMA 3VTKA 4CEHB 4ASUD 5FUWA 2TMKA 3SZRA 4M9ZA 4FWTA 4LJYA 1M2OB 4W7SA 3IO5A 2VTKA 4UNRA 4QFMA 1O3YA 2ZRLA 2WWXA 1CP2A 3AP1A 3BFVA 1G3UA 3HR8A 4LYAA 5HZHA 5KSZA 1SVKA 2R2AA 4MRNA 3HU3A 4BFZA 1K6MA 1M7GA 5BN5A 4R2HA 5FPTA 4EPYA 3OF5A 1AS2A 5E7MA 1CRPA 3PJRA 2WWYA 5CIQA 3B60A 1QRAA 4E22A 3VR2A 2IF0A 1A2BA 1A1VA 1G17A 2ZI5A 1OW3B 2CCGA 3CR8A 3GLHE 4A92A 4D4MA 1M6NA 5KDOA 2XJ9A 4B35A 3EPKA 2CE7A 2O8FA 4Q9IA 1OFUX 1XFAA 5CYOA 4MRVA 1G8YA 3K9LA 5FUXA 2NZ8A 1VIAA 1Z6TA 5LBIA 4B3DA 2NIPA 4IDHA 4RCZA 5FPSA 3GJ3A 3THWA 1SKYE 3EZ6A 1ZU4A 3T5GA 4WZAE 2KB0A 4L9SA 3VQTA 4CT4B 2B6HA 1CR0A 2Z6VA 2FFHA 2F9LA 4DEYA 1UAAA 2XXAB 3KXLA 2IYRA 1FP6A 5EXSA 2PBRA 1KI2A 1RRPA 5L8VA 1KNXA 1DAHA 1JR3A 4RVCA 4FCWA 1ZUNB 2XGJA 3O8DA 4KFRA 4M1TA 1J7KA 5SZIA 3E5HA 2P6NA 4F38A 3T61A 3JZAA 3W8RA 1DTSA 2J0UA 1KMQA 1HTWA 2ZYVX 2JJ1A 4KCGA 4NCNA 4ZCIA 3G5UA 2ZVQX 4PSVA 2GXQA 3AVPA 4RJLA 4Q4AB 3W6PA 3ZVMA 3FFBA 3B1YA 4YDSA 4MGZR 1YJ5A 4P4SA 3RSOA 5DI9A 3Q9LA 4PSAA 5BQ5A 1KI9A 1UDWA 2A5GA 3K0FB 1X1RA 4BPBA 1R2QA 3R8FA 2YWGA 2GWHA 1Q3TA 2NG1A 1VCMA 3TVTA 3GLGE 1II8B 4F4IA 2GAAA 2ODEA 2J87A 2JAQA 2ERXA 2ZITA 4IOLA 2Z43A 1P7CA 1SVSA 4AKEA 4G3XA 2FV8A 5KO2A 1Y63A 3BB1A 1ESNA 3W8NA 1FZQA 1GOTA 5SZJA 1HA3A 1S96A 1ANKA 3KJHA 4LHVA 1XTQA 5FOWA 2GVDC 4BGDA 3SI7A 5EE1A 3TBKA 3EG5A 4UNSA 2OXRA 2BCGY 1NN5A 1YU9A 2D7DA 4A36A 1SXJD 3UANA 3MG9A 3U5ZB 3U2QA 2EWVA 4LHXA 4ACAA 4HAXA 4TL8A 2GK6A 1OFIA 1Z28A 4QKQA 1XXHB 1NG1A 5ELXA 4TZ0A 1KO1A 5CDFE 1E1QD 1W2GA 4MDFA 1TPZA 4GDFA 2ZS8A 2GDJA 2FSIA 2XJ4A 3IDQA 2YOFA 1ZNWA 3DHWC 2WM9B 4LV5B 4AG5A 2FWRA 4HDCA 5JEEA 1J99A 1G18A 2VL7A 4Q1AA 4M1WA 2D62A 2KE5A 1J90A 1XDBA 2GEDA 3VR4A 2ANCA 1IJFA 1XJCA 2QAJA 2VEDA 4OI1A 3EX7C 1E32A 1Q22A 1N3BA 1BIFA 3WHLA 4DLSA 3DO6A 3AP2A 4MUAA 1S9HA 4TYPA 2J0UB 3GEHA 4B44A 1OH5A 2PX3A 5FOTA 2PMDA 4M53A 1MO6A 1US8B 2OFWA 2H18A 1CRQA 2WWFA 2UKDA 3K0CA 1E9AA 3LW7A 4HYYA 5A4JA 4FIDA 2X8AA 2XB2A 1IN7A 3RRYA 4U7DA 4DDTA 4MKGA 3R9WA 3IIKA 2OO7A 2CL0X 2JLQA 2RHMA 2ZRIA 3HYRA 1DVRA 3FDIA 4XWAA 2HUPA 2O8BB 1E2KA 4DDVA 4M1SA 1D2EA 1KSJA 4F93B 1G41A 1G6HA 1YR6A 3A58B 2HJVA 3NBZC 3CH5A 4Z8YA 4QJ3A 4TYYA 4TWZA 1LY1A 5DE3A 1E0JA 4C7OA 1RRFA 1UEJA 3GLFB 2JGNA 2FMXA 3TE6A 1R10A 4A2QA 4BEJA 5FPKA 1UPTA 4O2RA 4Q7LA 1AZTA 2N46A 4F91B 3U44A 5EZ5A 4I1SA 4FMCF 5TXGA 3GJ8A 2MSEB 3PEUA 2QM7A 1KJZA 3I4LA 4Q4JA 2XSZA 3NG1A 5JI3E 2IYUA 3GEIA 3CNOA 1RJ9B 4CZ2A 4Q4LA 1TUEA 1SXJA 3NTUA 1GSIA 3L0IB 3LBHA 2EW1A 1XD9A 4DJTA 1WB9A 3RC3A 3VFDA 3VX4A 1SVOA 4EQ6A 3AEZA 4FD2A 4NYMR 4B3BA 1H65A 3REGA 3MFYA 2DWPA 2JATA 2OXCA 1NVVQ 2ONKA 1AIPA 3QF7A 3GJ7A 1P2SA 4A6XA 2A5JA 2DB3A 1CR1A 3R20A 4JLAA 2PZFA 3P4XA 1W0KA 2KJQA 2OM2A 3DMNA 3EZFA 3QUSA 4LPKA 3PQCA 4HUTA 1WCV1 1XZPA 3IQWA 4MQBA 2C8VA 1CS4C 3O8BA 2QMUA 3UG7A 4D80A 1R6BX 4RZUA 4HI0E 4FINA 4M22A 4JT4A 2IYTA 1Q1BA 4G5SA 1PLLA 1EFRA 4OK6A 1XD8A 1AKYA 3QXSA 1N0WA 1NVVR 4PC3A 3BD9A 1NL3A 4DSOA 2GJ9A 1C1YA 3LBIA 4G5RA 4Z1MD 3DOEA 3V00A 2KWIA 1JAIA 4QBIA 4FMDF 2WKQA 1RC8A 3EW9A 4HUQB 4Z1MA 4ABYA 1RRCA 1VIYA 4YMUA 4HLUC 3GPLA 4MA4A 1L4YA 3MLEA 4IOMA 1QHHB 3WNDA 1JECA 1LNZA 1XB2A 5H68A 3T1VA 5CJ2A 1G3IA 3WBKA 1IXZA 1JR3D 2FGJA 4PC1A 1KI4A 4ZDKA 4A6PA 4XIGS 2A3RA 1GUAA 3RS4A 2EYQA 3TIFA 3CW2A 3KXIA 5EQTA 4D26A 2ASEA 4V0LA 4QNMA 2J7PD 3GCGA 4URUR 5CB6A 4B71A 5H8WA 3VAAA 2BVNA 1KNQA 2AK3A 2UZ3A 4Q66C 1A5TA 2D2EA 2GRJA 1AK2A 3EPLA 1X1SA 5UKDA 1CLUA 3BB4A 3ADCA 2H92A 1OHHD 2JJ1D 5KSPA 1TEVA 3BS4A 2X2EA 3ZZ0A 2IEZA 4C9BA 2HV8A 1MKYA 2MSDB 1MOZA 1SKQA 4QHSA 2PX0A 1N6IA 1TQ6A 3PFIA 4XSGA 1XEFA 2WJJA 3ECCA 3EWAA 1E2NA 4PXAA 5AJZA 1T4GA 3BK7A 1TMKA 4QG7A 2WWGA 4DSTA 3LBNA 3HP1A 4B47A 4ZI2A 2QAGC 1KMHB 1B23P 1CF4A 2CCKA 2ZI6A 2IYQA 2J9RA 1G21E 4TLBA 1OPXA 3CONA 1VDZA 3QNUA 5K8IA 2O0JA 3EWSA 4HAUA 2AWNA 1KDOA 3CLVA 3NHBA 1DADA 2AFIE 3KX2A 4DSNA 2Q6TA 4LPSA 5KDLA 1G6OA 2FH5B 4ARZA 5HR5A 5SZHB 3CBQA 3MWLA 3J81k 3AGPA 2Z4RA 2IL1A 1FX0B 3QY0A 2Q3MA 1KO4A 1D9ZA 1TQ4A 4NZYA 3N2IA 4L15A 1KGDA 3KFVA 4RZ2A 5DO9A 1M1YE 1ZM7A 2G0TA 3ZQJA 2YOHA 3EIHA 3MUFA 1OSNA 3L8ZA 2CXXA 4MKFA 1OXXK 1YE8A 4TLDA 2QMEA 1IXRC 1S8FA 4LX0A 1P75A 1DPFA 1NVWQ 3QI2A 3EA0A 