3COVA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.5 ang resolution- apo form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
molecule keywords Pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
total genus 95
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3covA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3covA01
1K97A 1IRXA 1MC1A 1OWPA 2JA2A 3VGJA 4A91A 4CDMA 1O97C 3C8ZA 3GLVA 3KT6A 4JXXA 1GTRA 3FIUA 1O6BA 3P0JA 3QE4A 3ND6A 3CLSD 4RUKA 2VXOA 2E21A 1QRSA 1BS2A 1TYAE 1U3DA 2YWBA 4PY2A 5TEVA 3MXTA 3MLAA 3UOWA 2IJGX 4Q16A 2J07A 3DV2A 3FHJA 2A1TR 4PBSA 1DNPA 1WKBA 3I05A 1I6MA 4QRDA 1QNFA 1KAQA 3SDBA 3SYTA 4KPUB 1ULHA 2X1LA 3HGMA 4JYZA 3CR8A 1F7UA 3HFJA 3PNVA 5KHAA 3BL5A 1QRTA 1Y42X 4YP7A 3P52A 1J21A 1M8PA 2NSYA 1ZH0A 2PFSA 4HJRA 1IVSA 3AKZA 1EFPA 3H97A 1N3LA 1MBZA 1N1DA 1KQNA 3G5AA 3SEZA 1I2DA 3SZGA 4EF6A 3G6KA 2DPLA 3FOCA 4HJXA 3NBAA 2D13A 4NX2A 4OJMX 4XSVA 3ZXSA 1V8FA 1EFVB 2VTBA 4DDHA 3GMIA 1NUUA 1XJQA 2AKEA 1JECA 2BTEA 3A2KA 4CT0A 3HL4A 3KFLA 5EKDA 1COZA 3DPIA 5LLTA 3IVCA 1I6LA 4NZPA 3MUEA 4F4HA 3ELBA 2CYCA 1TEZA 2QUHA 2G36A 5F23A 4ND6A 3QTBA 3H99A 3CLUD 3CLRD 2HGZA 3HV0A 1EE1A 4G5YA 3IOCA 1OBHA 2A1UB 2CYBA 3OTWA 2V0CA 4ZT3A 4KR7A 3FI0A 2NZ2A 3UC5A 4ZCPA 1M1ZA 1NI5A 4MQ6A 4G5FA 4HK4A 1MB2A 2CUZA 4UZFA 2D5BA 2QUIA 1N78A 4OUDB 4U63A 1XNJA 3RK0A 3ISJA 2X0KA 1NSYA 1O95D 4U8HA 1N2OA 1VBNA 4ARIA 1T6ZA 4WNYA 2XRZA 3DLAA 1NZJA 3E27A 2QJFA 1R6TA 5H16A 2DERA 1V47A 3VU8A 5JBNA 1YULA 5K0TA 4MW2A 4HPWA 1GZUA 1YUNA 1O5TA 3ND5A 4ZT5A 1VLHA 1Q15A 1KQOA 3COYA 1T9GR 4MW0A 1WQ4A 3D6VA 3KT0A 1S4MA 1U3CA 1ZUNA 1ZJWA 1JEEA 2DETA 3AFHA 1R6XA 4MUKA 3ZXIA 3INNA 1IFXA 3K9WA 5DEOA 2WB2A 1PFWA 4DLPA 1M8KA 3MLBA 2O8VA 2BYTA 2V0GA 1Q77A 3X1MA 4NATA 4PBTA 1KH3A 3KT8A 3ZJVA 3ZJUA 3ZGZA 1G8FA 2A84A 3CA8A 2AG6A 3X1KA 1H3EA 4MWDA 4NAHA 2Z08A 1OBCA 1P7PA 3CLRC 3SP1A 2A88A 3Q4GA 3H05A 4L2IA 4MVXA 3S3TA 1NUSA 4NDAA 1N2EA 3FETA 1K4KA 1LI7A 3M5WA 3IOBA 2X1MA 1WXGA 3CLTD 5DASA 4J76A 1QRUA 1PG2A 1IQUA 4CQNA 1T6XA 3Q12A 3FH0A 1MAUA 4EG4A 1WXFA 2EJCA 4MUHA 4MW6A 3COVA 2JANA 4MWEA 4JFAA 4KR9A 1O94D 3FNRA 3KT3A 4ZT6A 4DJAA 3IUBA 4MWCA 2YXNA 2J4DA 3QTTA 1YUMA 3TNJA 1H3FA 1N2GA 2PZAA 2R5WA 4AQ7A 2X3FA 2CFOA 1KAMA 1GPMA 5KCMA 4EG5A 4MAFA 5HUHA 1NYLA 5FO1A 1NURA 1M8FA 1WY5A 1EFPB 3RJZA 3PXUA 3GUZA 3OP1A 4EG6A 3H9BA 1PG0A 5HG0A 1PFUA 3ILVA 1O0BA 1A8HA 1JILA 1U7DA 2HMAA 2QUKA 5AHWA 1ILEA 4DDMA 1GTSA 3P0IA 2PG3A 2A4MA 3U1VA 3CLSC 1WXIA 1D2RA 3VRHA 5IHXA 4QREA 1JZSA 2J5BA 4PBRA 3CLTC 2QTRA 1WXHA 3TQIA 1KORA 1JEDA 3IMEA 2QJTA 3X1JA 3F3MA 3IODA 1F4LA 1MAWA 1Q11A 3SZ3A 3NBKA 5FO0A 1YIDA 1N75A 2YY5A 3NV7A 1G59A 1TQ8A 2XRYA 1U7XA 4F3RA 4JZYA 1J09A 3CVWA 2A86A 2CV1A 1O94C 3H9CA 1N2JA 2PZ8A 4EG7A 1JIKA 1RQGA 3G59A 1NP7A 1J20A 1M83A 4E1AA 1G8GA 4RPIA 2WQ7A 3CVUA 3P0HA 3RK1A 1NUQA 4YP6A 2GM3A 5J58A 2DUMA 3TZLA 3IVXA 1WOYA 1KR2A 4YP5A 2HZ7A 1QU3A 3CVYA 4OUDA 2AZXA 4KR6A 4I6EA 2E18A 2ZP1A 4MW4A 2E89A 2CV2A 4BWVA 4EG1A 4YMIA 1LI5A 4ZT4A 4MW7A 4YBRA 3RFFA 3A04A 3IUEA 2OQ2A 4R2MA 4J75A 1SURA 5BNZA 3HZRA 2A1TS 4R2LA 1WXEA 3TQOA 1IQRA 3ZJTA 2Z3VA 3CVVA 3LCJA 1IQ0A 5HUJA 3K32A 5FNZA 2PZBA 3CVXA 4MWBA 4Q93A 1N2BA 5TS2A 1KKUA 1GAXA 4DE5A 1EUQA 3CLUC 2DXIA 1XNHA 1KP3A 3PRHA 3COWA 3AL0C 4GRIA 4I6JA 1B6TA 3AG6A 1K4MA 3N8HA 4L2IB 1R6UA 4ZCRA 1EUYA 2QTMA 3N9IA 1MJHA 3DO8A 1O95C 1I6KA 1O96A 1WJGA 4MVCA 3LE8A 1XNGA 4FZJA 1H3NA 2OV4A 3IOEA 4P2BA 1TYBE 4MUGA 4MULA 4G6ZA 3AIIA 4MLPA 4DDKA 5DK4A 3RBAA 1N77A 1TYDE 1PFYA 2CSXA 2WSIA 1N2HA 1EJ2A 1QTQA 1X8XA 2PIDA 1N2IA 1TYCA 4EGAA 2E0IA 4K0RA 4EG8A 1H1TA 4R0NA 3IMCA 1OWLA 3SEQA 1QJCA 3UK2A 1IH8A 2H29A 2EL7A 3TZEA 1GN8A 1HYBA 2I1LA 4XFDA 2A7XA 1JGTA 1JIIA 1UFVA 5K0SA 2TS1A 4ZCTA 4KPUA 4ZT7A 1OWNA 1O0CA 4JXZA 2O5RA 5DB4A 2WQ6A 1MRZA 3IH5A 2H2AA 1JHDA 1F9AA 2C5SA 2ZUEA 2QUJA 4MUFA 3ZUGA 1KQPA 1T6YA 1JZQA 1T9GS 1ZH6A 2VTBB 2CYAA 2J08A 5J59A 3D6UA 4MVYA 4MVWA 3L93A 1U0BB 3IMGA 3PNBA 4AS1A 1VL2A 4ZCSA 4S1OA 4MW1A 1EFVA 2J09A 4MUJA 3N2YA 1CT9A 1GLNA 2QJOA 1OWMA 3FG9A 2CV0A 3N05A 4ARCA 1MOPA 1YIAA 1YI8A 1IHOA 3A05A 4WSOA 2PXHA 1J1ZA 3PNYA 1NUTA 1M8GA 3ZIUA 4UZEA 3IVGA 4MUNA 2IP1A 1QQTA 3MMXA 4U7JA 4MUEA 1OWOA 3LOQA 4EFKA 1Q19A 3FWKA 1MB9A 2A1UA 2D54A 4MUIA 3UY4A 1OD6A 5H7XA 4DNXA 1LW7A 2RE8A 1JIJA 1VBMA 1O97D 3UMVA 2B7LA 1TFUA 1KP2A 3TS1A 5KWVA 4GU5A 1J1UA 2IELA 4KKVA 2ZUFA 2RD2A 4K03A 5IJXA 5LFAA 1VBKA 3AG5A 3RHSA 2DLCX 4CDNA 2QTNA 5TGTA 1K92A 5J5AA 4XFJA 1F7VA 1KH1A 2DEUA 1G8HA 4TS1A 3HMQA 3IDFA 2GOYA 1M8JA 3FY4A 3JXEA 1QU2A 5TEWA 5LM3A 2Z09A 4MW9A 1FYDA 1EXDA 4I6GA 4ND7A 3A4IA 1FFYA 3ND7A 2JAXA 1NUPA 4X0EA 1WQ3A 1X6VA 1PFVA 3L92A 2YWCA 4MW5A 2DR2A 4QBTA 3COZA 2CT8A 3FDXA 3Q10A 4ZCQA 4EG3A 1WZ2A 2GKSA 1JMVA 4ZT2A 4NAUA 4H3SA 1KH2A 1O96B 1J70A
chains in the Genus database with same CATH superfamily
