3COVA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.5 ang resolution- apo form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
total genus 95
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3covA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3covA01
2CYCA 3IMEA 4MW7A 4ZT2A 1IHOA 5H7XA 2EJCA 4U7JA 1VLHA 4QRDA 3A05A 3AG5A 3IMGA 3AKZA 1JIIA 1NUTA 2BTEA 4MVWA 4WSOA 1SURA 3FY4A 2JA2A 2WQ6A 3SDBA 3LCJA 3X1MA 4X0EA 1ILEA 2A4MA 2J4DA 1JZQA 1YUMA 2G36A 3CLRC 4JXZA 1NI5A 1IH8A 3FETA 5FNZA 1IVSA 3CLSD 5LLTA 4MUHA 1H3NA 4R2LA 1WXEA 1KORA 2CSXA 1I2DA 1D2RA 3IODA 3IMCA 1KH2A 1MBZA 1NYLA 4XFJA 1FFYA 1COZA 3ND7A 2Z09A 4EFKA 1YULA 3RK0A 1T6YA 1N3LA 3OTWA 5FO0A 3VGJA 3ZXSA 1EFPB 4DE5A 1G8GA 2A1TS 3IOCA 1OWOA 4ZT4A 1B6TA 4CDMA 1O95C 1KH3A 1PFVA 2OV4A 2IP1A 4TS1A 3CVVA 1ZJWA 3FH0A 4JYZA 2Z08A 3HGMA 2AKEA 5J58A 4EG6A 2YXNA 2PZ8A 3NBAA 3L92A 4HK4A 3Q4GA 5IJXA 5KWVA 1PFUA 1ULHA 2B7LA 1I6LA 3COVA 2JAXA 1U3CA 2AZXA 3RBAA 4MWDA 3IOBA 3RJZA 2C5SA 4MULA 4MUIA 1Q11A 3NBKA 1H1TA 2I1LA 4L2IB 3G59A 4GRIA 5F23A 1K4MA 2A84A 3COYA 2QUJA 3MLBA 1WQ4A 2DR2A 5KHAA 1EUQA 4H3SA 1OBHA 4ZT3A 3ZIUA 4Q16A 4ARCA 3TS1A 2PZAA 3KFLA 4KR9A 4G5YA 2O8VA 3X1KA 4XFDA 3U1VA 1WY5A 5K0SA 2ZUEA 1GZUA 3ZJUA 1N2GA 1EE1A 3FG9A 1O95D 4JZYA 1QTQA 3CLUC 4OUDB 1KAMA 5HUJA 3QTBA 1WQ3A 3C8ZA 3CLUD 3HV0A 4MW2A 4NAHA 5AHWA 3DLAA 1WZ2A 3UY4A 4MW5A 4AQ7A 4CDNA 3CLSC 1PG0A 1V8FA 2J09A 2A86A 1TYCA 1QRTA 4CQNA 2GOYA 2DEUA 4MQ6A 1J1ZA 1JIJA 2WSIA 3PNYA 4R2MA 3RK1A 4A91A 2CYAA 1QRUA 3CLTC 2CT8A 1F4LA 2Z3VA 4EG5A 5HG0A 4R0NA 1WJGA 3P0IA 1N2OA 1QRSA 3E27A 1KP2A 1EFPA 1QJCA 2HZ7A 3COWA 3CLTD 3ILVA 4DJAA 1MB2A 2QTRA 4HJRA 2YWBA 3H99A 1T6XA 3SYTA 3INNA 1H3FA 1F9AA 1KR2A 2QUIA 4MWEA 2PFSA 3IVXA 2CV0A 1O0CA 1R6UA 4MLPA 4MUGA 4ND7A 4HPWA 1ZH0A 1GAXA 2X1MA 1OBCA 1O6BA 2X3FA 1DNPA 2QTMA 4OJMX 3MLAA 3HFJA 2A1TR 4ND6A 1M8PA 4I6GA 3KT0A 4EF6A 4ZCRA 5TS2A 2CV1A 1O0BA 1ZH6A 3OP1A 1ZUNA 5BNZA 4PBSA 3PRHA 1VBMA 2V0GA 2PG3A 5KCMA 4K0RA 1O5TA 3IDFA 3F3MA 2WQ7A 1IQRA 