3LVQE 3B1ZA 3BFXA 5TV2A 3QPVA 5IK2D 4P0TA 3NBFA 1NVUQ 3SDZA 4PO1A 4IVRA 3KKMA 1GITA 2OZEA 2YINC 4BLQA 2IYZA 2G1JA 3KB1A 3CX6A 1E96A 2YV5A 4OHVA 4OL0A 4MUBA 2UVQA 4FCVA 2FE4A 2FFBA 1MRSA 4JSTA 4Q19A 4IRUB 3CM0A 1N6LA 2A7QA 3SQXA 2GXSA 1FTNA 1S0UA 2ZREA 3CF2A 6Q21A 5TARA 4P31A 2GILA 2R6AA 1CEEA 5E95A 2VP5A 1Z6GA 1LV7A 3ZGXA 1E6CA 1NMZA 4HAYA 4W9MC 1MABB 4KI0A 4EFLA 3OAAA 2VF8A 2QORA 2QZ4A 2JDIA 1EFCA 1FFHA 2AK2A 3LH5A 4Q1FA 2D7CA 2RGDA 4KYUA 5FPYA 2PMKA 1ELOA 4BFTA 3M4YA 4QBGB 1YRBA 2JDID 1MRNA 2I1VB 5KTYA 1KZ7B 3KTAB 1OH8A 2HEIA 1SVMA 2ZRHA 5B57C 1W4BA 2P3SA 2WJIA 3Q5DA 2NPFA 4C3ZA 4FMDB 3ADDA 3W5IA 4DCVA 1KHTA 2GEVA 1W0JD 2ZVPX 5KSYA 3CRQA 4Q7MB 2BIFA 1XRJA 1OYYA 4URYR 1R5OA 1OXTA 1W0JA 3B7GA 4RKFA 2IEYA 1AQUA 3GFPA 1OJLA 3HJNA 2AXNA 3PIRA 4B74A 1T3HA 3I72A 1FX0A 1HEIA 1QHSA 4W5HA 1ZYUA 2D74A 2RKOA 4CT5A 4DCSA 4ZV4A 2GJKA 2DFLA 3RWOA 1SULA 4Q18A 3AVWA 3AUYA 3FPAA 1G16A 3CNNA 2F1JA 2IYLD 3X2SA 2JASA 5JJIA 2OFXA 3TSZA 1BO6A 3U7HB 2VP9A 3CWQA 4MGKR 4C4PA 4JLOA 2GAOA 4LJ6A 3DDCA 4XH9B 4JBWA 2GJ8A 1Z0DA 3QENA 3BC1A 2IC5A 4LY6A 2IWHA 5GJBA 1SXJE 3DZ8A 1N6HA 3OIWA 2XITA 5BYKA 1N6PA 4TYNA 3RSLA 1TF5A 1DELA 2WJYA 1E9SA 2IUTA 2GCOA 1KJWA 1DOAA 2RGGA 3U7FB 1HV8A 1U0LA 2VHJA 4O0MA 4QHTA 2WWWA 4Z8XA 3UKDA 4C0JA 3QKSA 3VX3A 4I1VA 3NBXX 4C0SA 1XTSA 5G40A 3EPJA 1P2UA 1Z47A 1GRRA 2ZRNA 3W6OA 1EG7A 4XVUA 4X8HA 3HU2A 3NDBB 1T91A 2GESA 3QVVA 2GXAA 3NIBA 3WRYC 1OYWA 3PVSA 1WBDA 2ZAOA 2HYIC 3UMFA 4B3XA 1KKLA 4PO9A 3B5JA 1OFHA 4QJ4A 4TLEA 3KKQA 1VYUA 3MMPA 3ZIAD 3PEYA 3SHWA 4M1KA 2MMCA 1E2FA 4YDHB 4C30A 1JJ7A 1DARA 1SHZA 2ATXA 1IBRA 2E9SA 2J7PA 2WJVA 5DLQC 2W0SA 4PHTA 2HDNB 1GTVA 3U3MA 2QBYB 3RLFA 3U3KA 2C03A 5AWFC 3SJZA 4CEIB 3TSWA 1SXJC 4LHWA 3RRZA 4AD8A 4JT2A 1OH6A 1LF5A 3AVQA 4EJSC 1CKEA 3IBGA 3P20A 4IXMA 3AF1A 2YWFA 1QHNA 1US8A 3CB4A 1VPLA 2YJTD 3GQBA 3OIUA 1AS3A 1X6VA 4IJMA 1RIFA 5K8LA 2GJSA 3FVQA 4BUJA 1N25A 1BMFD 1CULC 2REBA 3AUXA 1Q21A 3MSXA 2EFEB 2NOAA 4BLPA 1T6NA 3FHCB 2OCYC 5KSOA 2ZAMA 5G3ZA 3VNUA 3FMIA 2WPDD 1E2JA 1N5LA 4DB4A 4GL2A 1ZNXA 2OEPA 4QHYA 2P6RA 1LS6A 1W0KD 4P4UA 3S1AA 3TW8B 1Z5ZA 1R5BA 4TT3D 5FR1A 5JI2E 5JWHA 1S9DA 1SQ5A 1NF3A 1ZJ6A 3NEJA 3EAQA 4DLVA 3PR1A 4QOSA 2IX3A 1ZP6A 5JHGB 1E2MA 3OFNA 5KNBA 5FUVA 1Q3HA 1VTKA 2QN6A 2WKPA 4LYHA 4PANA 3VR3A 4YMVA 3NKVA 1NIPA 4JLKA 4G5QA 2BBTA 3CPJB 1MO3A 4GOXA 5C1BA 1JJVA 1XMSA 2BBOA 2V7QD 1OV4A 3THWB 2ZE6A 3ND8A 4ESVA 5EP2A 2C9OA 4BZPA 1NNEA 1EESA 3ZJYA 2CHGA 2OAP1 4AI6A 1ZW6A 5D3MA 1G8FA 4L4UA 4KVAA 4PHFA 2QUZA 1GKUB 2J0VA 4XVRA 3RRNA 1XJ0A 1DAKA 4JVLA 4KSCA 3UIEA 2Q3FA 2RGCA 4RFSA 4GP6A 1E4VA 3ND9A 1VECA 2QQ0A 4DLWA 1J8MF 3B1XA 3LX8A 1FTSA 3AKDA 2ZE5A 1C4OA 4OQXA 3X1XA 1R7RA 3VKHA 1XMVA 1W49A 1PV4A 4KVGA 2JLRA 2FX3A 2A2ZA 4BZQA 1TF7A 2CNWD 3F5FA 3KL4A 2XNDD 3C8UA 3N5CA 4WVFA 2OUKA 4GOJA 2G0NA 2RGNA 2VP6A 3PUVA 2O8EA 1N2CE 3Q7QA 1L4UA 1KY3A 1ZMXA 1OHHA 2CEAA 4V02A 1V5WA 4NH0A 3I5YA 2ORWA 4TLAA 5EZ6B 3WMGA 4YC7A 2XTNA 3OHMA 3FKSA 3L0PA 3S1AB 1KK0A 1Q0UA 1SVIA 2PCLA 3E70C 1YZQA 3ZLJA 1E99A 4BFUA 3KDSE 3OE7D 1E9DA 1I2MA 1R0YA 1NY5A 2ZSEA 2JLWA 4JVSB 2BMFA 4LHZA 3MCAA 3GLIB 2IS1A 2ONJA 2NO6A 2NZJA 4GSYA 3GJ0A 1VMAA 2IUUA 3B8HA 1W4AA 5H1YA 1Z0IA 4UQOA 2RGBA 4JLMA 2V3CC 3ONWA 4JBXA 2CL7X 3FKQA 4NBSA 2QAGA 3WXMA 4L8GA 3AVUA 1T5LA 5JWOA 3BGWA 3CRVA 4KBFA 3KUDA 4OQNA 4D0NA 3R8CA 5C18A 4NYJR 2RCNA 2FJUA 3ASYA 4D82A 3BH0A 4CRWB 2XZOA 4EQ6B 4I99A 2VSXA 4A15A 3Q3JB 4EFMA 2FEOA 4BLTA 5P21A 2QPTA 2WIAA 521PA 1DAGA 4MKHA 2O0HA 1XD2B 2VHQA 3EIEA 5AJXA 1XTIA 1ZBDA 2G77B 2OT3B 2VHCA 3AGQA 3RABA 4TTPA 1U90A 1MV5A 4BRWA 1RE0A 3EA5A 3CWZA 4IKEA 4CEHA 3CZQA 3GD7A 2DR3A 5AJYA 4D25A 5HKKD 1FL9A 3OIVA 4LV8B 1AGRA 4FN5A 1T8UA 4O3MA 3T15A 4EAQA 2Q9BA 3T12A 2ZI4A 2IXFA 3BJIC 3Q72A 4UXIA 5LDDC 2VRWA 3GLHA 4NU0A 4PAQA 5CLQA 1L8QA 5LB2A 2JLVA 2HCBA 1LFDB 4NYIR 3CX8A 5D3QA 3RHFA 4DLYA 4NKRA 3UPUA 5B64A 5DN6A 5CDFA 1G5TA 4LJ7A 3TW4A 2GVZC 1XXHE 4N3NA 1SZPA 4B2PA 1E79A 3W9YA 4UJ3A 1IN6A 3FMPB 4X8OA 4BRUA 1OF1A 1LVGA 5A5GA 1QHHA 1U8AA 5D3MB 2K5UA 1D2NA 1XX6A 2HXYA 2VP2A 5B2ZA 2Z0MA 4OHXA 1G8PA 3V9PA 1N0VC 2A5YB 3A37A 2ZYTX 3KUCA 3VKWA 4DLXA 