2VPXA 1O87A 5T6BA 3WE7A 4JLNA 4JZKA 1OWPA 4AIIA 7ADHA 3KLNA 5IDXA 1XJCA 2ERXA 4H59A 4JB0A 3NHRA 3TZQA 3RFCA 3FPAA 2BTOA 4MVJG 4V1CA 4UE2A 4H3HB 1YO6A 3NXKA 2AMJA 3PSAA 4GKAA 1UK8A 4OK6A 4WXYB 4UFOA 3GGPA 3NUZA 2A50A 8LDHA 2GPTA 3OZGA 4TYYA 3P9ZA 1JMKC 3O8QA 1R10A 3LH5A 2ZJOA 1DKPA 3BL8A 4V0RA 1ZKDA 4XUCA 4AROA 3VTZA 2DOKA 3B7WA 4JC4A 1D7AA 5FOTA 2V5AA 2XITA 1C7ZA 3B82A 2CNLA 3SQLA 4K9DA 1W9HA 3O8OA 2GO1A 5HZMA 3HXOA 4B8YA 2AEJA 1NP3A 2HCBA 3P2EA 4LXQA 5EWJB 4OEHA 5ER9A 3N2IA 4KN6A 5EJGA 4OKSA 4ETWA 1XMPA 3LQQA 4KXVA 1Z47A 5A2GA 2DKOA 5ICGA 5LP6A 3L79A 1NY5A 1CW2B 1U0HC 3L7NA 4HF7A 3ZCSA 4TVSA 2IYNA 3Q2KA 1ZW1A 2F17A 1QNFA 1E94E 2ZBVA 4R1TA 1TCCA 2JK1A 1EG7A 4Y9UA 4DPLA 5LYJF 4ZVOA 5JXIA 1JAXA 1L5FA 2Z1MA 2ZTMA 3KAJA 3CR8A 1NW6A 2JZCA 4ND3A 3T5TA 1FX0B 4BGVA 4PVDA 5CDTA 1GPNA 3RSQA 2AOXA 1EUCA 1PGNA 3HU3A 1S3GA 521PA 1X87A 2FSUA 4UPDA 4ARAA 2UUAB 2KSQA 2OGWA 3T61A 3KD3A 4P9NA 4C4SA 1OI4A 2QRHA 4FNGA 1CZOA 5DWVA 1KEVA 2VT6A 4P3XA 4BJ1A 3KPYA 2QQ5A 2O06A 3N58A 4L7VA 5HM8A 2FSHA 2XOEA 4QUAA 3KJIA 3D3KA 1ZMBA 2D13A 3KDAA 2WICA 3L8MA 3PFKA 1ZQ1A 2R62A 2YBEA 5EWLA 3ZXSA 1E1CA 3HGQA 1S0UA 3BMCB 3BWBA 4C5AA 2IDMA 4RCZA 1XJQA 3K8OE 1QK4A 1C9YA 3LF1A 4K9RA 5LA6A 5ICEA 1COZA 1IXZA 1SJ9A 5AUQA 1KEKA 2WPNA 3QZUA 1U7TA 5KAPA 2PJUA 5JALA 2PMCA 2NPIA 4FFRA 5CCDA 4A0HA 2OQRA 3ZEIA 4KIWA 3C4JA 4H1WA 5IJ9A 3UW1A 1RLJA 4R1SA 4K3VA 5A02A 5F2EA 2HGZA 1Y4SA 2C8VA 5TNXA 2IXEA 2L0XA 1QHHB 2FXVA 1CUZA 2H1IA 4REMA 5AHOA 4NEGA 2HIGA 1Q0UA 5HTOA 4MYUA 2F9LA 3OM9A 1LQ2A 4DCSA 3QXHA 2F3SA 2H00A 3GEMA 3OWHA 4OHBA 1V3QE 2FN8A 2W2NA 4P34A 4XDHA 2AZMA 2PKWA 3AR4A 2QN7A 1D9ZA 4H4DA 1AS0A 5AVWA 3ZDXB 5C9ZA 5GJVC 4PHGA 1MFZA 2I5PO 2W0MA 3B9QA 1JDSA 2OGTA 2YFYA 3GBVA 3R5SA 4LXXA 1L7NA 4J3NA 4AZ0A 3AB8A 3H8WA 3OE7D 3VO8A 3DLAA 4I3FA 3RCBA 1J99A 3ZWWA 4YDQA 2VL7A 4NHOA 3GJ4A 2PV7A 4E5PA 2H7YA 5A3QA 1YQQA 1HNWB 2BHNA 3HVKA 3UICA 2BBSA 3A6PC 1WNTA 3V8PA 4FLEA 3BSFA 1XCGB 4KQ9A 2PMEA 4M99A 2PUFA 2CXPA 2ID4A 3KB1A 4HPWA 1AK2A 4BGEA 2VHVA 4FT2A 4LF5B 1I5EA 2J0UB 5DJ5A 2BHTA 2I8LA 3N2ZB 5TX7A 1I1NA 2OOSA 4PRZA 1XK7A 3DT6A 1M34B 3GLHE 2B0CA 2XD9A 4O4HB 1RPAA 3NIDB 4LPKA 4BWFB 4B44A 1TYEB 2KBFA 3ZHRA 4LV5B 4EUHA 3JZDA 1T8PA 4OFBA 2C4TA 1UM8A 1YDFA 3BJEA 4RGBA 2V5UA 2XGOA 4QU0A 4IRMA 2XVYA 2IOFK 2DAPA 2BSXA 1QE5A 5JHHB 2C2HA 1B43A 4KPFC 3X1KA 2ZU0C 4MWDA 3C41J 2P3QA 1ZN8A 2JVKA 1ECBA 2PLRA 3BZBA 4IHKA 1K8YB 3A1NA 1VPEA 4GPD1 1A71A 2BFWA 1DI0A 3BAFA 4O1MA 4RJLA 1BA2A 2G76A 1QK5A 4HQOA 4D25A 1TQ4A 4CKYA 3E9RA 3F6SA 2PT6A 2JJ1D 2PGOA 4CFZA 4TUYB 3MWDA 1YMUA 1UKBA 1SCKA 2C07A 1MC8A 1RTTA 1ZOIA 3UBTA 3UHJA 3W6NA 1U8XX 3DE4X 2VJBA 3GLGB 1E32A 2BCEA 5ED0A 4BNGA 5JIBA 3C24A 1BFUA 1FOEB 1ORRA 2XVMA 2I22A 1QIKA 4D8XA 4BEBA 2WWYA 5IT9A 2NSHA 2EC5A 1ADGA 3IHKA 1AHHA 2O2XA 4Y1EA 3EGIA 4TRRA 3DYIA 3PC6A 5FADA 4D3FA 3GLHA 2PANA 5GTDA 4Z86A 3QXJA 3COVA 4I4TF 1AN9A 2JANA 2O8EB 1NRIA 4JFAA 4OKIA 5KNDH 2WEKA 2Y1FA 4N5IX 1MV5A 2ZVJA 1A82A 1A9SA 1RYMA 3NWBA 1VKNA 4EZEA 1M7HA 4FFSA 2P2SA 3G2OA 3BREA 3KKMA 1H3FA 1N2XA 3KJFA 1YB6A 5EKTA 3L1HA 1O77A 3C14C 1A5BB 4PG4A 2IXFA 1OXSC 4OCZA 1QWOA 1R1DA 2J7PA 4RPCA 4P6VF 1GY8A 4GUDA 1Z3CA 2B7CA 4D4HA 3AP3A 3OA0A 2Y1EA 1UODA 3KLMX 1PZHA 2QQGA 3GLRA 4DM4A 2PUBA 2GEJA 3RJZA 1IBSA 4AJJA 4EG6A 1V11A 1Y6QA 2ETXA 4PTYA 5A9SA 2PUCA 1NC1A 2V6FA 4ME6A 2QX8A 3N8DA 4J2HA 2G9NA 5AHWA 4G85A 5CB0A 2WSSD 2P9GA 3NWJA 2QSJA 4NVRA 3CLSC 3AGQA 1BH6A 4GKBA 2M6KA 4NZZA 3RK4A 3SJCA 4EQZA 5IK2D 2FQXA 3FTEA 2NYUA 3ETJA 4Q7QA 1FTWA 3ELUA 3SVTA 2CBXA 3CLTC 5H8WA 1S7GA 5I4CA 1QORA 3JZFA 4P93A 3UH0A 3IP3A 2F7SA 3NC0C 4YFVA 2NO4A 1VMKA 1EVYA 2QMOA 1IMJA 2Y0DA 3A36A 3MPOA 1DAMA 3HBLA 2X7JA 4HTAA 4AJEA 2Q4TA 2HEIA 3JQ6A 3IAHA 1VP3A 1L5GB 4CV3A 4YMHA 4Q5IA 1PVDA 2QVGA 4HBGA 1X1RA 3RF7A 4YQEA 5AW6A 1AN0A 3BGIA 1W36B 3EUWA 4HFJA 3RIGA 5EZYF 3DT9A 2VP5A 2EWVA 3AFOA 2WE8A 2XUPA 3P0FA 4EG7A 3RYFA 4Q4AB 2YN0A 3BHMA 1ZD4A 3B1VA 5DHAA 1YVEI 3KSDO 5CIYA 3RSOA 2I2FA 1MGOA 2WTXA 1B73A 1XV5A 4RPIA 2XUIA 3THYB 1JDNA 1J9GA 1TMOA 3ZZTA 1M2VB 2OLKA 1CQJB 3CNHA 4V0QA 2AG5A 2IE0A 2Z95A 3N2EA 2DUMA 4IOKA 1VPDA 2E4WA 3GG9A 1DE0A 1V45E 3BBPA 2A1IA 5KHOC 5LB2A 2ZZMA 4MPDA 3WK5A 1RVV1 5BQPA 1FYVA 2RHGB 3ISVA 1NNI1 2GBGA 4MRMB 2I65A 1BG6A 3QKRB 4EJ6A 3GGCA 3PP8A 1L8OA 1VJ1A 1FS4A 3B3FA 4YMIA 4KUEA 1CERA 4PGMA 3N2NA 3EVDA 4GEKA 3TW4A 4W4TA 4W1PA 4XWKA 4CEJB 3A3KA 2REBA 5JAOA 2XUJA 1Q0RA 1Q7TA 5BNZA 4CEIB 3UANA 3DE0X 1HTBA 5D3ZA 3U9TA 1IQRA 3ZJTA 3BRWA 2PJZA 2ALJA 3QEMA 4KJXA 1TNDA 4OMUA 4GL4A 5H81A 3WXMA 3OQMA 3I76A 3OIYA 4ZPJA 4ARZA 1IJFA 1GQSA 3W5HA 1IIBA 4HFRA 1EB8A 3O90A 5AHKA 1VA4A 1RXEA 2DMRA 4CT4B 1MABB 3H9QA 3P9RA 4C14A 4JSYA 2DXIA 3RJMA 5CX1B 3KQLA 3G7SA 3MWEB 4LVOA 1OIWA 4E30A 1QYCA 3P9YA 4NCAA 5JXGA 2ACVA 1P5RA 1E2GA 3AU8A 5T57A 3K6SB 2NUTA 1FUKA 3RRFA 3ZY4A 3EQZA 2QY6A 3T0IA 1PBNA 4DVJA 1ND6A 1LLCA 2HMUA 4O3MA 2A8YA 4U0JA 2YHAA 2JCXA 2EZUA 1NXXA 3BFXA 3VVCA 3L8FA 1JJIA 2ATIA 4L8VA 4JI2B 2QLTA 2VP0A 2G04A 4YCJA 3EASA 1ZVMA 4MQFB 3SXUA 5FR2A 3I8XA 3NHJA 1SXJB 3RAJA 4I4NA 3RHZA 3I2HA 1SBQA 1OTHA 5ECWA 4POAA 5ERYA 5UKDA 1DWUA 1GQFA 2FX5A 3BERA 1X8XA 2PIDA 4MB2A 3UTDA 2YZKA 4G4JA 1EWVA 3WL5A 4AMUA 3EBOA 2CVZA 2NUAB 3T7RA 3ETCA 4K0RA 4BQPA 1QGYA 2KYRA 4KBYA 4ZMSA 1OWLA 4NDNE 2VWGA 3SSMA 4FGZA 