1IRXA 4QBTA 1K4KA 4Q93A 3A2KA 1KKUA 3HL4A 2A88A 3UOWA 1GN8A 2O5RA 4MW4A 3VU8A 4YP7A 1MC1A 5FO1A 3ZJVA 2A1UA 1G8FA 1WKBA 1IQUA 3FI0A 1R6XA 3FOCA 1S4MA 1G8HA 3PNBA 4L2IA 4CT0A 1CT9A 1M83A 1KAQA 5J5AA 5HUHA 1YUNA 4BWVA 2DLCX 4I6JA 2VTBA 3Q12A 1IFXA 2OQ2A 3X1JA 1WXGA 4RUKA 4YP6A 3DO8A 3RFFA 3VRHA 3ND5A 4U8HA 2DPLA 1O94D 1F7UA 5J59A 1U7XA 4UZFA 3TQOA 2NSYA 1N77A 3H9CA 1MJHA 2GM3A 3AIIA 2J07A 4EGAA 3IUBA 1XJQA 2DETA 1N2JA 3UK2A 4ZT6A 3ZGZA 4DLPA 2CFOA 1XNHA 4MVYA 4ZCPA 1JHDA 1NSYA 3ZJTA 3SEQA 3KT6A 4MUEA 4P2BA 2V0CA 1TEZA 1GLNA 1XNJA 5TGTA 1J20A 3G5AA 1H3EA 1MRZA 2E18A 3M5WA 4E1AA 1O96B 1TYDE 4EG7A 3P0HA 4PBTA 3ND6A 4KKVA 1JEDA 3SP1A 2D54A 4MUJA 1VBKA 4DNXA 3MUEA 1LW7A 3TQIA 4OUDA 3K32A 1V47A 4MVCA 2DXIA 1J70A 1O96A 4KR7A 1TFUA 3CVUA 1NZJA 3ISJA 4MWBA 1IQ0A 3D6UA 4GU5A 4DDHA 3FWKA 1M8FA 3FNRA 1PFYA 4U63A 3FDXA 3HZRA 1QU3A 1UFVA 1N78A 1LI7A 2CYBA 1WOYA 1WXHA 5IHXA 2NZ2A 1PFWA 1M8GA 1O97D 2QJTA 4PY2A 1X6VA 2R5WA 3CVWA 1M8KA 1JZSA 1MAUA 3MXTA 4MW6A 2XRZA 1U7DA 2ZUFA 3G6KA 2CV2A 1GPMA 1G59A 4FZJA 1VBNA 3AG6A 3DPIA 4KPUA 4J75A 1OWMA 4WNYA 2WB2A 3LOQA 3S3TA 1JIKA 1FYDA 1NUUA 1Q19A 1OWPA 1T6ZA 2VTBB 2J08A 1O94C 3P52A 2PXHA 4MW0A 1TYAE 4MUFA 1TYBE 3SEZA 3DV2A 4MUKA 3N8HA 4EG1A 2H29A 1NUPA 2D5BA 1EFVB 3QE4A 1WXFA 2TS1A 3PXUA 2RD2A 1NURA 1N2EA 4AS1A 2DUMA 4MW1A 1N1DA 4ZCQA 1Q15A 4I6EA 1JGTA 3PNVA 2A7XA 2JANA 2AG6A 3GUZA 1EJ2A 4NX2A 3IUEA 3A04A 1O97C 1I6MA 5TEVA 4G5FA 2QTNA 1VL2A 3IVCA 4JFAA 3TNJA 2X1LA 3GLVA 3IH5A 4ARIA 1QU2A 3HMQA 3CLRD 1MAWA 4NDAA 2E0IA 1BS2A 1JILA 3I05A 3IVGA 1LI5A 1KQNA 4ZCSA 2PIDA 1N2BA 4YP5A 1MOPA 3QTTA 1I6KA 1NP7A 1Q77A 3CVXA 4ZT7A 5DK4A 3TZLA 2EL7A 4RPIA 1K97A 4ZCTA 2GKSA 4KR6A 2PZBA 3SZ3A 5LFAA 3ZUGA 3BL5A 3KT8A 4ZT5A 4MW9A 1K92A 4JXXA 2QUHA 1JMVA 1JECA 5K0TA 2YY5A 1N2IA 1YIDA 5EKDA 4DDMA 1EXDA 3ELBA 1J21A 1TQ8A 1PG2A 2QJOA 4K03A 3H9BA 2E89A 1QNFA 3LE8A 5TEWA 1QQTA 2D13A 5DASA 1OWNA 1EFVA 5DB4A 4DDKA 1WXIA 1RQGA 2HMAA 3SZGA 3CVYA 4QREA 1KP3A 4YBRA 5JBNA 3H97A 4HJXA 3N05A 3AL0C 3JXEA 2HGZA 