2OESA 3UK6A 2IS2A 4PFSA 3RS3A 4D0GA 2RGAA 1FMJA 2J7KA 3QIAA 5AJVB 4P4TA 3ADKA 4H9GA 2ZTSA 3BIFA 2R6GA 2FFAA 1XEXA 1P2TA 2O5VA 4KJZA 5GJVC 4R98A 3MJRA 1NSFA 1NLZA 2VA8A 1NKTA 1SGWA 1OXUA 1XZQA 1NP6A 4M1YA 1XEXB 5J4VA 4HZUB 4B3CA 1W44A 2DBYA 1Z06A 2HYDA 4RD0A 1HY3A 2IYYA 1Z2CA 4AG6A 2BEJA 1N6OA 3LXXA 1VKJA 5EXPA 3GLFE 3TRFA 1G7RA 3C16C 3CNLA 3SBEA 3B9QA 5IK2A 1BKDR 1AS0A 2CNWA 1FQKA 2R62A 5EE0A 4QNRA 1DBSA 4EDHA 3SJCA 1ONBA 3PUWA 1E2PA 2GEUA 1DAIA 4P33A 3K8YA 1O87A 1P6XA 2ECKA 1Q44A 1CJVC 4NPHA 5G53C 4CW7A 5E7IA 2QP3A 3RDPA 3JVVA 1ZD8A 2W6IA 4N0DA 2IF2A 3K53A 3RANA 3AQ4A 4LC0A 3V4FA 1K5GA 1UKZA 2VPPA 2KI5A 3DZDA 3SFVA 2DYKA 2I4IA 3KFXA 2PJZA 3GLFA 4PAOA 5FOUA 4ZCLA 2VP0A 4QXAA 4NYJQ 1GDDA 1NI3A 2O52A 4NCIA 4A2PA 2BDTA 3NH9A 2FPMA 5GJCA 1P9RA 4MGYR 2ATVA 2ZJYA 4CIDA 4PPNA 1AZSC 1JAHA 1VG0B 3BBPA 3SJBA 1XCGB 3IKJA 2ZSAA 4YXWD 2JJ2A 3GLGA 1S4QA 4OI2A 4UXJA 4M4SA 4TMTA 4D4LA 3ZVNA 1XEWY 2X2FA 1RW4A 2VSFA 2C2HA 2IUSA 3E2IA 5L3SB 3KQHA 3G0HA 2LKCA 3X1ZA 3LX5A 2CVFA 4ZDWA 5JS8A 2XXAA 2QE7D 4Q21A 2FSFA 1OFTA 3KJGA 3H0KA 1JXOA 4NYIQ 2N42A 2GZHA 4E5UA 2F43B 1W36D 1A2KC 4KAXA 4CEIA 3K70B 2A9KA 5G3YA 3NDPA 4M8NE 3QEOA 4J0QA 1H8EA 2OBLA 4PPGA 1ZD1A 2I1QA 4II7A 4V0NA 1KAOA 3OFND 5TVKA 1YR7A 3W6NA 1KK2A 1G20E 1OT3A 3EZ9A 1Q57A 5GVRA 1W2HA 3W34A 3B9PA 2CLCX 3U3JA 5J4KA 1UKVY 3A4NA 3EARA 3WHKA 2ZM5A 1Z29A 3OIYA 1U2RA 1U99A 2ZRGA 2OBMA 3IO3A 4LJ5A 3K70C 4V0KA 3FMOB 3I32A 4JBYA 1KO5A 4PQYA 4ITRC 4Q1CA 1SVWA 5A0FA 3UG6A 4LJ4A 2CMKA 1E9RA 4GMXA 4LZZA 5G41A 4JLDA 3EC2A 2V9PA 3VR1A 3H84A 1PVOA 4JSYA 2O8BA 2GHIA 2VF7A 1LS1A 5CYPA 4CF7A 2ZRAA 2H8KA 3DOFA 3WMEA 4XJXA 2WICA 5KHOC 2E1RA 2EFCB 1E98A 1HUQA 1ZCAA 2BEKA 3QKRA 2ZJAA 4ARZB 2B7CA 2MMGA 4Q1BA 4QM7A 2JEOA 3QF4A 4WW0A 3KQLA 2WJHA 1ZCBA 2HF8A 1N6KA 1XD2A 3CH4B 2Z4SA 4GP7A 3CO5A 1NBMD 2HLDA 1L2TA 2PT5A 5FR2A 2J0QA 5FBRB 1FPMA 4D0LB 5KUTA 2ZJ5A 1DS6A 3LQRA 3X1DA 1P72A 4KXFB 4Q4HA 5DGXA 2W58A 2Z83A 2AD1A 3QKUA 1MO5A 1OXSC 3ASZA 3SYKA 4B76A 2O8CA 4HB2A 1BS1A 4LOAA 1P73A 1W5SA 2PT7A 4DDWA 3L8YA 2ZI7A 3O8RA 3M6AA 1VG8A 3NWJA 4IFEA 1Z07A 4IHQA 2QSYA 2D2FA 2D06A 2WKRA 4LC1A 1T3SA 1WF3A 2A78A 2WIBA 3TAUA 1ZIOA 5K8TA 4OJQA 4IXNA 2CDNA 2QPOA 1YR9A 3GLIA 2ZUDA 3TNFA 1QBKC 3HDTA 5AUOB 4JYCA 2VHUA 2GA8A 2H57A 1MO4A 2OAQ1 4TN1A 4UJ5A 2D4HA 4WZBE 1NIJA 4YMSA 3I5XA 1G5PA 2KSQA 2QMHA 4C2TA 1M74A 2IS6A 4BECA 1K5DA 4DB2A 3JZMA 2H16A 2G9NA 2B8WA 1Z3IX 1SKYB 4TTQA 3RWMB 3LW8A 2AX4A 4P32A 2NMVA 1KSGA 3H2YA 1WXQA 1G7SA 2DFNA 4KFTA 3WYFA 1OKKD 5JEDA 1HT1E 1XTJA 1PUIA 3MRSA 1G64A 4GMDA 4TQUS 4WAUA 3I61A 3R7WB 4CDGA 2C98A 3IHWA 4NL4H 3VMFA 4A2WA 3QG5A 1UKEA 2H17A 5JHHB 1GNPA 1RJ9A 1U98A 5AUQA 5AUPB 1L7VC 1W48A 2AXPA 2ODNA 1YHNA 3BORA 4LRWA 4RFSB 4XWKA 4RD6A 4MYTA 4BLSA 4TYWA 1EK0A 2B8TA 4X8MA 1JB1A 2J41A 3KQUA 3R9XA 3RNLA 3O8CA 4B48A 2PZEA 1ZAKA 3BOSA 1SHKA 1R8QA 4OQLA 1W47A 2IT1A 3EASA 4Q1DA 4WZ6A 2IYWA 3Q85A 4MGIR 4TZ6A 1E2IA 1XP8A 3T1TA 1II0A 3BRWD 4GBMA 5DI3A 3RAPR 3TKLA 1G4AE 2G3YA 4LBWA 2J1LA 4F7WA 2FA9A 5GVSA 1EFUA 4B3FX 4WOPA 4G0NA 2YNMA 5FL3A 3K9NA 2GTPA 4E03A 1E9FA 1Z6AA 4KV9A 3W90A 2A30A 3ICEA 3C5CA 4AWXA 1FNNA 4JJZA 3FKSD 3K9GA 2EFDB 3TLXA 3QVUA 2HXSA 2FZLA 3EXAA 2VIIA 4TSFD 5IDVA 4A4DA 1E1RA 3SQWA 4TMKA 4BFXA 2J5XA 1J70A 1KKMA 5LD2C 2VO1A 1NKSA 4UKDA 5L3VA 2I3BA 3UATA 1AN0A 3LA6A 1DG3A 1IN4A 1NLYA 1GZSA 4O25A 4DZZA 1JEDA 3FHOA 5C46F 2GKSA 1DO0A 4EIWA 1SXJB 2QE7A 4RSGA 2WSSA 4C0HA 1CJMA 1TX4B 4EJSB 2FZ4A 3EPHA 3SE0A 2OHFA 4OI0A 1BOFA 3QF4B 4R7ZA 3I92A 121PA 1E0SA 5EE5B 3EZ7A 2ZRDA 1CU1A 1G3QA 1ODFA 4K8OA 3WP1B 3AVXA 4LJ9A 3QXHA 3W3AA 2J59A 4IFBA 1JXMA 4JLPA 1VCNA 4KU4A 5EP1A 1PLJA 1OE0A 2ZRMA 3AH8A 1E3MA 2PEYA 4LV6A 1YKSA 1BMFA 1WE2A 2Q0HA 2ZEJA 4DLUA 1LTQA 1G7CA 1BH2A 3NC0C 4R2IA 5C4MA 1YVDA 4QC2A 5FBVB 4F92B 1N6RA 1ZC3A 3K0EA 2R6FA 2YOGA 2ZJZA 1A7JA 1TAGA 4DLTA 3C7KA 3P32A 4P4SB 3RS5A 4Q9HA 3B1WA 2MSCB 5FI1B 3TAHA 2CCJA 2ZR9A 3K0FA 3THXB 2ZYUX 721PA 2BKUA 1JR6A 1G8GA 3I3SR 4PHHA 5JCPA 1IY2A 2KBEA 2OLJA 3IIMA 2PJRA 3OZXA 1K8RA 2OG2A 4YLGA 1ZVQA 5JMTA 1XWIA 3AV0B 1T5IA 3MWJA 1ZM4A 2HT6A 4DCUA 2ZXUA 1UDXA 4M21A 2DPXA 4ZDJA 1EFRD 4R71A 