3T7CA 1Z6QA 4OX9Y 1I3LA 1ISRA 2BFPA 2Q8QA 5FL7A 2R68A 2PWBA 1QAMA 4XFDA 4EPRA 2Q5JA 3LO5A 4LA4A 5KYYA 3KQNA 1UFVA 3L0BA 4HAXA 1SC4A 3X1XA 4DEYA 5ES4B 1IZ8A 1WO8A 4O2LA 3VKGA 1TKBA 5JD6A 4KAJA 4RY2A 1DJPA 2XUZA 5EIHA 3A9WA 4MVJD 2V7XA 3H2KA 1EBBA 1DWOA 3IP9A 4MCJA 3H0CA 4OHOA 4AX4A 1BE8A 3EG9B 1XO1A 2DWPA 4AKIA 3CO5A 3IL2A 2FW9A 1ATZA 1W49A 3LK6A 1MMFB 4NFSA 2BGLA 1LW6E 1CJKC 4RAOA 2A5GA 4Y2RA 1BGVA 5BR7A 5KDOA 3QUQA 4KK4A 4RJKA 3EF3A 3QXSA 5FD8A 3STTA 3B3JA 2BFFB 2VTBB 1WRBA 1SBYA 3K16A 1E20A 4G37A 5ALGA 5IXYA 5AUPB 3U13A 3TLGA 4KFRA 4CGZA 3W77A 1UBLS 4Z7NB 1D5CA 2A5DA 4AWXA 3JATA 4MW1A 1P0CA 4G4GA 5CH5A 2E1RA 2VDUE 3KHUA 3OIFA 3K0CA 4Z4EA 1FYXA 1VXRA 4FZ3A 4E4TA 1MOQA 5C7LO 3DDNA 1LSJA 1JJBA 3ZWPA 1C1XB 1PW7A 1U6KA 3A05A 3VFDA 3JQCA 3JTMA 3DNMA 1VTKA 2IP1A 1JLLB 1IEWA 2ODEA 3NTXA 4AJIA 2W6OA 4NYIQ 5H59A 3T15A 3MMXA 3TLKA 4F06A 3M6AA 1PK9A 1JU9A 1WMDA 3G9XA 3SGLA 2D54A 1FBTA 2FPSA 2F3RA 2P9FA 3UCFA 1F51E 1M7BA 1PX0A 5G3YA 4KMMA 4Y1GA 4FNMA 1KI4A 1LW7A 1XKQA 2C9MA 2K7ZA 4U2EA 5CNMA 5BNWA 4QARA 3GDHA 5K0CA 1EP2B 3TEMA 3ZVNA 2C2YA 1JLSA 4II7A 4RSMA 3CRRA 4UREA 3PQ6A 4HDNB 2IZ1A 1OH7A 3DOCA 4JX9A 3ST7A 2YWEA 1EK5A 1GPAA 3IOMA 3N2KB 3NKLA 5C1IA 1UP4A 3E82A 3ADCA 4HDOB 1JEYA 2GPWA 3K70B 9GPBA 1LDBA 4XVQA 1NHGA 1TW3A 4K03A 4NFHA 3TTWA 1YR8A 1DZ3A 3L05A 1XYVA 3W6OA 3W6UA 5IG2A 4WLNA 2WZBA 4G4SO 5LU9A 1K92A 1L5OA 3GDGA 4H1VA 4XFJA 3R9IA 2QL5A 3PEEA 3WLEA 5B3KA 1GJRA 5IZ4A 3GLFB 4PVCA 2W4MA 2E49A 4C0XA 4RABA 1Y6GA 3E7WA 3FY4A 3S1AB 2IHUA 1IPHA 2OCKA 3HC7A 3ICOA 3LFUA 3MTEA 4XGIA 3V9AA 3WJ7A 3DLTA 2BSQA 1T3TA 3EVZA 4DLTA 1HNNA 3AHJA 1HT0A 3AKCA 3EN0A 4J0DA 4N48A 3U4AA 3I3SR 1GP2A 2JAXA 2G9ZA 2DFTA 4LG1A 1NQUA 3PR2B 4I3GA 1EAYA 4MV0A 2VDNB 1Y33E 2JIOA 3E1GA 1UUFA 2JZOA 4QDKA 4IXJA 2HDNB 1EFKA 3NTVA 4LQDA 3KOUA 3QU4A 5IBRA 3D5EA 2XNDD 4Z3OA 3EQ8A 1EFDN 5HK8A 2RJNA 1JB1A 4GPAA 1U5BB 3TRKA 3PR1A 4BKRA 2CB9A 1K97A 1P8AA 2HXYA 5THKA 4B6SA 1TZBA 5GPBA 1W5SA 4A91A 4Z1MA 3L7KA 4BX9A 4DJJA 3ETLA 4ESEA 5A04A 1ML4A 4TTJA 4ZOLB 5FOSA 4JKYA 4MX8A 1L4GA 3O4HA 3Q0EA 5IMBA 1IN7A 2PSJA 2Q8PA 2UZ3A 2WKSA 4BB5A 1LF0A 3LHSA 3FDIA 4KN9S 5IXSA 4CXMA 2HL6A 3LPDA 1UCFA 4LUCA 1TXGA 4CM5A 2EDCA 2ZBFA 1G8PA 4TTAA 2VTDA 1SQSA 3RARA 1YL7A 3TL6A 3GLIA 2VXOA 4HAZA 4DQDA 3P2MA 3PE3A 4FQ5A 2IUFA 3ESBA 3NT2A 4UATA 4YTEA 1DRJA 1QR2A 1UT6A 2UUCB 3PE6A 4POOA 1K7SN 1SQ5A 1VIAA 5DM70 4A7PA 3EH1A 4EPTA 4F96A 2GBIA 1EPUA 2WU3A 2J30A 4LPSA 1C3OB 2PL3A 3G8YA 4CI0B 2NU8B 3ANLA 2W42A 4LHYA 5CDYA 1QVRA 2FLWA 3KYCA 1KWKA 2B2NA 1L5MA 2M6RA 1E1QD 1KIAA 2GEDA 3P96A 2I3DA 5LXTF 3I2JA 2JCSA 4MRNA 2GLTA 3JWEA 4WE3A 3SDBA 1PAUA 3SYTA 3V4VB 3WO1A 4DV2B 2GZMA 4BRSA 3Q3GE 3HB1A 3W78A 5K05A 1BNCA 1T0BA 3HFJA 4MVJF 4WY5A 1II0A 1P1FA 2YOFA 1YK0A 4R1NA 3VSAA 2H17A 3HJHA 3BT7A 1HQDA 2NUPA 4CF4A 4CM7A 1CUSA 1ZL0A 4CRWB 1IDN1 1URPA 2W90A 3H1FA 3NEAA 4Z9XA 3TVTA 4F71A 5AVTA 3FTDA 1ODTC 3IAFA 1Q7GA 4X66B 1IVSA 4R5HA 3H7AA 1E9FA 3GOQA 2UDPA 2Q5QA 1EUDA 5BUQA 1FUUA 1E3QA 1N5IA 1F5SA 2YS7A 1S3SA 1D2CA 2UVDA 3ER9A 2ZYTX 1H05A 2RK3A 2B1QA 3L3BA 3A4LA 2H31A 3BS4A 3C98A 3NALA 3PNPA 4IRUB 4E7PA 5IJZA 2QPAA 3KQHA 1P9WA 1CR1A 1WV0A 2L69A 1B41A 1T6NA 2WYUA 4XSHA 4BLQA 2FI1A 2G88A 4GLOA 1GM5A 1X1CA 4YGYA 3RIHA 3RTDA 1FDWA 5LZ2A 4GD3Q 1SC3A 3PE4A 5C1DA 2NU9B 5LP6F 2DTXA 2G0AA 2OXTA 5BMOA 721PA 1JFTA 4X1YB 5K03A 3RVKA 4LXUA 1I6LA 3T1YB 1A4UA 3IBFA 4FC6A 2OPHA 3NWPA 3QVLA 3I52A 3STYA 1TEZA 2H1FA 3NEPX 2QUHA 2X0IA 1TA4A 5F23A 4U2BA 4CYMA 4EKDA 3LTNC 1E2LA 3OE1A 3U39A 5BWCA 3G5LA 5I4BA 3SJZA 4MRSA 3OX1A 4OQXA 4MQEA 3BB4A 4RHEA 4D4IA 1EX9A 2YDXA 4N0PA 1FDRA 3NB0A 2W6QA 4XX0B 3WYGA 2H0QA 4OM8A 4LIPD 2BMFA 2H1SA 1TK9A 1E7SA 1NKVA 2EHDA 4O02B 2PE5A 1A9XB 2X0KA 4UPEA 1R66A 1T6ZA 3IAS6 2ZI6A 2O2JA 1N6KA 1TE2A 4L4SA 3WFIA 3INRA 2WK1A 3NBUA 4REOA 2GAFA 1K4YA 1BXGB 2C00A 5ICCA 3TM4A 3P7MA 3QVOA 1A7JA 1RJ9A 1QOZA 4Z4QA 5EWMA 1UBEA 3AL2A 3HJBA 3SLRA 3NHBA 1UMBA 4R31A 6AT1A 4Q34A 2I67A 3GGGA 5AW0A 1IWPB 1XCPA 1WKCA 3KJQA 4DMFA 3GZNA 4YXWA 4LGMA 3DM9B 4M37A 4D46A 5F5NA 2UYOA 3W04A 2PL5A 3KKPA 4DLSA 4GOLD 3ESRA 3KBOA 1IFXA 2FMKA 4JJ6A 3QOWA 4JX8A 4D5GA 3O2JA 4X1KA 3QLTA 5E1OA 3HL0A 4OQLA 5CIWA 1FJGB 2Q0HA 4B3SB 3GT7A 1A4IA 4F8EA 1G18A 4IGKA 4KQ6A 3RS4A 3WQBA 4EVIA 1P29A 2WINI 4F5YA 4G0VA 2OL4A 3QLVC 4UMEA 2H7CA 4A2CA 4YV0A 4PWYA 1JFSA 1UKZA 2F6RA 2J3IA 2VSFA 2BOVA 3BXOA 4M88A 5FLEX 3RKSA 4A5OA 5KTOA 5F3WB 2J41A 2PMBA 3DWEX 4LHZA 4NAHA 1YOBA 2PMKA 4LISA 4EJMA 3U3XA 4HYQA 1TCBA 4HTFA 4BO9A 2Y92A 4O2AF 4V0OA 3U3JA 2I55A 4B9AA 3ROGA 4TRMA 1GZDA 4BFZA 2RB5A 2XQJA 3FLBA 1SU6A 2W93A 2HBRA 3MIIA 4RLSA 4WK0B 1C4OA 3BMOB 3EVBA 3QX7A 1V37A 4UE6A 4UFNA 1QC5A 5EJ7A 1FF9A 1K4KA 2YV3A 1Z62A 4HUQA 4B84A 4YUAA 5HKKA 1Y5NA 2VZEA 4MDYA 3VX4A 1YAJA 2OWEA 1VCIA 2W58A 4FR0A 4OHZA 3DVSX 3TI9A 4CKBB 1WSAA 2O07A 4TSFA 5G2FA 3LC7O 5EHIA 1XAIA 5K3EA 3UGJA 2C9ZA 2GCGA 3EIUA 2IVZA 2QIOA 3MJRA 2CEKA 4HYYA 3D8UA 4DYHA 4CCSA 4I19A 1MO5A 2JHPA 1FRNA 2Q21A 1X0XA 2VXYA 3FDFA 1YFLA 1NN0A 2ZUTA 1YDWA 3A3PA 5CU7A 2VK4A 3JD3A 1R37A 1PGOA 1WE2A 