1NUSA 4F3RA 4MAFA 1GTSA 4F4HA 3TZEA 1X8XA 3K9WA 2CUZA 4J76A 4UZEA 1MB9A 3NV7A 5LM3A 3CR8A 1N75A 2DERA 4KPUB 4XSVA 2ZP1A 2QJFA 1GTRA 4MVXA 4NZPA 1R6TA 3IOEA 4S1OA 4EG4A 1J1UA 1J09A 3H05A 3L93A 4MUNA 1XNGA 4NATA 1U0BB 1OWLA 2A1UB 3CA8A 1A8HA 1KH1A 3FHJA 2QUKA 3N2YA 1U3DA 3COZA 4NAUA 3P0JA 2RE8A 1Y42X 2VXOA 1YIAA 2BYTA 1P7PA 3Q10A 4EG8A 1OD6A 1KQOA 4EG3A 1YI8A 2IELA 2E21A 3A4IA 1T9GS 1F7VA 5DEOA 4YMIA 2J5BA 3KT3A 1T9GR 2H2AA 2IJGX 2YWCA 3MMXA 3N9IA 3D6VA 2X0KA 1M8JA 4MWCA 1N2HA 1JEEA 3RHSA 1HYBA 3FIUA 5H16A 4PBRA 1EUYA 1NUQA 3AFHA 3GMIA 1M1ZA 4G6ZA 3ZXIA 3UMVA 2XRYA 3UC5A 1KQPA
chains in the Genus database with same CATH superfamily
1UDXA 4D0SA 2L69A 4B34A 4HEJA 1NASA 1WMAA 1JR3A 1Z3CA 1ULZA 4OA8A 4DYDA 3GGDA 2NO4A 2KMLA 3FCYA 2AF4C 1E5XA 3KJFA 2E4YA 1JIIA 1NUTA 1G17A 1TA0A 2ZSAA 3M6AA 5ALOA 2KJQA 1ZRMA 1Z0AA 3BXPA 3EWIA 3QJGA 5LR6A 1H1LB 4BN5A 4R1MA 2QZ9A 4AYTA 2VDMB 4HL6A 3D3WB 5JJLA 1GTVA 1SHJA 2DQKA 4QTZA 5CVUA 3S1AA 3AWDA 1BGVA 3W2EA 3L8FA 4EG0A 3QVGA 1SKAA 2BR4A 3B9RA 4FZ5A 3EEOA 1FZTA 4DUGA 2QRVB 1HY3A 3G5MA 3IXLA 4J0EA 5FQOA 5CB0A 5KBYA 1NQTA 3KJEA 1JU4A 1UPXA 3OT5A 2FZKA 5BSEA 3T3OA 2GILA 4UNNA 4LZJA 4QU5A 3TUJC 1JPJA 2ZIFA 4AT1A 5JTUA 2IHNA 2EGUA 5EIBD 3WLJA 4AWBA 4TYPA 4B4KA 2F6RA 4ZO9A 5CCEA 3KSMA 3NIFB 1ZC3A 3QFTA 2JGKA 4NC9A 1VDZA 3QMMA 5CK5A 3FIJA 4U3JB 2Q21A 1M2GA 2VNJA 3HKBA 3WSTA 3BDVA 4DM3A 2NU8B 1I01A 1NXXA 1NXVA 1N4DA 4UCXA 1HETA 4QM7A 1AMNA 1QFZA 3P4UA 4DE5A 2X4IA 3IESA 2DSNA 3G9TA 3L49A 5TDHA 3WFJA 4FYYA 3CRMA 5A6SA 5FX2A 2EFCB 2I6FA 3OX2A 5K9ZA 1PF7E 5KNLA 1TT5A 5AW5A 1M6VA 1YK0A 2AXNA 4DQXA 4ESOA 2LIVA 4JKYA 3RSHA 2LV8A 2WJ6A 1FJXA 2OXCA 3EQ9A 3NVAA 4TT8A 2D3TA 5FA5A 3WJ7A 2BMAA 2PZ8A 3UWPA 3O38A 3ZS8A 3A3YA 4JJAA 1XMIA 1P0MA 2QP9X 3DT6A 4EHLA 2PU5A 4H1TA 2YINC 2WINI 3COVA 4R1OA 4S24A 3EA5A 3IKLA 4XSHA 4UMFA 3SKYA 4F4JA 4YI5A 4ENSA 2A0XA 1CVIA 1RCTE 1O5IA 3ZV7A 4PX5A 1S7GA 1FUIA 4IIDA 4OH1A 5AQ1A 2WFLA 2XXJA 1J90A 2FUEA 1QFMA 3CPJB 5CNKA 3TK1A 4XUCA 1ISSA 2FMXA 2Q3LA 5CURA 