2C95A 4EKDA 4DWJA 4US2R 3C15C 3QKRB 2ZUBA 5HE9A 4C0LA 5JCZA 3PG5A 3RS0A 4R9UC 2ERYA 2XTMA 1EWRA 2QA5A 1RVDA 3A1TA 2ZRBA 2BBSA 4UNPA 2EFHB 5E4FA 1H8ED 3QE0A 1BYIA 4JVNA 1U81A 4B34A 4OI4A 2QENA 1VG1A 1S1CA 2FEMA 1KYIA 1X8KA 5FH9A 1JBKA 4RCYA 3K70D 2WSMA 2ODBA 5FTLA 2QTVB 2RAPA 3MAAC 1KDTA 5HKKA 3ZVRA 5FOVA 1GP2A 3I8XA 1OB5A 1CJUC 4KYIB 1GILA 1N5KA 1Z0AA 1TU3A 3VHXA 2PEZA 8OHMA 3K09A 1T0HB 1HH4A 1UBEA 1EWQA 3A4MA 3FB4A 4LHYA 3VR6A 2OBNA 4OYHA 3PITA 4Q03A 3HWSA 2OLKA 5DSZA 2ZU0C 3T1OA 4FW9A 1XTRA 4TL7A 5CM8B 4C0AC 2NGRA 4HLUA 1KSHA 2IK8A 3FHTA 2LKDA 4H1UA 3LLUA 5JJKA 1D6JA 4OKSA 2ZJBA 3U44B 1E2QA 2H7VA 3VR5A 4ZCMA 1IM2A 2AHOA 3PXGA 1W7AA 2DFTA 3KJEA 3GLGB 1KO8A 1S3SA 5DH9A 5DHFA 5EUMA 4NP6A 2A5FA 3GLIE 5KDDA 1OLOA 2G6BA 4LBYA 2F6RA 3U3RA 3T5DA 3KQNA 2ZSBA 4US0R 3DKVA 4QL3A 4RD1A 2C04A 3TGPA 2BJVA 1B0UA 2WSSD 2QTFA 3W3ZB 2ZSFA 2IYXA 2IBMA 2RGXA 3LWNA 3B1VA 4DLRA 3LD9A 2ZI9A 3PUZA 2OILA 4JS0A 3OEHD 1T3LA 1VG9B 1Z6YA 5DHAA 3F0TA 5L3QB 2RMKA 5HPYB 1UADA 4Q4AA 2QRZA 4XVQA 1KI7A 5CITA 5F3WB 1F60A 3LDAA 1XPOA 3C5HA 1X86B 4URXR 2OCBA 5J40A 4B3GA 3QJYA 4MYHA 1CBUA 3X1WA 2ZANA 5CJPA 1H8HD 2EQBA 4PO8A 5EP4A 1Z0FA 1TU4A 1FW6A 1F2TA 4HDQB 1Z83A 3CPEA 3BE4A 3UWOA 2GCPA 4KLZA 4A0FA 1X8JA 1HE8B 1JPJA 1WP9A 4YONB 3TR5A 2JCSA 4QJ5A 4OQMA 4Q9KA 4DC9A 1TQ2A 5KOYA 5EJEA 4Z51A 4MYCA 4Q5IA 3K0CC 1NBME 2FN4A 4DCNA 2ZRKA 1OIVA 3B82A 2O8FB 1Q12A 2GBLA 3A36A 2CLDX 3F8TA 5LB4A 4MH0R 4B2IA 3LY5A 4PSKA 3R7WA 1XF9A 5FPHA 4TTRA 3K0AA 1HQCA 2CBZA 2W2TA 3IEUA 5JZVA 3NH6A 5M04A 3SJAA 4LBVA 3RC8A 2YHSA 4Q4JB 1ZM9A 2L0XA 2W2VA 5KNCA 4A8JB 1M34E 2VHTA 2XOKA 4DT1A 2XSZD 4IDOA 4ZDIA 4CEJB 2OE2A 3C41J 4TSFA 3WP0A 1A4RA 1F3OA 1ZNYA 1KDRA 1KOFA 3HPQA 3SBDA 2X1VA 1HE1C 1X3SA 2J0SA 1R0XA 3WY9A 1PJRA 3UWKA 3SYLA 3N70A 1Y3AA 4BFYA 2JIZD 1JI0A 1G1MA 2W6JA 4JIMA 4URZR 2B92A 4B75A 2H1LA 4W5WA 4TMXA 4C0BA 4AK9A 4RZXA 4D81A 3ZZTA 2WHXA 5L3SA 2QP4A 3CF0A 1U94A 2CJWA 3TQFA 4NTZA 1KIMA 4LUCA 4AYTA 1WQ1R 4Q48A 3QSYA 2FG5A 3F3YA 4HAWA 4ASUA 4QGHA 3LXRA 1GL7A 3M0EA 3EIQA 3PUXA 4IEIA 2O8DA 3IPYA 4AKHA 1YZNA 2ZI3A 1ZRHA 4Q47A 1ZUIA 4LSGA 4PPFA 1U0JA 2OV2A 3QBTA 4DHEA 5F2EA 2JA1A 2IA5A 2VBCA 1XJQA 2O8EB 2FNAA 1QF9A 1COWD 1GNRA 2ZE8A 3GEEA 3U7EB 3QKTA 2QEQA 4C2UA 3JVUA 1W4CA 3SOPA 3SEAA 3C4JA 3B85A 3THXA 3NVAA 2Y8EA 5KPDA 3NC1C 2XOKD 2BHRA 1QHXA 3ZD7A 5AK0A 4D4JA 3FE2A 3IPXA 5GADl 1QZXA 1R0ZA 3IQXA 1KI6A 2P0EA 4KHZA 4UNNA 4NONA 2Q21A 3VU9A 3K0SA 5TDHA 1JALA 3BAFA 1W5TA 3NHAA 5AUNB 4AC9A 4Y0AA 1X8LA 1XEWX 4M9SA 1OH7A 3CPHA 1BYUA 4I1UA 4BFSA 1NRJB 2R65A 3I8SA 3K0AB 4AKIA 4US1R 1KI1A 1NG9A 4FMBB 1U9IC 2XTZA 1YR8A 2EVWX 4TYQA 4IEEA 3PEWA 3SS8A 1D9XA 4MDEA 1P62B 3ZS8A 3TQCA 5EE3A 3FWYA 1XMJA 2V55B 4IOKA 4TMZA 3BERA 4ESHA 4HLCA 2W00A 3AF4A 4I1OA 4M1OA 4CVNA 4F4JA 1ZINA 2RH5A 2YKGA 1ZC4A
chains in the Genus database with same CATH superfamily
1UDBA 1G8SA 3K9CA 1SC1A 4JA0A 2HAEA 1PFWA 5C4GB 1NPDA 1R27A 4BEBA 2ZUTA 1KY2A 5B30A 1WDKA 1GAJA 1KP9A 4MQ5A 3EEOA 4K9OA 4ZO4A 4RY2A 1YWGO 1SUAA 3QG1A 1TKAA 3E1SA 2VJDA 3RHTA 3B13B 1WMAA 2REOA 3WLEA 4AIIA 4HZIA 4INAA 2JA2A 4EL5A 3E5MA 3EMBA 4F5WA 4LMPA 4PZZA 2FDRA 1V5EA 3GA5A 4NCKA 5HIIA 3FPBA 3OZWA 5JXHA 3HO1A 4U00A 4ZQBA 2XRZA 4JMLA 4UQLA 5KYVA 2BOVA 3IV9A 4WADA 4UXHA 1IJEA 5ELMA 1IJKA 4FI3C 1Z45A 3CLUC 4RF2A 2YIMA 4NK5A 4XTRA 3RFVA 3S2IA 1Y9JA 4W63A 2BM1A 2O9JA 1DC8A 2AFHB 2Y6VA 4OQFA 3NTQA 3SS7X 3HMQA 3OT5A 1K88A 1LBSA 2AJDA 4GOLD 4YK7A 3ZE0B 2RAVA 1G7TA 1YZTA 2WAXA 4M2LA 4HVCA 2JD2A 3FCAA 3G7NA 2CK3A 3JYNA 1G0OA 5IHPA 1KJ9A 2DT8A 5AW2A 3I2YX 1VB3A 4AO7A 2JLXA 3V7FA 4OFBA 4A8JA 3T1HB 3OE5A 3ZLVA 2NO1A 2NSJA 1G291 1IB0A 3TS1A 4JBLA 3UAVA 3OMLA 4DXHA 1PR0A 5I7SA 4GBGA 4IS3A 2AC7A 4K9LA 4HPWA 4GPTA 2DCUA 1Q0QA 3KB2A 5KNDA 4YJ2A 1XYVA 3O1LA 5A7GA 3A2MA 2WIJA 3ET4A 4CPDA 3KTAA 4Q1EA 3AV3A 2X40A 3IFSA 2DFPA 1CS0A 4E7PA 5JVDF 1W4LA 4A1FA 1DB3A 1NVKA 4ZCPA 1Q92A 4R8KA 2QR2A 1O0SA 4S1TA 3CKLA 3HYNA 4GMGA 4G5GA 4M9QA 2B5VA 5LM3A 1F8UA 1YOBA 3TRDA 4YT8A 3AKEA 5AXBA 2C1XA 2FSHA 3JTEA 2ZJ2A 3BTVA 3T7RA 2Z3WA 2XTJA 4JJKA 1K7EB 2BTQA 3HKCA 4GU5A 4B82A 1Z63A 3AUKA 2FUG6 1LCIA 1TT7A 3U4QB 2O7RA 