4JB3A 4FI3C 3FF1A 2OCIA 4URWR 3WVNA 3H2HA 4RZIA 1CZHA 3DMYA 1SAYA 3BTOA 1N9KA 1YUMA 5AOVA 3M6MD 4UAJA 3ZIAA 1V2GA 3JALB 2MIIA 4N4AA 4Y1RA 5FUVA 3HPRA 5GIPE 1FSZA 1XFAA 1KBZA 1KL7A 1GUFA 3BPSA 3MFQA 4FZVA 1N1GA 3X0DA 3KO8A 3RVBA 3LMKA 4TWJA 5CT9A 3E7PA 1A95A 2WKRA 3F5QA 4JOQA 2QMZA 4JLJA 5HTKA 3FRJA 5FEMA 2CNOA 4R6XA 3D7RA 1M0SA 1KYVA 1LSOA 2Y2VA 3OP1A 3PJFA 2FXIA 1DQZA 2QAGB 3W7AA 1IZ9A 1WS6A 3E8SA 3CFAL 2O52A 2P9EA 3CNNA 1YQTA 2Z8ZA 4TWAA 4UTOA 5BYJA 3O7MA 4D45A 4S05A 1L8QA 1DOAA 1HYHA 1MO3A 1HDOA 2ZRCA 3LJKA 3PFBA 5AJXA 3ETDA 4RCYA 3DAFA 1H3EA 2P9JA 3CKKA 4B6FA 2DFLA 1LRJA 2BGMA 4J0HA 3D8HA 2IXGA 3N6RA 5DMXA 1RQRA 1ZU4A 4PRYA 1F2UB 1T2EA 5DGCA 2GYWA 5CHEA 1M1NA 5JPDA 4WCFC 1E3TA 3ACBA 3KKKA 3KZOA 1VE5A 1VFPA 2VPPA 2NLOA 4YBZA 2VYCA 5SY9A 1O0SA 3E7XA 2E37A 1WVIA 2B5OA 2EXXA 3X2EA 3CJQA 4A82A 2X2OA 4V2IA 1AZLA 1E9BA 2FJPA 3VYRB 1YFZA 2B78A 3JU3A 5BN5A 1DIAA 3GCXA 3PI7A 1RWKA 2Q3EA 3DVAA 4TQ9A 3VR6H 4BEJA 3JVIA 2O3TA 1VE6A 1AG9A 5C7IO 1P6UA 1SKYB 3AI3A 3SX4A 3PHBE 1PT8A 2AOWA 3G3EA 1N2JA 3JQ7A 4RW0A 5SZHB 3LQFA 1SXIA 1RQGA 2OK7A 3L01A 4JUAA 5J2UB 3B8EA 1OY1A 1KK0A 3OQIB 4INPA 4FGWA 2M32A 3REQA 4RF2A 3RROA 4JJAA 2JRLA 5FA5A 1QRDA 2FFJA 4H7HA 4EVRA 2B25A 2CKDA 1XCOA 3G0BA 1Y7LA 1NUQA 4JASB 4LYJA 4U2FA 2HJVA 1PWXA 2Z57A 1U7WA 1JT9A 4KI7A 1QFMA 3GARA 2AKYA 2X0DA 3TLEA 4D3ZA 3DWGA 1DV2A 1QAQA 4ZV7A 3W1EA 1DT3A 4BFUA 3QHQA 4LNAA 1G42A 1IC6A 1I7DA 4FYKA 4BQFA 1I4DD 1BJTA 3OKFA 3PS9A 4RK1A 4L4RA 4A3SA 4X7PA 4AQYB 4YAOA 1N6RA 2CE2X 2X40A 1I10A 3EFOB 4OB8A 1ULTA 4PPGA 4TYQA 4XPIB 3VI3B 3WOVA 3WK4A 3WSTA 1L7PA 4DQXA 5JRDS 3EXG2 4TYNA 1A9YA 1X7ZB 2QTLA 3GEBA 4YBRA 4EB3A 4JI8B 4PLTA 5LDGA 3WG9A 2R7KA 4WH0A 2QE7D 3EBLA 2XCLA 4KX5A 1Z9BA 2WWXA 3TQOA 4DYDA 2WYOA 3BMQA 5HE8A 1YC2A 3WMFA 3NP9A 4OHKA 1DG9A 3DEFA 4JD5A 3IXQA 2YZ2A 2BFEB 4XYGA 3E61A 3DLBA 4KO1S 7ABPA 3OEWA 4F6RA 4G1UC 4RBNA 4ZI5A 1H4TA 3BCHA 2VHQA 4KE9A 5TS2A 1LV7A 3ENWA 2ODAA 2VHYA 3LPCA 4M3NA 5LBUA 4X54A 5LYJB 4UDXX 4ZAFA 4F3YA 1PR0A 3OZXA 2V6JA 2OZEA 3J7TA 4GPIB 4ZAZA 4A4DA 3A06A 3X1YA 4CIWA 2HJHA 1B8UA 1Q44A 3C48A 3AHDA 2HHHB 1W59A 3K35A 5KNCA 5ALWA 3N8HA 2GDZA 2VJKA 3TDMA 3EGEA 1W4AA 5FTMA 1H2WA 1L7AA 2VPWA 4HH4A 4D0NA 3WIEA 3LLUA 4ENRA 2NZJA 3RVDA 4HNVA 1KWGA 1G20B 4QU9A 2EQ5A 1P1BA 4OO3A 4HEJA 4AG5A 5L3SB 2VYNA 3LDFA 3S99A 4ALJA 1ADJA 1CPYA 2VDVE 3T0FA 3HWSA 4W7HA 1P91A 3O26A 2IP2A 1WXDA 3KDPA 1Z6PA 1GZ7A 4GW3A 3C3AA 3IUJA 3RQIA 5HNKA 2CJXA 4WASA 4B80A 1JPNA 4N3BA 1NBAA 4D9IA 1H22A 4C4XA 4OJKA 1QONA 2FPXA 1G7RA 4JJ8A 5IXJA 4UVGA 1EJ2A 3I4CA 4GWLA 3KUUA 4Y6QA 1OJLA 2IU3A 1U4OA 1L9KA 4R8VA 3QTLA 3RWMB 1QRAA 3IMKA 3VH2A 4FCWA 5DH9A 3QELA 5IDWA 2V3CC 3IJ5A 2I4MA 4HVLA 3GPDG 1XEXA 1J97A 3CC8A 1YB1A 2VA9A 3N2LA 5CVTA 1IG0A 1QDEA 1A2OA 4LNHA 2P8JA 4C78A 2XQKA 1TUBB 2ILTA 3IUPA 3L41A 3TZEA 3UM9A 4AYWA 1VHTA 2J5QA 3FNGA 1WXQA 4LRYA 3T7DA 3ZV3A 1LPSA 16PKA 2CLLB 3GAFA 1GRQA 2QNBA 2A78A 5FPSA 4D6XA 2H4WA 3DQPA 3PYLA 4J7UA 1P7WA 1HYEA 3NRBA 5FULA 4P35A 2C3PA 4S1PA 1JHDA 2BISA 3JQDA 2QRKA 1ODCA 4FHDA 1IY8A 3LPMA 4U7FA 3SYNA 3SBXA 1T8RA 3HVHA 3NAGA 4NG5A 2H48A 3PUJA 3DZHA 1NVXQ 2Q28A 3KU4A 1HRKA 1WL8A 1I4EB 4LGYA 4NE2A 3MAJA 3HJCA 5A5DA 1J8QA 5LR6A 4OIMA 2ZSJA 5G02A 1XDGA 1EFHA 4PS0A 1NF9A 3FI9A 5F3RA 5HIIA 2C82A 3LLSA 4PFKA 1V95A 5CM9C 5SZKB 4HYTA 4CZ2A 2HT6A 5DLYA 2O54A 3ZI0A 1RXYA 1VJGA 3X1DA 3OX4A 3F7MA 1TA0A 3LUBA 1KSHA 2JD0A 3K8ZA 4KLAA 3AQIA 3DTVD 4OL0A 3UFXB 3OWOA 2CCGA 5ITZB 3KYBA 3S7ZA 1Y5RA 4EYOA 1V9CA 4ZAWA 3EPJA 4ND1A 4D82A 1IVYA 1E63A 2WAMA 1Z8DA 2WKPA 1GGJA 1YIAA 1NAIA 2R1VB 2HM7A 2WIAA 3RUDA 5JJ5A 1J1ZA 3SKXA 2C2MA 2BZ1A 5F21A 2BZ0A 5CLQA 3IKVA 3B2EA 4K2AA 5FPPA 4CTKA 1W581 2FEXA 4DIBA 1MJGM 4AMBA 4GM4A 1KJQA 2PA0A 1AQYA 3HADA 1S2NA 4WACA 3ZKWA 3DDCA 1U4NA 4F3CA 1YH3A 2IHBA 1E9CA 2QQ0A 4JB8A 2W2QA 3TPCA 1N1MA 4RXMA 2I4OA 3USCS 4XM2A 1AB5A 3D2BA 3G88A 1KSJA 1SA0B 3DGFC 3LX5A 2Z9DA 1O97D 4KXNA 4TMFA 5BV0A 4CV2A 3AP2A 2Y1XA 2XGGA 1L4KA 4YEDA 2FKNA 1KVQA 3NG1A 3TCXB 5FWYB 4GU5A 3Q9UA 3PDIA 3GHHA 3DBLA 3H5RA 5BW0B 1XCMA 2D8MA 2IELA 3Q6IA 4L0QA 3JQEA 1N9ZA 5F3DA 3WBJA 4BO8A 1KFJB 2Q3FA 3C6BA 1DEXA 4WCVA 4FBMA 2YWRA 1WDTA 3DZKA 5EVJA 4C76A 4JLAA 1CE8B 4F97A 5ARBA 1GCAA 4HN9A 4KQXA 1Y3BE 2ZVQX 5JEDA 3DLCA 1T36B 3CRZA 1J0EA 1HY3A 4RSGA 1YB2A 2HA0A 4UUOA 4I4TB 3KAKA 4EITA 4YB8A 1E6MA 4FNAA 2OHHA 3LO8A 1Q0PA 4Z0NA 5IAGA 3ZNOA 1V4NA 3AYZB 2IPXA 4FCVA 1P3JA 2VSNA 4ND7A 1U90A 3SD7A 4ALNA 3HA3A 4M87A 4I1OA 4FX5A 1QBGA 4GI5A 3C3KA 4TM7A 3RAPR 3MJVA 2ZI7A 4Q3LA 5DHTA 1I8TA 3WIVA 1FRFS 1WBJB 1LA2A 1PFVA 4YCDA 5TT1A 4IWXA 2ECKA 4ZIRA 4J7CA 2EKPA 2WVAA 4J29A 2DR2A 3D6HA 3EF1A 3COZA 2Y1CA 3IVAA 3PUWA 5C34B 2HMYB 1YQGA 2QGZA 6REQB 3ADPA 2DE0X 4UU7A 3K09C 3HUEA 4C6RA 2O7RA 5E8JA 2ZYUX 4LGVA 3CMMA 1N7IA 3GJ5A 3M70A 4D0SA 1IJKA 3THSA 3A70A 1UAGA 3EXFA 4BN4A 1IWOA 5B55A 4NBUA 2AMFA 2QTBA 4RO0A 2OO5A 4TKUB 3ROFA 4CDMA 3OZIA 3B1JA 2WNIA 1G8JA 1ICEA 3AF3A 1PYOA 1P5JA 3KIPA 3M4JA 4YPFA 4DVGA 4E15A 2ZM6B 4JXXA 1Y1SA 4FFDA 1Y4ZA 2DFKB 4D4MA 2VCHA 1W19A 1WZCA 1MX9A 1Z68A 5MGBA 