3COVA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.5 ang resolution- apo form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 95
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3covA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3covA01
2YY5A 2QUKA 1EFPB 2CUZA 3CLRC 1J70A 3IUBA 1TEZA 1JMVA 4YBRA 2DUMA 2Z09A 2A86A 3G6KA 3K32A 3PNYA 4KKVA 1X6VA 3AFHA 4EG5A 2AKEA 5HUJA 4HK4A 1JGTA 1QQTA 1WXEA 1N2EA 1TYAE 1MB2A 4KPUA 1NUSA 2A88A 1F7UA 3Q12A 2PXHA 4NX2A 2IP1A 2A4MA 1GTSA 2NSYA 2QUHA 4K03A 5EKDA 3MUEA 1WZ2A 2IJGX 4MUGA 1GAXA 1IHOA 3P0IA 1Q15A 4MW9A 4OUDB 2CV1A 2CYBA 4PBSA 2A1UA 1G8HA 2DEUA 4KPUB 3SEQA 3IOEA 1XNHA 1Q19A 3CVUA 1F4LA 2XRYA 3G59A 3KT3A 3TZEA 1F7VA 4PBRA 5IJXA 4H3SA 1MAWA 5DEOA 1ZH0A 4CDMA 4I6JA 4NATA 4HJXA 3RK0A 2V0GA 3AL0C 3TNJA 4MWEA 1YUNA 2A7XA 2QJOA 2QJFA 1QNFA 3IOBA 5DK4A 3FHJA 1ILEA 1PFYA 4DDMA 2R5WA 3IMEA 4NDAA 3A05A 1EE1A 4MUJA 3JXEA 3KT0A 2CYCA 1KKUA 2HMAA 4UZEA 3TZLA 3CLUC 1I2DA 2QTRA 2E18A 5AHWA 4L2IB 1OD6A 3ELBA 4U7JA 5HG0A 1NZJA 1GPMA 2YWBA 1G59A 4F3RA 4ZT7A 3SYTA 3GUZA 1O95D 2X1MA 3CVWA 1ZJWA 3FG9A 1O5TA 4JFAA 4EG1A 4XSVA 2AZXA 4G5YA 2A1TS 3CR8A 1JHDA 1QJCA 1OWOA 3DLAA 2X1LA 4J75A 3QTTA 2DXIA 2HZ7A 1QU2A 3MXTA 3ND6A 4EG7A 2EJCA 1O6BA 3BL5A 4ARIA 1O97C 4OUDA 4P2BA 1EFVB 1JZSA 3IDFA 3TS1A 2CFOA 1T6XA 2J09A 2JAXA 4E1AA 1A8HA 3AG5A 3CVYA 1NUUA 3IMCA 4MUNA 1J09A 1ZUNA 4G5FA 1JEEA 3ZJVA 1UFVA 1XJQA 4TS1A 1O96A 1M8KA 1KORA 3QE4A 2ZP1A 4ZCTA 3X1MA 1KAMA 1XNGA 4JYZA 4MLPA 1LI5A 2XRZA 4J76A 2DETA 2Z08A 4CQNA 1CT9A 5KCMA 2DR2A 1VBMA 1K92A 3ILVA 1F9AA 2H29A 4Q16A 1I6KA 3CLTC 4GRIA 4YP6A 2QTMA 3RBAA 2X0KA 2J5BA 3IH5A 2CV2A 1NUQA 3IMGA 4FZJA 1FYDA 1KH3A 2PIDA 3FNRA 3FY4A 4DNXA 1S4MA 4QBTA 3RHSA 1J1UA 3KT8A 4ZT4A 2DLCX 3PXUA 4XFJA 2B7LA 3X1KA 1EUYA 5TGTA 5JBNA 3CA8A 3H9CA 1TYDE 1T6ZA 3UOWA 3UK2A 3IOCA 2AG6A 4ND7A 2A84A 1MJHA 3COWA 4MW6A 1OWPA 1IVSA 1WXFA 1WJGA 1GZUA 5J59A 4MUKA 3A04A 3RFFA 4YP7A 1QU3A 3ZGZA 1R6TA 3P0JA 4OJMX 1JIKA 2J4DA 4I6EA 4ZT2A 4MVWA 4ZCRA 2VTBA 4JXXA 1LI7A 2WSIA 3ZXSA 5TEVA 3INNA 4MUFA 4ZT5A 1KP2A 1IQ0A 2NZ2A 4XFDA 2CT8A 3FH0A 2VTBB 1M8JA 3OTWA 1KAQA 1NP7A 3K9WA 3UY4A 1VL2A 1YULA 1VBNA 3D6UA 2CV0A 2A1TR 1M8PA 3SP1A 4PY2A 5TS2A 4AS1A 3TQIA 2JA2A 5DB4A 2DPLA 3PNVA 4EG3A 1N2IA 2PG3A 3A2KA 1U3CA 2OV4A 3U1VA 3LCJA 2WB2A 1N75A 3HFJA 1KH1A 3Q10A 1RQGA 1T9GS 4ND6A 3UMVA 1JIJA 4EG6A 1KP3A 3IVCA 4MW0A 4AQ7A 4MVXA 1PFWA 2JANA 1IFXA 2WQ6A 1U7DA 3ZIUA 4YP5A 1NURA 4ARCA 1KH2A 1MAUA 3ZXIA 1KQOA 5LFAA 4MQ6A 4EF6A 4NZPA 3HL4A 3LE8A 1MRZA 1IQRA 1VBKA 4QRDA 2IELA 4MWCA 1M83A 3GMIA 1MB9A 1NYLA 5HUHA 4R2MA 2WQ7A 3H05A 1QRTA 3ISJA 4EFKA 1OBHA 3FI0A 4MUEA 1O94D 1M8FA 1EFPA 2RD2A 4HPWA 3I05A 3L92A 1K4MA 3MMXA 1COZA 1YI8A 3RK1A 1R6XA 4CDNA 2D54A 2YXNA 3FETA 2DERA 3NBKA 1IQUA 3QTBA 5K0TA 5LM3A 4NAUA 5BNZA 4MW1A 3CLTD 4MVCA 1PFVA 1HYBA 3G5AA 2ZUFA 3RJZA 4WNYA 3PRHA 4MW4A 3COYA 1NUPA 1N3LA 4G6ZA 1H1TA 5FNZA 5H16A 3VRHA 3IUEA 1SURA 3MLBA 4MW7A 2O5RA 1U0BB 3COZA 1N2JA 1YUMA 3E27A 1N2BA 1H3NA 3FIUA 4UZFA 4MAFA 1WY5A 1JIIA 2YWCA 1LW7A 3DV2A 3GLVA 1QRUA 5KWVA 1KR2A 4A91A 4S1OA 4R2LA 1WOYA 3L93A 1FFYA 2BYTA 2D13A 4YMIA 4ZCSA 1KQNA 4GU5A 1J20A 3ZJUA 2GKSA 3P0HA 1U7XA 1J21A 1Q11A 1Q77A 1J1ZA 4MUHA 1I6LA 1TQ8A 4Q93A 2J08A 1T9GR 2H2AA 3FWKA 2QUIA 1MC1A 4RPIA 2RE8A 3ZJTA 5K0SA 3HV0A 4JXZA 1BS2A 2X3FA 4ZT3A 3HMQA 2E89A 2PZ8A 3LOQA 4QREA 2E0IA 2Z3VA 5J5AA 3DPIA 2ZUEA 1V8FA 1P7PA 1WQ4A 1WXHA 4HJRA 5IHXA 3SZ3A 3X1JA 1O0BA 2HGZA 2CSXA 1U3DA 3FOCA 2PZAA 3CLSD 4MWBA 3F3MA 4MVYA 5LLTA 3CVXA 4MW2A 3CLSC 3SEZA 1MOPA 1N77A 4RUKA 1N2GA 2A1UB 4U8HA 4EGAA 4EG4A 3VGJA 1KQPA 1H3FA 4BWVA 3N8HA 2C5SA 1EFVA 1T6YA 2I1LA 2QUJA 4R0NA 1I6MA 1NI5A 1GTRA 4DDHA 2TS1A 4X0EA 2QJTA 4CT0A 1PG0A 1JECA 3KFLA 3C8ZA 3M5WA 2BTEA 1YIAA 3CLUD 1B6TA 1YIDA 3HZRA 3PNBA 3VU8A 4KR7A 3S3TA 1PG2A 1Y42X 3N2YA 4KR9A 1ULHA 3AIIA 1X8XA 4MWDA 1TYCA 4DJAA 1EUQA 3HGMA 1GLNA 4L2IA 2VXOA 1EJ2A 3H99A 1K4KA 1M1ZA 4PBTA 1N1DA 1OWNA 1WQ3A 3Q4GA 3CLRD 1EXDA 1WXIA 3NBAA 5TEWA 3AG6A 1D2RA 5KHAA 1O96B 4ZT6A 1K97A 3NV7A 1QTQA 4F4HA 1MBZA 4MW5A 1JZQA 2J07A 1DNPA 3H9BA 3N05A 3COVA 1NUTA 3ND7A 3SDBA 4ZCPA 1V47A 4NAHA 1R6UA 4MUIA 1XNJA 4ZCQA 4MULA 3OP1A 2PZBA 4JZYA 3KT6A 5FO1A 1O97D 4U63A 5J58A 1O94C 1M8GA 5DASA 3AKZA 2GM3A 4I6GA 3H97A 4WSOA 1N2OA 1VLHA 1ZH6A 1N78A 4DDKA 4EG8A 5H7XA 3N9IA 1O0CA 2CYAA 4DE5A 3D6VA 1OBCA 5F23A 3IVXA 2GOYA 1NSYA 2PFSA 3DO8A 1IH8A 5FO0A 2E21A 1N2HA 3TQOA 3SZGA 4DLPA 1IRXA 2OQ2A 3MLAA 1GN8A 1JILA 2G36A 1WXGA 1O95C 1WKBA 3IVGA 3ND5A 2EL7A 4KR6A 3ZUGA 2O8VA 3UC5A 1OWMA 3FDXA 3P52A 1QRSA 1G8FA 3IODA 3CVVA 4K0RA 1PFUA 2D5BA 1JEDA 1G8GA 2QTNA 1OWLA 1TFUA 2V0CA 1TYBE 1H3EA 3A4IA
chains in the Genus database with same CATH superfamily
