3COVA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.5 ang resolution- apo form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3covA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3covA01
1QU2A 2DEUA 3G59A 4MW5A 4JXZA 1JZSA 4JFAA 1NURA 3D6UA 3FETA 4MUKA 4PBRA 1HYBA 3C8ZA 4EG7A 1GTRA 1NZJA 5AHWA 4J76A 3IOEA 1EE1A 3HL4A 2XRYA 3FWKA 1UFVA 3GLVA 3AG5A 4CQNA 4YP7A 3L93A 1FFYA 2A1TR 1WJGA 1EXDA 1J1UA 4XFDA 2OV4A 3N9IA 3UK2A 4MWCA 3ZJVA 4EF6A 4YP5A 1T9GR 4PBTA 1OBCA 2CT8A 2X1MA 2A1UA 3SYTA 4ZT4A 1QRSA 3AFHA 2QUKA 3ND5A 4CDNA 4H3SA 1F7VA 1KAQA 2ZP1A 3HV0A 3Q12A 1JIKA 4DNXA 1N75A 2QUHA 4CDMA 1O96B 5FO0A 2CYCA 2V0CA 2J4DA 3PRHA 4ND7A 1XNHA 4RPIA 1R6UA 1NUPA 3CVUA 2DERA 4ND6A 2WQ6A 3OP1A 3IVCA 4OJMX 1I6MA 1R6XA 2QTMA 3KT0A 2A84A 1QTQA 4ZT3A 4NATA 2ZUFA 1MJHA 3ND6A 3H05A 4MUHA 2A1UB 2OQ2A 1TQ8A 1IQRA 4MVWA 1YULA 3IUBA 1PG0A 1NI5A 3RK0A 3IOCA 5LFAA 1IRXA 1KQPA 1WXFA 3RK1A 1U7DA 4MUGA 1EFPA 1QU3A 3IODA 3F3MA 2R5WA 4U7JA 1JECA 1KP3A 1M1ZA 1OWOA 1SURA 1WXGA 1WXIA 4MWEA 1MB9A 3P52A 2VTBA 3COWA 2AKEA 4U8HA 3PNVA 3FH0A 3HFJA 2IP1A 3TS1A 4OUDA 2V0GA 3TQOA 3KT8A 4YP6A 4ZCPA 3KFLA 4WSOA 3SZGA 2Z09A 3LE8A 1N2BA 2PZAA 4KR9A 1H3FA 1ILEA 3QTTA 2PZ8A 2NZ2A 2DXIA 1MB2A 3LOQA 4I6GA 1QRUA 5DB4A 2CUZA 2YY5A 3L92A 2A88A 1WQ3A 4HK4A 4I6EA 2WB2A 3N05A 2DETA 1NUSA 5IJXA 3AIIA 3A2KA 1M8FA 4MVCA 1FYDA 4ZCTA 1U7XA 4JZYA 4MW0A 1VBNA 1IQUA 3CLSC 4KR6A 3QTBA 1GTSA 2VTBB 3G5AA 4NAHA 5DEOA 3CLSD 5TEVA 2PZBA 1KH3A 2Z3VA 1ZJWA 1H1TA 3H9CA 3DO8A 1KAMA 2CV1A 1M8JA 3FY4A 3AL0C 1NP7A 2A86A 3N2YA 1WXEA 3ZXSA 1G59A 1NUQA 1T6ZA 1MC1A 1KP2A 4G6ZA 2CV2A 1T6XA 3HMQA 1D2RA 1JMVA 5J59A 4JYZA 1O96A 2E21A 2A4MA 1MAWA 4GRIA 1Q15A 3X1JA 5K0SA 1I2DA 4MW2A 4MW1A 4MUIA 2QJOA 4K03A 3MXTA 1WZ2A 4X0EA 5FNZA 4MW9A 1IQ0A 1KR2A 4L2IA 4KR7A 1O97C 2Z08A 1KKUA 2O8VA 1U3CA 1V47A 1M8PA 1O95D 1KH2A 2QTNA 3TZEA 4EG6A 3FDXA 1O97D 2RD2A 3E27A 2A7XA 3ELBA 4EGAA 1JILA 2IELA 3ZGZA 1TYAE 1N2JA 3VRHA 1X6VA 3AG6A 1GLNA 1YUNA 2AG6A 1OBHA 1PFWA 1NUTA 1IH8A 4J75A 3INNA 5IHXA 5J5AA 4ZT6A 2QTRA 1TYDE 4DDKA 1OWNA 1I6KA 4K0RA 1O6BA 2O5RA 1U0BB 1KH1A 2QUIA 1F4LA 4L2IB 2DUMA 3ZIUA 1LI5A 3P0IA 3VU8A 1IHOA 1M8GA 3QE4A 2HMAA 1OD6A 3DV2A 3H97A 1VBMA 1O94C 3UMVA 3SEZA 5H7XA 4GU5A 4YBRA 3UC5A 1O94D 1T6YA 5LLTA 4PY2A 4HJXA 1XNGA 4NAUA 1DNPA 5DK4A 4QBTA 2J08A 2XRZA 1F9AA 4DLPA 1JIJA 1U3DA 4YMIA 1WOYA 1IVSA 3P0HA 4MW7A 2CV0A 1YI8A 2E0IA 4R2LA 1P7PA 1CT9A 3HZRA 1H3NA 1VBKA 2IJGX 1YUMA 1S4MA 3D6VA 2J09A 4ZT7A 4ZCRA 3MLBA 1ULHA 1OWLA 2NSYA 4CT0A 4DE5A 4ZCQA 1PFVA 3ZJTA 3IMCA 4MUJA 5J58A 1COZA 4QREA 3SDBA 4MW6A 2D5BA 4WNYA 1F7UA 4UZEA 4EG5A 4AS1A 3IUEA 3FI0A 3TZLA 4PBSA 4MWBA 1O5TA 1OWMA 1JEEA 1GZUA 4KKVA 2DR2A 3K9WA 5KWVA 2YWBA 3Q4GA 4DJAA 2DLCX 2DPLA 1N77A 2J07A 3FG9A 3GMIA 3Q10A 2HGZA 1VLHA 4EFKA 1MAUA 4MVYA 4AQ7A 4MVXA 4MUEA 1KORA 3RBAA 4F3RA 5TS2A 1A8HA 2CFOA 4MUFA 3JXEA 3IOBA 2JAXA 3X1MA 2GOYA 2GKSA 1K4KA 2EL7A 3A4IA 3MMXA 4MUNA 1H3EA 3UOWA 3PNYA 3CVWA 5JBNA 4ARCA 1OWPA 1XJQA 3RFFA 3TNJA 1EUQA 4NX2A 3N8HA 3H99A 3S3TA 1TEZA 4E1AA 3ND7A 2G36A 3ILVA 1G8FA 1B6TA 1LW7A 3NV7A 3VGJA 2JANA 1WKBA 5BNZA 4DDHA 3ZJUA 4MWDA 2PFSA 1J09A 2HZ7A 1GN8A 1QQTA 2E18A 1JHDA 2EJCA 3RJZA 1N2GA 1N2OA 1TYCA 2BTEA 4RUKA 1O95C 1V8FA 1M8KA 3RHSA 1WY5A 2D13A 3G6KA 4NDAA 1J21A 1KQOA 3I05A 2RE8A 2CSXA 4MULA 4JXXA 5K0TA 3U1VA 2AZXA 1QJCA 1NUUA 2YWCA 3FIUA 5TGTA 3FNRA 4TS1A 4ARIA 2H2AA 1NYLA 1J70A 2GM3A 2E89A 1TYBE 3BL5A 1ZUNA 4EG4A 3SZ3A 1J1ZA 3X1KA 4XFJA 3GUZA 2D54A 3CLRC 3K32A 4Q16A 5H16A 5KCMA 1N78A 2QJFA 1O0BA 1G8GA 3SEQA 3IMGA 3CLRD 3NBAA 1O0CA 1EFVB 1I6LA 3SP1A 3MLAA 1Q77A 3NBKA 1VL2A 4Q93A 2ZUEA 2C5SA 1ZH6A 4KPUA 5F23A 3A05A 1XNJA 3M5WA 3FHJA 1RQGA 4HPWA 4A91A 3IH5A 3CVXA 4QRDA 4R2MA 1JGTA 1ZH0A 3AKZA 2JA2A 2X0KA 3A04A 4MAFA 4NZPA 1PG2A 4I6JA 2I1LA 4R0NA 3OTWA 4ZT2A 1PFYA 2VXOA 4XSVA 1N2IA 3KT3A 1QRTA 3IMEA 1GPMA 2TS1A 4EG1A 1WQ4A 2WSIA 5DASA 2H29A 1N1DA 1IFXA 4HJRA 5EKDA 2X1LA 1BS2A 1QNFA 2CYAA 3COZA 1K4MA 4G5FA 1K97A 2PG3A 4S1OA 1YIAA 3CLUC 1JZQA 4KPUB 4EG8A 2J5BA 1WXHA 2BYTA 1R6TA 5TEWA 4G5YA 1MRZA 3H9BA 5LM3A 5HG0A 3CLUD 3CR8A 1MOPA 4BWVA 3UY4A 1JIIA 1YIDA 2QUJA 4EG3A 5HUHA 2WQ7A 3DPIA 3LCJA 4ZCSA 3ZUGA 2PXHA 5HUJA 1Q11A 3HGMA 1MBZA 2A1TS 4MW4A 1PFUA 3COVA 1J20A 1N3LA 3CA8A 5FO1A 3CVYA 1GAXA 1N2HA 4DDMA 3ISJA 3IVGA 1K92A 2QJTA 1T9GS 1NSYA 1LI7A 1M83A 3P0JA 2B7LA 2YXNA 2X3FA 2CYBA 4F4HA 1KQNA 3CVVA 1EFPB 4MQ6A 3CLTC 1EUYA 3DLAA 5KHAA 1Q19A 1N2EA 3IVXA 4ZT5A 3CLTD 3PXUA 1EJ2A 1X8XA 2PIDA 3ZXIA 3FOCA 1TFUA 3COYA 4OUDB 1Y42X 4FZJA 1G8HA 1JEDA 4P2BA 3MUEA 3KT6A 1EFVA 4MLPA 3PNBA 4UZFA 3TQIA 4U63A 3IDFA
chains in the Genus database with same CATH superfamily