3VO2A 1J25A 4PYLA 2XE8A 2RBEA 5HVNA 4V03A 1WSWA 1DOHA 1CZKA 1U9ZA 1WDKA 3IHTA 4P83A 4E09A 4TXLA 4GPBA 3RYIB 3LRXA 3GFVA 3QOFA 5DHQA 3H9JA 5JWOA 1LV8A 2OKGA 2W2OA 3K0FB 2IU6A 1A8PA 3Q3IA 2CLKB 3E5RA 1X7YB 3HEAA 5JMWA 1NVVQ 3H5OA 4BNKA 2BR4A 3A9SA 3OFSA 1SM4A 2A1TR 1SXQA 1UXHA 4IZIA 4FYWA 4CNBA 1NC3A 4BEWA 3LT4A 3AR8A 1JI0A 2N75A 4HLCA 1G8AA 4QGHA 2NZUG 2X8WA 4NABA 1GSHA 5LMNB 1G2QA 1LY1A 2CVQA 2O8CB 1OXVA 4KVFA 3B6IA 4MDEA 5ALMA 5K3DA 1L4FA 1XDUA 4QU5A 5AM2A 5EJAA 4HAOA 4JQCA 4QJ5A 4R4JA 1D3AA 3JYPA 3Q3CA 3ZWYA 4BLUA 4LYFA 3L1VA 5ALOA 2PS1A 3FBTA 2J9FA 1XDDA 2K2QB 5KSWB 2FZ5A 3K1YA 2TYSB 3KBBA 2HUNA 5HKKD 2NACA 4UTXA 3SEZA 5AR1A 3UCXA 4NKRA 4C6SA 1X92A 1R6VA 2VAPA 5JFGA 1K6JA 1GV1A 6LDHA 4N5DA 4A5SA 5BWBA 2VCYA 3LXUX 5DNEA 4JU9A 1MXHA 3HM9A 4K9KA 1S3IA 2X8AA 1NU6A 2QENA 4WK2B 4UNQA 5ELMA 1H2BA 3NFRA 1FNNA 2QYOA 4JT9A 2QYHA 5EJ8A 2GILA 4INAA 3DXXA 1DKOA 3D9QX 4N7JA 1EJ6A 1S8FA 1Z0SA 4G1MB 4JVMA 4CUJA 2GAJA 2QY9A 4PAMA 2VDPB 3IVCA 2H65A 4QQFA 4DQUA 4LQLA 5KNBD 1AVTA 3OAAA 4AY6A 5EQDA 2ICAA 3PQ5A 4MP8A 3UB4A 4MS3B 2P62A 5ARDA 3V7WA 1A2BA 4EB6A 1IEXA 1LDYA 1U0TA 4FVTA 4HWSA 4ER5A 3SSOA 1K0UA 3K1ZA 3M9LA 1OT5A 3BJMA 2AQ8A 3FD8A 2WU1A 1SUAA 2MYUA 3Q7IA 5D5QA 1V5WA 3ETEA 4K2HA 5I7AA 1UR5A 5JJCA 5E1DA 3CHYA 1M1ZA 4MQ6A 2VF8A 2ZR9A 3C1AA 1LTKA 3TNLA 5JVDF 3W5UA 4M6WA 4IS3A 2X6RA 4UZFA 2C2XA 1N78A 4TVBA 3B1XA 1OXUA 4HXEB 4PSVA 4U63A 3RAFC 3ISJA 1SCQA 2JCVA 1O95D 2AW3A 2DPYA 4CCYB 3H2SA 5F2NA 5JCJA 4W5RA 4DT1A 2JASA 4WNYA 4G09A 2XIJA 1FB5A 2WIKA 3A6JA 3IUQA 4HS9A 1T2DA 3IXLA 5EG5A 4HDMB 2FW0A 4P4SB 1DBIA 1LCIA 4WOPA 2FPWA 1ABFA 5H16A 3UJHA 4NMLA 4F86A 1S2LA 3II6X 4PNZA 4ZICA 2QRMA 3R6WA 1A8QA 3C7KA 2H07A 2ZRLA 3I8OA 2QN3A 4Q7EA 1KEEB 2PL9A 3A37A 1T9CA 1X80B 2P6NA 4CMAA 3ENKA 4INOA 3G1TA 4YJGB 3IAEA 2VP2A 2I7TA 3VPCA 3K9WA 1RAAA 1T4BA 1C0LA 3C3BA 4XM1A 1E7RA 2ZYDA 4QOSA 3U26A 2AYZA 3HI4A 2NTVA 1A9OA 3L6UA 4X1IB 5BVHB 1PFWA 1AU9A 1PQPA 1H93A 4WESB 3V4ZA 4YMSA 1HYGA 2JJ2A 3PA6A 3VVMA 3UBMA 2PKEA 1YL6A 4HR7A 2A3RA 3JD2A 1VJTA 4HD8A 5TB5A 4EIWA 3UHAA 2Q6TA 3MWJA 3TGWA 2JJMA 3FOAA 3ZHCA 2AI2A 3SQDA 3AETB 4PC2A 2VC2B 4D9KA 5K8TA 2O8DB 3O3NB 3PWTA 1R5OA 1H4SA 1SCIA 5ECYA 3K2IA 1NNEA 3SP1A 5J3JA 1JG3A 1NT4A 2D74A 5KHLB 3HYCA 5FUYA 4NTZA 2VCEA 3N7TA 3R9XB 1JP7A 2XMPA 4ZVMA 3WGVA 5FOWA 1GTZA 3I6MA 1GD1O 2OK8A 3THXA 2LPMA 3GJ3A 4G8DA 5KQLA 4C43A 3EEOA 4UUMA 2RGEA 2IBMA 1K9SA 4WT7A 4DBZA 4E13A 5DYTA 3NYIA 2XCSB 1G5RA 3DEYX 2D2XA 4IVNA 3U6BA 1GL3A 1DADA 1NBMD 2Z6UA 1NTRA 4JEIA 3V3KA 1DO0A 3DTNA 5CT8A 3H1TA 4WADA 1PJ4A 2G1UA 3OA2A 4DAEA 1TADA 1W4BA 4MWTA 3B9RA 4Q1EA 3PXGA 3ZI4A 1Q1EA 4B3CA 1YTLA 2P3OA 1L8AA 4XD2A 1ZBDA 4DZZA 1NUHA 3QG1A 3WMGA 3E2MA 4DG9A 5B1IA 3DHEA 5AXCA 4BVBA 2BEWB 3A14A 1FXSA 2GZ2A 3JVVA 4JQYA 3E4CA 1SUWA 4ENPA 3NXSA 1VE3A 4Y9DA 1OXBB 1VHLA 4R1PA 3BORA 2O1SA 2W2KB 1Y82A 2RGGA 4U3JA 5NULA 3K0CC 1DC4A 2NPOA 1GVHA 1RQPA 3F8WA 1B7GO 3INTA 4L50A 3T3HA 2C59A 1XLTC 4IXNA 1NQOA 1YNSA 4MJXA 3TNJA 2GBFA 4JIMA 3C3CA 2FP4B 3DMFA 4RULA 2NVUA 2DFNA 4JJFA 5JCOA 1SWWA 3GJYA 3SBDA 4K6OA 1XWFA 221PA 3E4DA 1FDIA 5KCMA 2AJCA 3MW8A 2JARA 4IXWA 4TV8A 2JLZA 3RODA 1X3SA 4YR7A 4C01A 2ZS8A 3DDWA 4JEMA 3HBJA 4NE7A 3PHGA 2MINB 4BV8A 3HB0A 3PC8A 4KE7A 3V7UA 1FNDA 2BGNA 2LCFA 3E9MA 4M98A 1P18A 4L5YA 5G1PA 2I7XA 4X20B 1M6HA 4ZEWA 1RWNA 4LECA 3WDMA 5I4KA 1R9GA 2JFXA 2ZB2A 4RL4A 5CXXA 1VIVA 3D7LA 4MPJA 1VYHA 1ESZA 5KQSA 3WGUA 2HA6A 5C1OA 1Z34A 1XKTA 1ZUHA 2XKAA 4QODA 5LU8A 3KJGA 4IPTA 5J4HA 1ATIA 1FFHA 1X15A 2GNOA 3GLKA 4R54A 1PL8A 1OH6A 1M67A 1TVCA 1E6UA 4UQPA 5D3QA 2W2MA 5K2OA 2JLBA 3M1YA 3IMEA 5E6SB 4KLNA 2XDAA 2JFPA 2QJTA 3I9MA 4J91A 4K1LA 4KZPA 4NV3A 4GOXA 5GY7A 1XMJA 2IEYA 1SBCA 2ACEA 4KSCA 1ZD5A 3H3JA 1YIDA 4D0RA 1Z4IA 2GN6A 5FAKA 2HQSA 1Q83A 2ZPAA 1JU3A 5EMHA 3H9EO 2WJPA 3AYXB 4QYTA 2HXGA 4WN9A 4YREA 1SZPA 5ALHA 1VPTA 4XLTA 4AY4A 3OTQA 5BMVA 3WHKA 4RF4A 4W5OA 1W7AA 1LLUA 3QPVA 4G86A 4XXHA 3RYCA 1VL6A 1RXSA 4G89A 2C77A 3DBHA 4QJIA 2E2WA 5TQ2B 2NV0A 4IQ8A 4NMHA 1CFZA 1Y98A 4F2WA 2A0FA 1J20A 1A97A 2JFGA 4OLHA 2DSTA 1M6YA 1W0JA 2E55A 3KV3O 2CFTA 5DRYA 5EINA 2ROQA 4CL0A 3WWEA 4YQFA 3QQPA 3VNSA 3MHPA 3EDRA 2QNIA 3G82C 2BMEA 3QUSA 5CJ2A 3O4GA 3T7SA 1B93A 1AOXA 3IVXA 3JPYA 3F5SA 3O3OB 4OI4A 5DNCA 2IBTA 5BXQC 5LOVA 4TS9A 3H2BA 1BOOA 4TKVB 3FPGA 3TE7A 1P2SA 2IYYA 1V5EA 3CEHA 3FSGA 3MIZA 4MJ7A 1U8AA 5A06A 3ANNA 1THTA 5CITA 2WD7B 2R25B 1ZGAA 4XDGA 2HMVA 4R2MA 2IWRA 1ID1A 5GVSA 1YZUA 2OV8A 3DOEA 2YBDA 1SURA 2JEOA 2Q9AA 3MQ4A 4U1RA 5A03A 3WAGA 1E61A 2OC4A 4YT8A 2CBZA 2J6HA 2Q46A 4LE0A 3QJ5A 2J45A 3I34X 4JYCA 3HY3A 5BYKA 1D0SA 2WF6A 3IQHX 3FOFC 1W44A 1KVUA 4IFIA 1FXUA 3WJ1A 3TSZA 1WCIB 3AEQA 3JTEA 1CLEA 2QRVB 3O2SB 5G4KA 1KQGA 3QNUA 5LXTB 1XROA 1X7DA 1AJEA 1NBOA 1EUQA 2G0TA 2XUAA 5IZCA 3HZHA 4Q3NA 3G0HA 3UV6A 2WWTA 2QN9A 2YWJA 2PX8A 3MJ4A 3IV9A 2JIDA 2XD4A 2I33A 2OCBA 3HBNA 2PRSA 3PNMA 1K4MA 1MEJA 4IIJA 1RDFA 1ZM3A 3N3AC 5HQ3B 2GTPA 1RCTE 2WTNA 4X63A 4ZCRA 4V1CB 1BWSA 2JBAB 1XHEA 3OM0A 2Q8NA 1YE8A 4CF7A 5JNVA 3DKRA 3SS9X 2RCNA 1AUVA 1SVLA 1ZM7A 