4JT9A 1DZ3A 4IDNA 4OU5A 2GYWA 4CRWB 1Y6GA 3KUCA 2J9FB 4Z4CA 3LS2A 4O08A 4J91A 3DUWA 3IEXA 4DVGA 2APJA 4UDNA 3CFHL 1AH2A 4LXXA 4AULA 4D97A 2H8KA 3DOEA 3ENVA 5EYPB 2EFHB 3N0RA 3O8LA 4HB3A 3AFHA 2DWCA 3RVDA 3OLWA 1OXTA 3LHSA 4NCJA 2FQXA 2CLOB 4WKPA 2VDJA 4LIPD 4R1MA 3E48A 1TGVA 4X1YA 1BHJA 4MQ5A 2AIRA 4LI3X 3PYMA 2OV3A 1ZWLA 3I12A 1X19A 2WNSA 2WPNA 3C2QA 1NVXQ 4HFRA 1XXLA 4QGGA 1L1FA 4EHDA 5FQNA 3FWHA 1JU3A 1Q50A 3PITA 4LPSA 4NNJA 4YB8A 1E9DA 4UATA 5HJ7A 3UZUA 2PH7A 4LZAA 4WEQA 3H9EO 4O4IB 1MB3A 1V3TA 3BT7A 4C01A 1HLGA 4L08A 3MMZA 5EWJA 5EC8A 1FP1D 3HCPA 5H0IA 3BORA 3RE1A 1KRXA 3N5CA 2GTIA 2JBWA 4FN4A 3GD7A 1LX7A 4GOJA 4NABA 2QBYB 4DPKA 3NWEA 3I4CA 1BHSA 2XT6A 4EYQA 2ZIEA 2X42A 3JRXA 1GYPA 1L2TA 1OLXB 5C31A 1MXFA 2E5LB 2JVJA 4B83A 1L8XA 3W5VA 4F2GA 1T2UA 2DULA 5KMGA 3HB5X 4RK7A 3GK3A 2QRGA 4UFPA 1EA7A 4HJXA 1S8FA 4IINA 2JGNA 3E70C 4RV4A 3HCOA 5HJEA 3KLPX 3ANMA 2NADA 5FYQA 1YUNA 2A7XA 2PKXA 2A5FA 4DR2B 4FBGA 2YXDA 4LA4A 1U0TA 5JPDA 2WKPA 3QIAA 2NUAA 4Z4EA 3C3AA 5GVRA 3D4OA 3K9HA 1O58A 3OQPA 1VYUA 2WNHA 4LI0A 5IT0A 2AXPA 2Z2IA 4PIVA 4EPXA 1QFJA 3ZUPA 5E3IA 2GN0A 1N1EA 5A3QA 1Z13A 2C4WA 2VK1A 1PZFA 5GONF 5C46F 5DGXA 2CYCA 2G40A 3VYTB 1TKRA 3HKEA 2PU7A 2QEQA 4HGYA 4TWZA 4A0HA 3IOYA 4R8SA 2LDXA 3BDAA 1K2VN 3K2QA 4YCNA 5DV9A 1QWSA 1NR1A 4ZV4A 3FPCA 1NG9A 3ZWQA 1TK3A 1JW9B 3JQFC 3K6SA 1IZ0A 1XP8A 5A04A 2J3IA 3GFGA 2ATEA 3L4BA 3LXMA 3TNFA 1JFFA 2ATVA 2G83A 2HEIA 3F5DA 4BZQA 2OO5A 3WY9A 3UHAA 4TXMA 3L8ZA 4XGKA 3PNKA 5EUQB 1JG1A 2EZ4A 3SYTA 4EPTA 3A3OA 3UHJA 2YXPX 2BFCB 4M36A 4QEZA 2TECE 4E2YA 3QLJA 4M38A 1YJ5A 4RKFA 1QX3A 2AZXA 4KWIA 3RG8A 2ZCVA 3NWOA 1CCWA 1SBZA 1U90A 2Q46A 2Y0PA 1VL6A 4UNNA 1JHDA 5H80A 3V32A 3MWDA 4ERNA 2QBYA 5JJKA 5FPPA 1WUTA 3M1LA 3S81A 1R0RE 3T1QA 5IM4F 1EB8A 1QOPB 2VA8A 1VE7A 3P7MA 3C3PA 4DY4A 4RK6A 1FZQA 1NN3A 2YJ6A 4A8JC 2WF8A 1O4WA 4UOEA 1IHPA 2NSHA 5FI0B 5FULA 2NOAA 3FLBA 3L06A 1SPXA 2PS1A 4ML3A 5ITZB 3OZWA 3H5VA 1KJIA 1M6HA 4OSOA 1OE0A 3RIYA 4U9HS 1Z7BA 1SCKA 1UP6A 2W5UA 4MITA 5E9QA 4QBHA 2HWXA 3CEAA 4FKMA 4JKIA 1XLUA 3R7FA 4B17A 3FOWA 2B0JA 1USVA 3RBVA 2XCUA 3AP1A 3PJRA 1JH8A 4PNPA 4MHTA 4DBZA 4RY9A 1ZS9A 4M22A 3RUEA 4OXXA 3X1WA 1SQ6A 1GARA 1I0ZA 1QP8A 1Q12A 1BTOA 2ZITA 4GZMA 3QFRA 3ILVA 5KKAA 5EZQA 5IM5A 3W5HA 1ZR2A 2FMTA 1UPBA 3PNQA 1PDWA 2XV1A 1DFHA 1TQ4A 1CETA 4I2NA 3PX2A 1V5EA 3OZVA 4HDMA 1GPH1 4TKUA 4Y2HA 4G5XA 5ISMA 1OFVA 4QECA 2ZTMA 3B3GA 2OVFA 3RUIA 4A1FA 1UJ5A 2CXOA 2NU6B 1MW8X 2W2LD 3KJHA 5DX8A 1GL3A 4F3YA 4XXHA 1IZ8A 5KYXA 4XFJA 2B7LA 3VVBA 1AUOA 3AFMA 4W8OA 1YH3A 1AGRA 1G16A 2CDNA 2ENWA 2Y67A 3A11A 4GYYA 3B60A 1UBKS 2R6GA 1ISGA 4LJ4A 2OCAA 2EP7A 1YL6A 1U6IA 3AHFA 4QQKA 4B35A 3R9WA 1YRAA 3FDFA 4YMUA 4G8BA 1ZM9A 2FPRA 9MHTA 2JFUA 4BP9A 4KN5A 3PUWA 3KLNA 3SJAA 3RFFA 6NULA 1RTTA 4GLJA 2IEAA 3EA0A 2VSYA 1YQEA 1N8SA 1IHDA 1LPBB 1MORA 1QYCA 4GXTA 4HDSB 4MVWA 4ZT2A 5BOVA 4OMUA 3DE0X 2ZGVA 4AQDA 4R31A 4UOQA 4BHRA 2BE7A 4GKKB 1NJSA 3I8XA 4O4JF 4KV7A 5J2UB 2AX3A 3IUJA 4DAOA 1G17A 2G5TA 3A06A 5CGZA 1W87A 3VHXA 3OHMA 4O1IA 4RSMA 5A4IS 3SZRA 5GVSA 1DRKA 1YQXA 4P7KA 4OFWA 5J5VA 3MCAA 2AX4A 3ER9A 1XD9A 4O4LF 4Z4FA 2Z83A 3IJRA 3ZN2A 2ZSKA 4U7DA 1M9NA 5DKFA 1KSFX 4ZDKA 4H7DA 4RQBA 4WZBE 1MPTA 1J0CA 2QG4A 1VKNA 1RM3A 3K9BA 5AHXA 1G4UR 5I9SA 1GL9B 5T4BA 1JSZA 2AI1A 4BNMA 3Q10A 4FP9A 4GOLD 4HAOA 4J0EA 1Y63A 4CV1A 1EWRA 3LLSA 1DQNA 5G1PA 3SPXA 1FU4A 2PRYA 3HXPA 1KSHA 3BQNB 1RHRA 5LPNA 3HKBA 2LCQA 2C9CA 5FOVA 3NTLA 3I1YA 5DNVA 2O6LA 2MINA 4IVPA 1X1QA 1ENZA 2C83A 4IS3A 3B85A 1EWVA 1CUAA 3PBKA 3OWHA 4YAUA 1SXHA 3NH9A 2DM6A 2ADOA 1JA9A 2WPDA 1E79A 2HA6A 5EIEA 2F9FA 1NYLA 4UBIA 3IHWA 1C7JA 3N8DA 3L1UA 4HGNA 4OP3A 3ZWKA 4NCKA 3ZTTA 1LBTA 4GBJA 5I7RA 4BJ3A 2DFLA 4M0LA 4P3XA 4FDAA 2FN3A 4JGGA 1DHTA 1KP9A 2R4QA 4WK6A 3WZMA 8OHMA 5HKAA 1DG9A 1CG6A 3E1SA 3GGDA 3N8GA 5L40A 3R74A 2EEZA 3OLQA 2ZXEA 3BEDA 2C4HA 3N87A 4UXJA 4RK5A 5IC4A 3ASVA 3UAYA 2PRZA 2IEDA 5C7IO 1DKMA 1XZ8A 3EWAA 3FETA 4BNFA 3IURA 5KYWA 5LM3A 3AY0A 1G38A 1KO5A 3LOPA 1H5QA 3OZIA 4E5SA 3IBYA 1FY2A 2WB4A 2COUA 3ST7A 4B6SA 7GPBA 5L3QB 3K73O 1DHRA 4PLVA 3ZY4A 4C0AC 2ID9A 1NNLA 2JFYA 2D2IA 2BDTA 2FZ5A 1JXOA 3COYA 4QGFA 3WLQA 4BQNA 3IDAA 3FTEA 4HXGA 4WLNA 1Y6JA 5ESXA 4D25A 2Y8EA 1S96A 4ISBA 4QJ3A 3DFMA 2DY1A 4HC4A 4I1OA 2FPKA 4PGHA 5SZKB 4HXYA 3ZCRA 2WHPA 1V45E 1X3LA 2CNKA 1N2JA 1ESCA 1XMQB 1N2BA 1EHCA 2EP5A 4UFNA 1P2FA 4UZFA 4AN1A 3ZY6A 5C34B 5A3SA 3SIWA 1I32A 4EO7A 1AQNA 4IKEA 2WOJA 1JKMA 1V5FA 2ZYDA 3E7FA 3UYKA 2EFJA 1AKTA 1GAEO 1OF1A 4E32A 1EUCA 2Z8YM 1HWYA 3V4OA 1ZVKA 4P3NA 1IK6A 1KZHA 2QMHA 4OHMA 1HR0B 2PH5A 2O05A 2XEXA 4DMHA 3JQ8A 5AKGA 1GGEA 1KWKA 5JNVA 3P0HA 1KMHA 3ZCVA 2P9ZA 2RHWA 4LOKA 5DHAA 1E3QA 5A7GA 1ZN7A 4V1CA 3EPKA 5F3RA 3RVSA 3GMTA 1I6WA 2AJLI 3BD9A 1UZLA 3ZIDA 3B5JA 1QMGA 3RM3A 4DMUB 3RS8A 2CLFB 3U4QA 3KJQA 3NBYC 4KXVA 1WZCA 3M6UA 5EGNA 4L3VA 1JDBC 3OJXA 1PQYA 1E2QA 1G1AA 1SH7A 3WA6A 4F1JA 4ZXPA 5IAOA 3GZNB 2FPMA 4NZNA 3GCDA 3PWSA 1LDMA 1EVEA 3L0CA 3ZDZB 3WWZA 4EVSA 3MT9A 1L5SA 3F98A 1AGNA 3S55A 1TZBA 2EQBA 4BMNA 5BYKA 3TQFA 4P7GA 3NVMB 4V0MA 4DWWA 1V5GA 4RW0A 2ZQZA 3DPIA 2ZUEA 2R8RA 2FP4B 4CT5A 5BSWA 2OBFA 1N8TA 4UAGA 2GR7A 3OEWA 2Z6QA 3KDPA 4DV7B 2VH5R 1QO0A 4RD1A 3IAHA 3MD9A 4M9XA 2H8GA 2YASA 1YBFA 4MINA 2VNKA 5G4LA 4MS4A 2CKMA 3DMTA 3LX4A 2IDKA 3NYWA 4HQNA 4TGLA 5YASA 1NQWA 1RYEA 1H05A 2ROQA 4NMXB 