1XE3A 4F11A 1LW6E 2O1SA 5EGNA 4RIFA 2NSLA 2HQ1A 1OBHA 3C3BA 2X5KO 2Y1OA 3RV3A 2ZDHA 3H84A 5I9BA 2BFCA 4DKXA 3RYCA 2MMCA 4HDMB 1W1WA 5B5SA 4A1OA 3TXXA 3RF6A 5JY6A 2HU7A 2CNKA 2IZ5A 1SA0B 5EWJA 2X42A 3RUIA 3NBUA 2ZUEA 2F55A 4DMUB 1P91A 4V1CA 3KVVA 1BYUA 3CLUC 1S7CA 1RM4A 2HMYB 3O75A 4WBSA 3C1OA 3IQEA 1T9ZA 2C1ZA 3G79A 1FYWA 3H4TA 4QEZA 3QTBA 2HK6A 1FL9A 1KHHA 3CVOA 5LYJA 2IUUA 4KDEA 1WZ2A 2IU0A 2DCMA 2L18A 1Z5VA 2LDBA 2ZLBA 5B3AA 2WUGA 3CJRA 2GM5A 3D8UA 4RF2A 1EFDN 1JAZA 2FYTA 3DGFC 3M6WA 1JG3A 1SRQA 1T8RA 1US8B 2DQ4A 3JVIA 4D42A 2A86A 1CJCA 2GBPA 4Z4HA 3GGGA 4PC3A 3O3MB 1NN3A 3EUAA 4HFJA 3AY7A 1N2ZA 2AZMA 2HEGA 4Y67A 1OIVA 1Q0SA 1TCAA 1XRMA 1GPDG 1NV9A 2X8WA 3L7CA 3O1IC 5DU2A 2OPHA 3RK1A 2HHAA 8GPBA 1F4LA 2VK1A 2WILA 2WUVA 4JKIA 3KKNA 4B6EA 4XTRA 1YAHA 3K9QO 4AZ3A 2WHPA 5IC5A 2CLMB 4DLNA 4G56A 3T5MA 5J43A 5IKOA 4HWKA 2MSNA 5CW1A 1KP9A 1EAMA 4DCOA 4H1VA 3C3CA 2I8CA 3HR7A 4ZC1A 3TBHA 1C9YA 5JT1A 1T9DA 2WRZA 3IBFA 4DCPA 4FIZA 3ME5A 1T2AA 5IJ0A 1B0PA 2NUPB 4Q3OA 4QTYA 3TG8A 1AQUA 2X7HA 3TAHA 1WMBA 3IP7A 4X5OA 4CPDA 2Y1XA 3E22A 3ZNPA 1GRQA 1WD5A 3G8AA 4BV9A 1TZJA 2X1MA 5HJ5A 2QTMA 2JZOA 3FNFA 4QXRA 1U28A 5HF8A 4G26A 5LSAA 2PEZA 3OZRA 3LUCA 2XZLA 4ND5A 2VJYA 2OXEA 4DR5B 2GJ8A 3OEHD 1ZCBA 4YJDA 5EC8A 1M8PA 1U2GC 4BO6A 1W4LA 2Z1MA 4BIIA 4CIAA 3C7AA 1RBQA 2OXIA 2HDWA 3PRHA 5REQA 1ELOA 1HE4A 2XBLA 2PL9A 1JH8A 4CLDA 1KIAA 3DONA 5DWQA 4H3KB 3KUXA 5I7VA 1DAFA 1XKTA 4C4PA 3WWPA 4E3ZA 2O07A 2VDLB 4YIKA 1O5TA 4N0QA 5F64A 3C3XA 3CWQA 3WZMA 1A76A 4YWJA 3IAM6 1LK5A 2NVOA 2A5DA 4A2CA 3ORSA 2NOAA 4ZK2A 2YYYA 1G8JA 2FG5A 4ABYA 5L7YA 1I7QB 4Y2HA 1TAQA 3HL4A 3JVDA 1WZNA 2YXLA 3MWDA 3NJ4A 1O77A 2Y1DA 2WICA 3FWNA 3QENA 1M6VB 3GFSA 2X3YA 4H6PA 4YO8A 4F5DA 5CEFA 2C61A 2IUTA 1PZEA 2PJRA 2A1UA 2O57A 2QTAA 3TLZA 2PNJA 1EX6A 5BV0A 1Z08A 5TPWA 2DT5A 3C97A 1FJHA 2CVZA 2QSZA 2B30A 1K7XB 3AERB 4EAQA 4L57A 3MCAA 3H9GA 1YUNA 4UVEA 3LT4A 5KDOA 4JP8A 5AM0A 5FUYA 4ZMBA 4CXMA 2P6RA 3STYA 3AJAA 1S4QA 3LCCA 4FHFA 1Y98A 5DSXA 3VOBA 5E38A 