4BNYA 5BSWA 1CY0A 1EHCA 4XD2A 1F8XA 3FNEA 4K6HA 3PIDA 4U2FA 1OI7A 4DYDA 1DDGA 1EX7A 1KFJB 1VBFA 3FZGA 4MDYA 4BE7B 3U4QA 1ZNZA 2HDHA 2UUAB 2IKQA 4WEQA 2HCJB 3D8NA 4TMVA 3AVTA 2BI8A 5CX1B 4ZCSA 3RVMA 4Z9FA 1UP4A 2XXBA 3PU6A 3WWPA 4B43A 1IYZA 2LD4A 4C05A 5HXAA 5K6RA 1D2GA 1DMRA 2C99A 3L4EA 2JJ8A 1F06A 3DJFA 2R6CA 3KSAC 1Y7PA 2OCPA 4MKIA 3TW8A 1PN3A 1R8YA 2R6DA 4RVHA 1OX5A 1GQ2A 3C74A 1QIEA 1R9NA 2E4ZA 2ORIA 3GZNA 1VSUA 2Q9CA 3B78A 4JX8A 5J5CA 3HEBA 3RJMA 4CLRB 5KNBD 1BHJA 4QU9A 5DM70 4R1TA 3NYWA 3Q8MA 1NXTA 2H9AA 1KVSA 3UK2A 2XNSA 2VKQA 3G9UA 1TIBA 1UPAA 3MZ0A 1RTTA 4OSOA 3LL7A 5FCDA 2DZDA 1ZQ1A 4UEQA 1RC1A 1NUHA 2JFBA 3VDQA 1PGJA 4TRRA 3SR0A 1QK3A 4JEMA 1JQLB 1DV2A 1IN5A 3C3DA 4PHCA 2ZR0A 4HEJA 5J2TF 2G4VA 5CYGA 3UT5B 1ZIPA 2FFJA 2R6JA 3KFLA 1TO2E 3NXSA 4CLXA 2C8KA 4GE3A 5ECGC 3MQFA 2FPWA 4Z9BA 3ZV4A 2P5UA 2OHJA 4EG7A 1DQPA 1CR4A 3NIWA 1GRQA 4CKBB 3CKKA 3D1JA 4G56A 1OKKA 3DFZA 5K0NA 1J0AA 4H16A 1TL7C 3E3NA 2Z9CA 5FWXA 3W5JA 2AI3A 1DXYA 3JQ8B 1VCOA 3PTAA 1MH1A 4D5EA 5HZKA 2AUTA 3DLTA 4ZI7F 1Y4AE 5B37A 1GN8A 1RJDA 1U7TA 3IP9A 4GVPA 4GX0A 4K88A 4O59O 4Y67A 2CHVA 2VYVA 4KODA 4BP3A 5JYBA 4PG4A 2FAXA 1H1DA 2P4QA 4K6CA 4OA5A 2R6HA 4TL9A 1KSFX 4UEJA 1RHKA 3RKUA 3T9EA 1T29A 4AURA 4JXXA 2B1RA 4G85A 2PMEA 4OAPA 3U7RA 4KC0A 4RA9B 1H85A 4RGQA 5KWIA 5ESDA 2QL6A 4GPAA 1PBNA 2EIXA 3QVGA 1HDOA 3OT1A 4AP9A 4C7MA 3UOAB 2JFFA 4M38A 1CJSA 5ER9A 4LJLA 1HZJA 1O7JA 2QLLA 2XGMA 3W2FA 2VAPA 1SQ6A 3N6RA 5IUNC 5KHLB 3GWZA 1M8PA 4CKZA 4PGHA 1IY0A 1TU0A 3UT0A 3VZDA 3ZDDA 1N92A 4BMNA 4C5BA 3MMNA 4I8IA 5DT9A 2Z2YA 3FNRA 1VI2A 4YAUA 2IJGX 2PJUA 1DBPA 1GDTA 3EUAA 5FTKA 1QJCA 2DY1A 4GG1A 3S2GA 4CM7A 4DKXA 4URVR 2IEIA 4M8LA 1JLMA 3OPMA 3W9UA 1P9WA 2HF2A 2QTHA 5DIZA 4AF6A 4F8YA 1H3EA 1A88A 4D6PA 1HPLA 4WHMA 2JLYA 4X60A 4EENA 4UW9A 2PAFA 1PKEA 3DGFC 4PQRA 4BKRA 4DM7A 1LC3A 5JS7A 2RBKA 4J2HA 2B5WA 2H5EA 2Z9DA 4M55A 3JQBC 3AX6A 1R00A 1T35A 4EA7A 2A8YA 2VQSA 3MT9A 1ZUHA 4S2EA 5BORA 4JL6A 3BXZA 1C9KA 5NLLA 1ZXBA 4KTTE 2GSDA 1Z8NA 4MWZA 1TYBE 5K3OA 3PCTA 1KY5A 3DMPA 3GMDA 1GWNA 4A9AA 5BSMA 3UGKA 4BHTA 2Y9MB 1C0LA 3HCFA 3OEEA 2C4UA 4L02A 4TSRA 3TLBA 1Y37A 1RKBA 1ZITA 2B25A 2B82A 2XF8A 3F78A 3G8DA 3GV0A 5AHRA 2WUFA 3I9LA 4XQCA 5HQ3A 5KTOA 1FUYB 2H7CA 4NAUA 5DBIA 3ZZ1A 4LDRA 2JPDA 2QLNA 3BG5A 4URFA 1YJAA 2J85A 3E7DA 3GJXC 4XAQA 5ERXA 1RM3A 4GOOD 3ROGA 4B6JA 3G85A 1PYDA 4CKCA 1TRKA 2W0MA 4BZXA 3ORYA 2FDCA 1V2GA 3PYXA 4H6PA 5T4EA 3M6VA 2CJXA 5DI3B 5AM1A 4ALNA 5JPDA 3WQHA 4KQIA 4ZEWA 3R5KA 1XPJA 5JXGA 1TTHA 4AW9A 4ZICA 4W4TA 2ACWA 4YAGA 2OP0A 4MRPA 3BFJA 4Y6QA 2EWWA 2DWQA 1X1QA 1HURA 4EW3A 1KPGA 1YMQA 3HXLA 2ABWA 3M49A 1ECBA 1SUCA 5EEGA 4MRRA 1CUIA 4BYGA 1JMVA 4XRGA 3KV1A 1BMQA 1V43A 1WULS 2QTZA 3A6FA 2R2GA 3ND5A 3P2KA 1Y1LA 4G5FA 1U5CA 3ORQA 1I2CA 2QQGA 1TT5B 4P3OA 3IKLA 4EPXA 1YFZA 3PGXA 1QMPA 3WJ7A 3ZEIA 1IXYA 3L49A 4OLHA 3A9UA 1WBJB 3V4RA 2VR1A 4R69A 3U48A 3AR9A 4S35A 4Y7CA 1DC6A 2QZJA 4FCTA 4NBRA 2GQ0A 4I4TB 2C2BA 5K6AA 2DXIA 3TSAA 3GP8A 2H2HA 1Y8ZA 4LRXA 2CVQA 3A7EA 1VL0A 1HYQA 1AF7A 3GJ5A 4PQEA 2HBYA 3M4NA 4HDOB 5CIWA 4ZVLA 5ESXA 4Q7QA 4QGFA 1JR4A 3KKPA 3TSYA 1SVLA 2PL3A 3O83A 4P4GA 5EUBA 3BHJA 2BHSA 1C9NA 2XKAA 4REQB 1I30A 3LCUA 2NNLD 5FL7D 1YQUA 2WWHA 5LC1A 5CDYA 3CLRD 3EEFA 2GLUA 1TVCA 2YVAA 5G0UA 4MKXA 5EUQB 4J0KA 3B51X 4TMWA 1U9IA 4E46A 5A1TA 3FLBA 1IWOA 1EUQA 2I1LA 4B5KA 3BN3A 3GMTA 1XZBA 2UXBB 4WNCA 1AJEA 2NVUB 3RYTC 1JEEA 3QEJA 4CF4A 4WCFA 3QBDA 4DDMA 1JG6A 1M7HA 3K31A 3KT0A 1KAGA 2IYVA 3QRWA 2XCTB 5DGDA 4A0SA 3ZY3A 3EXFB 5J47A 2J4FA 3A0UA 3Q7PA 1SCJA 1XZNA 1NJ6A 3GU3A 3BTOA 3M81A 2F43A 3GA0A 3W04A 4L5BA 3HKDB 3UMGA 5BN4A 3BSFA 3ZKWB 1WM1A 5CX4A 2PRIA 4OJKA 1QG6A 3MSCA 3PEVA 3NJ4A 3HE3A 4MHSA 3DUWA 2APJA 1QM5A 4YB8A 1X87A 3IVRA 2CD7A 4EY4A 2H51A 3JQCA 1T24A 2E3JA 4X7MA 5CT8A 2NTVA 5GGYA 2ZJOA 3DL4A 1GKYA 4GZ6A 4RZQA 2IUYA 5D7BA 2X9QA 3QOXA 3TK1A 2PIDA 2GZSA 1P4SA 2CLLB 2PM8A 2XQFA 2BZGA 3RVDA 1TNDA 4UVIA 1CEYA 5L40A 2F48A 1K3UB 2V1XA 4MUMA 4TZTA 1UJ2A 2ZB3A 4WXHA 1E94E 1Q1EA 1UMKA 4A0GA 5FKJA 3X43A 2R5NA 1RYHA 1DSSG 1VLZA 2G8NA 1ENOA 1CR2A 3LCJA 3L6UA 2J3MA 1GG9A 3N07A 4HFRA 5K0GA 