5BYAA 1XC7A 3NR2A 3VR4A 4IQ8A 3WRVA 5JV5A 4AS2A 2VF8A 2XF8A 5L4LA 1N2GA 2ILTA 4Z54A 1KYTA 3A7EA 3ZV6A 1S1MA 1C1HA 1NY5A 1JUDA 3A9RA 4F7WA 5IMSA 4NU8X 4ZHQA 4B3JA 4NH0A 1E0DA 3D0QA 1PRYA 3OX3A 1JEYB 3WZLA 4F45A 4TZ0A 1GSHA 3DAPA 4FGLA 1UM8A 3TEJA 4B84A 3IE0A 4ZRNA 4NCIA 1AK2A 1J6UA 3CT6A 3H7AA 1VCNA 3ETCA 4NDZA 1DTWA 5C5CA 4DDWA 2EJWA 2H85A 3MXOA 3QE2A 4TUYB 1AVTA 2I7DA 2P2YA 3DBHB 4P81A 1QV6A 2FG6C 5C1PA 4Z0PA 4EFDA 4E4TA 1O9GA 1EHIA 4QLAA 1YR9A 4KR9A 3I09A 4UMVA 4DILA 4D56A 3A1WA 2Q99A 1SIOA 2GEUA 2Y0CA 3RRYA 2CEKA 1H2XA 1XOIA 3WK9A 2FWAA 1RWWA 3H5RA 2FJPA 1XLWA 1YS7A 3OIFA 2VHZA 2EC5A 4HYQA 4K9PA 2P41A 3MJEA 3QMMA 1OOEA 1Z28A 2XRMA 1IVNA 1XEXB 1TYZA 4R1NA 1RIFA 1N7HA 2L17A 2X4DA 2YICA 3AR5A 3OP4A 1A76A 3G2JA 1UBCA 3GEMA 1E7YA 1JZQA 1N2CA 2N75A 1DNPA 3SLRA 5I7WA 5C35A 3D0OA 3N05A 4QVIA 2VYFA 1IYZA 5JROA 1UDBA 1V47A 2HDWA 1U02A 1MB0A 2ZRKA 3EFEA 1OI7A 2X1VA 4FN5A 3T41A 3KYCB 1YDMA 4L76A 1GRNA 4F97A 1P4AA 3RKRA 5L3VA 2XZTA 4QUBA 4R40A 1PNOA 2C2KA 2D1SA 3LCCA 2EGUA 2XCTB 2Q1YA 3AKDA 4GBGA 2ONZA 1GHTA 4TZ6A 3UMMA 4QTUB 2DR3A 2I4RA 4WSOA 1BCRB 1Y3IA 1U0LA 2BI8A 4KZKA 1UBEA 2EDAA 3LIIA 3NS7A 5DBOA 3KQMA 4Q4HB 5T5QA 3VZQA 3DNPA 3AF2A 4ZYUA 3DVLA 1MENA 1VB3A 1ZL0A 4LRQA 5CHEA 5AKXA 3UJ9A 5ITSA 1OBCA 4PSDA 4BNTA 4AKIA 3H8WA 2A0FA 3H18A 3ZXYA 4XJSA 5BV1A 1JXMA 2FWMX 2ET6A 3M2TA 4ZZ2A 4E4RA 3EGIA 5ERGB 5CG2A 1TLFA 3GT0A 3RIGA 3SZGA 2HWUA 1QF9A 1E4YA 4HMOA 3EX7C 4Z0HO 5HP4A 2JJ2A 1NVAA 2P90A 1Z2AA 2QRJA 3AEZA 1FSPA 6Q21A 2QAGA 2O19A 5FBHA 4QFBA 4EJFA 4Z6KA 3QVKA 4MJXA 1KEPA 2OGSA 2Z6VA 3UXHA 2PD6A 4D3ZA 3QVGB 1UBFA 3KJIA 3OPYI 2CZCA 3ZHTA 4UUQA 4YRJA 4RPLA 1ATZA 5EAIA 4U7PB 4JITA 3TRJA 2G82A 4GWKA 1CJTC 3U3DA 4KSBA 4AKGA 2RHMA 1KY2A 1G8AA 3WLIA 2REBA 4C4TA 4FEEA 3CZ5A 4FHCA 5JNUA 2RHGB 5HIKA 3AVVA 4B3GA 1WUYA 1MQSA 3WLAA 4NRDA 4AP5A 2P2GA 1QK3A 4NMHA 3M34A 2PMFA 3UWKA 2C94A 3DVQX 3TSZA 4DCJA 5BV7A 1G63A 4CNQA 4WBXC 3NYQA 2GEKA 2A50A 4XTRA 1Y8QB 3CW9A 3KE9A 1LFAA 2BIFA 3C3DA 1E1LA 3ZD9A 4I1RA 1IXZA 2JZCA 4PAOA 1YZKA 4TVSA 5B1EA 4BFLA 1GU7A 3FB1A 3C5EA 3IDSA 2OYCA 3CX7A 3U3XA 1ZUNB 1YK1A 2QOEA 1AURA 1K0UA 3AEKB 3EVFA 3JD2A 3PPWA 4G4JA 4D9FA 1MX9A 1ZJ5A 3QX7A 4NX2A 1I14A 4Q00A 4AECA 1EJ0A 4BE4A 1USKA 2HFJA 3ABQB 2PGLA 3D8TA 1PZNA 1U8XX 5CX1B 4ZVTA 4OGKA 4P0PB 3HU1A 1JSRA 5JSHA 3CH7A 3GB9A 3ET5A 1Y4DE 5MGNA 2DH5A 4B8ZA 1ZESA 2BTOA 4TMXA 4EVIA 3W5CA 1ACLA 3Q1KA 2A1UA 1A96A 1K89A 5LC1A 3I5YA 3USCS 2IUTA 4Q6BA 5IUNC 4P54A 4XDGA 3VJMA 1E9EA 1G8HA 1OB5A 1RIIA 4MQFB 4TWIA 1G5HA 3EH1A 3IOEA 3LBIA 1K7SN 2C4VA 3BMOA 3EHDA 5D86A 1R8XA 3T15A 2CFIA 2OKGA 2WFLA 4TLMB 2C2BA 4RHYA 1QPGA 2XT9A 4F71A 4WL0A 4WN9B 3KZNA 1KDRA 3PCXA 4BRUA 3ZV4A 1U7TA 1WXXA 1IIRA 1E2EA 2BL4A 5FR2A 1BGVA 3T7KA 3FPFA 1G4AE 2PA3A 3ESQA 4J1TC 2XNCA 1CQXA 1W59A 4HRAA 4MWEA 1BMTA 3CO0S 2EBHX 2P91A 5JW6A 5IT9A 3Q8LA 4M9SA 3IOBA 1UANA 4KSCA 2R1TB 5BY2A 1XZHA 3NIBA 1Q20A 3QELB 4L74A 1Y3BE 3UIEA 4FM9A 3L5KA 2QVZX 3ZE7A 2NACA 1B1CA 1QIFA 2HM7A 4UPEA 3DHWC 4NP6A 3W2TA 4PLWA 5LZ9A 4R6XA 4F1KA 2FXIA 3RC2A 2ODWA 4JSRA 3RFVA 1GFIA 1QZUA 2O2XA 3WNQA 1U5CA 4LRUA 1ZIXA 2IFTA 2QRNA 4NICA 4YDHB 1N5DA 1Y3FE 2HMAA 2Q27A 1PJ8A 3OCVA 4N5HX 2W2NA 1SU8A 4MI3A 2IY8A 3P2MA 1EGMB 3ACBA 1CIVA 4MWZA 2Q5HA 3JU3A 3IE1A 1W30A 3BIFA 2F9LA 4ZAFA 3EZXA 2QAJA 4U7JA 4YMGA 2QUAA 5DRYA 4FR0A 1XZJA 4MRMB 5JQGB 4UNQA 2EAUA 3IJPA 1ZPDA 1WQ1R 4F3RA 1GLGA 4L4UA 4O8CA 1JLRA 4FGWA 1DEAA 3TKAA 1LRLA 3AJEA 3RQSA 2H5EA 2X1MA 1IBMB 1TPZA 1X9GA 2A57A 3T3IA 4MRPA 4XSVA 2ATCA 1LD3A 1AHHA 3GZJA 1C7IA 4A0RA 4B6PA 1T1IA 5L6LB 1W4CA 3AB8A 2DKOA 1C2YA 3BGSA 2B8JA 3KK0A 4JP5A 2IRWA 4BLUA 1XCBA 4EG7A 4DA7A 2R7MA 1OV4A 2FF7A 1B0ZA 1RWXA 4I9FA 5JS2A 4YVFA 2DT8A 1QP0A 4K6GA 1JZSA 4M46A 5L7TA 3AHIA 1CY4A 3P9YA 4A6XA 3QX8A 3QKSA 3RSGA 1GAWA 1UK9A 4XD7A 2OXCA 3UCEA 5A4JA 1NM5C 2INGX 3AQ4A 4JYMA 3WHKA 4LHXA 5KQGA 2ODQA 2G70A 4B43A 4BNYA 5LZ7A 3WNZA 1BKYA 5DULA 1NLUA 4KE7A 3H5TA 1X92A 5JALA 4B74A 3HK2A 4ZYWA 2VJQA 3PCRB 2HSGA 5D3KA 5JNSA 5K3OA 3UA0A 3Q8WA 4G2TA 1ML3A 2ZP1A 4ZCTA 2XZOA 3BIXA 1ONBA 2HV9A 3H4VA 4Q6WA 2VJLA 5BUSA 3WJ2A 3I23A 3TXXA 1K3FA 1B8UA 4ND3A 4DCUA 1USGA 2XUGA 4KGXA 4CLEA 5KCMA 5EQFA 4N18A 5JZBA 3LSYA 1Z0IA 2PUEA 2X1HA 4J0CA 3WG9A 3WLJA 4Q16A 3OOWA 2VAMA 5E2IA 4DRXB 3PQ3A 2FMUA 2JF0A 1HSZA 3AV3A 3PDUA 3ZDFA 3F2IA 5E9WA 3GDFA 3AB7A 1G291 1DKOA 1SK9A 2BGRA 2GI4A 1R6DA 5F51A 3WL4A 1P9RA 3AR7A 3Q2OA 3ZLUA 4BX9A 1T2FA 5GP1A 2IOYA 1KBZA 3HG7A 5IUJC 3E5NA 4GRDA 2P0EA 2GPBA 2P9QA 2ZR7A 3CNOA 4ND1A 5IAEA 3H5NA 4BCCA 3FKJA 1LVUA 4DNXA 5IBCA 2AFHB 4S05A 1JMKC 1SXJC 5FT9A 4R1TA 3U3MA 4JLSA 4W82A 4AKHA 2JCXA 2K4MA 3D5EA 3FYUA 4P92A 2H3EA 1UEXC 4MR8B 4N01A 3ANSA 4LDPA 1YGYA 1Z88A 3F6CA 3IAS1 2QORA 5DBEX 4EEZA 4IAOA 1W0KA 1G98A 1JLSA 2G0AA 1BQ3A 2WIAA 3DL7A 3KYJB 3DQPA 3M1AA 1MJHA 3JVIA 1I7SB 2V74B 4O0LA 2G3YA 4Z9FA 3ZWAA 4LBVA 1QE3A 1AMUA 3GEEA 2TSYB 1LLDA 3VJLA 4WZBB 4MA4A 3ROZA 2Y92A 2Q45A 4TZTA 4YP7A 4YXFA 3HJGA 3V1TC 1ZH8A 1WS6A 2KLBA 3OT5A 4TV9F 1W29A 3R6GA 2ZSIA 4Z8YA 1QHHB 5ILGA 3TI9A 4HQLA 5AKYA 