3RIMA 1ZUIA 5GVRA 1JF8A 4KACA 1U2GA 4GKJB 2ZSUA 2VDOB 5D5HA 2GN1A 1HFKA 3N7TA 4TVBA 3W8FA 4DJTA 4EPYA 4PSAA 4DKJA 1E0DA 1ZS9A 2HDHA 4D4HA 5B3KA 1MPTA 1OF1A 2LWIA 2YL2A 4NCBA 2XF2A 3ZN2A 2C4TA 5CM2Z 2EFJA 2IKQA 4MVJE 3SFZA 4BC0A 4RJTA 2A0KA 2EKPA 3K53A 3KD3A 3MGKA 2MU1A 5ITVA 2HSEA 4HZIA 4NXNB 3HJAA 3PEVA 4PIMA 4D45A 1Y9EA 4RJLA 3T7KA 1DEXA 1WDWB 2FWAA 4BNKA 3B3QA 4U2EA 2CGEA 1XZBA 4PGGA 4K6FA 3I37X 5IYZF 4PC1A 4YONB 1I1QB 1PW5A 1FLVA 3KKEA 4OXYA 1KFJB 2NQ8A 5PGMA 3SHOA 2OAGA 3WHKA 4QUIA 2ONCA 4B45A 2G1AA 3MNFA 3ID6C 4RKRA 3SHTA 2EX0A 5LQJA 1LFDB 4EHFA 1UJ5A 3GP3A 4BNTA 4Z3KA 1GPKA 2FN7A 3AU9A 2IKSA 1DO0A 3IVRA 4UDXX 4AJNA 2OO5A 4QA9A 2YR0A 1C0LA 4M86A 4MPRA 2AMJA 3SQMA 2M1XA 2MOKA 3OZWA 4CTOA 5CD9A 1CUAA 1U0RA 2C3MA 3WGIA 3O73A 5EE9A 2HF2A 2W11A 2Z6QA 2GHTA 2EWVA 4R2KA 3KTAA 3COJA 4NV1A 2Q2WA 3R41A 1VPLA 4K9RA 3PNQA 1P2VA 2V7PA 4D8TA 3AO0B 1YCHA 4HQKA 3S1LA 4IOLA 3B5EA 2GMWA 4D9MA 2XUPA 4GYKA 5AW4A 1U1CA 4XEUA 3KQQA 2X4LA 1KEPA 2PT6A 3VXKA 4KPFC 3UICA 5K0FA 3WLRA 1M6EX 1LNQA 1XLUA 5KYYB 2XTZA 4JJ8A 1M2WA 3GLQA 1PFYA 3E7PA 4U63A 3GK3A 5IFLA 3F9CA 4CT4B 3DHWC 3ZJ4A 1Y1PA 2IOQA 1ACLA 4MKXA 3VBCA 2A3RA 3RYTC 4H60A 1SKYB 5JFOA 4HOYA 2B4RO 1SVWA 1ZM3A 3NBQA 4LOAA 3GLRA 5AKIA 1ZD3A 1M8GA 3DE7X 4PLHA 3REGA 5IKMA 3WB9A 2AFHE 4FHDA 1Q1ZA 1Y9ZA 3A70A 3QMVA 1MAUA 4AU1A 3KJGA 5JQWA 1SGWA 3KEFA 4QOGA 2RHLA 1RXSA 4PPYA 5CT9A 5GJCA 3M4NA 2PYDA 3TRJA 4KO1S 4Q1CA 3IQXA 2ZSHA 5IT0A 4I5EA 3BAFA 3B6MA 1EVJA 2O3JA 3WRVA 2JHFA 3ZQJA 1EFUA 2YIDA 4I4NA 4J75A 1DPGA 1Y8AA 3PV0A 4TMWA 1QUFA 2PKYX 1JDZA 3LOQA 3PNMA 1XZAA 3L0CA 4L50A 3VZRA 4BZWA 1BCRB 4CCSA 3HY6A 1Q19A 3OBBA 1S3IA 1FMLA 2J08A 1O94C 1OYWA 2B7BA 4GVLA 5K6AA 2VZEA 1UXGA 2QY9A 1W0JD 2H85A 4LI0A 3DV2A 3OJLA 2A59A 2PSDA 2NUAB 2H1HA 4S3MA 2P2DA 1UPBA 2I87A 5JSZB 2C77A 3CB4A 5H1YA 3VR4D 5AKZA 3O92A 5ALFA 4TV8F 2G9VA 1P0CA 2JGIA 3QJYA 4K9SA 3UKOA 4DFDA 5JBIA 3O03A 4CLHA 4E46A 3LMKA 1Z62A 2ADOA 3S81A 3ZX4A 2YICA 1UZNA 1BTOA 1KK3A 4MW1A 3IQIX 2OQRA 3QVXA 1F3OA 1I9GA 1RE1A 