1A9QA 5C5DA 3NEYA 3CVVA 4DV7B 4QTZA 1VYVA 4BFWA 1GL6A 2RFLA 3K71B 1I4DD 3HN6A 221PA 4BP1A 1DT3A 5FUBA 1XPRA 4WLNA 2NADA 2A6PA 2O07A 2ZUCA 1V3UA 2BFPA 1BE1A 2QP9X 3BHIA 1M1ZA 2PH7A 2YBDA 3UM9A 3PL5A 2PCJA 5K5EA 4MP8A 4YS6A 5JBIA 1RPZA 2DHRA 1REQB 2PL9A 1JVNA 1C3XA 3LQQA 3Q8XB 4DUGD 5JWRA 5SZKB 1WZUA 4Z0PA 2VDUE 4M1MA 1O9BA 2QUJA 4WA7A 2XNJA 4G01B 4WT7A 8ATCA 5LYJB 4C4RA 1RT9A 5DKFA 5C52B 1HQDA 4YBRA 2CLFB 3A1CA 3TCNA 2WABA 2P69A 3JAWB 3PUYA 1IN8A 1K86A 1QAQA 1XSEA 2PUVA 1RPTA 1T36B 4TPKA 5EHGA 3M1IA 5F5XA 2OPHA 1MUUA 1ENPA 4RKQA 1RHQA 3SIXA 1NZJA 3LUGA 4K81B 4CLEA 3BWEA 3UMRA 1SNYA 1QHGA 1D03A 1OXMA 2PKWA 1ZIDA 2XUOA 3OA0A 1ZI8A 4M6WB 4NICA 5IJXA 1T9CA 3PNKA 4DIUA 3H3FA 2QGZA 1ML3A 2PQMA 3CUSA 4OXKA 4PW0A 4LK2A 2Y6UA 3IEVA 5DM0A 1VJGA 1IVNA 2FPXA 3L8DA 2R96A 4IJUA 5C1PA 4RLHA 2F7SA 5KTRA 1QMGA 4OHWA 4A0RA 3BEDA 5EZYF 5ADHA 5LZ8A 2V7TA 1W4ZA 2D5BA 3AINA 1XA4A 3LFUA 3DBHB 1LI4A 1Q1ZA 1XMPA 3ZYCA 1W8DA 4DRXB 3PNYA 1XZ8A 5JFOA 1NZFA 4N12A 3U6BA 3IVAA 2QK4A 3BHNA 3CJRA 3ZY5A 2O8NA 5DYGA 4AY5A 4F5ZA 3U40A 5HNKA 1GYQA 3C6YA 1DEKA 4TQ9A 5E38A 3LKVA 3E81A 5JFTA 3MBOA 3ZWMA 1SU6A 2ZIWB 3FWZA 4LCBA 1QZ3A 1CG6A 3ZDRA 1S1MA 4ZVVA 1C3VA 3USES 1XQYA 3UW1A 2IW3A 4H1VA 3F73A 3T9FA 3OLZA 2ZWOA 3ISVA 2O4CA 3DD1A 2ZWVA 3FYSA 2P0YA 4BVFA 3GT4A 2ZOSA 2J6IA 3H6GA 2RHOA 4CEJA 1G5QA 3MWYW 3FPFA 5C51B 2PYIA 3IB3A 1UANA 3I8OA 2NZWA 4AP5A 2Q27A 4HN2A 1L6RA 4Y6SA 1F12A 3JXEA 2ACEA 3PT9A 1PL0A 5CM2Z 3FPGA 3I12A 3AETA 5E9AA 1XCJA 3G3EA 4JC4A 1AKQA 1UKYA 3LRPA 2NPIA 1OILA 2SKCA 2WD7A 4XFKA 4HF7A 2VLIA 3NWEA 4ZFNA 3EDCA 1BW9B 3M4XA 2BMEA 3PXEA 5AVSA 4RVSA 4KE8A 1S3IA 1G3MA 1ABBA 1XU4A 2O0KA 3JWPA 4PR0A 2M6LA 3Q5EA 1KTVA 2C5LA 3ROTA 3W2IA 3JX9A 2VPWA 4GZLA 5DIFA 5FI0B 4YAIA 4JXJA 4D6XA 1XA3A 4F85A 4AKGA 3QZUA 3T7TA 2P2LA 5KKAA 3ZI7A 4Q4DA 4I4LA 2WOOA 2O8VA 1XZCA 3DAPA 5IARA 1BX0A 3PQEA 1AGNA 3B2NA 1O89A 5LYJF 2AFIA 1NHWA 3G1UA 1NFRA 1I6MA 5ALDA 5F2OA 4ZHQB 3UV7A 4BKOA 2Z5LA 1EX6A 2HJGA 4NAHA 3ETDA 5F77A 2FPSA 4X54A 2ZG6A 4XQEA 3LOPA 5A7HA 2WJGA 2AKAB 1I0IA 1U1CA 4LRYA 2NU8B 4IF4A 4X6LA 1U0FA 2Q50A 3T0IA 5I01A 3IUNA 2Y0PA 5DHUA 2JGLA 1SG9A 5IBCA 2ZW9A 3QVMA 4KQFA 3EQZA 5HF8A 5C8ZA 1CSEE 3EGVA 4HKTA 1YZLA 4QUGA 821PA 3UICA 1JSCA 3D7NA 3TN7A 4EPTA 5DSTA 5IF9A 4RVDA 1RHMA 1YASA 5GONF 3HVHA 2CXQA 2MYNA 2HK7A 3G2LA 3AF2A 2ZUUA 4L16A 4LF4B 2LCQA 1KQOA 4IYJA 1GO2A 4W5OA 2AF4C 3HWX1 6PFKA 4LJKA 5IEJA 4TQAA 1A2QA 3IIJA 3LQ4A 2P4UA 1ZH2A 1EGQA 3RC2A 1WSBA 1LRLA 3MT0A 2H9YA 2ZBUA 5FQOA 5A7FA 1TUBB 2X22A 3KYBA 2NZXA 1GM5A 2JHCA 5CT9A 2QN8A 2VI5A 2CHEA 1FA9A 1NXWA 2W6ID 3D6HA 4R6XA 1QGED 2PU5A 2Q49A 5DJ5A 1RWBA 2E4AA 4GSLA 1SCDA 3WHPA 1W36B 2D8AA 5KS2A 3VNVA 3FFXA 4JR1A 4AUEA 1GRVA 4XOUA 2ZQZA 1QOQB 2QVLA 3GLHB 2JGDB 4UMFA 1V8BA 3PNLA 4CI0B 2X19A 1F8GA 3G49A 3E9YA 4F4DA 2EGGA 1Y7HA 5A4DA 3HJUA 2HZ7A 5EIAA 1DG1G 3I05A 3SX2A 2YY5A 4B8WA 2JHPA 5BP7A 4WKBA 4X93A 1AF4A 3ZE6A 2CHQA 3HA3A 2QAIA 2WPDA 2HIAA 3FSGA 4J1TA 5EZQA 3ZNOA 2PY6A 1R6VA 4UTXA 1E2LA 2OBFA 3B3AA 4XYEA 1U0RA 4F4CA 3G2HA 3SHFA 1EDEA 2WU4A 3TW6A 4DE5A 1PEYA 5C1OA 2OSBA 4MR8A 3ACBA 3KHUA 4FR2A 4FUTA 3MGKA 2ODWA 5CM9C 3HWRA 2DPLA 3DVLA 4RIIA 3UB4A 1G8MA 4BLRA 4G1FA 4L5CA 2ON6A 1J9EA 2AN4A 2B94A 4ALIA 2X6QA 4TWIA 5E3HA 1X7ZB 4X1IB 3Q3CA 4HWGA 5C2JB 4OBEA 1Z2AA 1Y34E 2GH1A 3O95A 4BB0A 1O96A 1C9YA 3X2FA 1PG0A 2IHYA 5H81A 1IFXA 2DAPA 2WTEA 4KQ9A 3ZBUA 1V8FA 4WUVA 1HGXA 4AU1A 2HTEA 1LB1B 2KQUA 4BNUA 4EBFA 4U7WA 4B6OA 3CZ4A 5KBYA 3QPWA 3KZVA 1KYTA 3TLYA 2P8SA 2OFOA 4Q01A 4QGAA 1PUJA 4XD7D 2F1IA 2PANA 4AUKA 1DI0A 2RHLA 2P3QA 1RFLA 1VLHA 5LOVA 2ILTA 5G0WA 2DVMA 2G83A 4BKUA 2Z6AA 5TY0A 4XQGA 4KXMA 2BKAA 4KNYA 2KW5A 3I9V6 3P9NA 1NN0A 3Q7TA 1FNMA 3SZMA 2P9YA 3UCFA 1W8IA 5HCIA 4XIFA 2NACA 2PGNA 1VCHA 4PPQA 1VIMA 2HIMA 5KWJA 1WPQA 4CF6A 2ZVJA 3IAEA 4OGWA 1MW9X 1GR0A 2P5SA 3HYTA 4HZUA 5KTMA 1HX7A 1I7LA 1VGRA 2V7PA 4RK6A 1P5ZB 5KCMA 2CJWB 4TT8A 3KHSA 3RFCA 4D3DA 4YQFA 3KD2A 1AKVA 2Q8PA 3FOAA 1C5KA 3CR7A 3DM5A 1YZKA 3I73A 5EZYB 4WCFB 4XIIA 1IONA 1GL9B 1L0BA 4NMLA 4JUCA 4AS3A 5FUWA 3R5TA 4DABA 5HIAA 3IKTA 3OM9A 3ICPA 1L5NA 3QU9A 3SZRA 2HJRA 4M9ZA 1OROA 