1HDIA 4KVAA 3VTZA 4EATA 1IG3A 3WYGA 3DVAB 1QIJA 3O8OA 1PLKA 1V7PC 3G7NA 2A58A 3ST7A 4KBYA 3QNUA 1RI2A 1WDTA 1YMQA 1ETHA 4M1KA 3TRHA 1L5RA 2FUNB 2ZE8A 3DFIA 4J76A 1G60A 2IITA 1V7ZA 3NPAA 4XH9B 3TG2A 3U3OA 1OBOA 4BUZA 3T7JA 2CY0A 1XPOA 2NZ8A 1AZTA 3OBBA 4U39A 5AKZA 4YIHA 1SD2A 2XEDA 2DPMA 1MORA 1JUDA 1X9GA 3ORRA 1C3OB 4HTFA 2ZJ7A 1KO8A 2HDNB 3VJMA 4PONA 4PGMA 2E9SA 4TL7A 1A2BA 1E3SA 4JXJA 4I5FA 1E59A 5LQDA 2QVXX 5JROA 1Y4DE 3H5TA 4IO1A 3AR6A 4K6MA 3F97A 3VI4B 1YKGA 1NDQA 1XSEA 4YRIA 1DDOA 2GPYA 2YVQA 4HC4A 1Y5IA 4L5IA 3IJEB 1RHQA 1UAYA 4M1SA 5E6RA 3GJQA 4DREA 3UKJA 2J7PA 2XXJA 5C81A 2PSHA 4O1HA 5C53B 1ZJZA 2C83A 3DDZX 2AA3A 2FMKA 4G4GA 2JD0A 4ROTA 5CDFE 1YA8A 4H3SA 3S2EA 4I5EA 3BQ9A 2PE5A 3KQKA 2CXUA 4Y0VA 5EMKA 1RBZA 3ZW9A 3PFHA 3MHTA 3IESA 1SC4A 2DM6A 1G4UR 3PUVA 4ABTA 4TZ0A 5JDIA 4DSNA 4GZ3A 3IEUA 1IJBA 3WIDA 3F1LA 3MAAC 4PX5A 2DFDA 2ZDGA 3CYFA 3DMTA 4ND7A 2BGIA 3UH0A 4DHEA 4Z0TA 4G41A 3H2HA 4B32A 2W2KA 4WOKA 5HOQA 2WHPB 1ENYA 3IQEA 1JE1A 4C7BA 4J2TA 4TV9F 3UH1A 3ESBA 1TRHA 4KQGA 1Z5WA 5HRAA 2HR1A 5DW0A 3QWHA 5I5GA 3PXGA 1M66A 4MKGA 1VLQA 3VJRA 1QH0A 1U9JA 4AAYA 4XLLA 1G2OA 2VCHA 3WADA 3DFFA 3KKQA 1XG5A 3ACCA 2XDYA 3OCZA 4BUCA 5JTUA 3E1KA 1MR3F 1XQWA 2X9VA 3V8PA 3FPCA 1UMKA 3URMA 4V38A 2PLWA 3Q72A 4L7QA 3VPGA 1UQRA 2R00A 1BS1A 4N82A 3RDPA 4E3ZA 4F4FA 1J0EA 2FX2A 4MUGA 3HM2A 3K5WA 4JEMA 2FUG1 3TNFA 5LQRA 4FI3F 2X4LA 1O6CA 3SEAA 3VISA 1U0JA 1WMDA 1NN0A 2O4CA 1YMUA 5ESXA 4Q1BA 1QE3A 5KOJB 4PCUA 2WVGA 1F0KA 3EG9A 3EFHA 4UC0A 1UOOA 1E3QA 4QQFA 1X2EA 3QU7A 1RQ7A 1WW3A 1GILA 3JYNA 4WSOA 1J8DA 5BN4A 5J3JA 5AW0A 3C3WA 5D7BA 3KDAA 3OE7D 4EFMA 5B5SA 2AR7A 4YMVA 2X1VA 5I4KA 2YDYA 4Q1AA 2QVCA 1I4TD 5LN1A 1DEOA 5JD6A 2WD8A 3SYLA 1I1OA 1L9XA 3CFFL 2H4YA 4KXWA 1LXCA 5FD8A 4OYRA 2PZKA 3MINB 2A88A 3OZUA 3C45A 4AJHA 2YHIB 2VH5R 4BVEA 2P75A 3IP5A 4DA8A 2DZDA 3P7MA 4H0NA 4DBLC 1ECBA 3E22A 4QFCA 2OV2A 3R3SA 1KZHA 2ISQA 3QPAA 1X7XB 1W88B 2WT9A 1ZITA 1QGYA 3G1UA 4G1EB 4MV4A 2V1XA 4XFKA 4H1UA 2VHVA 4FYMA 4B09A 5JYDA 4LRXA 1Y7LA 1IN6A 1ZH4A 2PXXA 3NIGB 5FOXA 3QX8A 1GTSA 1HTWA 2AJDA 4Q37A 1X80B 5U4QA 2V7PA 4ER5A 3WLHA 3M83A 1XZ8A 1R4MB 3OLZA 1ZJWA 5BY2A 3CINA 2ZBVA 2NM0A 4I8IA 4KQJA 4NYIR 4Q66C 1IONA 2AWNA 3PBKA 4C0QC 1C80A 1XCBA 4PX2A 4IGIA 2X8BA 1P7WA 2HFKA 4RTKA 4J94A 3TLBA 1D2MA 4KAFA 3OIYA 3ZHSA 4NESA 3B12A 1FDTA 2O06A 1VCOA 4B7XA 3JQ7A 3PD1A 3GDFA 3PL1A 4IQ0A 1XTIA 3D3QA 5B7GA 1UJ6A 2YWGA 3CJRA 3MS2A 3AVXA 1M73E 4Q3DA 3ZDRA 1H4SA 4GT1A 2MWMA 3HMQA 3T1NA 1D2RA 4JI8B 1D5CA 2K4MA 3DMDA 3E5RA 3EZFA 1AS2A 4UMVA 2ZDQA 2WTXA 4BKUA 4Q3KA 3FPHA 3O95A 1ZPDA 2C4NA 5K0SA 3GFBA 3G2MA 1SXJE 1RYZA 3A4MA 1KI6A 2ZR7A 3B8HA 3O8NA 1IEVA 3R0ZA 4XARA 3WOVA 4K03A 3PR2B 4BQQA 3THWA 1I7DA 1E3LA 1I7NA 2QTVA 2FW1A 5KDDA 4Q1DA 4MIOA 4LY9A 4A6XA 1QP4A 2CCGA 3KPJA 5FKJA 5T4EA 1I36A 1Y5RA 4M9QA 1KJ8A 2A5GA 4OQQA 4X3PA 3L7KA 2BCJQ 2H08A 2VK2A 4K8OA 3TIGA 1ONNA 5GGXA 3ELBA 4JLKA 4YPVA 2RD2A 1R3UA 2FFHA 1I2AA 3P9YA 4IJUA 4P92A 1OFGA 4D56A 3KTDA 4K9LA 2VP9A 2RHDA 5DNUA 1IE3A 4LVCA 5LYYA 3G8YA 1GWNA 1E60A 1BW9B 3AUYA 2Q9UA 2OORA 1U8AA 4I14A 1ULUA 1KSHA 3GBVA 1R5JA 4EB8A 4OYHA 3R44A 1RWBA 1X38A 5LNK1 3SS7X 4Q02A 3GLHA 3MPUA 3U3MA 2CUTA 2VP3A 3WYDA 4EARA 2HWYA 3MOGA 3OZGA 1G9SA 1JPJA 3TOSA 1Q1ZA 1J5PA 4LOIA 2YIVX 4Z9AA 3OJFA 2R4UA 3C3BA 3A9VA 2Q0QA 5DX0A 5DNWA 4C01A 1QYCA 3TZ6A 3AR7A 5E8JA 2WWRA 1C9EA 1UK7A 4L2IB 2Y71A 4TYQA 5FPHA 4I3HA 4JBHA 1HT0A 1CXZA 3VU8A 3OPYA 2Z1NA 1O9GA 1NJ2A 3G3EA 1ZBDA 3QE4A 4AN0A 1PP4A 1QLHA 1JEQB 3D4NA 1II8A 4IILA 3KAQA 3BKWA 3HI6A 3Q3CA 4B6EA 1CQIB 5AUPB 2YL2A 1DKRA 3HRHA 3UXYA 5K8JB 3EZ2A 3K1YA 3IB3A 4YP1A 5I9NA 4HH3C 5DO9A 4PAWA 3C5VA 1WEKA 2RHWA 4BO8A 3UC5A 2O8FB 1KK3A 1YHNA 2HBZA 2X3YA 3A6LA 4MS1B 5C31A 5DNEA 2WKWA 3N1UA 5BO5A 5BWLA 3BB4A 1PSDA 1V1JA 2O8NA 1U2DC 1F9AA 1TDJA 4MGIR 1GU7A 4D9BA 2XKBA 4WUTA 2H2GA 2I4MA 3EUFA 5ABPA 1DC6A 1UPFA 2HA3A 4GIBA 2B6HA 2BL4A 1YE8A 3M3PA 3MD9A 1RJDA 3M5DA 2IYSA 2VIIA 2VK4A 3V4PB 3T3NA 1G8JA 4ZCRA 2I4TA 3AEQB 2AG0A 3NBXX 2O1SA 5T4BA 4TRRA 2O3JA 4RZQA 1M10A 1ZI9A 1FS6A 2YN4A 4TKUA 4MUJA 1LV8A 2HI0A 4X44A 1QR2A 3MRVA 5IKXA 2A5FA 2O5VA 3M2PA 3OZIA 5BW8A 2BM0A 5TVKA 4H6WA 2NXWA 1D4OA 2ZIFA 3RJMA 2EJBA 1GZUA 3M3HA 4C21A 1CUAA 4H3HB 2CZCA 4UUMA 4K1XA 4DJAA 1JHZA 2YXEA 2VPWA 2FWNA 3VZDA 2VI5A 3BWXA 2JGLA 3UMYA 4I5GA 3U7QB 2PVPA 5T67A 1CIVA 3GLIB 1LBQA 1VTKA 3TG8A 3QU9A 4PG6A 5DYIA 3ZZNA 3MA0A 2YXBA 1R9NA 5BYKA 3WP1B 3C3YA 1T1RA 2G0AA 1JVSA 4QYIB 1ECFA 3D2BA 3TZQA 3ZS8A 1DWUA 4EJ0A 3ER6A 1HKHA 4MUNA 2GA8A 3FFAA 3DO6A 4GNRA 1VE9A 2Y67A 3QLTA 2HTEA 3E9ZA 4RE5A 3QFRA 1XWIA 1GIAA 2PKYX 2WTNA 2XUHA 1GPH1 3OZCA 5KYXB 1PYGA 2V6GA 5A7HA 5KS2A 2K2WA 4X6UA 3BC1A 3GD5A 4P6VF 3QVGA 3ELWA 2OFWA 4RY9A 4XQGA 5KVVA 4EFDA 3ND7A 5HIAA 2I52A 5KJ6A 3PA6A 4WA7A 1VHJA 5BUSA 3RWMB 2VDPB 4KK3A 2FPSA 3UF0A 1YDMA 2PANA 3PPWA 5DLYA 1KQ3A 1RQLA 4IUDS 1H22A 3FKSA 4YAOA 3T7DA 3WJ2A 3ZJUA 5KYWB 3KX2A 2W8BB 4JROA 1UANA 2J9XB 2QGFA 1B8VA 3VNQA 3WNVA 4F7DA 2ZUVA 4R5MA 5BSMA 1H9CA 3H87A 1O58A 3I76A 4NKRA 5CXSA 4JLSA 1BJTA 4NI5A 4CKCA 3K30A 3KOMA 4RC9A 1XXLA 4H77A 5IYZF 2WAOA 1BU8A 1FRQA 1NVBA 3C8UA 4RHYA 1PNRA 2UUPA 1JMYA 5FA6A 2P2SA 2PRSA 4ACBA 2FEMA 3PDWA 1J21A 1GAJA 3GHYA 4FILA 4JB8A 4OKIA 3NJRA 5DP1A 4D8YA 4N12A 3DL4A 3EA4A 4NV3A 1RAAA 4F3NA 3ASYA 3T9AA 5LOVF 1O3YA 2Y68A 2B2XA 3F1KA 1MH9A 2YWCA 4ZALA 2PMFA 1TMKA 4YRKA 5AXDA 2VF7A 5L9AA 4MUBA 