3E4CA 2D2IA 3HXLA 2UVPA 4GD3Q 3G8CA 1IOVA 5EZ5A 3OQ6A 4FDLA 1NI4A 2H2GA 2W7TA 1N6RA 3FKSD 1F2UA 1I6MA 1ZMRA 5ADWA 1NGSA 4QHSA 5AKJA 1YXMA 1WD7A 3VAYA 1CLEA 4QT0A 5FQNA 1PSDA 2FFQA 3DJYA 1XWWA 1ZVKA 4QTUB 3THYB 2OZPA 2X1LA 5KNBD 2ZRDA 1TQHA 4LE0A 1UK6A 1SPXA 5HM8A 5DHRA 5DNUA 1ZL2A 3L1KA 1TZBA 2V8BA 1EMDA 4JASB 1WTCA 1SC4A 4FOTA 4LDRA 2EBFX 1P9LA 3KLNA 4G81A 3UWOA 1WETA 2W2KA 3UQZA 1NQUA 1BG6A 1MG0A 1VPDA 2RH4A 3OEEA 4CKCA 3A9VA 2PX0A 1XFDA 2H4XA 4Q66C 3FOAA 4P81A 1HTWA 4WKGA 1YB7A 3P2MA 3VNSA 1D04A 3UMMA 2EKQA 2IV7A 2G09A 2VCHA 4CEJB 3HVJA 3OG9A 4KR6A 1G20B 4LDQA 4CL8A 1YR8A 5FNVF 2YDYA 4RK6A 4YJHB 4Y0AA 5IF3A 4JVMA 2WJPA 5D51S 2HWUA 1U7UA 3QW2A 4XD7D 1JECA 1SJ9A 2ZIUB 2YY5A 5DXJA 2IQIA 1N2SA 3L7OA 4FUTA 3L8HA 5JNWA 2H2WA 4M8LA 3ROFA 4HMOA 1YQGA 3TLEA 2QXTA 5A4MS 2CMHA 5CFLA 3R0JA 2BMWA 1DWQA 4RA6B 4XDZA 5LUBA 4ASUA 5A02A 1A5TA 3T38A 3U4GA 2A9QA 2Z5LA 1XZKA 4JX8A 4BHTA 4GRAA 1AKWA 2BFWA 2PRKA 1ZU4A 4JIMA 3TCNA 1DEKA 4IMIB 3KTAB 4YRNA 3IMFA 4UUQA 1VLLA 1JVSA 2A57A 4GLJA 2NZVG 2EU8A 2PAFA 2ZANA 4RWEA 1DLJA 1C9EA 4MI1A 2GR8A 2JD0A 4FX2A 3BJIC 3WLQA 4JL6A 1CP3A 1E2NA 2IY7A 2YIJA 4H4DA 5SYNA 2FJPA 1NUSA 4PQYA 1N9GB 2OXFA 3C3EA 2HHHB 5KYUB 1A69A 4N18A 3OURA 1P4AA 4M0UA 3UG6A 3VOTA 4MNTA 3FTQA 5HR5A 3TWOA 1QE5A 4E2WA 2FPIA 1UKZA 4UPEA 3T7AA 3D8TA 3OJ0A 1UP7A 3HU1A 3MT8A 3ZNNA 3VNQA 3OLCX 1H8HA 4WACA 4H7KA 3HP7A 2GAAA 1E1CA 4I8DA 1LK7A 4PPNA 4GH5A 3DWIA 2AQIA 2B8NA 3EXHA 2HSZA 3LPDA 2YHUA 3DBRA 4A8PA 3T1TA 2SKEA 1UAYA 3PJFA 3VHXB 5L6MB 3NM4A 2CXRA 1WCV1 2AC7A 4CM4A 4Q39A 1BEUB 3G0OA 3M1AA 4W8GA 2IZ1A 4AZ0B 3QBTA 5A1TA 1J2JA 5AKEA 621PA 2Q4RA 2BBSA 1JI0A 3M6LA 4ZI7B 1UADA 4EG8A 5DLYA 2CZQA 2PMEA 3AUTA 8ABPA 3RC3A 3V7NA 3L1VA 2J6CA 2JW5A 4EUSA 2ZK7A 4KJXA 3O8LA 4DMMA 1E3MA 2C1XA 2NXEA 3D4LA 1N0UA 2ZVDA 1UQTA 4WJLA 1CJMA 5MFPA 3MAGA 4XVRA 1G20A 4J8PA 4AF8A 5B2FA 3VMFA 4MWCA 3QA9A 1WMEA 1Z7GA 3TN7A 1OY1A 3KFVA 3H5AA 4NS1A 2PLRA 3BREA 3ANLA 4Y18A 1JBKA 1PG5A 4BQNA 1HT2E 4R0VA 2B8EA 3DT8A 4OB6A 3CLHA 5WRFA 