3A7DA 1C7JA 1PR9A 3HCCA 4KO1S 4LJYA 3V8BA 1YRHA 1IHDA 2VTKA 3IO5A 4HVAA 1NU8A 4IHAA 2Z1NA 3DE6X 3P9CA 1O3YA 1Y3FE 4TV8B 5GPBA 2WWXA 4W5QA 5C8VA 1T8SA 1DRUA 5JSYA 4AF8A 5HZHA 5KSZA 2BFCA 2R2AA 9ATCA 1U8TA 3DE7X 1FCJA 1K6MA 2VK8A 1M7GA 5BN5A 4R2HA 3TWOA 4RZIA 2JVIA 1W5AA 3UMBA 4EPYA 1KIFA 1CRPA 5FA6A 3NAZA 3ESRA 4M8KA 2DWCA 1SBQA 4E22A 2GBGA 3VR2A 1ZS9A 2YQ5A 3WKDA 4YJHA 1KEWA 3H97A 2Q4BA 2ZI5A 2G82A 4A92A 4LF7B 5KDOA 1J0BA 1EDBA 2DUJA 1U3DA 1TC1A 2EBFX 3A31A 3DO5A 3ENNA 4B35A 3CUVA 2O8FA 1J8VA 1ORIA 3EDMA 3KWMA 1ILEA 4E5NA 5AO9A 5FUXA 3D8SA 1TKRA 4R1QA 3V32A 5A2GA 1CDOA 3W79A 2NIPA 4IDHA 1N5MA 3V2HA 3RIGA 5MN4A 3E0QA 3THWA 1I0LA 2GO7A 1WW8A 1DDOA 3T5GA 4DILA 1N9GB 3UAYA 3WK9A 5TPZD 3OU2A 3O9MA 4CT4B 2B6HA 4FFBA 1CR0A 2Z6VA 3AUSA 4PLWA 1VKRA 3L02A 4BZZA 2XXAB 4FDUA 4YHHB 2IIBA 1D2CA 3RNOA 1EA7A 2CXTA 4XUEA 4AUMA 4YV2A 2HRZA 1ULBA 3K30A 3N2GB 5L8VA 1TW3A 4KGZA 2QN7A 1DAHA 1I6KA 3W8FA 2X5XA 2IZ0A 2Q5HA 3H2SA 3HSSA 3ZTTA 4DY4A 4H7KA 1DINA 4LW8A 2XB9A 3REQB 1HXHA 4F38A 3T61A 3JZAA 3I37X 2DUMA 3DULA 1GFWA 3I0ZA 5BNFA 1VL2A 4X5OA 1KMQA 2VQEB 1HTWA 3C43A 3K32A 3NAGA 1E5DA 1QKKA 1PAUA 2B8JA 1QAOA 2PFKA 2ZVQX 2GXQA 4PG5A 1WMFA 5E4TA 4RJLA 1Y9EA 4ONEA 4AJJA 4EI8A 3ZVMA 5C35A 2Y99A 4P4SA 1V7ZA 2JGJA 3UHPA 3PICA 3H19A 2M1XA 4TKVB 3AJ9A 1R6DA 4FB5A 3Q11A 4WXEA 3OE1A 1UDWA 2A5GA 1R2QA 4RMJA 2BFEA 4C7KA 2Q1SA 1C0PA 1TJ5A 2EQ5A 1II8B 4F4IA 4JJGA 3LQ1A 5J58A 1LRJA 3DBRA 1M5UA 3BXPA 4N03A 4XGRA 3T0FA 3WMRA 3GFRA 1ESNA 4D9GA 3W8NA 3L0BA 3UXHA 2WNHA 4XWYA 5ECYA 1FXWA 2ORED 1H94A 1UT6A 3DTVA 3W2HA 1O97C 1QE3A 4BX2A 1TGVA 2MSWA 3F2VA 2JI6A 3ISJA 3SI7A 3SX0A 4R2KA 5EJFA 2A0YA 1YVRA 1AKMA 2DT5A 3IE1A 4RDCA 4EI2A 3U5ZB 2AOWA 2E6UX 3LUKA 2EWVA 4LHXA 4PRLA 3U2QA 2QW0X 5A02A 2GK6A 1ZVJA 1OFIA 4H6VA 3TIGA 1XXHB 1NG1A 2VDVE 1Q16A 2XCQA 4KVFA 1E1QD 2OXIA 2AZTA 4YRBA 4WZBB 1UMDA 4MDFA 3CSSA 4J3FA 1YHZA 2GDJA 1ZSVA 4U7TB 1JDBC 2R751 2BGUA 3F8SA 4IXTA 5AI6A 1G2IA 4W7IA 1UMCB 3A1DA 4ALLA 4QODA 4AQYB 2OTCA 2VG8A 1J90A 1XDBA 2GEDA 3VR4A 3ZJTA 2QAJA 3O6VA 2Q6KA 2PXHA 3NV9A 4JI2B 1Q22A 4E21A 5JO9A 3MC1A 3EY4A 4H7JA 4LXYA 5KOHA 1N3BA 3MJSA 1BIFA 1MA3A 3A9SA 4MJXA 3ZKWA 4Q3BA 4MMYB 3AP2A 3PS9A 3V7YA 1NW5A 4A5SA 2GNPA 3GEHA 2JIQA 4B44A 2AN5A 2PMDA 3Q3EA 1PFGA 1I32A 4DF3A 1US8B 4YPOA 2R79A 2OGUA 3BGOS 5IP5A 2R8ZA 4KZPA 5KYYA 1CRQA 1VPVA 1K7YA 2UKDA 1E9AA 2WNIA 5CT4A 2JB9A 4JI1B 3E23A 3VR6D 4G37A 2RIPA 4U7DA 1UOQA 1YQQA 4HDAA 3WO0A 5K6TA 4KBYA 4M6WA 4EG3A 2HHHB 4KMMA 2O2XA 1DVRA 3HYRA 1ONSA 4EGFA 4XWAA 5EIBD 4DDVA 4M1SA 1D2EA 3I52A 4CM4A 1DUVG 1I01A 1YR6A 4GKJB 5EWMB 4DG9A 1NC3A 4P92A 3MW8A 1C7FA 1M8FA 3N59A 4QJ3A 2Z5VA 1DXOA 5LXTB 4JCOA 1UEJA 4AFNA 5AT1A 2FEAA 3CUWA 4CCSA 5EGNA 2HJ9A 4BEJA 2C4NA 3QVKA 3V6LA 4G0OA 4XDGA 2BF4A 4JUIA 4L3VA 1O95C 1BQ4A 2JIBA 4FYVA 4U2BA 5BV1A 5IS2A 5EZ5A 3GJYA 1NRIA 1XWWA 4UDOA 3IPRA 2ZCVA 5LXTF 1KJZA 1NWHA 1QE0A 1QIMA 1E4EA 2AQKA 4BIIA 4IIJA 4Q4JA 2XSZA 1PW5A 5FADA 1C7EA 5CD9A 3P52A 1I13A 4KLRA 3GEIA 2Q1WA 4QBKA 3CNOA 3Q7EA 5CVEA 4KN9S 4Q4LA 2PNFA 2I22A 2DRIA 3HEAA 1XD9A 5E7QA 3RC3A 1DBWA 2ZXFA 5EA2A 3FX2A 5J5AA 1H4SA 3VX4A 4ID3A 3WKAA 4H7PA 5E4JA 1WY7A 1R8XA 2OO3A 3NR2A 1L7XA 1DZIA 1JQDA 1M5TA 1TJPB 1ZRSA 3BICA 4JJAA 4NYMR 2CDAA 3DWFA 1CW2B 1HQKA 1UAGA 4X20A 5HQJA 3SR3A 3VYTB 5BURA 3L7JA 1SKBA 3I83A 1Y80A 3H04A 1NVVQ 3L41A 1RQRA 1V9SA 1GPAA 4J6EA 1TJYA 4XIYA 3QF7A 3GJ7A 2A5JA 3DYBA 2G72A 1CR1A 1OFUA 1ECPA 1XK7A 4CR7A 5HVNA 2WTNA 3R20A 3OA2A 5FHQA 4INPA 5HKBA 5KNLA 5I4IA 1GTRA 1SXGA 4GYKA 4LSZA 2KJQA 2OM2A 3NHFA 3QUSA 4LPKA 5FLKA 4ZYTA 4NCBA 3B5EA 5G4KB 3VPDA 2C8VA 1IEQA 2B4KA 4YCMA 1DMSA 1PE0A 2QMUA 2J07A 4D80A 1TI7A 1PG2A 1M6EX 3B48A 4I55B 5BUZA 2PKEA 3GL9A 5JDIA 4IBOA 1QIJA 1GPYA 1Z26A 2YZGA 4XWWA 1EFRA 4YX9A 3GRFA 3DOCA 4LMAA 4RKRA 4C7XA 4YQEA 2B1IA 3DW3X 3KVOA 2OECA 2ID9A 2OV8A 3BTUA 3ES9A 1WHTB 2ODQA 1DGQA 1QUFA 2QXTA 4QBIA 4C20A 5BNIA 3JRXA 5F5NA 4HUQB 1F0NA 3ZJ4A 1KZ1A 3RUEA 1AKWA 3WLJA 1RRCA 1L4YA 4DQLA 5LOVF 1W1UA 4NJMA 4PZDA 4BQNA 4F3TA 1D1TA 4HGPA 1VPDA 3Q3HA 1XB2A 2FWPA 4KP7A 1KHHA 1PT8A 5H68A 2IHUA 3ZDEA 2DECA 3U39A 4MB0A 4O2BB 4QAQA 1ITZA 2IV7A 2JEYA 