4XIYA 4D99A 4G0NA 4PHGA 3C14C 4WERA 2GM3A 1BCRB 2WE8A 1TA9A 1I5OA 2YWHA 5HQJA 5BV8A 1OPRA 4ONEA 4DG8A 3SU8A 5HVNA 2ZIWB 3GDHA 1OFTA 3H2JA 1VIVA 3FJOA 4R1LA 4NU0A 3AM4A 4BASA 2RI1A 4HGYA 1W85A 3K32A 4P7FA 4XVHA 1QQ5A 2IV3A 3UQYS 2FW6A 3ZGOA 1UFOA 2YBDA 2HSEA 3MTEA 4TWRA 5LB4A 2AX3A 4V24A 4D0LB 1SFRA 1NVVQ 3PUIA 3ER8A 1XQVA 2HUNA 3MLAA 4R2WA 4UASA 2CLEB 2PUJA 1U7TA 3LP8A 1Y33E 3HJNA 1EWTA 3EE6A 3EMKA 3VBEA 3BK7A 2WYWA 3WRVA 4HS4A 5BSGA 2PEYA 2PXAA 3V7FA 2J85A 4XX1A 2EZ9A 4YC7A 1R27A 1OILA 4TMYA 1EDDA 5DBOA 1NC1A 4IJ6A 4M9RA 4W1QA 1Z6ZA 3KIPA 1JXMA 4JVMA 2CXTA 5AJHA 3L0BA 4M1OA 1EE9A 1MH1A 2ZWVA 5FAKA 2FPGB 1Q12A 1R0KA 3DE5X 3OP4A 2QZ9A 2ZITA 4A0GA 3UB3A 4JHLA 4HDOB 3ND9A 2BKUA 2ZAMA 3CF4A 3L05A 4CLOB 1J39A 1N7GA 3LWDA 4B74A 4D8VA 1ZD3A 3LBHA 2B4KA 4IH1A 4UFPA 1IY2A 1M2VA 1BYIA 1SVNA 2N47A 2WSIA 3TZBA 4D8UA 3HDJA 3VKUA 2QX4A 4CTJA 1SXJC 1I5EA 3ZLJA 1L6IA 4CI9A 4LFAB 2VNSA 5F35A 3O4JA 2ZRFA 3RUPA 1SNYA 3MYRA 2GYYA 1RWNA 5HKAA 3UENA 2V9PA 3HYTA 1XEXA 1YIAA 1JJ7A 1RYMA 1YZGA 1ISHA 2FP4A 2ET6A 3G2PA 3NW9A 4AMZA 3A4VA 1F2UB 4X7BA 3KXDA 2GERA 3QXCA 4Q6WA 1RAGA 2JKZA 3LT0A 1L5NA 4O8CA 3ID6C 1KS9A 1LCIA 2G6TA 1B43A 1JBEA 2RGGA 2ZJ8A 5CT6A 2IE0A 4J1SA 5AK3A 4C3ZA 1YE5A 1WHSA 5K0JA 4D3ZA 5ALRA 2WWYA 2BKAA 4MVJH 2VKTA 3EISA 5CB4B 3O7MA 3VR4H 3HY4A 2HSWA 4I4CA 3CISA 3LCUA 4RTMA 4D26A 1US8A 1SPXA 1LZLA 1Y80A 1KVSA 4KIJA 3HDGA 3UWDA 2UXDB 2F90A 4NICA 4ZYVA 1I32A 4MW4A 1KS2A 2HMSA 3WGVA 2YQ5A 2REXB 3PHCA 4B6QA 4E1BA 4EYGA 2V7TA 3JWGA 3CVYA 2QVBA 1WVMA 5MN5A 5JYBA 3FB1A 2IX3A 4ARVA 3G2IA 1RJGA 1X7YB 1NSYA 2JHCA 1BOOA 1M83A 2A33A 2EAUA 1P4GA 2WJAA 4HAVA 4CMEC 3M4YA 1EUCB 4ZZ3A 4CM8A 3HBFA 2ILVA 1E3IA 4YO8A 4V0NA 5CJ2A 5AQEA 2DRIA 4DJTA 5L40A 2G71A 1H69A 1S8FA 3QNWA 4WKOA 3ZV5A 4PZEA 1K75A 4MQ6A 3CLTC 3JSXA 3O2SB 3KP1A 3FTPA 3CKKA 2PUDA 1T3HA 4FMDF 4GXNA 4MRMB 1Q19A 2H1LA 4A16A 4L0QA 2UUCB 5EP1A 2IODA 1CZHA 2OHVA 2JLBA 2VAPA 3IULA 1AQYA 1I3KA 2BHLA 2CWDA 3C70A 3MK31 4JCOA 4KZPA 3M0EA 5ALYA 1GA4A 1P45A 3UWMA 3TJZA 4L50A 4OUDB 3TMAA 5LP1A 2H18A 1IXSB 2X42A 3OY2A 5C3MA 4NBNA 4GMFA 2VZEA 3RSLA 1G2PA 1DMSA 4CKYA 3PHBE 1NE2A 1E1QA 5IAAA 1AURA 1SN7A 3KUXA 3L6BA 1G5FA 3QUCA 3AXSA 2YWJA 3ZGNA 1VMAA 1NZJA 4FFVA 2RHOA 4MPDA 1RVDA 1V3TA 4QD3A 3A1TA 1S0UA 1R15A 1EE1A 3OUUA 4H6XA 2PL9A 1T3TA 2NZXA 2YVKA 2Q27A 3IXMA 3L4BC 3HCBA 1RLMA 3I42A 4JP1A 4E4RA 5AHOA 5ALGA 3SJAA 3VVBA 3ZYZA 5JAIA 3JZFA 3U6KA 4Z54A 1RXSA 3NYIA 1W25A 5B7PA 2HA5A 5AVKA 5TY0A 5FPYA 3ZY4A 1H5NA 3N9IA 1B26A 4JL6A 4X60A 3MGGA 2CB0A 3KBOA 1SK9A 4MWCA 3GLFE 3PZRA 4B76A 2A92A 3H11B 1N2SA 3QYAA 1B73A 3AERB 1U2GC 3J80A 3HGQA 1JJIA 1NJ8A 1QHYA 4YRMA 2VH1A 5CLJA 4WA8A 1T9BA 2D06A 1OFUX 5CFZA 1V8PA 1X39A 4LI0A 4RD2A 4PO8A 3DW3X 3M6WA 4TTJA 1IU9A 4YV0A 3LT4A 1RPZA 1HYQA 4M7OA 1AV7A 4O3FA 3CPEA 3NB0A 5DDIP 5JD3A 1XZFA 5ELXA 1NQWA 2IEYA 4K2HA 2ZP1A 3V4LA 3E7FA 2I8AA 4I5DA 3QH4A 2P0EA 3AB3A 3K0BA 4CDMA 1M6VB 2CYCA 2IU6A 2Q7XA 3O82A 4G84A 5EEGA 4QQNA 3MQ4A 1YBFA 1HZJA 2W2TA 1QB8A 5F1OA 3DEAA 2UZ0A 3U62A 3QG1A 5B1EA 2QMQA 4KXNA 5BRAA 1QQAA 3ZJVA 4FQ5A 1E0AA 3HEMA 3QRWA 4ZOLF 2HRCA 2Y6UA 1PJLA 4BNFA 1VL5A 1XK6A 3EGOA 4GHWA 1TUGA 1B4DA 1SMKA 2JBAA 2QRUA 2WC1A 1R4NA 2C59A 2WMDA 4IDOA 4TM7A 4PRZA 2HUPA 2WZDA 1PT7A 1U8EA 5D3QA 5ALZA 2VDWA 4ZDKA 5DI9A 3F5SA 1HE3A 3O5AA 4LN1A 1BC5A 5AYVA 2UUAB 1HXHA 4TMTA 3TQQA 4B85A 1YAHA 4C2BA 3AM3A 1JAZA 2ZSIA 3DBHA 3T54A 1AGRA 2YH2A 3FNQA 1TMOA 1BE0A 1O08A 2VDUE 1RM5A 2I4LA 2KBFA 2XQJA 4PLTA 2G5CA 4R9VA 1NX9A 5HRCA 4KV9A 4AO7A 4IGAA 3IOCA 4WZBA 1SOAA 2K5UA 5TF0A 3ZTYA 2P6RA 1IRXA 1F2DA 1KQPA 2QRHA 3EVBA 4GVLA 3BRCA 4HPJB 4I55F 1P3JA 1ECGA 4N3GA 4OXRA 4WN9B 5FQOA 2MMCA 1DCKA 1AZWA 2BN4A 2JFOA 1KBQA 3WL6A 1I9GA 4LHYA 3SYNA 2NUBA 4Q9NA 3SOZA 1Y7PA 1J2UA 1S5PA 4HNUA 4QLAA 5B36A 1QCZA 3U09A 2DUJA 4KBGA 3F5MA 1L8LA 4TMWA 2HJRA 3AM1A 1SXJB 3ZDXB 3OIFA 3SQXA 2IP1A 3GJ8A 1FA9A 4C4AA 4CUZA 1FFEA 1P5HA 4QOSA 4C30A 1U7HA 2YQ4A 3WGHA 2X7HA 4HDSA 2BM9A 1QLJA 3MJSA 2DQYA 2UU9B 3QE0A 3U0VA 1NPYA 1QGUB 1V1RB 3LQQA 1SPBS 2OAEA 4R3WA 1HFWA 3UAGA 1UDWA 1E32A 1KJWA 2AOUB 1XPRA 2VQDA 4QYTA 1EIWA 1EJ0A 5LLSA 4ETWA 2JFQA 4TLAA 5DB4A 3UATA 3GRUA 4HMOA 1F4VA 3QE2A 3LO8A 2RG7A 5LP6A 3I8SA 1ISPA 3E8MA 4UUPA 3K3PA 3LHFA 5F2NA 2FCRA 5AKYA 2B1IA 4MVCA 1TIKA 5TB5A 3H2GA 4UJ3A 5CD9A 5KDOA 5FBKA 1M5RA 4JVNA 3QXJA 3GVCA 1J22A 1YK1A 4N76A 3TCNA 3QTBA 2ZRDA 3COPA 3WLTA 3NASA 1NYTA 4BQRA 1FYFA 4V0OA 3U56A 2RHRA 5KTOA 1NKVA 1IN4A 4BFVA 2HF8A 3RSOA 2RC5A 1C1YA 2O2EA 2FVXA 2X13A 1R00A 2FFQA 1YR1A 2VKQA 1MV5A 3KVVA 4FGLA 4F6LA 4WOCA 1UKCA 3NQ41 2ZR9A 2PBFA 3VSBA 3D0KA 3M4NA 3FXAA 2Q5JA 4PGHA 4UTPA 5C1DA 2KI5A 3AKEA 4RMJA 2AC4A 3DTYA 2AL7A 5IFLA 1ES9A 4R7TA 4D44A 5TMEA 1Y1KE 4G6ZA 4N48A 1Z4IA 2BIFA 4BNWA 1B0AA 2QL5A 3JR7A 3TE7A 3WTBA 3EXIB 4LXUA 3O74A 5ILOA 1C30A 1O96A 3DPSA 3E61A 4D4JA 4RPHA 3KL4A 4G5RA 3QKWA 4YRQA 3NR2A 5EXXA 1YNSA 2HPHA 4EZEA 3IP3A 1A4RA 3IHWA 1V1MA 3NH6A 3M6AA 4JEHA 2BFBB 3UG7A 4E22A 2KX7A 4RKWA 5EN4A 1OH6A 4EI9A 4UNIA 4JJKA 1YVUA 4HEJA 2PZLA 1NM5A 2OFPA 