1ENYA 2C7VA 2Q5OA 4FW9A 4EKDA 5IPFA 4KWTA 4YA6A 2QHXA 1AHHA 2Q6IA 3FNQA 1I3CA 1T36B 2J67A 4FSXA 1QK5A 2FAXA 4ZAXA 3IDOA 3X1WA 3KSUA 2JLUA 2I9KA 1TU3A 2ZWIA 1LC0A 1J0AA 1P7ZA 1THGA 4MV0A 1CZKA 4GFDA 5IM5A 3OQPA 4AKTA 3PUJA 4MCJA 4CODB 4JUBA 1CJBA 5U1PA 1STOA 1K66A 3VAAA 3AKDA 4QYXA 3HCOA 4BNUA 2WU3A 3P2IA 4S2UA 5GADl 3BE6A 3M4YA 1PEKE 1DFGA 4R5HA 4OG2A 4M87A 5CJ2A 1RFGE 1YVDA 5FNZA 1PSWA 5JCOA 3CLSD 4D9JA 2D6FA 4LTNA 4TLEA 1GPUA 1JDBC 2OP0A 5JXWA 1SG6A 1URPA 3ZU2A 4WADA 2CSXA 1XXLA 4HRAA 1D2RA 2QL6A 1SG9A 3GRYA 3O1JC 1JV2B 4V1CI 4F6LA 3CYFA 2QGNA 5CX1B 1FFAA 2QX4A 2LTAA 4K9DA 1BW9B 3ZLUA 3R8CA 1MV5A 1QDUA 4OY3A 4C4RA 4M1WA 4JGBA 2WU1A 3PEYA 1WXWA 1QP0A 1VSTA 3SCZA 3GRFA 3MWFA 1ZDMA 4UMEA 5DBEX 3BM5A 2GVZC 1NN5A 3OUTA 1B2RA 1WMFA 4OBBA 2H1IA 3L77A 2B94A 2YNMC 3ETCA 1OWOA 1AO0A 3OCVA 4OGKA 3ZYCA 1XD2B 4CDMA 2I4NA 3EDRA 3BJEA 2LW7A 4K9OA 4CF5A 5FADA 3KPUA 2IE8A 1K0UA 3MXOA 4JS0A 2NO5A 4XDGA 3FMFA 4QQRA 1A8QA 1DUSA 3E5HA 5GVSA 5F3WB 1G9TA 3IIMA 2FWPA 2JF0A 3IEXA 5FYDA 3OWXA 4PZZA 3S28A 1UPUA 2O8DB 1FVHA 4FOOA 3BFVA 1I6LA 3WKDA 3HP4A 4B4DA 1EUDA 2ZSFA 2WVHA 4MWDA 5B3LA 4BO8A 2PSJA 3OA2A 2ZM5A 3NBKA 4JSRA 3PT5A 2FSFA 1H6BA 3KKOA 4J16A 4LV8B 2B6HA 2ZKIA 1ESCA 2GAOA 5G1PA 1C9DB 2GWHA 5TF4A 5LMUB 2OE2A 2XD4A 4Q00A 1UFOA 4Z0HO 1UFRA 3TOVA 4HNUA 3BFPA 5LKAA 2PJZA 1FFEA 1A7KA 4YT4A 4EUFA 3NEAA 2WAMA 4RIEA 4U6QA 2YNMA 4LC9A 2XE6A 4UJ3A 4BMZA 1T2VA 1FDRA 3BZUA 4NDZA 2GX6A 4JZYA 2ZRBA 4Y0NA 4Y2TA 1KOLA 1DBRA 4GNRA 4YQZA 1PJBA 3TXAA 1AA6A 2IX9A 2AN4A 1YR3A 1WQ3A 4NBNA 3Q7EA 4B80A 4NAHA 4YFYA 3NZEA 4FQ5A 4QO8A 2Q4TA 1A7AA 4ZVPA 1JKXA 5EZYB 1IBCA 3WZ2A 5KNDD 5JW6A 1SOWA 3G7UA 2JCBA 3CX8A 5AT1A 4DIDA 1A27A 1CY6A 1QR6A 5A5DA 1W5TA 2O0JA 2OVBA 1RACA 2CE7A 1OFVA 1TYEB 2C57A 3D81A 3F78A 4Q37A 4ZEMA 3DE0X 4DXAA 5AD1A 1RHQA 2ETXA 4GKBA 4H77A 1JPNA 4LC0A 3H2YA 4N01A 1V3QE 4YP0A 2DULA 4E30A 5C1OA 1MA3A 4YPOA 3QX3A 3JQAA 3VTFA 2H1VA 4I9GA 4JB0A 4D3XA 2VJMB 5JS7A 4M3NA 2AE1A 4OYLA 4R0NA 3HRHA 1QIKA 2D0OB 1TM2A 2R25B 4Y2RA 1QYWA 