3RS3A 1MABB 4ESOA 2IZ7A 4ZTZB 1FLAA 2WJAA 4O8ZA 3U6BA 2HMUA 2WHPB 1VLMA 3Q9UA 1S2NA 3LKDA 4R1OA 4AY5A 3INNA 3NDJA 4IHJB 4MPRA 5T4FA 4BNHA 3WX0A 3RTBA 2JFNA 5FUMA 4XPIA 4QOJA 1TLLA 4YCDA 1W52X 5IASA 2FP4A 4H7JA 4CFSA 1QVVA 1IEWA 1FTSA 1NP7A 2NWQA 2ZBUA 3QU7A 2WTXA 5EINA 2NPOA 4EWLA 1J5EB 1HT3A 1LJ8A 3L0PA 1TD1A 3A14A 3B6KA 3HV2A 4IMRA 4JVLA 4PZLA 4OQNA 4RENA 3SFVA 2YR0A 1HO3A 4KFCA 2MSDB 1Y1LA 4RIIA 3EG5A 3SR3A 2WYHA 3HRIA 1EM8B 5FWYA 3TAUA 3FBWA 3CUYA 5BQ3A 1XMOB 2DPLA 1UJCA 2DSNA 1BW9B 1BXRB 1BROA 1ZVMA 2QZSA 2PG3A 2VBCA 2OD2A 1UC9A 1ZA2A 4M0FA 4LJ8A 5JAQA 3PHGA 4AXBA 1SZJG 2QN3A 2GO7A 3HVRA 1QIJA 2V4UA 3D7KA 1VXRA 2J7PA 3G0DA 4GAEA 3BKXA 2C2XA 1E9AA 1DAOA 1ID1A 2AOWA 3ZBTA 1EINA 1XVVA 4R5HA 3CKKA 3TZHA 4MVXA 4KXWA 3ROGA 3B53X 1CUDA 1U6KA 5LQRA 5G4KA 2HK9A 3ZIUA 1NURA 4BN4A 4CM4A 5JMOA 1M2FA 2P2ZA 2IDJA 2FDXA 4X60A 5LFAA 1V16B 1AUPA 3W7VA 2J9XB 1KEVA 2AH5A 2XMCA 2GHTA 3FPKA 1W1WA 4RIEA 2V7XA 1SXQA 1IQRA 1ZXLA 3D6MA 2O2HA 1E3JA 3QU4A 2R8ZA 3HYCA 4IOJA 4RGQA 1YDGA 4EUEA 1VBKA 4M1QA 5JQGF 4QUEA 3PHCA 3E4DA 2VKTA 1FMFA 3U4CA 3EMKA 1VLQA 4QE3A 2UZ0A 2GRAA 4HWKA 3N39C 2F3UA 1GR1A 1QGOA 2QIOA 4EKYA 5ADVA 2ZYAA 1IC6A 4W6ZA 3EGEA 4I9UA 4NCBA 1XRPA 2BSXA 2KX7A 2ZB7A 4HNUA 2B82A 4NK5A 7REQB 4IGAA 4UHDA 4CL0A 2Q2VA 3I9JA 2FG5A 2VHVA 2WZCA 3AU8A 3IE2A 4WDRA 3ZH9B 4CDNA 3RPEA 1NMEA 2QL9A 1YV9A 3PDWA 3I52A 4QYWA 2DQZA 4BX0A 2VIIA 1RHQA 3N28A 4L8YA 4OQMA 1TJ5A 1OILA 1PFVA 4S0ZA 1QTNA 3KKZA 4A92A 1YDWA 2XNDD 3ESAA 2JGMA 3CR7A 5B1DA 1WR8A 2UUBB 1TAHA 4GR9A 1XTRA 4WXPA 5BNWA 1U2ZA 1UBJS 4QOGA 4U2EA 2QS9A 3OA0A 3VPCA 4JI1B 2VF7A 5DO9A 2OP0A 3SSMA 5D85A 5FOSA 3HPQA 1RZVA 3E22B 4ZQHA 2I29A 3GLIB 1FFSA 1L7XA 1Z6AA 3RLIA 2EL9A 3P2JA 1N6IA 4HQOA 4HAWA 4F3CA 4BY9E 2E4VA 1DFGA 1H6CA 4KACA 2DOKA 1VE3A 2PKRA 3HFGA 4J4BA 4IBOA 4COOA 1XSEA 4S04A 2OZLB 4BGDA 2BRUC 4TTSA 1U2EA 4EUFA 5A5DA 3ZJUA 2FAXA 1XZNA 5SY4A 1JT2A 4LFBB 1VJ0A 2DUJA 2I5PO 4KLCA 4HX9A 2WSLA 1ZMRA 2ANBA 5AHOA 5JCPA 3EIOA 3S2ZA 3STHA 2IPAB 3OQNA 1AQYA 5BRAA 2IUEA 3BQMB 2HA0A 3TAHA 1OZ0A 1AY0A 2R65A 2C7BA 4HDQB 5LQSA 5LUBA 2OHVA 4B2IA 4P6VF 4YACA 3EXFA 3ZLBA 1KTVA 4UZSA 2HXGA 2E6UX 1YQGA 1KE1A 1II0A 4BQSA 4YQFA 1VSUA 2G1PA 2FETA 3LOQA 2WJZB 4I08A 5B30A 1Z6YA 4RF3A 4X90A 4HJRA 1M6NA 5AP9A 4AJ9A 3LKBA 2F43B 2G67A 1FRFS 2FE4A 2C98A 4PSKA 4YJGB 3F74A 1G0OA 2XXJA 5AOVA 4BB9A 1D04A 4WLEA 5BSTA 3SEFA 2HGZA 1U3DA 4KFRA 3FOCA 3WLFA 2FR8C 1FRZA 2AI3A 5G3YA 1PK7A 3FXAA 3RRJA 4ZQGA 1M74A 1X9IA 4CNBA 3WLLA 3MTDA 4KAAA 1Y4ZA 2XE4A 1L7DA 3PXCX 4RE6A 3CLSC 4BOYA 2EKDA 4QUGA 4UNPA 3E22A 4WY2A 5BWCA 1DC4A 1XLTC 2H6EA 3HM9A 4YUZA 5BR8B 3HR4A 4Q4AB 1LS6A 3CKLA 4UHJA 4KIWA 2R11A 1KVRA 2OK8A 3NTRA 1SQ0A 1EP1B 3PR1A 4DJFC 2C5SA 4Z3OA 1KI8A 3LQKA 1J2TA 2O2EA 3H9QA 1L9XA 4RSRA 1U4NA 5EJAA 1NI5A 5FFMA 3KKOA 1T8UA 1U98A 2VKQA 1GXSA 3F6RA 4GE3A 4BMPB 1H4TA 1Q7EA 3I2HA 2C5HA 4FJ1A 4CIYA 3BXPA 1PG0A 2NXCA 1C9JA 2FFQA 2G25A 3II6X 3EGCA 4DC9A 1IG0A 4DOMA 1BH6A 1X7XA 2CHVA 1KQ3A 2JK1A 4I19A 4AI6A 3CGWA 3HI4A 4PZ0A 4I99A 2C2MA 1U2SA 2FSUA 4BZPA 2R5FA 3O8RA 1Y42X 2XUJA 1NN1A 1NOKA 5G0VA 4P5DA 4B6JA 2JGLA 3Q7IA 4BO0A 2QPOA 4W1RA 5ALTA 4C2BA 4FC6A 4P86A 4DCTA 4KLRA 3BRCA 4Y2TA 1ODSA 3HYRA 3HRKA 3WGHA 3Q4GA 1H66A 2PZEA 1DIGA 4O1HA 2EYUA 1DX4A 1RYMA 3CB4A 3RSFA 3IIMA 2XVXA 4CV3A 1EXDA 5KU1A 1QCYA 3WGKA 5J3JA 3RU2A 4MS3B 3LECA 4OXIA 3LUCA 5F4BA 2D3WA 1XFDA 4DV3B 2JGJA 1LEHA 1J5XA 1RNLA 4P34A 3RRMA 3P1JA 3H9BA 2Q5OA 3QU2A 3UO8B 2I62A 4MLDA 1LPNA 4CM4B 5HKBA 3ITNA 2OXRA 3OJEA 4YMWA 1RCUA 3IAAA 2J3EA 4A3SA 2NUAB 4JLAA 3W0LB 5DTEA 1Z73A 3T12A 3KQYA 3OUUA 4MWTA 4N9QA 4YXWD 3CO5A 3KT6A 5J2TF 1XMXA 1O97D 5D51S 4GO1A 2J7KA 2N1MA 3I4LA 3UJ3X 2AMLA 4B6FA 3B8EA 4E70A 2EFDB 3U49A 1E6EA 4WVLA 3M6AA 2C9OA 2RKWA 1FFHA 1NF9A 1C9MA 3ZDYB 2OCYC 2VJPA 3RG2A 4KH0A 1SBQA 1QAMA 5HGXA 2C8VA 1FSFA 3T7IA 4B87A 2WF6A 1SK8A 1QRAA 2Z3ZA 3CZAA 3M0EA 3STTA 1CK4A 1MQAA 4MQLA 1XTIA 2IGTA 2QZ4A 1TFRA 3RWOA 4CEJA 4C2UA 1NBEA 4LYYA 4AWXA 2ZJ7A 3PQFA 1G7TA 1Z7YA 1NJ2A 1CVRA 1B00A 2ERYA 2PFSA 3IELA 4Z7JA 1ZLXA 3O38A 4ZVQA 4HXFB 2FSVC 4TQUS 2IVFA 2QT9A 3TQOA 4ENRA 3OIYA 5K09A 1SXPA 1NP3A 2OQ2A 3G8DA 4H7FA 4MV5A 1X8LA 1E69A 3BC1A 3IULA 1ILWA 3BXHA 3L8CA 4L8FA 4RD4A 3P19A 3HWX1 4IGIA 3LGXA 3V55A 3MWJA 2R84A 3D3WB 4KWEA 4C4AA 1DPGA 3D7NA 1DAKA 1OBOA 2GPAA 5GM1A 3ORSA 1Y9JA 3C1UA 3QKSB 1CUUA 1J2EA 2OZVA 3ENKA 2VZEA 2RKOA 1SBNE 5EN4A 4I66A 1JN0A 1HSOA 3QVMA 2XVMA 2VUUA 1AM4D 3CM0A 1AX9A 4C7XA 1Z9BA 1P61B 3CLHA 4RKQA 4GVXA 2OGTA 1UPAA 2HSDA 1M1YB 5J43A 3A4IA 3PCTA 1DIHA 3ID6C 4RESA 2ZUVA 4BMOB 3L8HA 5T3UA 1E7RA 2YY5A 2PVSA 3EXHB 3FUVA 2JH9A 3AY6A 2PS3A 2ZSEA 3CLRC 1KS9A 4YRZA 1JWLA 2DPGA 1CEQA 2WUFA 1K88A 4R1LA 4RHUA 1QC5B 1Z5PA 4H08A 2NTEA 4BO5A 1HOTA 1D0SA 2Z09A 2HXSA 2IXGA 3R6DA 1L4GA 1P4SA 4KKVA 3IP8A 4DXHA 4JC0A 4EUKA 1G6OA 2YFHA 1T36A 3WO1A 4AIIA 3FTFA 1E1NA 1AHNA 2WFMA 4MRMA 4ON9A 1MO5A 3BAFA 1GG5A 3S28A 4MV9A 5B3JC 1FVFA 1J4AA 5TPWA 1RZUA 3T54A 3CU5A 1P9OA 3BMQA 4G63A 2IU4A 1EFKA 4CR7A 1WHSB 4DR4B 1MJGA 3C6ZA 2UYGA 1DCMA 2Q7XA 