5LQCA 1H9CA 2PGXA 4I46A 2NTYC 4L3VA 1JEAA 2IUYA 1JFRA 3CLKA 4KVAA 4OQYA 3STUA 4RJIA 3V8VA 3WHLA 1TYBE 3GCWA 4EHFA 3AMVA 2TMGA 3SJBA 4RLFA 3KB8A 4P4NA 5FP0A 3HKCA 3ILSA 4DDKA 5ARCA 4G8BA 3IRVA 4YJHB 4D8YA 1OXMA 3G89A 3RVNA 2CL7X 4IGIA 1BWPA 1P1CA 4TT3A 1N2HA 2ATXA 3QWIA 4I9UA 2IHVA 3MYYA 1W94A 4BB6A 1OHHA 1Z88A 4XTRA 3AVQA 2HAEA 3TCKA 4HAWA 3TTSA 3ES9A 1LVGA 2E0IA 2OAEA 3VKUA 1BEEA 1TTQB 2F9FA 3RUIA 5AMXA 2YV5A 4C2AA 2C4KA 1E2BA 1P2TA 3QI7A 3T1NA 1BXRA 3O3CA 3C45A 2PAFA 1YA4A 2A3NA 5CW2A 1BCRB 2ZS9A 3LTEA 2OCXA 3FFTA 2DX7A 4CN8A 5B1EA 4DCGA 1HLFA 2ZQYA 4TYPA 5AICA 4C0LA 5BV2P 3HUUA 1CP2A 3OZFA 4KQJA 3IE0A 3LT1A 4RVUA 1XQXA 1Y48E 2OZLA 2BGGA 1K5GA 4HVAA 1O0CA 2CNDA 1L1EA 2WQ6A 3REFA 1MRZA 1ESCA 3QVTA 4ZAVA 2IH5A 1CUFA 3W6ZA 1XRLA 1RHJA 2VDJA 4BKPA 9MHTA 3FPSA 4R81A 2B82A 4MUFA 4L4YA 1KAEA 1B2LA 1KQPA 1FP2A 1GWNA 1SHTX 2C8LA 2PX0A 3HYLA 5T8KA 5GMOA 3BMXA 3GFTA 3RSHA 13PKA 3BWEA 1Z0UA 4X61A 4AN4A 4C88A 1VMEA 5IKXA 3UMRA 4K1XA 5ICMA 1YZHA 2DBZA 2JVIA 3RU7A 1XJWA 1GDTA 3F78A 4GT1A 2H2IA 2JW5A 3KM0A 3K9FC 1DCFA 4LHWA 4LZJA 3E15A 1JQBA 1HMPA 1DT5A 4IF4A 5AUNB 5B6PA 5JS2A 2WU8A 1L4BA 3LRPA 4Y3UA 4UOEA 1G19A 1GLNA 4RVCA 1CTQA 3L7LA 1U0EA 2PYDA 5B6JA 2VUUA 3OQNA 1JR4A 2V8BA 1N5DA 4W9MC 4RLHA 3SZOA 2C5BA 1NUTA 4RY8A 1HDRA 3ZIUA 1XTTA 4HZUA 5J4YA 5L7TA 1NM5A 1ZLXA 4BLTA 1GPYA 5JS7A 2K5UA 2CNWD 3FAKA 2B4TO 1IN8A 1SU7A 1JDTA 1O03A 2IYQA 3N39C 1FTSA 3TNFA 4C05A 2QR2A 4Q9DA 4S0ZA 4YMTA 3QKSB 2YHIA 3WMEA 1E9DA 4XWAA 4JVSB 1JQLB 2ZT7A 1E3LA 3WSWA 3COJA 4Y6OA 4O2AB 3C6XA 4BQRA 3UHFA 4QDJA 3FUXA 4GIBA 2AVDA 2CMGA 1JYEA 4J0JA 4MI6A 3DFZA 1KTIA 2D2FA 3L84A 1O8BA 1W0CA 4AIRA 4E94A 2YWXA 1J1UA 1LBEA 1QH1A 5GZ6A 1ESEA 4M86A 1Z17A 2QI9C 4LOIA 4RHFA 2RD2A 2GH1A 1OLSB 4RM3A 5IJXA 3IUNA 3E7FA 1ZJYA 4DLUA 4Y6PA 4Z8YA 3RHSA 3OTHA 4P5EA 2KLHA 3F97A 1RYNA 1JHQA 1P17A 1BMTA 4GX1A 3CINA 5HMMA 3ZI7A 3ZV7A 3BCRA 4I5GA 3U4DA 4BZZA 3IAUA 3M1LA 4Q1FA 4TS1A 4JEHA 3U48A 1KZ7B 3WB1A 1A96A 1CR2A 1S8OA 2GOYA 3VR5H 5C1PA 3AVXA 1FLAA 1R8QA 2AXEA 4BU0A 1A04A 2AIRA 3RT1A 2X6QA 2G72A 1H6DA 5B37A 4PC7A 2DH6A 2NVBA 2BFBB 3IIKA 4FIDA 2V1UA 3FSEA 3R5TA 1EXNA 3HO6A 2Q41A 4JK3A 2FX3A 3QP9A 3H18A 4P0TA 3HJRA 4O4JA 4WKOA 1U94A 1EXWA 5JT1A 1TOAA 2UYYA 2JK0A 3BHJA 3GAMA 3RRNA 1WQ3A 1B0PA 4EW3A 1W4ZA 3RNLA 3SM9A 3TZHA 3FUVA 5DNYB 2HEGA 2A9FA 3ZY2A 3WGZA 4HX2A 2EQBA 5F35A 5LBIA 4E0BA 3S8EA 3TLMA 1NXPA 2Q4BA 2QV7A 4HSEA 4PICA 2XMZA 1MRNA 2GKSA 2VDOB 4ZKDA 1I36A 3MWDB 1DB3A 1FLDA 4OG2A 5KWJA 1N1EA 4H3SA 3RS2A 2XBMA 1WQ1R 3W5BA 5HW0A 3CRVA 3G8BA 1ZMXA 1I7LA 7REQA 2W4QA 4ITUA 1MC1A 2VNKA 4ZZ0A 2EBFX 5DGIA 1KJZA 3D6TB 4BXOB 2A5YB 3A3YA 1D8AA 1ZM4A 3PIDA 1FFWA 5F4ZA 5JAQA 2R4UA 1VPLA 4CF3A 3VYTB 2OGZA 3VOSA 3RRMA 5HRAA 4FMBB 3ROMA 3RSZA 2HT1A 3HBAA 4WJLA 3DP7A 5JAUA 2P2LA 5CR9A 4BIMA 1HDYA 4OB6A 4EGFA 2W71A 3D7MA 1G41A 4BB9A 3FVVA 3G9QA 3V1MA 4BY9E 3ULKA 5E7QA 1QLWA 4P5DA 2PUVA 4KW7A 4OSOA 3LFTA 1PJLA 3U17A 4DXDA 2IXTA 2OFWA 1F0KA 2EW8A 5H5JA 5L4NA 1CDEA 2IJGX 3OKPA 1C1HA 2ZT8A 5K45A 5E3JA 5IC5A 5LQDA 5SY4A 1DC7A 3TTYA 4DAOA 3KCQA 4DPMA 5G0SA 5FQOA 5HF5A 1Q1AA 1CR4A 1E79A 1KFBB 1RI2A 2OP1A 1DCTA 1QQAA 3CMCO 4MA5A 3I9LA 1P1JA 3C3XA 4B47A 2F48A 1Y8AA 4PHCA 2XTAA 5FTKA 2NV6A 4OQZA 3B78A 3PUKA 2Z1NA 3P9NA 5DKFA 3HGMA 2J3KA 2VP6A 4LOHA 4JYZA 2VKTA 3I9NA 4GLFA 4G2TA 1TD1A 3TK1A 1V11B 2L18A 3N3BC 1HV8A 1E1LA 1Y7TA 2B69A 2FV8A 4M7PA 4XYBA 2HIMA 3P2JA 4WVLA 5EN4A 3GT3A 5FWXA 4XQEA 4MGIR 3E84A 2FZKA 1JHZA 5CVVA 4Z9YA 3IBSA 4E22A 4QLBA 1LPOA 3JQBC 4I4CA 1EFPA 2R8BA 5E9QA 5BPFA 4RTPA 3F6CA 3EGXA 4FN5A 3BXPA 3VR4H 3AT1A 2QNRA 4UHHA 1WIWA 4H6VA 4K88A 1L5YA 3RFTA 2QPLA 4HAIA 4JJGA 5B3LA 4C7KA 1UBJS 3PZRA 2BUAA 2VAVA 4CUKA 2FSGA 3AZQA 2HMSA 4FFNA 1PSZA 1MB3A 5H82A 4GX0A 3WK9A 3R8FA 4L27A 3TB4A 4EY4A 1KQFA 1CUGA 4A15A 1VQ1A 1AGRA 2YXEA 3BG5A 3G2KA 5DI3A 1R2QA 1NUUA 1ONSA 4OJTA 1KU0A 2M6LA 1E1NA 1FFEA 2CDCA 3I32A 4FTWA 4D9FA 4NDZA 3EPLA 1KS2A 2PO5A 5G0TA 3WGLA 4W5NA 1SR8A 1R0BA 3HP4A 4Z51A 1WA5A 1NJ8A 1GA6A 5AVRA 1JG1A 2CYCA 1IDOA 2OCPA 5DLEA 2DPHA 2LV8A 1WTCA 4ND6A 1AHPA 4HLQB 1RM5A 3S2UA 5AM4A 4YR9A 1IMOA 4A1OA 3IOCA 1RRGA 4R01A 1YWGO 2ZRBA 3ZWMA 1DLIA 5LJLA 3HV2A 1W85A 2Z5VA 3QUTA 1NI5A 2XV1A 1CUEA 3NUQA 3BGSA 4ZJZA 5TPZA 4BJHB 3QM1A 2JLSA 4LBYA 1XNJA 4KITB 4JLMA 5IWCA 2W4IA 4XGKA 3DVLA 4EJSA 4B3MB 2HYDA 4CFYA 1NA5A 3I2KA 4BLPA 1MTOA 1NZJA 3U0BA 1IEVA 1USVA 4K9LA 4K81B 3COPA 3AOEA 1R6TA 2FZCA 3F74A 2XXAB 4KWCA 3G2PA 1ZOOA 3LX6A 2WBLC 4DJEC 1AT1A 2HN9A 4WNIA 3JARA 3TM5A 5B4VA 1YA8A 1GTL1 3D7KA 1EVKA 1Q1ZA 4TL7A 3O03A 5JS1A 5EMMA 4QBIA 4FM9A 4IF6A 4RNCA 3LUFA 1Q0HA 4UE3S 5IM5A 1B6SA 4HB2A 3UF0A 1LPBB 3P1JA 4O5OA 3RC2A 1H1LB 3GEEA 1WG8A 4QOFA 1IUPA 1RRKA 2FYTA 2IGTA 2BEUA 4CTNA 4KLRA 4EJ2A 2YW2A 1M8KA 4WFQA 5C32A 4BO1A 3CS3A 5DYNA 1BYIA 2V0GA 3GQBA 3L7AA 2JAUA 2QWXA 3B6EA 1IB6A 1CU1A 2COUA 4GKVA 4B3IA 3F8TA 4QTZA 4RK7A 4XQ9A 5CB4F 1R6DA 2VF5X 4RD4A 4MHTA 5A7FA 3R4CA 1G2OA 1PQYA 1R8YA 3L0OA 4MTCA 4WLVA 3FUWA 2R48A 2G82A 3O4FA 4RGQA 3UAVA 2ISCA 4NOLA 4PN7A 3A9RA 3MWYW 1XDBA 4ZQBA 1JR2A 