5ELLA 3WGLA 1U65A 2QRLA 4OOFA 3H9GA 3MFQA 2AZDA 3U4CA 4EB6A 5AD1A 5FLXA 2W0SA 1JKMA 1BX1A 3CNBA 1SQ0A 2PAFA 3GJTA 2I2AA 1I14A 1B23P 1SCUA 2OKCA 2OOSA 2B4RO 2OFOA 1X8KA 4A8PA 1QVWA 1KGSA 3U4MA 1FY2A 4F56A 3I61A 3OF3A 2GZRA 5ADWA 5KNCD 1UIMA 2XUFA 8AT1A 1GGKA 1MDBA 3FTFA 5AVWA 2AD5A 4YCSA 1VIMA 1P2DA 3LU1A 4TGLA 2LUOA 3VBCA 4TXMA 4COKA 4HQLA 3GZ4A 4UU7A 3E2MA 3K05A 3MMSA 3WSWA 4BMOB 2X5OA 1WOMA 2C2ZA 3MWYW 4W5WA 3DVQX 4CIYA 5JSZB 3COJA 2ATEA 3KETA 2DSTA 2F48A 3WA6A 2A0FA 4Q3OA 3ZXXA 1J56A 2F1OA 2R48A 2CNWA 1FXUA 1N1MA 2C20A 3LLMA 1MB0A 3DMPA 1RQPA 1QDEA 1VJGA 2HMWA 4PR0A 5CP8A 4B46A 5KWJA 1DUSA 2AE1A 3A31A 3BA6A 2V6FA 1RRVA 4CMHA 1Z5PA 2ZBEA 4QUJA 5C18A 2ORED 2X76A 1T2EA 1L7NA 1TK2A 3CGGA 3KUDA 1M8GA 4NYMQ 1YZHA 4IMIB 1N1EA 3ABSB 4OUKX 2PL5A 5LYJF 3BCUA 3N2KA 1HLGA 4J7AA 4EVIA 1N1GA 4ZK6A 4MXDA 1O94C 2GEKA 3DF9A 4CL8A 3SEZA 5EUBA 3LH5A 1Z2AA 4QYMA 1R4AA 3OTGA 1X42A 1NYRA 4CLRB 3BD8A 1IAVA 2D3TA 4LQCA 5CVCA 3I2HA 2OVBA 4RKEA 2ILTA 2PH5A 1QGAA 1U2EA 1YNOA 4HJXA 5BN5B 1FP7A 1ZL2A 2DH5A 5C7IO 5CURA 2YJZA 1V41E 1U0RA 4CG3A 3DWGA 3EQ7A 4IRMA 5IDXA 1TO6A 2P2CA 1A5AB 2H48A 2Q5FA 4O8ZA 4BNMA 5AXCA 2WUEA 4AZ0A 1IBMB 2I62A 3SS8A 1U6JA 3UN1A 3MJFA 1C9JA 4MMZB 2Q99A 2OAGA 5DF1A 3OSUA 1JLKA 5A5EA 1PJ2A 1K3FA 1ORHA 3CX6A 1JDPA 3NU1A 4PFQA 1TCAA 2JEYA 4JT4A 5CTJA 5DTEA 4A36A 1H6CA 4BJ1A 3GLSA 2BEWB 3O03A 4R51A 5D3KA 3FCAA 5ALJA 3V33A 3ZJTA 1AIPA 5C7LO 5J58A 3VZQA 4BNVA 3RBZA 3SDBA 1I4EB 1Y1SA 4XKJA 1ZM3A 4BIIA 4WNYA 4F5YA 3DEFA 1NF9A 1YDGA 1IAQA 1FUEA 4R7ZA 5J2TF 1CW2B 4MWBA 5DPMA 5AM2A 2ZWIA 1QRAA 5EMNA 4OHOA 3M1LA 2PGLA 4GOOD 2YWBA 1KWKA 4J0CA 2JLZA 3OLQA 1IOWA 3FJ1A 3BFPA 1NVAA 2PV0A 1SEPA 5DHQA 5AW8A 3R0XA 4U8GA 1S2NA 1Q0TA 4K3VA 3Q7QA 1ORIA 4PO9A 1YDFA 4ZQGA 2CFOA 3NM4A 3E0QA 1QKJA 4OFBA 3KJIA 2PYZA 4GI5A 5YASA 4M89A 1HF3A 3QBDA 3R7AA 2NSJA 1PTJC 2XI4A 3DOIA 1JA1A 1QGZA 1KEWA 1Q44A 4DLRA 4L9SA 3PNYA 1JSRA 1SXQA 3IIEA 2DAPA 4O4LF 2JBWA 1PF7E 2BGNA 2W0MA 1YHZA 1NVVR 2XYVA 3LYHA 3E70C 2ZQZA 3TNJA 2VUIB 3WMFA 4BQNA 4TTVA 1BHO1 2YJTD 1XQXA 2ZIXA 1TEZA 4U6SA 5TT1A 3UXMA 2PH7A 3KOOA 3FNIA 3H2SA 2Z4TA 2DMRA 4H4CA 1VMDA 3PA8A 4LYEA 1FTYA 1PS9A 4QT0A 1ZOSA 4DAEA 2P5SA 4I1OA 3L41A 1ENPA 3SZUA 1PVVA 3EQ6A 4I4TF 3KWJA 3OU6A 4EHNA 2FCAA 2JANA 4PLPA 4F8EA 2M6KA 4I50A 5EY5B 3JASB 4ZI3A 3GLHE 3T3GA 2L2QA 1XTBA 1SEVA 2PKRA 1PDVA 3AU8A 3U1BA 2FE4A 1NXQA 3F7TA 3GWZA 3SJUA 3WB9A 2RAPA 1BMFD 4QJ5A 2WTAA 1TYCA 5C51B 4JODA 1BXGA 4TWAA 1RLIA 1ULZA 1J8MF 1SC9A 2UYOA 3AVQA 5CMLA 4TV8F 5AM3A 1E5QA 2QRMA 1N6NA 1OXTA 2YYZA 1PE0A 1CUXA 3I05A 5IANA 2IYAA 4JXXA 1JHRA 1AKVA 3Q1LA 4CQMB 4EA7A 3NBYC 1N0WA 2VSYA 4IJKA 4DWOA 1TMYA 4C7VA 3FWHA 3DXZA 1NQAO 2EVWX 1QPGA 4MS4A 5JR3A 2D0OB 3MEQA 5GOZA 4QU9A 5AM4A 3GT4A 3ROTA 3B9RA 3CH5A 5I4BA 2CN1A 3HJAA 2BEUA 1CUUA 2R8BA 4H59A 4UPEA 1K89A 1A71A 1MPTA 4PNHA 1WRBA 2DBZA 5FOQA 1TADA 1UBEA 3STTA 3ROQA 4DV1B 4ER3A 3BOSA 5A71A 4Q48A 3E15A 4N3BA 3R5JA 3SEQA 2YICA 5EPOA 5FTKA 5DOZA 4KPFC 4YJ2B 5JJCA 3AI7A 1YOVA 1BVHA 4QA9A 1XVUA 3FYUC 3L18A 2GAIA 3WLSA 3L4KA 1VG0B 1TK3A 4MIKA 4EO9A 5F23A 2FR1A 3P27A 3M5WA 4MUYA 2DFNA 2J30A 2GM9A 2QRQA 3UV7A 2I2FA 5BW6B 3EEBA 1OXMA 4ZVSA 4UAUA 4DBZA 1F3OA 4ITUA 4P93A 3JQQA 4R2MA 1OT5A 1E1CB 1KY5A 4NBUA 4QBIA 3NCHA 3AKZA 3KAPA 2YMLA 4WD3A 5D5QA 2Q2WA 3EH2A 4ZRDA 1A98A 2D5LA 4QHSA 3OJXA 1MTZA 4NZOA 2R1VA 3NO4A 2GD0A 3QYJA 4QOJA 2AYYA 4WN3A 5KAMA 4JQSA 4QXPA 3CLVA 5EVJA 4ZOAA 1L6RA 3SBDA 2D7CA 4S2EA 4AVYA 2FFAA 3L3BA 2I1WA 3AVUA 5D2CA 1RPJA 2NTEA 2ORVA 4F2GA 1EM8A 1IFXA 4FDLA 4G5HA 4HJRA 3ZDDA 4HRXA 3ESAA 5TS3A 2PQ0A 2AI2A 5LWHA 2ZM5A 4BZWA 1PJ8A 5B3LA 1NKSA 2JB9A 4FBGA 4QO8A 2FFJA 3V80A 2FZ4A 1RRMA 1T1GA 1CYEA 1UMCB 2P5UA 1JKIA 2ZAOA 4INAA 4QBGB 1HLPA 1HLDA 1E2EA 1RABA 2WI8A 1RHUA 5AXBA 1NJ1A 4R8LA 2Z9DA 1JVBA 1Z4KA 3OZVA 4FFOA 5EJ7A 1XKXA 2QNRA 2EJUA 4MV8A 1LC0A 4C3UA 4EG3A 5HUHA 3V1UA 4GL2A 3V1YA 1EA7A 1X1AA 3B36A 3KPVA 4KBFA 4DA0A 5BRJA 5GTDA 2NQTA 3IAS1 3P2OA 4MB0A 1ZN2A 1AUPA 2R00C 3O1JC 1GCIA 4I9GA 2YUTA 1E6MA 1F8GA 1NIJA 1YA4A 3ZZTA 1KMIY 3DOFA 3WV5A 2Q6IA 4EEKA 3ZIAD 4MB2A 5EESA 1XDGA 2HCRA 4HDAA 2KSQA 3M6UA 2X19A 2XDQA 4AS2A 1BDBA 4JJ7A 1VIYA 2JGKA 1JSXA 2YRWA 3C7AA 1BTOA 5FULA 3VTKA 3GLFB 3EC2A 1JB1A 4TKVB 1D1PA 5J23A 5CX4A 3RH0A 3JWEA 5BV0A 3FDFA 5DZSA 4BMVA 5FO1A 4K9OA 4C6RA 2CEAA 1N2HA 5A0VA 2BRUA 1JT2A 3E9EA 2P77A 3IVGA 5CU7A 1LDBA 1Q1BA 1F3LA 3GRCA 1RRFA 1UBRS 4AKIA 4BMXA 2FZCA 3W4JA 3IEVA 3D81A 4DCMA 2CLIB 1G2IA 4OF4A 2OQRA 2OGZA 3OX1A 2I8LA 1FBTA 1XA0A 1AQIA 1YS7A 5DYYA 1H2YA 4C0LA 4JB3A 1BMQA 3HADA 2FQ1A 2YW9A 1DLJA 1WTAA 2XRFA 2I5PO 4IZ6A 1L5HA 2FK7A 5ERYA 4G89A 3UYLA 2X4DA 2GETA 4GBJA 1ZGCA 3DMHA 4MOWA 1SBIA 3PXUA 5FFMA 5JQGB 2W2QA 3I28A 4KNWA 1EFTA 1PS8A 2TMGA 4AUMA 3GPIA 2I4NA 1DELA 3MT0A 1OX4B 1YWGO 3EWIA 3UJ6A 1NRWA 1NUAA 1K6EA 1SVOA 2CWWA 2J4CA 2W2XA 4MLPA 4DWJA 2ZUDA 5IXYA 1CR6A 1NVKA 1WCIA 1GG9A 2O1XA 4FJ1A 4MJ3A 4U63A 3RUEA 5K0FA 5GIPE 3CF6R 4BN5A 3FHCB 4GC5A 1G5HA 1Z88A 4FHDA 4OHVA 4Q3NA 3PYXA 4JQOA 5D86A 4R8SA 5TQ0B 2OPBA 3PK0A 2FDXA 