4P98A 5E4TA 4PBSA 1JYFA 3RB8A 3RYHA 4DPLA 1XAJA 4PIMA 5CLJA 4BB5A 1M2EA 3AR9A 1XR3A 3N2GB 1DOHA 3AM1A 3KTOA 4QPCA 5DBIA 2WM2A 5I7UA 3SEQA 4BZZA 1QO7A 1FDRA 1NFQA 1OQAA 1RI4A 3B7PA 3OQIA 3UAGA 2Q41A 3NOXA 3PNOA 4XWKA 1FS5A 1LZKA 1KO4A 1X13A 1THMA 4GGPA 1T9ZA 1OLUA 3B3QA 4OKIA 3WFJA 1POXA 2HQBA 1C1DA 2FMHA 4H3SA 2KBFA 4KX3A 5KSPA 2OA0A 3DS8A 4UNRA 2D5AA 4WCVA 3AF5A 3VKGA 1A4RA 1WLYA 3TW6A 1IE3A 2C2GA 4NKRA 2UAGA 2YTZA 5FEMA 3ZH2A 2ZDHA 3KZ1E 2QE6A 4R7GA 1P8JA 1F12A 4LZOA 4I8IA 5AT1A 2LXNA 4MV0A 5C1OA 3LUDA 3J7AC 4GNRA 3LPMA 2ZUTA 3FZGA 1WU8A 5B1SA 4AD8A 1G19A 5ESRA 4MARA 6CHYA 2FEKA 5TMEA 4NS1A 3CWZA 3GAMA 1JKJA 3AY3A 5GQSA 2BFNA 1G5PA 4MUJA 1DJNA 3C43A 3NYIA 4KRFA 3HSKA 5BQOA 3UJ7A 1ZGCA 1RQPA 3PNLA 4FYYA 2X6TA 4BVHA 4DJJA 2F55A 1A9OA 1E2UA 2BCJQ 1XG5A 1KK0A 1FNSA 2J6HA 3GBVA 4IDEA 1SEPA 4WESA 3ECAA 3WHLA 1Z39A 2BGGA 5C18A 4L07A 3O8BA 2HIMA 4WK4B 1EGVB 5IJ9A 4NXNB 1O95A 3M6XA 1LJLA 1EG7A 1E64A 3E82A 1NT2A 3IBCA 1QVWA 1HETA 3QF7A 3A4VA 4QYMA 2AJTA 4OVKA 5EZYB 5TC4A 3DDOA 1XA3A 2NG1A 3VR5D 1RXVA 2QM0A 1XQ9A 4ZK6A 3LNTA 2V3CC 1RCTE 3DSRA 2VSQA 4BMZA 3KAKA 4WADA 3BK2A 1UIMA 2QRUA 2SKDA 3CVWA 1EVQA 3I01M 2FY8A 3PUKA 4YUWA 3T7SA 1XT6A 1XXHB 2VHJA 3A7DA 1I0IA 3SX0A 4LVCA 2PSJA 2A1TS 3IP1A 5BT8A 1OYWA 3FCYA 2B8EA 4F2WA 1Y7IA 3KPWA 1DJMA 3BDIA 5MFZA 3N3AC 4X20B 2X1LA 2ZANA 4J75A 4LGVA 4ZOQI 4OX9B 3D8RA 3QMVA 1GGHA 1DAFA 4XGIA 5K1ZA 4OYHA 2F1HA 5ALUA 1JG7A 1VPDA 2Z5LA 1F2VA 4BJHB 4DUYB 4O29A 2ZSFA 2ZJ5A 3UANA 4F9GA 3D7SA 3NMUF 2WTBA 2ODEA 4DXAA 4B3FX 1SCBA 3ER6A 3O91A 4IZOA 2GN4A 4GOMD 3TZKA 3MERA 1UDCA 1ZRMA 2GYYA 4TSRA 5LNK6 2B98A 5DYWA 4RZ3A 5EA2A 3EXEA 4R54A 4U2DA 4E5YA 4ZFNA 5KPDA 1IXRC 1FQJA 2YWRA 4JJ8A 3ZZTA 2P5YA 1BCSB 2BFDA 1UH5A 4OLHA 2C07A 1S89A 2VNHA 4M1WA 3V8VA 4FDVA 3NAMA 1U5BA 1PE0A 2EEPA 1ZG3A 2VYQA 4DB2A 3S2IA 1PHRA 1XK7A 3QE4A 1MRSA 3VXKA 2JLXA 3NX4A 3GCGA 4PZUA 1QC5A 1PGPA 2V7GA 3VJKA 4D9CA 5JZMA 3LMKA 4X8OA 3A9TA 5CJPA 4DIMA 1N9GA 4D8WA 2RH5A 2PJRA 3BCHA 3BMCA 4CKWB 1M10A 1TT5B 3C14C 3MPUA 4JY7A 5LKAA 4HP8A 3AONB 3RFXA 4ZYVA 2BEVA 3S6JA 2DT5A 3V7YA 1CFJA 1TIPA 3OEEA 4GRIA 5K01A 5FOXA 3GLKA 1TVKB 2X0KA 3LW8A 4ABTA 1KK3A 2DQ4A 3WAKA 3CW2A 3OJFA 4G65A 4L75A 3S0JA 1YHZA 4MUAA 3Q3GE 4HXEB 5BSVA 1KU0A 3EIFA 3AYXB 4IMIB 1LBHA 4GX5A 4FWBA 5CVUA 5JXWA 3B2EA 3RUCA 1AV7A 4M88A 1J24A 1JJIA 4HR7A 4F3KA 2OBYA 4TWRA 1Z0DA 3OQHA 1TA4A 4LOIA 4A8JB 1ZI8A 1Q57A 3L40A 1L4HA 3OFSA 1BXRA 1RXIA 1YKGA 2B69A 2QLFA 3L6BA 4ZO6A 5DWQA 5LVAA 5EE1A 3ZHQA 2ID7A 1U8FO 1XDBA 2XYHA 1F2TB 3V97A 3EIEA 4B1FA 4E4YA 1X1RA 2EF1A 3DJYA 3CUVA 2WP0A 1F5SA 3VOSA 2P3OA 2WR8A 3P0JA 1JE0A 1CC1S 4LNAA 2PSDA 5ALFA 5KJ1A 4HWSA 4B40A 4DIUA 3T7JA 1KYVA 4PLCA 3NBMA 3H6KA 3R6WA 2WZQA 4YRRA 4Y6RA 3DBVO 1OW3B 3PVZA 4M98A 3ZW7A 4NG5A 1B0UA 4JMLA 1TU0A 2HPZA 5I48A 1DKPA 1PIWA 3SHOA 1KP2A 1QHYA 3BE8A 1ADGA 1F4VA 3LLUA 3GLSA 3PLNA 5KYKA 1QUFA 1AS2A 2AG5A 4EKNB 2NZ2A 2JLSA 1I7DA 2B21A 1Y33E 3LZDA 3MELA 3PE6A 4CLRA 2GETA 3JQAD 3QVLA 4ZANA 1EFRA 2ZE6A 1TIBA 3BTVA 1LCIA 3IUSA 1Y8CA 4UHFA 3W6OA 5KBYA 2HLDD 4TQ9A 3B9BA 3MINA 2QKYA 5EJEA 4MMXB 3MMNA 3NM6B 5B1IA 1WETA 4YJ3F 3QFHA 1Z16A 2YC2C 4PG8A 3K70C 1PNVA 3KQSA 1EZZA 3D31A 2H08A 3L49A 4YN3A 1GRVA 3O7WA 1P1KA 3X3HA 3EIHA 3NT5A 1KZ6A 1RQXA 4DQDA 3K8ZA 3DE3X 4IDOA 1JR3D 5ELMA 3R9IA 1W36B 1U3CA 1ISPA 1RP7A 1VE5A 4DA4A 3PFGA 1IHYA 2ENUA 1XDWA 4QG7A 5F1KA 3IFSA 1NNSA 2OCKA 1HT1E 1ZVJA 4YCBA 3KWFA 3FNEA 1U2GC 3SLGA 4EZIA 4BMVA 1VM6A 1XNRB 1XLTA 2BEWA 2I3ZA 3GJ6A 1G64A 4Z0TA 4KIGA 1MZPA 5CFZA 5ALJA 2C20A 3L7DA 3T5MA 2NVBA 4URVR 4RJTA 2GCIA 3D8NA 4RFSA 4MVJG 3SE7A 5AVZA 1OHHD 2IW3A 3CSSA 4WH0A 1P5ZB 2F90A 1SZDA 4NZPA 3ZXIA 1FFBA 3HL4A 3UWMA 3LE8A 1N9ZA 3OD5A 4IYJA 4WMLA 3QKRA 3IKLA 5DM2A 2OHGA 4XWTA 1PGJA 1U9CA 5EIBD 3P9XA 2FG7C 3WWEA 5IT5A 3MB8A 2ZU6A 1MX1A 2BGUA 2HLHA 3GUUA 2V7QA 4X97A 5D01A 5H83A 4PTLA 1YB6A 1NJGA 3COJA 3GJ4A 1J22A 3AI2A 2NTYC 4TS4A 4QATA 1O94D 2KW5A 2V7TA 1E2PA 3LC7O 3M1IA 5DSZA 3VPSA 4RGBA 1JDJA 2ZYVX 3BBPA 2RI0A 3G23A 3ZHRA 4RTSA 4BN0A 3QX3A 2HLPA 1UQRA 4G24A 5GONB 4BVFA 3GRFA 1KC1A 1LVGA 3GLQA 2V6JA 4EENA 4YCMA 1E9RA 5IARA 4EGCB 1K5DA 4MDEA 3SXPA 3IPYA 3SCZA 4I8XA 3EE6A 3GUCA 4M53A 3I32A 5G53C 2Q3MA 4TUYA 4D0GA 5K0TA 1O4VA 1KK2A 4MW1A 5SICE 4MVCA 5FLYA 3ZDQA 1PJAA 2A33A 4Z9AA 1OJLA 2G1JA 4MYTA 4AL4A 1WXDA 1PJTA 3H11B 1NJ8A 3BRWD 4A73A 4QULA 1UBGA 2BDUA 1A5BB 5J4LA 2WI8A 1Q6ZA 3TLYA 2BRUA 2AT1A 3STUA 4YRMA 3PF8A 1XRJA 1B74A 1RLMA 1P1BA 2YYSA 2P7IA 2DG2A 2O2DA 3BERA 4OLFA 1W44A 3M4YA 1IUKA 3P27A 3BWVA 1E7SA 1AS0A 4JJZA 4L5CA 4OB7A 4Y6GB 5E6RA 3W7AA 4HGRA 4JMPA 1MO6A 5A06A 4MAFA 3BHIA 1SA0A 3QBTA 5IC5A 2GZSA 3X2SA 2QTVA 3QP9A 2O14A 1DCFA 2BEJA 2GILA 3QXHA 1KZ1A 2IKQA 5B1YA 3AI1A 1MZVA 2UDPA 2G80A 1VA5A 1Z0FA 1SMKA 2LNDA 1K98A 2OOSA 5E0KB 3FR7A 4LXYA 1K7FB 2FPWA 1UUFA 2HHAA 2IIQA 3RVLA 3H5LA 3QH4A 3VNQA 1UKCA 4FNOA 1DEHA 3DE7X 3Q15C 4LWPA 4MVJP 3SHQA 1J20A 1PWXA 4NULA 3RVMA 4XRGA 3D7RA 2O7SA 4IJWA 2FDRA 1LWOA 1Q11A 1ULSA 2XQVA 3KIPA 2O3JA 1MEEA 1X1CA 1M1NB 4I4CA 2G77B 3VR5A 3INRA 4OBWA 