4NBTA 4ZDKA 3QELA 4KXUA 4KXVA 4UHHA 1MFPA 4HEA6 5C34B 1BJKA 1SHTX 3BL8A 3CV3A 3T9AA 5IANA 3DV9A 4V0LA 2J7PD 3GCGA 5JAOA 2A84A 1GUZA 2BE7A 3U7JA 1U1EA 3CFYA 3P2YA 4OMDA 4Y9TA 2CMHA 4Q66C 3U80A 5JNRA 2BGLA 3EPLA 1X1SA 3GIDA 2AXQA 2I34A 1OLSA 4JUBA 3HCWA 3MWDA 4B2YA 1DXHA 1OHHD 3PT5A 4BX8A 1EK1A 2QJRA 1ZGCA 4J8PA 5KSPA 1NXXA 3I3OA 3PA8A 3V33A 4BNMA 3FBGA 4LHSA 2VYVD 2IITA 3A4TA 1FSPA 2PVCA 1DPGA 4RA9A 5LBUA 5BN4B 3PC6A 1PT9A 3SE7A 3TNYA 4KHPB 1BROA 2YIJA 3ER9A 2RBGA 3G7SA 5IJ9B 1Y0BA 2PX0A 3ROKA 5F7ZA 5EKSA 1EVIA 1EM6A 1Z2EA 5KI6A 1TQ6A 3PFIA 1CUXA 4KR0A 5CH3A 2B1JA 1XEFA 2WJJA 1X7WB 1ECCA 2QR5A 3EWAA 4ZI7A 1E2NA 2HNKA 1JU3A 1E3WB 1KQGA 1TCUA 3WGVA 1N7HA 2WUWE 4MWDA 2ZYHA 3F67A 1EPUA 5EL0A 3AQIA 3QP9A 4DSTA 2AG6A 1QQ7A 1I3LA 3O4GA 4FFWA 2UYYA 2IE0A 2GX6A 4B47A 4B40A 8GPBA 5ETJA 3MUNA 4F5YA 2H3HA 5FEUA 4ZI2A 4DR1B 3OU6A 4D9FA 4C3UA 1R6XA 3EA4A 5CAEB 1U0BB 4COOA 1B23P 3VKUA 3LY7A 4S3MA 3IXLA 4P80A 4E1VA 3ESDA 1L5HB 2J9RA 4JJIA 4UCQA 4J0EA 2A9RA 5CYFA 2DLNA 3A4VA 3KIPA 2I2AA 2AFIE 3F1LA 4DSNA 1MJGA 3TEFA 4NZMA 1KMIY 4O0LA 3IT1A 2HC9A 2XZDA 5FO1A 4KRXA 4FYMA 5IKOA 2UYCA 1WHSB 3MWLA 3AGPA 1J00A 1BS2A 1MT3A 2ZBRA 2JKZA 2X0KA 2UV8A 4F3YA 3NDRA 4MUXA 3N0XA 4WL0A 3ZCVA 3N2IA 4L15A 1UQUA 2O14A 1XXLA 3KFVA 4W9RA 2G0TA 1QK4A 2YOHA 5DFAA 4B46A 1YTUA 1K7FB 1EJ0A 2I9PA 3PGLA 5TPZA 3NP7A 3OCWA 3HB4X 4TKUA 1A4XA 1LZKA 3BGSA 2AQIA 3NT2A 4KQEA 4QOEA 1P75A 2WZCA 2Y1FA 1U7XA 1JHMA 3QI2A 3LVQE 2GPBA 4MCAA 3LTNC 5TV2A 4M87A 5ALYA 8AT1A 3EJ6A 5IK2D 4P93A 5TPWA 4JLWA 5JT1A 4W6ZA 1D0SA 2X8BA 1O0CA 1NVUQ 3JQGA 2VP3A 4NMXB 1L5RA 3PX3A 3D2CA 2YBEA 2DETA 2UZ1B 3GJSA 2PNJA 2GT1A 1CUAA 4NRDA 4BLQA 2IYZA 4DA7A 2G1JA 3ZIUA 1V7QA 3CX6A 3EZNA 3FTCA 5AMXA 2D0PB 3RAGA 2C94A 2FLKA 2FE4A 3AHCA 4FCVA 4QFMA 2COUA 4IRUB 3S5UA 1N6LA 2X3FA 2XMCA 1DX9A 4U7FA 3KB6A 2QRPA 3W78A 4HK4A 3EXIB 3CH7A 1N2IA 1Z88A 4LEIA 4EKGA 1HKHA 3BILA 2YVKA 1Z6GA 4ROSA 3ONDA 1Z8HA 3TZ6A 1OI3A 4CHGA 4QDOA 4W9MC 4EB6B 1XQ9A 4EHFA 2JDIA 1EFCA 1FSGA 2YWXA 1DJNA 5JCOC 2D7CA 2RGDA 1WXWA 1ELOA 5T6BA 1F0KA 4H4CA 1ZOIA 4QBGB 2HU8A 1KZ7B 4JBHA 3QPAA 3AR2A 3A1NA 3FGPA 2X5KO 2NYUA 3I0MA 2AJBA 5GM1A 1TYDE 1XI2A 4C3ZA 2REQB 5CJJA 2OXEA 4FMDB 3ZK7A 1Z4MA 1PL7A 2O2DA 4P7BA 2VJNA 3K9WA 3MCVA 4D9NA 5KSYA 1O6ZA 2FJPA 5F7XA 2P4EA 1PGQA 3LFHA 1ES9A 2A9QA 2OAEA 3KR9A 5KSWB 1NUAA 2BTEA 2R5FA 3F1KA 2A59A 3SVTA 3OTHA 4FCCA 2BI4A 4RKFA 3TAXA 3GFPA 4MZXA 2FR1A 1K7SN 1V9CA 3PIRA 4B74A 1T5HX 2OKGA 3B1KA 4L0CA 2P9CA 1YR2A 3A6KA 3QWAA 4JASB 4LISA 4CT5A 1RLUA 3U09A 3DOOA 3O9ZA 5ALZA 2GJKA 4ZV4A 4EGCB 1GTZA 3NYRA 4TVBA 4Q3CA 4RF5A 2B69A 3BD6A 2L2QA 1TZMA 3LT0A 1DUSA 1U8XX 4R84A 3WR5A 1MAHA 3CNNA 2F1JA 5LQCA 2X15A 3JQ9A 2G5PA 5CG1A 5C5IA 1UIRA 1Q17A 2OFXA 4JT8A 3TSZA 2VP9A 3A1FA 3CWQA 4MGKR 1EJBA 4UHDA 5CA0B 4QFCA 3N2KA 4XH9B 3UB2A 3ZE9A 5IX8A 1HEUA 4J43A 2WSIA 1E1KA 1OWNA 3OKPA 4LY6A 4NSNA 4R2MA 1K8YB 4WY8A 3W4IA 1CRLA 1O4WA 2VSQA 3OIWA 4ZT3A 1AO3A 4BVGA 5MHTA 2DUWA 2O2CA 4E14A 3WG9A 4DLAA 1E9SA 2GCOA 1DOAA 2YXPX 4TSKA 1HV8A 1MG5A 4O0MA 5AHWA 2ZIZA 4I1VA 5LLDA 4JELA 4XYGA 3NDBB 3B12A 4TUYB 3N2YA 3NIBA 2O5CA 3PLNA 2X8WA 3A3NA 3ZXYA 2H1IA 2O0MA 1X42A 1JJAA 1YCHA 3H5VA 4B3XA 3W0LB 1KKLA 4EKYA 2EERA 2SKDA 3B5JA 4OU4A 3RIEA 1NX9A 3HV2A 4N5LA 1VL5A 1FDUA 3MELA 3P96A 1XL0A 1W85B 2P0AA 4L0MA 4M1KA 3SXUA 1P29A 3BZWA 4ZZ1A 3OJCA 1C9JA 1E2FA 1JJ7A 3OPYA 2EX4A 2V97A 2WNSA 1SOAA 3D5TA 1IBRA 3PZBA 1KZ4A 2E9SA 4MS4B 4B79A 4XVHA 2HPAA 4A6EA 3T52A 4Q3KA 2KHZA 5T5QA 2QLFA 1Z5UA 1U4NA 1BE6A 1S2GA 4HDRB 3TL2A 4ZTUB 3U3KA 2HV9A 1J0XO 5AWFC 3SJZA 1U80A 4IDFA 1JFRA 2BL4A 2FVXA 2C2KA 2YV2A 4NQZA 4UOZA 4JI7B 3AVQA 1FXUA 4FFVA 1NRXA 1N3LA 1RCTE 3FF1A 1QOPB 4OLJA 4IXMA 2PL1A 1WKBA 4WWHA 1GUFA 4YN3A 2YWFA 2HCRA 1US8A 4CE6A 3KYCA 3REQA 5B64A 1RI5A 1X6VA 1XQVA 4LXIA 2GN4A 4YR9A 5K8LA 1SR8A 2BFBA 3PHLA 1PK7A 4BUJA 1P0FA 4E5MA 1CULC 3VA7A 5AKJA 3MSXA 1VJ0A 2NOAA 2EX1A 5JQGB 5LUAA 1T6NA 1K9VF 1UPFA 3BKWA 3NC4A 1GSHA 3ITNA 4LYEA 4BBAA 1R8JA 3V4SA 3ND7A 3LF1A 1PUXA 1QP8A 3IDFA 5G3ZA 3I2IA 2WPDD 1E2JA 4UFOA 4W5NA 1ZNXA 7YASA 4P4UA 3S1AA 5D7NA 1Z5ZA 4PX5A 2PD3A 3WGYA 1S9DA 3DLIA 1SQ5A