5B3JA 3VC7A 2LMEA 2BGRA 3RB8A 4OQYA 1QG0A 1LRLA 1EINA 2Z04A 2QX9A 4QQRA 4RF2A 2L19A 4YP7A 3OZXA 3DHWC 4QOEA 4JYPA 4LHVA 5EAIA 1HMPA 2XKKA 2GAAA 2Q6KA 2VOEA 1W36C 2QQGA 4OQNA 4P31A 4XE5A 3HO1A 2UZ1B 4E6EA 4KQ1A 2OXTA 4F45A 1JR3D 3DQZA 4F8JA 4G4SP 1KZGB 2I33A 1ZSNA 4YP5A 1C0PA 1TCUA 2QLTA 1V16A 4PNEA 4NEHB 2WAMA 4DM3A 5THQA 2Q8QA 2V3WA 4OXKA 3GGSA 2IBMA 3SYTA 4RL6A 3TW4A 4F4JA 5LDGA 3B9PA 1CHDA 4HNAB 3K1ZA 4HNQA 4MQFA 4DQLA 2H59A 5K0EA 2Q41A 2YVUA 4I3FA 2FW7A 3GJXC 3FVTA 4B0PA 4CDNA 5CCBA 3O8OB 4M0MA 5DOVA 5CNMA 3W1WA 1JZTA 3IAUA 2NVUA 2XDAA 3IEKA 1SELA 2H3HA 4IVRA 1XTUA 1ZMTA 2RI0A 4MPRA 5F7XA 1Z3IX 4Q4CA 1EVIA 4U5XA 4KPEC 5HIMA 2P9EA 3H5OA 4ZMBA 1PNVA 4ZCLA 3ZHVA 3L8FA 1UWCA 3MRXA 4FLEA 4ZC1A 1G3IA 2CSUA 4IL5A 5DU2A 3W5BA 1KMHA 1XZJA 2Q1TA 1YR9A 2BKEA 2NYAA 4HTFB 2AG1A 5DLQC 1N57A 1R6XA 1U98A 5AVRA 2WWTA 3DZFA 1S9DA 1FMJA 1PJTA 1KJ9A 2BKVA 1VYVA 3EC7A 1GKIA 2FF5A 4IDBA 4WY8A 3FYUB 1GFWA 3ZBTA 4EUSA 4IIJF 4QXRA 1F8FA 2H65A 3IT0A 3BE4A 4PEVA 2JFFA 4ILKA 2VRCA 2FWAA 4MUHA 4KQFA 2WD9A 5DWDA 5E6RB 4B82A 4DA4A 1IQRA 1VOTA 1XF9A 3RF7A 1WNTA 4F2WA 1WXXA 5JU6A 1LQUA 2L69A 4P5DA 3IUBA 2P6NA 1GYQA 3K1AA 1T4MA 3LX5A 4JR0A 4DNPA 1T3ZA 4LXGA 2EW2A 3RVNA 4EGCB 3MS4A 5I8ZA 5ITSA 4TQ9A 3BCHA 1U8UA 3C3AA 2AG5A 3S0JA 2CL0X 4MWEA 4FWTA 1RU3A 1NVGA 3K73O 1XHLA 4G9EA 1L3CA 1TAHA 3A7EA 3PNVA 4UEKA 3KOWA 3GEHA 3IEIA 2W2KB 1JWLA 3E9YA 1G8MA 4OKSA 1EU1A 3D2LA 3DF7A 3OE4A 1C4WA 3P4UA 4XWAA 5A5GA 2YYAA 3GUHA 1DRVA 4J0QA 3RS3A 4WLOA 1QAQA 2D3WA 1FNCA 2PZAA 3BBPA 3FVQA 4PXYA 3MT9A 2DKFA 2ID8A 3SC4A 4AS3A 4MMYB 4IIVA 2AWOA 2FPLA 3M1IA 1J33A 1RAHA 5KTMA 1XMXA 1UH5A 3M6FA 1P77A 2ZT8A 4UFNA 1HKUA 1YFKA 2ZWAA 3AUTA 3HU5A 4P8RA 4BX8A 3ORSA 4BX9A 1KYZA 3DOHA 4F60A 4EQZA 5JYCA 2M1ZA 4M60A 2OCLA 1C0LA 3WK4A 3WDMA 2OBBA 3A2KA 1Q74A 4LYDA 1P7ZA 1RC1A 2DB3A 1AU9A 5KYYB 4EKYA 3CGWA 1DZ3A 5K6RA 4QOFA 1W581 4FFRA 4NV0A 5ECDA 4E31A 4A2CA 3DDOA 5E1DA 3A6JA 3CM0A 3KZCA 5AJXA 2XAUA 4HVAA 4MQEA 5BUCA 1RMTA 3F67A 3FSRA 3VTFA 1NDUA 4P33A 1R0RE 2QE7D 1BJRE 2CJFA 9ATCA 1E7YA 3D43A 3PDCA 4PLZA 1QV7A 1XVVA 4ZD6A 3MJHA 3N2LA 3VHXB 4Q1VA 3C5CA 3BKXA 5EL0A 2IDKA 3AL0C 4O1IA 2FSGA 1VLZA 3D6NB 3JCZA 2C99A 4M7RA 2EG9A 1V5FA 1ZJ5A 2X6QA 2ZPAA 4MVJD 3ZU3A 1FTWA 1Z12A 3DWEX 5I7RA 1R0XA 4H7EA 1IK4A 4J6FA 5CLHA 4NYMR 4KR0A 1W5AA 3LXUX 4HD8A 1RYBA 1C3EA 3GV0A 3K1TA 3W06A 3IQFA 1B0PA 2TMKA 3E22B 1E9VA 1NXWA 1H2AS 3P2MA 1MAWA 2DLNA 4GRIA 4MRPA 1ADBA 3NVDA 3OFSA 1W0KA 4CBVA 1SBNE 1HLFA 2R8XA 2WM8A 3RYFA 1V48A 1K2VN 3NH9A 4Q6BA 3OEWA 4IZHA 2EX0A 3RYCA 4UNRA 2IHZA 3MXTA 3SICE 1IB6A 2VSQA 1JQAA 4KQ6A 3FPBA 3D64A 2PKQO 2WNIA 4TN5A 5DI3A 4ZV9A 3AF0A 2CHVA 1LDMA 2XT9A 4X6XA 2IXAA 4ITVA 1ITZA 3FHOA 5AJUA 1BYUA 4YFYA 4CKEB 3S55A 2NTJA 1F38A 2ECFA 2II6A 2PR7A 4P86A 3I9FA 1AKWA 4M98A 5HEKA 1RLTA 1U3VA 2P6MA 4FW9A 1EUZA 4IWNA 1E2BA 2W2LA 2PMEA 3JQ7B 4WZBE 3Q41A 1KK1A 3CX3A 3P9KA 1TKCA 4ZQIA 4F3CA 1GLNA 1V11B 4XSHA 1QOZA 4XIJA 2DY1A 2ZE5A 5J40A 2JCSA 4J75A 3I6MA 4MWTA 2CBGA 1YASA 5GONA 3AFOA 5SZKB 4HI0E 2FSIA 2FRXA 1WZIA 3DEKA 1WKCA 2MSCB 4ND2A 4V2IA 4DDWA 3QY9A 5JHHB 1Z0JA 2XUZA 1Y9AA 1MLDA 1KI6B 1PD0A 1UPCA 4R1MA 1NMZA 3B1ZA 1OLSA 2RCYA 3NDPA 4RVFA 4H16A 3INTA 4UULA 2YIDA 4HL6A 5KTSA 5IAOA 2QTVB 3I23A 5ALLA 3VV3A 3EFBA 3OKFA 4LYAA 3M8KA 3ER9A 1X1TA 3OPYI 3D6TB 3P0IA 3HYSA 3EPHA 1PR9A 2IE8A 4NK5A 1EGQA 5FLKA 3GLGA 3D7NA 4O4HA 3MUOA 4R9NA 4WLFA 4E5KA 1GA1A 3BT7A 4X41A 2G67A 1A7AA 3PXDA 5DCWA 3BD9A 3SOPA 1FLNA 4KMMA 5ALXA 3VZCA 4PE5B 1ZM2A 3HVIA 3V8QA 1Q50A 4XQCA 2XT0A 3NUZA 4RZIA 4HVTA 4JNCA 2RKWA 1KHTA 4N7RA 4GFDA 4LJ6A 4RK1A 3LIIA 4ITRC 3SPXA 4LFBB 3Q5GA 2NU9A 1EFRD 4XOIA 4DLPA 4DQXA 2O2HA 5EXCA 4NK4A 4X7MA 5EERA 2I87A 3V8EA 1S6YA 1OHHA 2WFZA 3WLEA 4HFMA 4ME6A 2Y6VA 3GLHB 4U2FA 1VBKA 2IJGX 2PSJA 2QQFA 3PENA 4JJFA 5C8YA 2ONKA 5JXIA 4LX0A 5KNBH 2HSZA 3EOZA 3PQDA 3FB4A 3DLIA 4B35A 5JWOA 1OWLA 5LD2C 4ZDJA 1J6UA 5EZ6B 3OQMA 3EH1A 1MAAA 2YMMA 4GECA 3RSCA 5IM4A 5FP0A 4QREA 2IS2A 3OPYB 3HP7A 2H5JA 2BI7A 1YF3A 2BR4A 1KJQA 2ADOA 2E4ZA 1II8B 2XT6A 4FUQA 3WLFA 3FI0A 3W5UA 1U9CA 3RG2A 4AUNA 3OT4A 1GEEA 2C84A 4OHPA 1Y0BA 4KJZA 2A5YB 4R01A 1W49A 4A1FA 2BFWA 3UMMA 1SVIA 5CCXA 121PA 1POWA 4A82A 4BNKA 4P0TA 1AT1A 2F9FA 1R6BX 2HDWA 4TL9A 1E62A 1N7HA 3IXQA 4BB5A 4LRSB 4HATA 5FUMA 1XNRB 2XD9A 3W4KA 1E9SA 4ZU1X 4O1MA 4BNXA 3IOBA 1QFMA 3O4VA 4P2GA 1X2BA 2R8EA 3GRVA 3WHKA 4KQ9A 1K4KA 1KY4A 4QSHA 1H66A 1M6NA 3DTVD 4N5HX 3CVOA 2YN2A 3DZCA 2EOAA 1KSFX 3ANYB 4EA9A 4C03A 3BFVA 5KNDD 3FSEA 1OWPA 1W9MA 1XJQA 3OOHA 1L4HA 3GIWA 1I3LA 4IF6A 4XQ9A 4TKUB 1TU3A 3E4CA 4DCGA 5ARBA 1R9GA 2AN3A 1SO8A 1ZXXA 4Q03A 5MFPA 1GPNA 2VP6A 3PC7A 4LWZA 4LRQA 1ZIXA 3QJYA 5FWDA 4D82A 5I4CA 2UZ4A 4EJMA 4L4ZA 1SCKA 1R0CA 1G8FA 1JS1X 1QK4A 1JXAA 1RC0A 1RQXA 2C3YA 1M2WA 3S7ZA 3G2QA 3W8EA 4HTAA 3LS2A 2VDMB 4N6OA 4OQZA 1U7WA 1H6BA 1UZUA 1QWOA 1YS6A 2J8ZA 3ROXA 7REQA 2JG3A 4NARA 2J7KA 4PPQA 2BT4A 1X13A 5CCEA 4KYUA 1FQKA 1X9IA 2ZVJA 1GVNB 1TLFA 3C7KA 2VDNB 3GQBA 4JFRA 3TM4A 4QZVA 2R2AA 1W2GA 5DWQA 3VU0A 1W0JD 3AVVA 3EGEA 