4B09A 5COAA 2FPGB 1Z38A 2EIHA 4EJSB 4NE9A 4Q93A 4IH4A 1YJ8A 2FJUA 5GOZA 1YD7A 2I03A 2RETA 4OQXA 4DLWA 5IPFA 3MCWA 4GYWA 4WXYB 3L6CA 1EFAA 3TD2A 2RE8A 5K3EA 2ZJFA 1PK9A 3RYCA 3NJRA 3D3JA 1NMQA 4IJMA 5KTMA 5BWOA 1QOZA 4BZWA 3MJHA 5DNUA 2WJIA 3I45A 3G49A 4QAJA 3TR0A 4ZQBA 4G89A 4MH0R 5FBWB 3KWMA 4NZ9A 3GVPA 2WKQA 2J6IA 4N6NA 3IP9A 2OORC 2C7GA 3UKOA 3ZBPA 1MIOB 2OEPA 2G8NA 3OQ6A 3DBRA 4JJFA 3U61B 3Q98A 4HBGA 4LJRA 3KYIB 3BD7A 4G07A 4DUGA 1E1KA 1R5OA 4P5EA 4NU0A 4O2BA 5CG1A 4D3YA 1FJ2A 5DSXA 1GAJA 3LFTA 3AI7A 4Y0AA 1W1UA 3P4XA 2NVUB 3ESCA 2GKOA 4YV2A 2V4MA 1GNSA 2WKWA 5JSQA 3RRXA 1E32A 1U11A 2HIAA 2YMMA 2EW8A 3H1AA 4HEQA 4HS9A 4HUQB 2A1UB 3LY8A 4IV5A 1SJ9A 4XX0A 1WVMA 1RYYA 1DXHA 1SB9A 2HNKA 1EVYA 1TVEA 3OC6A 3ENQA 3B82A 4BWVA 5BMOA 3SQOA 5EUBA 5ICSA 1GZ3A 2NU8B 3H3JA 2PQ0A 3L18A 4KRYA 4KQCA 1WM1A 3GY0A 5EE3A 4EEXA 2BFEA 3Q8MA 1GTRA 3R7WA 2EX4A 4BJ5A 4Z7QB 1FPQA 4NMMA 4UKDA 2I3AA 4C7KA 1GA4A 4CE6A 3QA9A 4B7XA 3J7TA 4D41A 1Y1SA 1RHKA 5ALQA 1GCIA 1NVGA 5CFLA 1Z2EA 3QPWA 4MRVA 4L57A 3I9OA 2EKBA 5E7QA 3C48A 2QSJA 5KEIA 5A4MS 2YJ3A 2M6SA 4US1R 1YIOA 3MOSA 1YACA 4R2WA 2OVBA 4K6MA 1E3WA 4IF6A 4TN1A 1TYCA 3CZ9A 1K5PA 5CGQB 2PQ6A 1MD9A 1A2BA 2HL6A 4D4IA 5LZ8A 4F2HA 1OMOA 2CK3D 2CXQA 2NUPB 2ZI5A 1E79D 3BD6A 4O2AF 2F8LA 3EZ7A 5JVDB 3VYWA 4Q4CA 5C8YF 1TA0A 3IV6A 5AUOB 1KI2A 2DUNA 2H7YA 2G5ZA 1JJ7A 1U0SY 2CD7A 3P2EA 4XB6B 2QG9A 3SKVA 1B93A 5AW7A 4MIKA 4ZALA 3ZZ1A 2XB2A 7ADHA 1MBZA 1S2MA 3C7KA 5B3LA 4MVJI 1HNXB 3FZEA 3WYAA 1GSOA 1FDTA 4TQGA 2GEVA 2DB3A 1JKIA 4KW7A 3W05A 1R3UA 4JJAA 1V9LA 2G8LA 4BQEA 5EFZA 3S27A 2XMBA 5C8YB 4NQZA 4C0JA 3KELA 1SXJA 3PEYA 3OM8A 2P0YA 5EIHA 1GV1A 1UFKA 3D59A 3GRZA 3HBAA 1ZKDA 4ZKEA 1OPXA 2OHIA 1E6KA 1ODIA 3G13A 4DNFA 1U8ZA 3R75A 3MCVA 1X94A 3Q9LA 3HLTA 1QTRA 3L05A 1JPVA 4X1KB 4INZA 1XMVA 1WO8A 4K1XA 1BJKA 3CRMA 2XWQA 2IE0A 2CLDX 4EG0A 1JB1A 2NQTA 3I9V1 2VDWB 1VIDA 2X8WA 1JBEA 1VIAA 3EVAA 4F0JA 221PA 3MCZA 1XRRA 3I42A 3DEHA 1ZONA 1W9HA 2R8YA 4I3GA 1VMEA 1JHYA 4EFNA 4MGHA 3T3HA 3G82C 2ZROA 2ZCUA 1OLUB 1YB4A 3JQQA 3MLAA 4MJLA 4G0NA 3SIPA 4F3TA 1FPMA 1X1TA 1XVTA 3HY6A 1EP2B 2DE0X 2AQIA 4I4TB 3ZWMA 2KHZA 2D0DA 5LIRA 3FYUB 5A7FA 2NO9A 3IQFA 5ALMA 5KKNB 3PQ2A 3FPAA 2AFHA 3CPSA 4PWYA 3UC5A 2FFBA 2Q5LA 3E61A 4S24A 1KJ9A 1Z0AA 1WULS 1Z62A 5CLHA 3VSCA 2R7AA 1PFUA 3WRYC 4ZVRA 3EVTA 4LE1A 1K6JA 2JGDB 3EF0A 3VH2A 1EHYA 2PKQO 4Q9JA 2ZIFA 3RDPA 2V1UA 3ROKA 3U4IA 3SX4A 4C20A 2YW2A 4UCFA 3U5TA 3VU0A 4IJ6A 3DEJA 3QITA 2JA1A 3B1KA 4WUTA 621PA 4PO3X 3GDWA 4D4LA 2BI7A 1ZLYA 4BP1A 1MAVA 5KC9A 1VJRA 3MJDA 5BSHA 2ANCA 4P36A 1LC0A 3KYDA 2A86A 5CLIA 4Q7JB 1ZOIA 2Q4OA 3E0XA 1FCJA 4NJMA 1FIUA 2IPLA 1W0JA 1NN5A 5HUJA 3WBKA 4KXUA 1TYAE 1YVEI 5KAPA 1KMCA 3WOHA 4R41A 3USES 2B3TA 3RYFB 4WBSA 2QXYA 1V43A 4TL7A 1RMYA 1CF2O 5GY7A 3UK7A 3JSXA 4WXMA 3DHVA 5KJ6A 3D6AA 3R0ZA 1PGOA 1J90A 1Z18A 4YROA 2OHFA 3S1LA 2PTGA 2QTFA 3PIDA 1PR5A 4GUAA 4XCVA 5IDYA 3WLTA 4ZGGA 1GAXA 5FTJA 1N7GA 1RLTA 2N0SA 7YASA 2WABA 2IEZA 1EE2A 1BDHA 2ASVA 3LT0A 4LV5B 4AJEA 1KO8A 4LZLA 2VDWA 3TG2A 3G5LA 4XLZA 4X64B 1N0UA 5GIOE 1QF7A 4L4ZA 4DA0A 1B23P 1JVBA 1MQ8B 2FPIB 3SOPA 1H2BA 5JRZA 1N34B 1UJ6A 3D6HA 3U7JA 4PYRA 5KOHA 5BNFA 3GUYA 3M33A 3V1YA 2B7CA 1CDOA 3RVBA 4DS3A 4RKWA 3DFZA 4U4AA 1EGHA 1MAWA 2MOKA 2RAFA 1ULAA 2WIGA 2W4MA 4J1TA 4DADA 1O5OA 4TVBA 2UKDA 5BW8A 1UMCB 4W99A 1Z3CA 4KE8A 4ZRDA 1COWA 3TNJA 1XAIA 2YS7A 4RHXA 4RTQA 1X3SA 3ON5A 4J16A 1AE1A 1SCQA 4GVLA 1SD1A 2OOKA 5FTKA 2NXEA 1WDMA 3QHAA 5DK4A 5DK6A 2E5FA 1P19A 3WMFA 4I50A 4BFCA 3F73A 5GGXA 2CC2A 1VI2A 4Q1BA 1QLHA 5A9SA 2H00A 1ADBA 1IMJA 1IAVA 3I9FA 2HCFA 2GESA 3A05A 3LRPA 3C3XA 3RTAA 2EDCA 1NBHA 3ZE0B 3O3NB 2NT4A 3Q41A 2M6LA 3RUDA 1CRWG 5K51A 3AVPA 4K40A 3TPZA 5TS3A 4WOPA 4BFXA 5DI3B 3EOZA 1KKUA 1RKBA 1SVLA 1Z83A 2H7VA 2I4IA 3AEUB 4I9NA 1NQ5A 4G09A 4HAYA 4UZEA 5SZJA 3LUJA 3TZLA 1FYEA 1I2DA 1TO1E 4N12A 2QTRA 4NY1A 3O90A 1DOZA 1FTWA 1HE8B 3HDJA 3AX6A 2P69A 4DREA 1TXGA 3KETA 2R751 1UBHS 3BGDA 2I0FA 3PLAE 2UYCA 2VT7A 3G9QA 2C5GA 5CRIA 5DHUA 5B53A 3L84A 2IBTA 2CGEA 4DKXA 2YJGA 5KVCA 4MO9A 5HE9A 4AUKA 4I4TF 4AG6A 1L1QA 1M3SA 2I7CA 2P6MA 3P4YA 4BX8A 1O95D 2XAAA 3BG5A 3JYOA 4M21A 1CUSA 2PUWA 1O5TA 2X19A 1RLJA 3FJYA 4MGEA 1QYRA 2Q3HA 2R86A 3UA3A 1NQAO 5CUQA 1A50B 2VLBA 3H13A 4KK3A 4LDZA 4QJBA 4AMBA 1QXSA 3MGKA 3OF3A 2BTQA 4WA8A 3IP7A 2UU9B 1YE3A 3FNGA 1TTQB 1GPYA 3JZMA 3MWLA 3IT0A 4MR7A 3DMNA 5JSKA 4PYJA 3D7MA 2XWPA 3WHIA 1ZVQA 3LT4A 4NOKA 5IBPA 3KTAA 1KHHA 2NU8A 2IV7A 3UF0A 2P8JA 3A4YA 3WRXC 2VSNA 5DXJA 5H3LA 2ZTVA 2Y9PB 2ZM6B 1ZI6A 2JIMA 3LFUA 5IXYA 3AUSA 3ENZA 5T6BA 4K05A 3RREA 2QU8A 2CDRA 4OHYA 2F1KA 3GH3A 3MIIA 3OD1A 5EHQA 1DMRA 6LDHA 4RH3A 5M7EA 3KO8A 4B9AA 3O3CA 4EY4A 1OY1A 2AZ4A 4Z9XA 3FCOA 2K2WA 1QGUB 5T8KC 3IMFA 5LP6B 5F2EA 1A04A 3TB6A 3LX8A 5GZ1A 4QO8A 1JQBA 1H2RS 1N5JA 2IYYA 2OCBA 3AJAA 3O92A 4HQKA 3PDIB 4MCAA 2ZU0C 5LQKA 2ZIWB 1AS3A 1DE0A 1N6NA 3QWIA 4X71A 4CTMA 2X41A 1X7YA 2XTAA 3TG8A 4MCHA 1CDEA 5E8RA 3I3SR 3ZK9A 5EXEA 5JBQA 4E08A 3CZQA 4MRSA 1L3IA 1GG9A 2CVHA 4ER0A 1Q0QA 3E5RA 