4TZKA 2DHCA 1X1QA 1BMFA 5C5IA 2HX1A 1U63A 4NDAA 3RVOA 4MLZA 4ZO4A 1G21B 1Q7BA 1T8YA 5A4KA 3OURA 4AWAA 1IM2A 4DNPA 3ONFA 3NIFB 5BRAA 5A9RA 3FSGD 1PT6A 2B36A 1W35A 1QHEA 3HSKA 4FFWA 1E60A 2OAP1 4LOJA 2Y66A 2I6XA 1E3JA 4IYRA 2B8EA 4V3CA 3VZQA 5ESDA 5FRDA 2OHGA 1RRVA 3TD9A 3WGMA 2I6UA 4XB1A 1OI7A 1XZBA 4GX5A 4NXNB 1K6EA 1CUBA 1PLLA 2HHJA 3AESA 4QFMA 1EM8B 4FEYA 3S28A 3IMFA 1T6BY 3KQUA 1SBNE 1SQGA 3DFUA 3IBCA 3EVFA 3TI7A 3ZHOA 1OQAA 4BHRA 5KIAA 4ND8A 3T5DA 1E2HA 3FNRA 3K9GA 1PCXA 1UKAA 4DJAA 2W2PA 1BN6A 1PU2A 3TJRA 5MDHA 3SBEA 4DARA 3W0LB 4W9NA 2HR1A 1PQ4A 1XN4A 4ECEA 4G0QA 2NPFA 3KZ1E 1D0VA 3HKDB 1QS0B 1QFZA 3V1LA 2F3QA 3VJMA 4WNAB 3V33A 2PGDA 2QDXA 2X9GA 3NPMA 4CHGA 3OX3A 2P2YA 2AG1A 1MA0A 2PBLA 4NP6A 2ZB8A 5ERGB 2A67A 1D09A 2ZRDA 4COOA 1Q95A 2ZXFA 3OECA 1OIXA 3A9UA 1P33A 5CTJA 3V4FA 1IL0A 1H2ZA 3GGJA 3LLCA 4HQLA 4OP2A 2D6FA 5ESXA 4PLWA 4PZYA 1BDBA 3CVJA 3QVWA 1XVVA 4TX1A 3SZUA 3T1TA 2FLVA 4HXFB 4XR9A 5CDFE 4KMOA 3FSRA 1JILA 2HMAA 3A6GA 2NO1A 2BFCB 1ILEA 1XKXA 2N47A 1GTSA 3P0IA 2PG3A 3QUAA 4YCNA 1PYDA 3KHTA 3OICA 4AMYA 5JJLA 5TXGA 3HP7A 3MSCA 3N0RA 4HZIA 1JLRA 1Z5OA 2ZR0A 2VYVD 4BVKA 2H11A 2QTRA 2FE4A 2GPYA 3PGA1 3UT5A 3TQIA 3FCEA 5ADWA 3A9VA 4MGHA 3C7CB 1F2VA 3KAPA 2HV8A 4MV3A 1O4WA 1RPTA 5L9AA 3GJ8A 3L6EA 2OHJA 3P9IA 4KAFA 3PQ2A 4K9QA 4OI0A 3UA0A 1NMYA 1R9NA 2OV3A 2XE4A 4Y2SA 2Q5OA 4KXWA 1JJVA 2WWFA 4NPHA 4AKHA 3SLGA 3L43A 3EGDB 4L75A 2JLAA 3RTBA 2BKUA 4MV4A 1YBAA 1YZFA 4IZHA 2C98A 4PX3A 4FW9A 5DGXA 5KINB 2A9KA 2HC9A 3RUHA 3NTUA 4DWVA 2V9ZA 3V1YA 1S2GA 4E3WA 2XEXA 3WZLA 1XL0A 4G23A 4OSPA 1M74A 4FQ8A 1K89A 5BNFA 1L5QA 1KJWA 3NBFA 3PQEA 4U6NA 1BKSB 1QYWA 2ODWA 3I4LA 3B2QA 4YAFA 4HPXB 2D1QA 2O9JA 2Y1GA 3G7NA 4JENA 1ODLA 1MO2A 4KAXA 2N9UA 5J58A 4KR3A 5DULA 3WYFA 4DV7B 5D5PA 1C2TA 3M9XA 3FBWA 5BNTA 5CDFA 4ZJYA 1FFSA 2XYPA 4PWZA 1KXZA 2HRBA 2X8JB 2E18A 2QRUA 1ODJA 4G63A 1P1KA 4V3BA 1E8NA 1P0PA 3ITNA 4WI1A 3AI7A 4UTRA 5BT8A 5C8YF 4J94A 2XTZA 2Z2KA 3DMNA 3T1OA 2RHMA 2OO5C 3OMLA 4X60A 2JB9A 4MW7A 3EZFA 1M7GA 3K0BA 2R6R1 4WZBB 3SJ7A 4EPWA 5LQNA 4MAMA 3WXBA 3RC9A 4OAOA 3OOHA 2OY0A 2AL7A 4GXRA 4HB4A 1PFKA 2QE6A 4M8SA 1GCOA 4R6WA 1HDGO 1VM6A 4KYUA 5E38A 2JVJA 2Z3VA 3T6KA 2BKAA 4X94A 2JA1A 1ZG3A 3BAZA 1TJ3A 5LZ8A 3VDXA 4Y8VA 2PH3A 4CFSA 4RH1A 5CFLA 1YZTA 2O8FA 2F2TA 2C42A 1HT2E 1U8TA 3FZEA 1Q2XA 3A8TA 2PXAA 3X2FA 3SICE 4LF7B 3ZH9B 1GDHA 4FINA 4D0LB 2W2LA 3PRHA 5BSRA 1D2NA 1FMLA 1PDWA 1VZ3A 1NZFA 2GLUA 3OBBA 3FHTA 5B12A 1L7EA 4J16C 4RFLA 2EGHA 4G8CA 1C30B 1R6UA 2IC5A 3BH7A 5T4FA 3PIRA 1ESMA 4IMIB 3ZYZA 3PC2A 1NI3A 5BRJA 1E4EA 4LRQA 4KXLA 3SSNA 1ZINA 4MVCA 1I3NA 1CC1S 2FAXA 2HQ1A 1KFCB 4QELA 5DW3A 1W87A 3RC1A 4OL9A 4DUPA 1QFXA 4LZLA 1CIJA 1CY4A 1D03A 3VH1A 2PY6A 5H70A 3U0VA 5E2AA 4MULA 4ZKEA 1VKHA 1NGSA 3P97A 2OBXA 3ABOB 3DTVB 4A1FA 5EY5B 3V6LA 3K1AB 4LDZA 4H0CA 1VYTA 5DP2A 5FAXA 4AQDA 5JI3E 3GRVA 1N77A 2PNFA 2ZI9A 3AHHA 4B9EA 4ER3A 3L7YA 2QZZA 4OQPA 4HQNA 1GG2A 1TEXA 1RZRD 3EW7A 2ZGVA 4JP3A 3CSSA 5AK4A 2NSDA 4H08A 3GDOA 3N5KA 3AY0A 4QVIA 1XTSA 2REOA 3EZ7A 4N3AA 4ON9A 3SJAA 1G2IA 3X2SA 4P36A 2Z9CA 3IHLA 3D1JA 5FUXA 4E5DA 4M0PA 2G5PA 2HSGA 2B21A 3H8VA 4D4GA 4BOYA 4HNUA 2CMDA 3Q7QA 5K0SA 2ARKA 3M34A 2EAUA 1EFRD 4KLZA 4IIJF 4QVGA 2OV1A 2YIVX 4HGPA 3MOSA 3TE6A 1SKMA 4G5OA 3RRZA 4EBFA 4OXNA 5KYNA 1G3IA 2Y05A 3HYRA 1FL9A 4MNTA 5JVDB 2V55B 4XJVA 1VOTA 2PKRA 2ZVDA 1L4HA 4G1VA 1YRWA 4R16A 2BN4A 1CJMA 1IY0A 1PUJA 3AIMA 3NT4A 4NJMA 4ZVUA 3WY9A 1HLPA 1D1QA 3KJNA 3M83A 4G01B 4QIHA 2C4HA 1ISIA 5DO9A 1SCNE 4LYGA 5L4SA 5F9HA 2E4UA 1R5JA 2IV3A 4BLOA 4FR2A 2CXUA 2IBSA 3O1IC 2J08A 5BV1A 3D3QA 1NP6A 4QNNA 5ADUS 2POCA 1SY7A 2JKZA 3JZIA 3UHPA 2ILVA 2QG9A 3MWGA 1SU4A 2EKZA 1CUDA 1RXCA 2ZUDA 5IN4A 1XFDA 2UVQA 3MOGA 3RS7A 3THRA 3UH1A 1CT9A 1QHIA 1PJSA 3QBEA 1TKCA 2JCGA 4TN1A 5FA8A 1HGXA 1LBQA 4ZYTA 1GZHB 3HVRA 2EZ9A 4ACBA 4DEVA 3N05A 4ZYWA 2BFDA 4ZU1X 2CFSA 2PEYA 4PO1A 4E51A 3LY8A 2HO4A 3DV0A 1E0DA 1U3WA 4DNQA 5BXYA 1JTFA 2I3AA 4MQEB 3IVGA 2JFNA 4ZAXA 4ZEXA 4GBJA 2PLWA 3H0EA 2WAXA 3IJEB 3OCCA 5AVJA 2ANBA 1Q19A 4OBWA 3AWDA 3T3MB 2A30A 4AW9A 1JTEA 3V7YA 3B6MA 3ON5A 3B1FA 3GP3A 1EFTA 1O08A 1C1YA 2DQ4A 3BICA 2B4YA 2VEDA 4O4IA 3I2IA 2FWMX 3JVUA 3UYKA 1JR6A 3PHCA 1XC7A 1DBQA 2HPVA 2PCJA 3PKZA 4GVPA 2V7EA 3OC0A 1D2MA 1L8XA 5A2QA 4MV8A 4AECA 4EY7A 2IYLD 1EP9A 4JUIA 2A5FA 2RG1A 2HJ9A 4LMBA 4BN5A 2XXBA 1QYVA 2XKJE 2C7GA 3DUFB 1LNZA 1MJGA 3LWBA 1UBNA 1T5HX 2VJMA 3PJGA 4FD3A 5FV4A 5AVXA 3X43A 2GR7A 5J5AA 3EXHA 3KE8A 1KH1A 3PC3A 3FUUA 3WYBA 3L6OO 4MLDA 4MIOA 2QT9A 1XMXA 3MUOA 4H7FA 4MWOA 5DK6A 1KERA 3OFKA 3SMQA 4IQ4A 2G25A 3PBKA 1EXDA 4UTZA 4JQSA 1N5OX 4M60A 5AM3A 2FHPA 3BL6A 2WJ3A 1CJSA 4ENSA 2PV0A 1A4RA 2JC3A 5EVCA 1MOZA 3OZRA 4X0EA 4CQMD 3LW7A 3WGTA 4UKDA 1FP1D 3OFND 4OUKX 3NHUA 4DEXA 1FSPA 5MHTA 4MW5A 2J9RA 3KYIB 3WFJA 2RBKA 1NSTA 1SZCA 1WZEA 1E99A 2LDBA 3EXIB 3FW1A 4W5WA 4WXHA 3GHYA 3ECCA 5E2IA 5LMUB 4IJKA 3DZCA 4KB5A 5DP1A 5JUWA 1S1MA 2OZKA 2WT8A 1JI3A 4KXFB 1J70A 5CLHA 1XU4A 3DAPA 3LBYA 4C0WA 2D2IA 2PUHA 2UVPB 4MQ5A 1A5TA 3JWHA 4RIFA 1XTZA 4IXTA 