1JI3A 1V8FA 4O4JF 2OGTA 2PUGA 1QHXA 4DLBA 1P2TA 1X8LA 3A9TA 1Z0DA 2LP4Y 4EHDA 4JP5A 5K0TA 3EB9A 2PBRA 1TAQA 3FYDA 3NWEA 4B4OA 1B74A 1W5TA 3FJYA 1L8XA 2VPXA 3QYFA 2EFDB 5CFNA 2CBZA 2XADA 4J0IA 2QJRA 3BGWA 3UJ9A 3RS2A 3ANLA 4PYKA 2IHJA 1NJFA 2ES4A 2PAAA 3NC0C 1E9EA 1KZ1A 1MDFA 4FP9A 5C35A 2X2EA 3S1AB 4P08A 4RELA 5AH0A 5KKAA 1MGOA 3IR6A 1Y9EA 3LPNA 4KNVA 4R3NA 3V2HA 1MO6A 5I7HA 5HCIA 2ZYIA 1NF3A 1WP4A 2GK7A 2W6PA 3G9UA 3H2KA 1L4NA 5HDBB 4ASUA 3PFKA 1LB1B 1YRYE 3QELA 2GBLA 3ZDQA 4D02A 3G8CA 7MDHA 3NBAA 2G28A 2G5PA 3OPVA 1I6LA 1WF3A 1R6VA 2VFAA 2WHEA 2YYYA 1ENOA 2I3GA 3UFBA 3WJ7A 1MQ8B 2YXPX 4M1YA 4CKCB 1K7XB 1U3UA 4Q93A 4N3NA 1ZISA 1RXWA 5BPFA 3KYDA 4IFIA 2JHPA 2FW9A 5IULC 4FB4A 1QAMA 5AVQA 3EIQA 1XKTA 3AFMA 3RC8A 2YNMC 3K6KA 5DM2A 1QYXA 5JO9A 2HU7A 2XQGA 3A1FA 3EVZA 3HCOA 1JGTA 4RO0A 1U5BB 4N6NA 1OBVA 4EPTA 5LMUB 1MQSA 3B6MA 4RH1A 4B6FA 1BSVA 4BRUA 2BC9A 4YMTA 5DTMA 3UGJA 1U1GA 4G24A 4A5OA 2ZRNA 3ORFA 4RW0A 5H4HA 1Q3TA 1D4ZA 2ODTX 2R5NA 3A3KA 3RS4A 1SCDA 2PJUA 1C14A 5IZCC 5E0KB 2WSBA 1D8AA 3QPWA 1GPMA 2TS1A 2AHOA 1VRWA 1CG6A 1W85B 3HL6A 1XRSB 3EF0A 3OZTA 3WNDA 4Q7JB 5DP2A 4D0NA 4AULA 4Z3KA 3ZN2A 4KODA 4FNOA 4U00A 1FFDA 4KYIB 1E7MA 2KM1A 3SF8B 1MIHA 1SXJD 1VXRA 2I8CA 3HJGA 2YJNA 4C3VA 4MSUA 3SN6A 1GNTA 4R54A 3ILYA 5CA1A 3CLUC 3QKRB 1A96A 3B8EA 3GMDA 4OMDA 2VPYA 1N32B 2R85A 4KN6A 4YJHA 2VJMA 3M1AA 5LM3A 2QXTA 1CDEA 1KYTA 3BZBA 4Q21A 1YIDA 1WS6A 3GI1A 2GSDA 4G8JA 3GJYA 5I9MA 4R0MA 5HCUA 3DLCA 3PE4A 2PU5A 3GYGA 3PUZA 4QX6A 5IVIA 4FWIB 4UTRA 3AQ4A 3DT6A 5C37A 2C3MA 5DIFA 5PGMA 4C5BA 1YJCA 2ZOSA 1LPMA 5HUJA 2V7BA 1KVQA 1FB5A 1R9MA 3KG2A 1CRLA 3DWIA 2FN8A 1DG1G 1OB2A 4GSYA 2AXNA 4MS3A 4A0RA 3N8NA 4BB0A 1YHYA 5LLDA 4PYOA 5LD2B 2VHWA 1I7PA 4PLYA 1FP6A 2GTPA 4Y18A 1J20A 1MAHA 4PLHA 3WBFA 1GQ2A 2HC9A 2FWIA 3R8FA 2BFOA 3AW9A 1PQYA 4NC9A 4XOUA 1T9GS 4R1OA 2AHRA 2CHGA 4MYSA 5FFNA 1XEXB 4GBMA 5CVTA 3PXEA 4BRWA 5AIAA 1YQEA 3R0QA 5JWHA 1GTVA 5EQTA 4B6GA 4ECEA 2O2XA 4MZXA 1DAOA 1A9XB 1UDBA 1U2ZA 1ZMBA 3RGGA 1MX5A 5D7NA 1QGED 1QS0A 1VPDA 1WHSB 2W43A 3K0AA 3CLTD 1HDXA 1EJ2A 3QVSA 3DCJA 3PC4A 5EXSA 3ZXIA 3ZDBA 4FB5A 2PKQP 4YRLA 1N9GA 1US8B 1Y3BE 2RHMA 3LUCA 4HQKA 4ZO4A 5B64A 5EP2A 4E2XA 5EKSA 1VYUA 4RIFA 4HVLA 4ZYWA 4V3BA 1A69A 4QWWA 3PHIA 1QSGA 2G06A 5ALIA 5ILGA 5K6AA 1ZR2A 2XB2A 3OAAD 1D4FA 1XDBA 3G59A 4OL0A 4ZU3A 2ZKLA 3W78A 4A8TA 5J2UA 1LD3A 1VHWA 2Y92A 3VC2A 3O6VA 4LGMA 1YFJA 1T6NA 3CRNA 4I36A 1P5JA 1QIGA 1JWBB 2GF2A 2QN6A 2W58A 2W00A 3DXYA 1K06A 4QARA 4ZWNA 5BW0B 4CM8B 3O8QA 4QDUA 3UANA 3OQNA 3FZGA 1P81A 5P21A 1N2ZA 3ZCRA 1DSSG 4I08A 2OL4A 3H1FA 4M36A 1EXDA 1J1UA 1LBSA 1O8CA 3GAAA 4IZIA 5TMDA 1ZN7A 1VPEA 1H5UA 2IYNA 2J3KA 1GZ7A 2B8WA 2XKJE 2NTVA 2YV3A 1VMKA 3EQZA 4HY3A 4FYVA 1VI2A 1S89A 4LZWA 3WRXA 4RHFA 4RQUA 3B7WA 2RK6A 2HOQA 3JD1A 2C9DA 4DCPA 4YA6A 2QPLA 1T9GR 4U0KA 3VAZA 1XL1A 3TW6A 5KVCA 1DJNA 3SQMA 3OQJA 5BMVB 2A1UA 2ZI7A 3B6ZA 1NM5C 4E88A 3E9MA 3FGNA 4TT8A 3T9BA 3PWSA 1M1UA 5JZBA 4DR3B 4TL6A 4W7SA 3DT9A 3ZZUA 3IQDB 1Y37A 3OLCX 3VHLB 1FX0A 1KI4A 4DXDA 4L7VA 5EVCA 4Y2QA 2IZOA 1ZCJA 4CKZA 3KQPA 3FPKA 4QJBA 1SUWA 2VYVD 4DNXA 1JG6A 3U40A 2PWZA 3R1IA 4RDXA 4C2UA 1OA0A 2DQ4A 1IHUA 4HDKA 1MNQA 5BSVA 1T0PA 1XNHA 4RPIA 3M5CA 1NFFA 4KRGA 1A97A 4TTTS 1G0NA 4J43A 3GLUA 3IVCA 4M9XA 2C3PA 4E30A 5DHPA 2WSMA 3ZHCA 1PZXA 1IPFA 1NI4A 3BHMA 3FGOA 4RD3A 1U9ZA 1SIBE 4L73A 3R9IA 4MKZA 5K0NA 3CI0I 2CJWA 3Q5EA 3VMMA 2O0HA 3N8GA 1JI0A 1FXWF 3SQNA 2RGDA 1FRFS 1ZQ1A 3K8ZA 1JTVA 2MDTA 4PQRA 4FIDA 3REQA 4FQ7A 1GCUA 2EZTA 2QE6A 4E33A 5ITZB 4MVJF 4HH0A 1YQ9A 1EB8A 3IELA 2DLDA 2QRZA 4W7HA 2XVXA 5AHRA 1DEKA 1DO8A 3DEJA 3O84A 3EK2A 3ED1A 4NE9A 5AKLA 4PZ0A 1WAMA 5FI5A 3N0WA 5FTJA 5H5JA 1GZSA 3LW7A 1UXHA 4RAOA 3G88A 1ZUHA 3LUKA 4KO3S 3IAM1 5AVOA 1KZ4A 4YT5A 5JH7B 1FFAA 1SBTA 2PWPA 4BNLA 3UT5B 5EKUA 3NMUF 2ZJZA 3KZ1E 4DLTA 2VTBA 1Z82A 3KZKA 5BWBA 3KWMA 1REQB 4FHGA 4KTVE 4WXEA 5I3CA 3QFCA 4TSFD 4RQTA 3HHPA 3TS1A 1QP8A 5KI6A 2JL1A 1X1QA 5C9ZA 1YZVA 1YQQA 2JBAB 2X0NA 3LL7A 4GR4A 1R4NB 2FEXA 4N0EA 5BQPA 3SM9A 3T4EA 3SZGA 3TAXA 5I7WA 5ALUA 4F84A 5K9ZA 2WU1A 1LPPA 1DXQA 2Z57A 1DAGA 1CK4A 1DX6A 2IHYA 4F92B 2AOTA 1HC7A 3T3EA 4ESVA 1RC8A 4M8LA 2C7GA 3NXSA 4UAGA 3DBHB 2GJAA 2JFUA 4HR7A 2XXAB 4GLBA 4HK4A 1KHHA 2F3PA 4GZ6A 5A7GA 4IIYA 2P69A 2Y0CA 2L42A 3L6CA 1F20A 2Z6QA 3RJ9A 2XWJI 1Y8QA 3W05A 1YONA 1FPMA 4RSGA 5JCXA 1BWPA 4ER7A 4LA4A 2O2DA 1ZA2A 3MJEA 4IHAA 2PR2A 1VCHA 2XR1A 3ZK8A 6LDHA 2EZ8A 2CNLA 1QYIA 2QN1A 3EXEA 2NW6A 2R9VA 2AEJA 4LF9B 3I4FA 4RCYA 1E5XA 2JCGA 4KN5A 5AK4A 5TEVA 2A9OA 2B0JA 3IQGX 2A5DA 4MTCA 1EB9A 3WHPA 3P2IA 1KEZA 4HDSB 1G38A 2JDIA 1ZGGA 4TSRA 2WAAA 3TUIC 1JLMA 1TPZA 2P9TA 2I2CA 3QFHA 4FC6A 4AFNA 4RL4A 1FDSA 2XRMA 1HTBA 4AG5A 5AKHA 5CT9A 2GUWA 3GPBA 4B3BA 2YS6A 2ZB7A 2R62A 2XNJA 4WVFA 2CV2A 2P5TB 4MTLA 5DN9A 4Y6GB 1KI1A 1T8PA 3VSAA 5JDCA 1GZDA 1UDRA 5ALOA 4CQMD 4IV0A 4DEVA 8OHMA 2CXPA 3IIJA 3VR3D 5TQ2A 1EP9A 3ENVA 5A04A 1K98A 3TM5A 3KQLA 1A9RA 4MW2A 2OGUA 4Y6PA 3B1FA 1FF9A 2QJOA 4H1HA 4MVJG 3BSSA 2UVPA 2NPFA 4D3SA 3ZY5A 