1HYEA 3PL1A 4Q0MA 3OZBA 4WZAE 1RYNA 5D84A 3C3BA 5HA5A 1DWQA 1Z5OA 5KNDH 3V8MA 2WWFA 4QGSA 1ZR4A 2GZMA 5IJAA 1I6KA 2XUPA 1EWKA 1VLZA 2CBXA 2QTMA 2MJLA 1DQYA 5BVHB 2JLUA 1MX5A 1U8EA 5AKZA 2P5TB 2ZIXB 5BW5A 5EHXA 2F43A 4J1SA 1DIRA 3LHIA 4HTFB 1K68A 1HMPA 2C8LA 3Q0IA 1S4MA 4LGCA 1QG0A 3R3SA 2CNBA 1H2EA 1N1GA 1N6LA 1JBKA 2J0UB 4L95C 3BD8A 4Y1FA 3VJRA 2XY4A 2VZ0A 4M2LA 5CYFA 5DTRA 1LF5A 1SD2A 1T3TA 1XVLA 3QKIA 1SIUA 3MFQA 1YQUA 3NBZC 3CUKA 1TYDE 4G1FA 4OB6A 3OWOA 5EPEA 3U56A 1G9TA 1H1LA 1SOMA 1BMFA 5C80A 3GGPA 1KERA 3GP8A 2J9RA 3HFSA 4KQ9A 2CDCA 5EL0A 4OI1A 2AG8A 1ABEA 1E58A 2P30A 2WSSA 2ZIVB 4FIZA 4F5EA 5KTOA 3S40A 1ZRNA 2PEYA 1GNVA 1OCEA 1OI3A 3UV7A 1NOJA 4QHSA 3ZWWA 4FKBA 1L7AA 5E2AA 1KYIA 3QLTA 3CLVA 3AFOA 4HVTA 3VPAA 4RVFA 5BOSB 1E6UA 5AK5A 5A03A 1W19A 3OCJA 4QXQA 2AMJA 5H4HA 4MDYA 3WL3A 3HZZA 3LX5A 4Q3NA 1DARA 2JAHA 3ME5A 4FHZA 3NVKI 3OF2A 1JL3A 3S2GA 1HORA 4FHFA 4CWAA 4LVUA 4YT5A 3A6JA 1FDSA 4WXRA 1ULTA 1Z0JA 2IXBA 3NNSA 4BJ1A 4N7RA 2P4EA 3GGCA 3GNSA 3UY4A 4LY3A 1FFEA 1IBKB 2POCA 1QKKA 1VL2A 2CD9A 3BN3A 1T4DA 1YULA 4A10A 3HL6A 2XQFA 5AI9A 4R6WA 4RTLA 2A1TR 3LYLA 3R7LA 4QSHA 2H9AA 3RBZA 2DKFA 4P35A 4PY2A 4YWHA 3UH1A 3VHLB 3WB0A 2P6PA 4ZYYA 4B3MB 3TQIA 5AW6A 5DB4A 4F1WA 1K6XA 1OH7A 1CVLA 1L5KA 4PFSA 5KAMA 1JQJC 1IJEA 5GOTA 2CL6X 2YHIA 3ZWYA 3C7TA 2ZG6A 2CLHB 3HCDA 4IIDA 3LQ1A 3L79A 4ND6A 2DP4E 5A3JA 1JYEA 1KP3A 1MCZA 2HAEA 3LA6A 4MW0A 1CS4C 1Z74A 2I66A 1L5ZA 1PW5A 2PXAA 1RWOA 4IV0A 2WU8A 1TKCA 1IEXA 4H31A 4QUKA 4TKUB 3ORQA 4TM7A 3UJ8A 5HOQA 1T8TA 1RJDA 3HKDB 2Z57A 4D3DA 5PGMA 1QS0B 4BASA 1A8SA 1M6EX 1YASA 2ZUBA 3DMTC 4CHTA 5JAIA 4H0NA 1IZ7A 1E1QA 2CWDA 2PWAA 1NVKA 2X7XA 5K9ZA 5CDTA 3UJHA 1UC8A 4MS1A 1AZTA 5D3ZA 3WV4A 5F1OA 2AG1A 3I92A 3VH3A 1JU4A 1EQ2A 2D1RA 3BFPA 2BLNA 3CCCA 2II6A 3K8QA 4HWGA 4LV8B 2D7JA 2JIZD 4PX9A 1J97A 1Q1EA 2NO4A 3Q0EA 1VPVA 1KXZA 1JE1A 1CZHA 4HH1A 4RA6B 1AUXA 4KQIA 4H60A 4I55B 4UUNA 2GHRA 4I0WB 1YTLA 2XNDA 2VYND 1HTTA 1M2OA 1XBTA 5L4NA 1IEQA 3RK1A 1R6XA 2BM9A 1RJ9A 1YCGA 1XQ1A 3A37A 4OL0A 1Q2UA 1E4VA 2BELA 2QGFA 1K9SA 3JWHA 1IY9A 2VRWA 3NBKA 4RKYA 5FUVA 3DBIA 3ZJ4A 4B33A 1X15A 1L4KA 3NFYA 1A8QA 2FCRA 5CAEB 2JCBA 5BNZA 3PGA1 3VR3A 3QPBA 1ZNYA 3QOFA 4UBMA 2BPOA 3T1YB 1HYBA 3KSRA 3I8SA 2WTMA 3DDCA 1DG1G 1VI6A 3WDSA 3IMKA 5DTJA 5EXXA 3VDMA 3WGIA 5CPFA 3BWDD 1O0SA 1GQRA 2DFVA 2VQDA 4Q4JA 4Y1GA 5F21A 3UH0A 4CEHB 1N3LA 1S5PA 3OIWA 5JTTA 2WVAA 1U8YA 1UJBA 2FE1A 3DE5X 1LDBA 2C9ZA 1UINA 3EA4A 1YUMA 4BWYA 3J81A 2E55A 1KFCB 3QLEA 2BZ1A 1DWUA 2I4NA 3R4CA 4X7RA 1N5IA 2AR9A 4JN6B 3MT0A 4RM2A 5FI3A 1FXSA 1Y7HA 2P9JA 4L51A 1KR2A 1TCVA 4WNAA 4DYDA 4UDOA 4ZU6X 2EGGA 3BMXA 2B7BA 1ZW1A 3LUGA 4F2DA 3KSAC 2BHLA 4RFSB 3H5WA 3REFA 3PX3A 1EVZA 4JZKA 3GCXA 3HKCB 3ZHUA 2WVHA 2PE5A 3OZRA 2JBAB 3EXAA 4RQTA 3TBFA 3FMFA 2AN3A 4OGLA 4YALA 2Z4RA 4O25A 2YIJA 1SKMA 2A6PA 1QHHA 2OLKA 3K0FA 5JDCA 4MUHA 2OBXA 4N5MA 2IUFA 3JVDA 2GXQA 3GZ4A 4G85A 4R1SA 5EJIA 4BWGA 3CB2A 3Q5GA 5LQCA 3IR7A 2LWIA 3I4FA 2ZXUA 2C59A 1EK2A 3PKIA 1JDBB 3HV0A 4F8EA 4Q03A 3HCEA 1CWUA 3HSYA 1CVIA 4BV2A 1YDHA 3DMGA 4BRWA 5CXQA 4OAQA 4CV0A 3HGQA 3T61A 5BVGB 4A2WA 4DWJA 3X1JA 3CRW1 3EIQA 5JASA 3HYNA 4GGOA 1O0BA 2A4KA 3QK7A 4HWTA 4LZJA 4TT8A 4F84A 2A5DA 4O4HF 3I6YA 1GPDG 4NPHA 2WE8A 1ZGZA 3I58A 1NAHA 1K7XB 1E3LA 2PJDA 3CVXA 1BN7A 5BR7A 4FDUA 2C7VA 5FBRB 1X74A 2FQWA 4LY0A 4FSDA 4DCSA 1Q0PA 3Q0TA 1G2OA 4LTNA 1QGDA 4QUAA 3EVEA 2C61A 3EQ9A 3UV6A 2I1LA 1EFVA 5EXDA 4XARA 4DPMA 1MXHA 2HJSA 4RKRA 1R50A 3AJ8A 2A9RA 4X3CA 3RAEC 5ER9A 2TS1A 1R6BX 4DG9A 8AT1A 1NWHA 4G5OA 2DFTA 1FMTA 1HGXA 5TE9A 3K4QA 4FONA 2WEKA 1XHFA 5CM2Z 4FMDF 4MIYA 2VDOB 1L4FA 3E18A 3JRWA 3D0RA 3KFLA 3PJDA 4XEUA 3TVTA 3UFBA 5JXIA 2H2WA 2O8EB 1FK8A 1QUEA 1TO2E 3C87A 4DNPA 1II9A 1XZIA 2FGKA 2GBGA 3PNBA 1YVPA 4YWJA 3CNEA 1PWHA 5HR5A 1XF1A 2P7HA 4OKSA 1FDVA 1VIMA 3G88A 4ALKA 3OJWA 4L9SA 2O8NA 3QQ5A 4YAFA 2AC7A 3MRXA 4C22A 5EJ7A 5EXSA 2F8TA 3M2PA 3RTCA 2QDKA 1PYOA 4DRZA 4JS0A 1N9GB 2LW7A 4CU2A 4HPJB 5LQAA 4ETMA 5BUZA 5IJ9B 1N1DA 5FL7A 3K5HA 3CEMA 4C7OB 3OE1A 2VWHA 3B38A 3BRWA 1GEEA 1UADA 2BMJA 2R2AA 5DN6D 3SK0A 2Z1DA 3NV7A 2RBKA 3EW9A 1FTYA 4YK7A 5CB0A 5BQ5A 2GM9A 4JODA 4MYCA 1D4OA 3TVDA 3EEOA 5L53A 1HL3A 3BKWA 1X7GA 3COVA 2MMGA 3SDBA 4BU1A 1N6PA 1SCUA 2KMLA 2FFAA 4MP6A 3SM9A 4E46A 4ZICA 4G0OA 1GA1A 1XRMA 3OJOA 3WP0A 1QH8B 2X8LA 2NO7A 1WDWB 4BGEA 5ALOA 2O0MA 4X6YA 1EFHA 5BN5B 1VPEA 2VT2A 1NUHA 2IOFK 5KZMB 5EPUA 3N74A 2A14A 1WUJS 3FUTA 4HB0A 2DHCA 5CB4A 3JD0A 1QM5A 4GM0A 4KN6A 2YHAA 3NT2A 3DAYA 1N1MA 3KV3O 2F3RA 3HXTA 3QGMA 4MIOA 4AYWA 2P68A 4BIMA 3CBGA 3QPCA 4B3HA 2Q6KA 2G3DA 2EJVA 4DA9A 4AICA 2OV2A 4H0CA 4JKOA 4U7WA 4UXHA 3IA7A 3AVOA 3VTAA 3EVGA 3UHPA 2WINI 5KSZA 2BAGA 3GJTA 5EIWA 3ZVNA 2NV0A 2WFLB 3U7QB 3DR5A 3BS4A 3F7NA 1KY4A 2ZTLA 3TLXA 2WG1A 1XCLA 5KREA 4TYNA 1S2LA 4X1OA 4CFYA 1IN7A 2BP7A 2C0CA 3IBFA 3C1OA 1SXJE 4KR6A 3HLYA 2JAQA 3A0RB 4MR9B 1X7ZA 1GUAA 2EV9A 2O8VA 4Q1EA 4QUIA 3WWYA 1KTIA 2WWTA 2NTJA 3HJFA 2HA3A 4LUCA 3DPUA 2D06A 5H81A 3SMVA 2Z8YA 3A3NA 1TMKA 1C8KA 2ZAYA 2XJ4A 