4OTZA 4E1VA 4OJYA 3BQMB 4UOQA 4XWGA 3NP7A 1V41E 2G8LA 4BMCA 1S6YA 4UEQA 3RUPA 3I73A 1ULUA 2OXEA 1JHYA 3GY0A 5TQ0A 3P0JA 4RDHA 2ATEA 2Q5LA 3MJTA 3VZRA 3EEIA 5LNK6 1R8SA 2P2CA 2PPVA 1CS0B 2BF4A 1K2VN 4G1EB 3RBZA 3T7IA 4AJHA 2HHLA 2XXAA 1RHUA 4KZKA 1MFPA 1YVDA 3L4BA 4GSLA 3RUFA 3W79A 2R6FA 3ZW8A 4C7OA 1J6UA 4PTLA 3EWSA 4AD8A 2VNIA 4G0YA 5BQOA 4G9EA 1P72A 4J43A 2IY8A 1Y6ZA 3C7AA 2QV0A 1TU0A 3EUFA 2NNWB 3ETHA 5F1OA 4C4RA 1GHTA 2ZAMA 3KQMA 5FNVA 5C7YA 1QZUA 1GUBA 2H1VA 1YAHA 4RTJA 3AONB 4PEVA 1XQYA 1RYEA 4RWZA 5EZ5A 1I6MA 5LQSA 3DZBA 3OQPA 4HDAA 5J4VA 3ICCA 4OLJA 2HRRA 4KRYA 3UWDA 2PKQP 3KOOA 3ZU6A 3OEHD 5EJ5A 2YIJA 3QVVA 3IQWA 4QUEA 1RAFA 5CM2Z 3WNBA 1ZD2P 3K9QO 5HRCA 4YNBA 1PWHA 5EE3A 3D3EA 1CZNA 1SUPA 3KJEA 3LHFA 3QFCA 4HXGA 4BCBA 5C3UA 3V4OA 5TLSA 2BEJA 2PFSA 1TJ5A 1X8KA 3F5FA 2C5AA 3PJDA 1RBYA 5AW9A 1V7CA 3CWZA 1XVAA 3TAUA 1OGYA 1Z4OA 3Q0IA 3Q87B 5H83A 3SOZA 3NI2A 3N7UA 3I5UA 5DYWA 4KWEA 4EHNA 2XT6A 5K5EA 1CY0A 1VMDA 5FPYA 4AZ3B 1LDEA 1V6CA 5F7OA 4RGVA 2RETA 2ZRIA 4LI0A 3DPSA 5BVGB 4XOUA 1X8LA 4M0DA 2OYCA 1N0VC 4LRWA 3B20A 2I4NA 1O6ZA 3LP5A 2VHCA 4PYNA 4D4JA 4QUKA 3GMIA 3DF7A 1KIFA 4OFXA 4PYMA 1SCUA 1JKJB 1KKMA 4P5PA 3HU5A 1Z28A 3P9PA 4CT0A 1OBOA 2M9MA 4M2LA 4IFBA 3W3ZB 1U31A 5A4JA 1LH0A 1VGRA 5AK6A 3ECAA 5DHFA 1TU3A 5CG2A 4U2KA 3BF8A 2XE7A 3ELBA 4F4HA 1BDMA 5C8VA 5DISB 1K1EA 5CFPA 4NZOA 4RSRA 1Z26A 3DA8A 2ZRMA 1LFDB 2FWIA 4C4AA 2PDAA 3L02A 3ML1A 4R7GA 1HEIA 1ORTA 2BFMA 2FPUA 1FDVA 3C8MA 4GO1A 3O6VA 4ZT3A 5A0FA 2BMJA 1VLVA 1H8EA 4LJ5A 3VSEA 4AULA 1J2YA 2KB0A 5EE1A 1Z5UA 3ZHXA 4FIZA 4DCNA 1WUYA 2FDXA 3EVGA 3EZLA 4RMJA 2WJHA 4O25A 3UKJA 3EX7C 5CLFA 4WUVA 3TRJA 4IIDA 5JBQA 2CUKA 1VGVA 1XRJA 1ENZA 4RTNA 5KJ6A 2QX4A 1HLDA 1Z5WA 4WKNA 1J90A 1WBDA 1LPNA 1N32B 3K0EA 4A10A 4J0KA 1QHFA 4HP8A 4JC8A 4N0DA 4YAUA 5LDHA 4XWWA 4MW2A 2QTVA 2XQFA 3C2QA 3FCSB 3WDSA 3B48A 1O5TA 3CH5A 2CL6X 3OUTA 4P4GA 3T3DA 2CNNA 4Z2AA 3COYA 1I2MA 2IEIA 1NTOA 2JGJA 4CKWA 2FMUA 3KOXA 1JHPA 3V8MA 3TOZA 1WVMA 4JI6B 5KOJB 2FGJA 4BFYA 2I87A 1U2RA 3U31A 2Y8EA 5KKCA 4C1BA 1WUHS 3MJCA 5GJWC 3D3WA 4G5SA 4ABYA 1EWKA 4IV8A 4JLWA 5K6AC 2BYTA 1XMQB 3IV6A 4CI9A 5LPNA 3W3AD 3NCTA 4IINA 2CFCA 2JGFA 3PUZA 4XDZA 3TX6A 3SX2A 3QOYA 3U44A 3LCCA 3P45A 4RVHA 1XVLA 3ZWDA 3I2FA 4N12A 2A84A 5KS2A 2I2XB 2SKDA 4L6CA 3AV0B 2AG6A 4WNCA 5E1BA 3HLYA 4RETA 3M82A 1HMYA 4P22A 1WR8A 2FPIA 4IFEA 5I5EA 3H04A 2OCGA 2RHBA 5AI9A 4ZGGA 5EHNA 2OYSA 2FFHA 3TW8A 3U7QB 1PT7A 2OZPA 2C3UA 1QCCA 2Q3JA 4MYRA 1GUDA 1WCWA 2CDNA 1UPXA 1JKXA 3CSDA 1GNLA 4GMDA 4H15A 4HDKB 2P7IA 2FR1A 3NJRA 3IOBA 1BQ4A 3MJFA 5C4MA 2OHOA 2VJOA 2EKBA 5BN4B 1U04A 4YC7A 4F72A 4EUFA 3SU8A 2YY7A 5T8KC 3Q15C 4KTVE 4NBSA 2ZXUA 2QX7A 5KQRA 2G0NA 3T7TA 5C8XA 4ZQIA 3TRHA 2IOYA 3KOYA 4L95C 1MAUA 2IGBA 1YHYA 4C5CA 4GPTA 4I55A 4QEKA 3WA6A 3WWYA 4EA9A 2DHEA 1SOVA 2V7QD 2IH2A 3AINA 2IKQA 1WMBA 4EYQA 3A6EA 1EGMB 1FVOA 4DJFC 2ZXEA 3GFBA 3PC7A 5SV2A 3ZCRA 4FCCA 1UC4B 3TQTA 4F04A 2GK6A 1EM6A 1QDLB 3D8NA 3KR2A 4G07A 1PJ8A 4J07A 4XB2A 3BXEA 5B3AA 4DC1A 2CUNA 4RFSB 1ZM9A 3ZBUA 3U61B 3GVPA 2W2VA 1V8BA 3F46A 2ZPUA 2C92A 2WUWE 4XLLA 4MICA 5E6RA 2PFGA 1EK6A 1B1AA 1RCUA 2B92A 3AEKB 3KL4A 4HGRA 5DE3A 5K0LA 3OLVA 4YT2A 1CQIB 5JYBA 1WY5A 2OG1A 1SVOA 4S04A 5AQEA 3ZU4A 3OI7A 3H9BA 2VF4X 4QM6A 2BDUA 2XNKA 3CWCA 4MS1B 4H6WA 3FTFA 1AV6A 5AKIA 1X9IA 2E6UX 5J23A 1U7DA 2EZTA 1G63A 2OHIA 1NXWA 5H9WA 4M7WA 2VG8A 1A9RA 1PZNA 1X39A 4Y6LA 1WPRA 1U2PA 2GO7A 1WXIA 2Z83A 1VIDA 5SZJA 1ZITA 4JYMA 1Q0QA 4PBRA 2J67A 1TVKB 3D7SA 3KJZA 3P20A 3ADKA 2O48X 1JEDA 2I54A 3VYVA 1KVRA 5HS4A 2P9HA 2VJNA 1Y80A 1RJGA 3HVJA 4MKZA 5BNIA 5EUQB 3VZSA 4A26A 2IV2X 2MSLA 2APJA 3SQNA 2ZDQA 3F98A 4DMUB 2NU7B 3BDVA 3T35A 1G59A 1XSEA 3ZKWB 3R09A 3VU9A 5EMKA 3UWOA 1V16A 3HNRA 2IXBA 3RFVA 3IDQA 1GVNB 1OREA 1B8OA 1HQYE 3FPLA 5BQ5A 2PZEA 3G8CA 1UBHS 4RTMA 2AN4A 3LY5A 4M0MA 1E1YA 1ISMA 2AFHE 3PEVA 4C06A 4XGQA 1X7XA 3PC4A 5FI5A 3SQXA 3HCWA 5FLKA 3VC7A 3KL2A 1AQJA 1YMQA 2ODNA 4Q6WA 3C0KA 1DTWB 3FLMA 4JA0A 4X9XA 4GBGA 3KWMA 2CJYA 2NW6A 3BFJA 3H87A 2ZSFA 3CFHL 2YFHA 5J1TB 3RG8A 1HL7A 3S5UA 3LLMA 5TC4A 2GZ3A 5ED4A 3ZU5A 1NW5A 3U56A 3CZQA 2CDBA 4KV7A 4OAQA 4CR7A 4ZT4A 1LI5A 3UMJA 4GUAA 1NQWA 2G4LA 1CDOA 3D31A 4Y2YA 5FCDA 5B3JA 4E2YA 1OB5A 4OXKA 1T5LA 2R6ZA 1ZUNB 2A1TS 3B51X 5E0OA 1OLXA 4HKTA 1KHTA 2GN8A 2QSUA 4HDSB 1AGNA 1SZDA 4RK4A 1JXQA 4QOGA 5AVUA 5IKOA 1GGKA 2VVTA 3L0DA 1DGQA 2SCUA 1ZDMA 3IPAA 5EA2A 5L3QA 3DKPA 4JHXA 3LBHA 5ALSA 3OQOA 5DVZA 1ORIA 1SUFA 1RJDA 3LX4A 4KRGA 4C4PA 1MH9A 2IEDA 2PQ2A 3FNEA 3X44A 3WK8A 2BSAA 4TVKA 3COWA 4BUZA 2XNJA 5JD4A 1G6KA 3QUCA 4L76A 3VDQA 2AFHA 1IE3A 2QAJA 3QY9A 1V6SA 4DCUA 2IDJA 1P4SA 2C4UA 2VRCA 3N8GA 2YRFA 3A9CA 3ZQ6A 3LUKA 4PYKA 4KVGA 1Z2NX 5KZMB 2BJWA 3PPYA 4PYQA 1N7GA 5DTIA 1RZVA 3G68A 3WDKA 3H4VA 5J1SB 1MP0A 1SUBA 1XNGA 3MTIA 4FOPA 3VMFA 1H3NA 3LKVA 5BYBA 5BSKA 4LF9B 2AW5A 4D1YA 1XEWY 1F2TA 4QGSA 2I2CA 4XQCA 2DY1A 1LD3A 4HFMA 1V25A 4F4DA 5HQTA 4EVSA 2WHXA 1AKNA 2BELA 2YHBA 4BQNA 2CSXA 3W8DA 1G5FA 3W2HA 2X9NA 3KLPX 2BBOA 4MEAA 4X62B 4P4TA 3J81k 5U4QA