1GD1O 2AN5A 5CPBA 1OZFA 2YJ4A 2FPOA 4OAQA 1L7PA 3PDHA 4CQLB 4J1NA 3NHKA 1D6MA 2UVQA 1L4UA 5MN4A 2ZETA 4DLYA 1DT3A 4B31A 2C7PA 4LSGA 2JKYA 2EW8A 1MIOA 1OXBB 3H65A 3K0FB 5LZ8A 2O7SA 2N1BA 3ZWBA 1WDWB 4CR8A 5CCDA 3HJUA 3IUNA 3LY9A 3PT5A 1Q0ZA 4LHWA 3GGCA 4EITA 2GCNA 2GS9A 4UOEA 4FFLA 2GVZC 2HQRA 3DFKA 4LHSA 4DIOA 4NRDA 4GYWA 3O92A 5FHRA 2R7MA 4XSGA 3T5MA 4I1IA 3FBTA 3N7AA 4LXXA 4M54A 1USVA 3SDSA 4CMJA 1E58A 2VNJA 4S1WA 4EO4A 2ON6A 1NQ5A 1AKRA 1C30B 5LQCA 4BAUA 4DMCA 2YHUA 4BNHA 2CD7A 2R87A 1Z4JA 3PYLA 1SQ6A 3OLWA 1SCBA 3HUUA 1RWWA 1JN0A 3FLAA 1BWRA 2H5LA 1I6KA 5BSFA 1V1MB 2GFIA 2ZVQX 4UFOA 3PF9A 1I0LA 3L1HA 2A0XA 1M0EA 3ZDZB 2V5AA 3MTBA 3NUGA 4NS4A 4D6PA 4IJ5A 3I73A 1KSGA 3G23A 4EB6B 1QC5A 4RTPA 3UWKA 1XJ5A 1RHKA 1UJ5A 2VHXA 4DCUA 2HMAA 3ACDA 2JLVA 1MNAA 1MZVA 2BM8A 1H2FA 4N1AA 2DH6A 3L0PA 4PRLA 1VJ5A 3CNQS 1NNLA 4MH0R 2Y1XA 1VP9A 4R2XA 1OBFO 3O91A 2BF7A 2HMUA 1LTQA 3NHJA 5G2FA 2OYRA 4QLBA 4DR5B 3O9MA 3ON5A 3IR7A 1O94D 1FU4A 2JEOA 5AKGA 4DC0A 3KDPA 1NMQA 4NAUA 1PJAA 5EWLA 2POQX 3BMCA 4JELA 4U7PB 4DA6A 1KETA 1DFIA 2WABA 1YOBA 1KPGA 1T35A 1RHRA 4M53A 1IVSA 4HX9A 3VM6A 5ERGB 2E0IA 5L45A 2CHUA 4LDNA 4D46A 4OM8A 2JHGA 2ZVDA 1U99A 4OA8A 5NLLA 4CIDA 2WNHA 3HXPA 2OC4A 5EA2A 5FUXA 3RKRA 5JVDB 3TTSA 1IZZA 3A0RB 3FUCA 4QUHA 4E0BA 1JFVA 1E6WA 3DDCA 3Q7IA 2B9VA 3G5MA 3JQGA 5ALVA 2GGSA 4QUKA 1UKZA 5HKKA 1BROA 4GKKB 1A9ZA 1RHMA 3IUEA 1OYVA 1EMDA 3LCCA 4BP9A 1MOZA 4EY8A 4UHKA 4UBOA 3PNSA 4PVCA 1MN6A 3OO0A 5JC1A 2JKVA 2O54A 4YAEA 3H5WA 3OZRA 2ZT5A 1QTRA 2OTCA 5C8XA 4G5XA 2C2WA 2L0XA 1M6EX 5FLEX 2HA0A 4FSHA 4NPCA 2HA7A 4A8JA 3K92A 2FQQA 3CQ9A 5B57C 2C4WA 4LQ4A 3HGTA 4AY6A 1CQJB 1HI9A 1KORA 4RHUA 1NBOA 4XUEA 4LKOA 4BNZA 4L5BA 2DY0A 1ESDA 4MUFA 3G0GA 4AZ0B 4FYXA 1V6SA 1RI4A 1POXA 2EL7A 1QUEA 4LWQA 3R40A 3NYRA 3DD1A 3R7DA 3R9KA 3RHTA 1I2CA 1Z25A 3MMXA 4GP6A 2GYUA 2D62A 2XF2A 5E4JA 2ZANA 3GGDA 2FUCA 3NBMA 3IV7A 4UHDA 3WGOA 4HWRA 4A6EA 4BMDA 1EUQA 3N8HA 4RKYA 2GN2A 4GOKA 3ZV6A 2BRUC 4TS9A 3DM5A 2PDAA 1G291 2JH9A 3QLEA 4O3MA 1PSZA 3ANTA 3QUSA 3QSGA 1S7GA 4JKYA 3R6GA 2E5WA 2JFBA 4MAAA 4PPFA 3IP9A 3MRTA 2FNAA 1Z07A 5IZ4A 4C7OA 1JDSA 1Q7BA 1ZK1A 2KJQA 2WWWA 3PEUA 4F5EA 2XY4A 4G5SA 1RRPA 2NVBA 3NYWA 3N07A 4YDSA 3EIHA 4HO1X 5L6MB 3C8MA 1QQTA 1XZMA 2HK7A 3I04M 3IKVA 1CDDA 2ZSEA 3NHFA 1INLA 2N42A 5GM2A 3T7AA 2P30A 2GTHA 3V97A 4HGNA 3Q2KA 2KLBA 1N2GA 1E0DA 5K4HA 2BONA 3FPSA 2GRJA 3GEGA 1H8HA 3PD0A 1JG1A 3E81A 4RMIA 5JJLA 5LL6P 2IWRA 1WY5A 2QZPA 4Y67A 3UJCA 3N2EA 3MXOA 3ZWAA 2GEDA 2GARA 5E9AA 3MMPA 3P9RA 3UGQA 4HB4A 2YJ6A 2ECOA 1IMOA 2BMFA 1E66A 3L0DA 2ZB8A 3I5XA 2WR8A 3B3FA 4OP2A 3GAZA 1J2RA 3TLKA 2ZIXB 2B69A 2IHVA 2IY8A 4LBYA 3TQFA 4AD8A 4C4PA 1TYBE 3FSJX 1XYVA 2C4KA 3S40A 1PT9A 1J1ZA 3PUJA 5B3JC 4D25A 4I2VA 4ZDIA 1C8KA 3IE2A 2P0AA 4YS6A 1T1SA 4P3YA 2GPBA 3VO8A 4LCEA 4KVFA 4F1WA 1VPTA 4QTTB 1T15A 4BDTA 1PO7A 4V03A 4Q16A 2VA9A 2I66A 5EGSA 4DCNA 4OLBA 1WHTA 1WMSA 3EW7A 1UXOA 4OHXA 2QTTA 3QPVA 2WMOB 2GFQA 4YAFA 3PITA 3HCNA 1BXGB 5IUJC 2C5SA 1OVMA 2C8KA 2Q7OE 1M7GA 1YR8A 5BYJA 3DV0A 3ZWCA 1SVUA 3SR4A 2QTGA 4GM1A 2ZBQA 3BMOB 1BQ4A 4D9NA 5EJFA 4F9GA 3QQ5A 1PFQA 4GPD1 2P9ZA 4PO1A 4BC0A 4EBFA 1F4PA 4PSCA 3IILA 1CBUA 2IEZA 2Z95A 3N2NA 1QKKA 3KE9A 1I33A 2WYIA 1W2WB 3GT0A 3IKMB 4MS4B 3ZKWA 4FE4A 4R1PA 3ZCQA 2V58A 3RVBA 2C5EA 1OAKA 2QYOA 4R0NA 1YFLA 4FDTA 4LUCA 4AF6A 2BEUB 4LV8B 6PFKA 1XMSA 2GBIA 3HNOA 3B60A 2VJDA 3OFKA 1G64A 4KSCA 4EPWA 1YT5A 2GZAA 5JS1A 1OXXK 1P18A 1NJSA 2G77B 3KT3A 4L3WA 4QG7A 5AOAA 1QRTA 1VLVA 3V7NA 4IMJB 4COOA 4IRUB 1K8RA 1OH8A 2VHTA 4KN8A 4EJSA 1XZHA 1QHHB 2FKAA 2JK0A 2QN7A 2Y9MB 1VJCA 2IVZA 2EKDA 3FYTA 3PKZA 1I01A 4QECA 5JNWA 1K4MA 2SKEA 4CCAA 1YOVB 2OMEA 4M99A 4GKAA 1R37A 3K6JA 3W7AA 1YRBA 1TM7E 3AJ8A 1HEYA 2X5JO 4CMCA 1N6RA 4DPKA 4BFYA 2E1RA 2XX3A 5HFAA 3LY8A 1E5LA 3T95A 4GX5A 3D59A 3OT1A 2BZ0A 2XB9A 4TOIA 4DLAA 3OJEA 1PU2A 1PI3A 1MO5A 4HX5A 4HB0A 4LJ4A 5CFQA 2QUJA 4B87A 1KBOA 1R5NA 3MWKA 4C0JA 2CF5A 2EGHA 3DPIA 2FG6C 3O1HB 3FNFA 3VDRA 5KYKA 1LLDA 3G82C 4G0OA 4YJGB 1DHRA 5G0WA 5H02A 1Y1QA 2R1VB 2F6RA 2P2DA 1N92A 3A10A 3IPRA 2PGNA 5AVYA 3LRPA 5A2QA 1G7SA 1YR6A 1E5TA 2I1VB 4CTMA 3A6PC 1E4YA 2LW7A 1FOEB 3HB7A 1EM8B 2IEGA 2P91A 4G26A 1TYZA 4J3NA 2O7QA 4XASA 3DEZA 1OJLA 1JAHA 3OEED 1KARA 1NF8A 4KE7A 3PGA1 4RFLA 4ZVPA 4N41A 3EVNA 3EEIA 3LUPA 2DWUA 2CYBA 4CFSA 1J25A 1KQNA 3CG4A 4Q18A 2FA9A 2HD4A 4GKJB 1DJPA 3VPAA 1FCJA 3UTDA 1C9KA 4CR7A 5CG2A 4K86A 1IPHA 2QW1A 5F9HA 1TQ6A 1Z6GA 1RKQA 4RTLA 4C89A 1V4VA 5SY4A 5CM2Z 4E07A 3FHTA 4F6RA 2H57A 1KDRA 2WHRA 1MO4A 4YJFB 4AJIA 1W1WA 3FOWA 1YK0A 2GZ3A 3FCYA 3KT6A 3PQ4A 1WULS 3CF2A 3PEVA 2PRJA 4GD3Q 5JSYA 3SXUA 3UK6A 2CHFA 3KV3O 1OAAA 2RGUA 4WI1A 2VYCA 5GAJA 4RPGA 1MJGA 3SX0A 3QIVA 4KTTE 1G7TA 4NULA 1VQ1A 4OFZA 4UM9B 3T3HA 1LJUA 2DWQA 3IA7A 4OXYA 3ZJYA 3ZWPA 4P1ZA 4BVJA 2DKOA 1VYHA 2WPDA 3LLSA 3GFRA 1WM1A 2AX4A 5EQDA 5AVSA 1ZRMA 3D31A 3KQOA 3N6VA 1U0SY 2JI6A 2WM3A 3PT9A 4W1SA 4BKPA 4PN3A 3EWAA 1ICEA 2QN8A 4NBRA 3CZAA 1NSTA 2Y1FA 3PVSA 3AJAA 2ACKA 1ABFA 2PU7A 3AC0A 5TPWA 2P11A 