3L77A 1A69A 1TJ3A 3KVRA 4AK9A 1YK0A 3G1TA 2B61A 3JAKA 3UQZA 4B80A 3VSAA 2IIPA 1V48A 3K0SA 4Q37A 2H18A 4PS0A 3AR3A 3FVQA 5F9FA 1IOVA 1RRGA 2CUKA 5ALRA 1IVYA 3L4KA 3L0BA 2Y1OA 2WIJA 3N59A 1ZMOA 3LHDA 4G23A 4MDFA 1C4XA 1YBMA 1J9ZA 1E2IA 2HYDA 4PR3A 3IEIA 4PPYA 5K4GA 5MN5A 3BILA 4B48A 2OO5C 3KQOA 3AO0B 4EG5A 3L4BC 2V0NA 3LQ2A 1GFZA 1N2EA 2DFPA 3VO1A 1R5BA 3WNBA 3VV2A 4Q7LA 3JQFA 4R4JA 4J2OA 3L0OA 3NC1C 2W6JA 2P2DA 3EGDB 3GX1A 4TL8A 4TTRA 3RSCA 5ICGA 4NCAA 1XD2B 2B5WA 2PSHA 1NULA 4TTPA 3E81A 1K8RA 3OX1A 1IY8A 2VEDA 4LXGA 1B14A 3GHHA 4PSUA 2ZIUB 4UBKA 5AVXA 3PDIA 1SKAA 1XHEA 2W9XA 3E0QA 2AFRA 2KPOA 1PG5A 3BMQB 3K0EA 2BKXA 5EIOA 4A15A 1HFWA 1T8RA 2AF4C 3GH1A 4DM4A 1U0NA 2BFFA 4L5BA 2OSBA 2GNOA 1JHUA 1ZN8A 3LTEA 3W2FA 4JLKA 2XRYA 5FWYB 3TZEA 1VG8A 3KPVA 4HV4A 2M2IA 1M33A 4A2QA 1F7VA 4AKSA 1KXJA 2OBBA 2DH6A 1QTIA 1P0IA 4N39A 7MDHA 4MHOA 1M75A 3TSAA 3LGSA 3UJBA 4C6RA 4KC0A 4WW0A 3BREA 3MQ4A 5LJLA 4CMEC 4C76A 1FBNA 1U1CA 1Z7WA 3QIVA 5K0ZA 5LA6B 3F46A 1Y5RA 3A6DA 1JDUA 1W6RA 3IC5A 2H4JA 5AW8A 1E89A 1FP4B 1V7CA 1XFAA 2R5NA 3CN7A 3LBYA 5H1YA 4AZVA 4OMDA 3E1GA 3L7YA 3NI2A 6REQB 1JBQA 2OECA 2A0WA 5AUNB 7AT1A 2PX4A 1KI1A 1IN1A 1Z22A 2GM4A 4B4VA 4KPGA 3LF2A 1RXCA 3DEKA 5L7YA 3LDHA 1WPRA 1KBOA 2O0JA 4YAEA 4XIJA 3TL3A 4B82A 2CJWB 1YKFA 4M1EA 1JDTA 1ZSVA 1U94A 5KX5B 3HWWA 4QRIA 3NOQA 4LSMA 2ZWOA 3HCCA 2NV6A 2X77A 3RABA 1A9PA 1MPXA 1US8B 2HD4A 5FQOA 2OXTA 2PUFA 1KFJB 1GILA 1A3CA 2ZTSA 1SRQA 2JVIA 3H3FA 4KNYA 1OD6A 2OAGA 3WYGA 4KYTA 3WGVA 2X0DA 5HG0A 4K8RB 4D0RA 2PUBA 4NK4A 1O9BA 3L1JA 5DHSA 1XPJA 2YWBA 1J0XO 4YCCA 4L1KA 1PJBA 4XWGA 3Q2IA 4YLEA 3ZHZA 3V4SA 2FK8A 2C84A 2GPJA 4IDGA 1FFXB 1W75A 1ZJWA 4YJ2B 2VP4A 5HNKA 1LRJA 4JFAA 1UKVY 2MCFA 1L7BA 1CIJA 4WQMA 2QL5A 1FFCA 1IPFA 5D3MA 4J2HA 2QTZA 1OWOA 3F47A 5EUCA 3NTVA 4KK4A 5ECGC 3OHPA 1BG6A 2WYWA 3EVCA 3NZEA 1BVYF 4RA9A 4DKJA 1DCTA 4BVAA 4GMDA 2JFOA 3AUUA 5TGZA 2AK2A 2NZVG 2L69A 2OUIA 3VR2A 4EB0A 2Y68A 1UCFA 4P2BA 5F98A 1YRHA 1XPUA 1D2HA 2IKSA 2HREA 4GR5A 4W1SA 3A1SA 3JQEA 2D1FA 3LBNA 3NIWA 1ST2A 4JEIA 4K86A 4M4SA 2DECA 3U4GA 2RI1A 3ZQ4A 4KREA 1JTVA 4TVOA 5KVSA 2B20A 2E4YA 3KAJA 4UCXA 2BCGY 5CYPA 5I5GA 3WIOA 2OZEA 4PLGA 3BGOS 4CM8B 3L7OA 3FJ1A 3MJSA 3QLUC 5DYNA 3EDCA 3ZJVA 3L3BA 4L3WA 4FTWA 1YZUA 3N0VA 4I55A 4RYDA 3EEYA 4DMMA 1M2GA 1M8KA 3W8NA 5G0SA 1W93A 4TYQA 3W8EA 3AR4A 1DBPA 5IFKA 4QGHA 2EX0A 1YCFA 3A0UA 4NBRA 5JS1A 1M0WA 4H1VA 4JVNA 4C3UA 1NA5A 1DC5A 5E9AA 3TIIA 2NYRA 2DR2A 1JLLA 2R6JA 4EAQA 2E2WA 5CXXA 4LC1A 1V71A 1MX3A 3EVDA 4GPZA 2BMDA 3CV3A 1WX1A 3EYWA 1KI4A 5JSYA 2NTVA 3G0IA 2IPMA 3AF0A 3J81k 5JJIA 3KHSA 4MICA 1W4AA 3V7NA 1W94A 4DR3B 2G16A 4IGKA 4BVJA 3FUWA 1TK9A 2ZRNA 4HRXA 5C5EA 1ZH2A 3TJRA 5CJJA 3PXUA 4V0NA 4DSAA 3MTGA 2C3UA 1U2PA 5CVVA 2XSZA 1E5DA 4C4RA 4ND7A 3G2KA 3BX1A 5HQTA 2FUKA 2JIBA 3EWIA 2QYOA 3NONA 2FWRA 1HDZA 5K2MA 4YI3A 3TZBA 2ATXA 2OWDA 1DAMA 2FWIA 1NLZA 3SAJA 3KU4A 1OAKA 3A04A 2HK7A 3FRIA 3OFND 3INTA 4LRYA 5CTAA 3PGKA 1H2WA 1E4EA 3FAKA 5F52A 1YZGA 3AGPA 3GQVA 3HR7A 3PK0A 1NBMD 1XDUA 2JCVA 2X9GA 3GMDA 4G0PA 1MH1A 3T1VA 1R1DA 1H65A 2I3DA 3UGQA 4BNDB 4QM6A 5H3CA 3FBGA 4F6RB 3DMYA 3KWJA 1CB0A 2I6FA 2R1TA 4WLUA 5TEVA 5TQ0A 3VZRA 3LW7A 1KDPA 2JLRA 3HACA 4FS8A 3QJGA 4HAZA 5I4CA 1I3NA 2J67A 4TWAA 1RPTA 2ZBDA 3FUCA 5G0WA 2I8CA 2ID4A 1PF7E 1IOWA 3I9V6 2XTNA 3UW1A 2VJNA 3H1FA 4X63A 4YJHB 3V4VB 5KHOC 1J25A 1EEXB 1HDCA 2X14A 2XDQB 5ES4B 5KTTA 2FFRA 4IEIA 1P2GA 1TK2A 1PGQA 2ZJ2A 3GLHA 5TQ2B 3M9LA 3D6UA 3E5HA 4JV5B 4II7A 2Q5JA 3D54D 1DKNA 1NRJB 3MLEA 4JUCA 4XYEA 3SP1A 4AS1A 2Q5CA 1AG9A 3W6PA 4P9NA 3RSHA 2F3TA 3JW8A 3DE4X 3A2KA 4MVJE 1KBQA 2XBUA 1CUZA 4P82A 1NXSA 3CNLA 3RC7A 5KYTA 2D00A 1GU1A 1XE3A 5C81A 5C1DA 1E2NA 2QL6A 3B36A 5FPTA 2IQIA 4D98A 1VPWA 4EABA 5AI4A 4INPA 1JVSA 2PA0A 2HU7A 1RDFA 3GPBA 1IFXA 1A7JA 2UZ1A 3DL4A 4MP3A 4PW0A 4GDMA 2Y77A 1CNMA 4JJGA 1WUIS 3I1FA 4M9UA 3RKUA 2O2CA 2R68A 1OFUA 2JGRA 2EG9A 2VRBA 3WHPA 2F17A 2W2LA 5L3RA 2G4VA 3RIMA 4FCWA 1MA0A 1HM5A 2VCHA 4G1CA 4UPVA 2QRVB 5THXA 1UXIA 2QQ0A 3D3KA 4B81A 3OTHA 2H52A 4C78A 1Y98A 2EFGA 2VHQA 2W93A 1KFBB 3BAZA 4ITRC 4YCAA 5TVGA 2D0IA 1JAIA 4J94A 3TINA 2I33A 3PPVA 2IH5A 5GV8A 1C0PA 3ICWA 5CPBA 2I4LA 3GDOA 5JDIC 1DIBA 4EY7A 1UOPA 2Q3DA 2ZJ0A 3A27A 4PYMA 1NW7A 4UEWA 1BGWA 1ESEA 3W06A 4IG4A 3LHKA 2XLCA 4JLMA 1OXUA 4I1UA 1VHJA 3D1JA 3EPRA 4ZPJA 2FXVA 1REQA 1AK9A 2CLLB 3Q85A 3LY5A 1KJ8A 3FDZA 5JEEA 1N92A 2P3SA 4E2FA 1ZGGA 1Y34E 3BFVA 5LP1A 2X7HA 2QPAA 2GAFA 3HN2A 3IR5A 2E87A 3L43A 4DSOA 3CUSA 3GJXC 4JQSA 4PGMA 2IHJA 4YPFA 4DQ0A 5IJWA 1BWQA 3FHOA 4M3NA 2H48A 1ZIDA 4MKIA 1LQ2A 3QBVA 4AZ3B 1KY3A 3OEHD 1D6JA 4DIDA 2QM7A 3G2IA 3CI0I 1VRCA 1N6KA 3B52X 4XDHA 1B0PA 5FNZA 4ZI2A 5JDIA 2EIXA 3IIEA 3IXQA 3PD1A 4YJ2F 1RXSA 2V5VA 2ZXFA 2SECE 3BWXA 3LT5A 2YFYA 1W4BA 3HI6A 3QEJA 4Q34A 2R4UA 1A7KA 1Y8RA 1CTQA 4MMYB 2QT0A 5IJ0A 2EYQA 1V3QE 3T7TA 5T57A 1HL7A 1D9XA 1JYSA 3O3MB 4EA8A 1XCMA 3PTAA 1YL5A 3OFKA 3ZXXA 5JMWA 5ABPA 1PS9A 3L93A 1FFYA 4JXKA 5JD3A 4XOUA 5DW0A 4YMIA 5FEUA 5EP1A 4IHJF 5JH7F 2PZGA 3JARA 1HQCA 2AOXA