5FJIA 1BN7A 3DTNA 1I4WA 2EBFX 1J7KA 1DIHA 1OKKA 3DBOB 3KKOA 2AVDA 3IT1A 3FD8A 1KYWA 3A4TA 4OGKA 1GPBA 1PFKA 2OLJA 4ZHQA 4Z9FA 1W36D 1Z4MA 1C0KA 4QXOA 4OPMA 1AGXA 4Q1EA 3H5RA 2P9CA 4L02A 2WQZA 2ZJ4A 2G1UA 4WKBA 4B2LA 5B1SA 2WG2A 1T1EA 4M7PA 2F4NA 5ARDA 1WCIB 1LQ2A 3HP4A 2HEIA 1ZM9A 1PK9A 1EHYA 2DF8A 3QEKA 2IDJA 2OAP1 1JR2A 4N5LA 2I7DA 1U9IA 2OR3A 3NTVA 5EC8A 1N2CB 3LHIA 4GPZA 4YB8A 1JL3A 3R8XA 3WL7A 3GCDA 5I9LA 1CS0B 1PR3A 4FHFA 3CVUA 5ER9A 2JJYA 2WQ6A 1FTGA 4YLYA 2BJHA 1KP9A 2BMEA 2QX6A 3RFTA 1TF2A 2ZXFA 1JSCA 2GN6A 3DKRA 3ECCA 4IUYA 4XQEA 5T4FA 3WNQA 3ZVLA 4CM9D 1MC8A 2AG8A 3GFPA 4OU5A 1W46A 2B1JA 4FEAA 2A0UA 1FDWA 1QOPB 2WYUA 4MJLA 3MCVA 4NJOA 3M82A 4P81A 3T7SA 1HYEA 4ES6A 4W63A 3BF8A 5IXJA 4FKZA 5CBPB 1GRQA 4N8SA 4B80A 2O50A 1Q14A 5ELMA 3IE0A 3KSBC 2P9YA 4C6SA 1YD7A 3SJ7A 4JC0A 3EXHA 2W8ZA 4MQFB 5AI5A 2QT1A 3ZQ4A 4ZK2A 1P9RA 2E4UA 1IN8A 1ZUD1 2PMDA 3H19A 3OQIA 3MILA 4D41A 4PLFA 3PNMA 1K86A 1H8ED 1NMYA 5KEIA 1WD7A 1QO0A 3X1XA 2QT0A 4ZV7A 1COWA 1DC5A 1JECA 1SHUX 1SUIA 3JZDA 3KKPA 3OPMA 4KH1A 3C3KA 4LOHA 5EIAA 3VHRA 2RGRA 2OPHA 3RTGA 4J49A 1M2NA 2C00A 2XNHA 3EJ6A 1TIBA 4JVOA 4NLLA 1Z29A 5EZYA 2CEKA 1KMHB 4GXTA 4MQ5A 1OIVA 5LQUA 2WRZA 3MGKA 1U7ZA 4UTXA 3MG9A 4XYBA 3KT8A 4MI3A 4YP6A 4HWKA 3GOQA 2HIMA 2RJ3A 1F1BA 2RFLA 2CXXA 3S4YA 2AB0A 2VDRB 4PPGA 4UD6A 5DTJA 1N2BA 2IQIA 1AS3A 1H3FA 1RD4A 1ZCZA 3QMPA 4YJ2F 4ARUA 4DLSA 4F85A 1T5IA 1KVRA 3HYRA 4MP6A 2NZ2A 3HE3A 4FOPA 4TUYF 1K9SA 4BE9A 4G9GA 4Z7NB 1SH7A 2PGAA 4M6WA 2REOA 4HNGA 2VAXA 2V45A 4QGAA 4L4RA 4PTZA 1VG8A 3K1AB 3W8RA 1LEHA 1QHNA 1P2GA 3E18A 3K0HA 1IUOA 2ZI5A 4YROA 2OBFA 2WINI 4YRGA 4OLFA 1IDOA 3PEYA 2VWPA 2RBGA 4HEHA 1Y82A 3ZEIA 5JZVA 3WIVA 4RIEA 5EFOA 1VP3A 1GZ4A 3MJCA 4C5AA 1JDZA 2O9JA 3EEYA 3R4VA 2DUNA 1DQSA 2E4YA 4Y2JA 2YV4A 5COAA 5IAKA 3ETJA 1ECPA 4ESEA 4DKXA 3AIKA 2X3UA 5FUWA 1H1TA 2VT6A 3LC7O 4GI1A 1JP7A 3HBNA 1M8JA 3CRZA 4JQCA 1UUFA 5JISA 4LTMA 2XE7A 1C7FA 2IPLA 1DIBA 2Q46A 2Q6LA 3HRIA 3S2IA 3TKYA 5CEFA 3OZBA 2FJPA 1WDLA 4XDHA 5TGZA 1V7QA 4G5QA 3SNKA 4CTOA 4BO0A 1HFEL 1NUQA 4MQUA 2FEAA 3ICCA 4N18A 3LG2A 5C7YA 2B5VA 2JW5A 4YACA 4V1CA 3BRWD 4RTRA 4BO9A 1C1DB 3H3XA 2D7JA 2KLHA 2GW4A 4XJTA 5DMHA 1DADA 5CH5A 1IL0A 1ZN9A 2PWYA 2WD7A 1P0QA 4YY3B 1DRKA 1MA3A 2P2NA 1GR0A 2I34A 4WBNF 1P0MA 1D4AA 1T3SA 4TVBA 3GJ7A 5E4TA 5FF9A 2E5LB 1CYDA 2A67A 2GX6A 2WU8A 2P4SA 4OJNA 4B3SB 1EFUA 4RVDA 2JI4A 3FUTA 3SR0A 3WQHA 1LF5A 3SXPA 1N5MA 4JJEA 1SR8A 2IP4A 2B94A 2ZDHA 4QYSA 5BOSB 5JUWA 4X6LA 4TYPA 2JFHA 1L5WA 2PBZA 5KBYA 3FKSD 4NOMA 4MNTA 3BSFA 3A26A 4EJ6A 4W5TA 1AJEA 4X92A 3RRZA 2J3QA 4I7EA 3H1PA 4GYJA 3WK7A 3F2VA 1VA5A 3ENWA 4KXFB 3INYA 4DQ0A 2QW8A 5K8VA 3KQNA 5LMNB 1PIWA 1TUIA 4M22A 1FUUA 3IP1A 3NP7A 4YMSA 2HX1A 2ZRKA 3F47A 1IBRA 1YUNA 3CCBA 3OX4A 4JOSA 4YCAA 4EA8A 1TD9A 4E2WA 5A1JA 2GEFA 2G09A 4NENA 4L4XA 1Q7EA 3INNA 2IIPA 4OG2A 3FVVA 4ZODA 4O2AF 5FOTA 1M1NA 3ZU6A 1LVGA 3SK0A 1CEEA 1J9EA 2D1TA 2ECPA 4V3CA 4D92A 1Z6TA 2PRYA 3VJKA 2HMYB 1QK5A 1IJKA 1Z0IA 1VKOA 3HKDB 4E12A 3JX9A 3L1UA 4KIGA 5INTA 2X0EA 1U0BB 5JSFA 1L5OA 1FSPA 1PEYA 5DI3B 4L5YA 1THTA 4R31A 4Z0NA 2EFEB 3UICA 4OB8A 2HJ9A 3Q2OA 4R2KA 4REQB 4BRZA 3KQMA 4L1KA 5I7OA 3VAYA 2LXNA 4GPTA 5FORA 4B8WA 4E4YA 1Y98A 3H97A 4FGKA 4PZ9A 1IUKA 3ESYA 1WUTA 3WAKA 3MCUA 3LFUA 4EX6A 2Z43A 1N9KA 4GVXA 4PHCA 3FRJA 3VOAA 2VXCA 1W4RA 2AC7A 2VT3A 3BD6A 1Z56C 5A1TA 2QXYA 5EHZA 2BMAA 4FEEA 4IVNA 2FOLA 1VLJA 1WUKS 3F49S 1ZMOA 3ZK9A 3V8NA 2ZR0A 4K6CA 3BXOA 3I1JA 2D2FA 3WTCA 3KNZA 2QG6A 3EIWA 3OIVA 1A9SA 2JFVA 4NL4H 3NHPA 4C4TA 3VJLA 5FNZA 1V95A 1C0IA 3K53A 4FTWA 3D6VA 4RS3A 4B3RB 3T7TA 2FETA 2CNDA 4WV3A 3U39A 1KTVA 3MCZA 4OJKA 2RDMA 5FBHA 2Q5IA 3R20A 4K9NA 2BFFB 5JS6A 5JW6A 1CRQA 5DX1A 2JGFA 4WZZA 4D74A 3GLGB 2CLLB 4HDCA 4LBWA 4JYCA 4AECA 1NU8A 2C5AA 4GMDA 3CT4A 4ZAVA 2NWQA 1K6MA 1OWMA 2NAPA 5JPIA 3VR6H 5IT5A 1M1YA 1M2OB 1FJHA 2YWXA 4HGZA 2Z3ZA 4LEIA 4YPFA 3HCDA 1G9TA 2JLUA 2OV1A 3FCXA 3D3NA 3KFVA 3PTLA 4OP1A 2QPTA 3FG9A 1R1DA 2LPMA 2XGOA 2YV2A 4TTRA 4HLUC 2PL3A 2QVGA 3EQ9A 2ADMA 4X63A 1P5ZB 2O0MA 5F7ZA 2Q4BA 1W1UA 3TTWA 1G5PA 2HRQA 2GAJA 4Y7DA 3ZVKA 4LF5B 4F3RA 2Q5EA 3GZNB 3ELYA 3AYXB 4JB2A 2PMKA 1RZVA 5ALKA 2PEZA 1S02A 1EQAA 1PK8A 2BHRA 5C8YB 4ZPJA 2MOKA 3UO8B 1FP2A 1ZUIA 2IUSA 1T8UA 3N5CA 1V9LA 3Q85A 3QXGA 1GQYA 4M0PA 2X0JA 3WHLA 1IK6A 1Y1LA 1GAWA 1YQDA 3OJLA 4OK5A 2KHZA 5DHSA 5FUYA 3VZBA 1RKVA 2EIXA 4BWYA 4AZ3A 4CGZA 1LH0A 1S8NA 1XD9A 4EPXA 1JEYA 2OB1A 4KLZA 5AFSA 4RVCA 4JT8A 4KXMA 3GPLA 2HWKA 1NBEA 3H75A 1I9CA 2HFJA 2YCLA 2RH8A 4YUAA 3GFTA 3ZD8A 3LVRE 2MIIA 5DVZA 3S6JA 1ZM7A 3CKYA 3D4IA 1EVZA 4R68A 1QVRA 3IEMA 2Q3LA 2IPNA 1FS4A 5A02A 4FFBB 4U2EA 4WT7A 3DZGA 3RT7A 4JYAB 3H4IA 1GN8A 3B7GA 2IBSA 5K5EA 2BY4A 2YINC 1DJQA 4KGDA 5K3BA 5M2QA 3GLKA 1TZMA 2IT1A 3DO5A 4HEA6 3RFCA 5IK2D 3KQSA 2ATCA 1MVNA 3CFYA 3KYBA 2CLDX 3RS0A 2ZJ5A 3EZYA 3MF4A 3P26A 3L01A 1JQ3A 5HUQA 4A5SA 1QJCA 1I94B 2Q2VA 4OXXA 4FYPA 9LDBA 2WA1A 4UDNA 3OG9A 1CUGA 3FMOB 3KPUA 3N86A 4OU4A 2YYSA 3S2ZA 2G9UA 4P35A 1MX1A 5DYNA 1T5BA 3BREA 3ZWKA 2GN0