1L4GA 1ADJA 4Q9AA 1A5BB 2JIDA 2OCIA 3TDNA 5IBQA 4MI9A 1SRRA 1G5FA 4UHCA 3EHEA 2QMOA 1EUCA 1UBRS 4HJRA 1GFWA 2M9MA 3FDFA 3QWIA 5ALEA 2NU8A 1NIPA 4D02A 5BQ3A 5LQNA 4LFCB 1PR3A 1R12A 3JWGA 4KOEC 3CG0A 1HDIA 1X7ZA 3V7UA 3KSAC 1EGVB 5JNSA 4XX0A 1AUXA 1R8QA 1X94A 1E6WA 2X6QA 5L3SB 3ORHA 1CZNA 1X7WB 5FPYA 1Q20A 4M6WA 4O5OA 4U2GA 5LQSA 2P6OA 4O08A 2QU8A 2QTZA 2JK1A 4N5NA 3R24A 1TW3A 4NJEB 5H81A 3I5UA 2DTXA 3PC7A 1IM2A 3GP5A 2IIVA 2GHRA 3TYXA 3PX3A 2GLTA 2ZT5A 4E3WA 3EOBI 4Q3EA 4KHPB 1F8GA 1N8KA 2QG6A 1VBMA 1QP8A 1MIHA 1LLCA 1E0KA 2YVUA 5ALTA 3LDAA 3Q9UA 5DDIP 5KI6A 3UFXA 3FRHA 5A4FS 3TVTA 4FLMA 3LQ2A 4QFCA 4I1UA 1L7PA 3N0VA 3R9XB 2X0NA 2VDRB 5C7OO 1L7RA 1GZ4A 4KZPA 3ED5A 5B53A 4Z3DA 3O82A 3FFTA 3MEQA 3CH5A 1A82A 2G06A 1B14A 2OY0A 4X84A 4AJ1A 4PQGA 3UOWA 4KITB 1SKUA 3JQBC 3CMMA 5CIQA 3C4JA 2CLIB 3TL3A 5GZ1A 5LVAA 2JB9A 2FEKA 4YT5A 2E4XA 1KOGA 1YBVA 2CNNA 3A37A 5E6RA 1E9DA 4TQAA 1M83A 4R1PA 1FU7A 5I6DA 4N3AA 2C78A 3WA7A 4NCAA 1LSUA 2W6CX 3G6WA 2D1QA 3AONB 1A1SA 1IFXA 3L7BA 3SMVA 2BZGA 1DKMA 3HYSA 3KYDB 3OZ7A 1EK1A 3NOVA 4ENWA 4PPGA 3SBDA 4U8HA 1YMUA 2GSDA 2X7XA 3FGZA 3AHGA 1UMBA 4LCJA 4LS3A 2O2YA 4C5CA 1F7UA 1X7HA 3I6BA 5KC8A 4Y0VA 1J8QA 4CIXA 4TKZA 1A96A 1WDLA 3GJYA 3WOVA 4IPTA 1L7QA 2E87A 3ZKWB 4DA4A 1Z5WA 2NM0A 2QENA 1MCZA 1O2DA 3GEDA 4LXUA 4PNZA 4TQ9A 1N9ZA 1QDEA 1RSZA 3JWEA 4YJ3B 5HTOA 3TF5A 4M38A 3BD8A 1MT3A 1U0HC 1LBTA 1XN4A 1H8HD 2EL9A 2QROA 3WR5A 4ZMSA 2FZWA 3DLPX 4RNDB 1AHPA 4Z49A 2HM7A 1ZD4A 1ARZA 2OENG 4OHZA 7REQB 2OD2A 1DIOB 1NA5A 4Y9TA 3BXEA 3FOBA 4LZAA 4XGKA 3N28A 5JROA 2FPPA 5AUQA 3W9UA 3R3ZA 1SKYE 4PC7A 3LY8A 4DB4A 1FVXA 4IV8A 2YBEA 5C9ZA 4MH0R 3DFZA 5M5BA 3DD1A 4RKWA 1XNRB 4V39A 3SYRA 3DP9A 2XDAA 2VL7A 3C3YA 4GBGA 5LU8A 3CVJA 1IEWA 1JLMA 1SPBS 1IJBA 3WKCA 3NRBA 4PBTA 4QXMA 3ZOKA 2ZB2A 3VVLA 1UDAA 2EFHB 3OPQA 1F06A 4ZAFA 3RK4A 4EM6A 4BVAA 4XXHA 2QG9A 5HJ2A 2W90A 4UE2A 5EE3A 3MUEA 4YCDA 5FOSA 3OIDA 4RPHA 3OCWA 1M0TA 3D31A 3WNZA 1L1QA 3C74A 2GZ1A 3MB5A 2PL5A 1AG9A 4NWIA 5EZYF 5J47A 1HUQA 3J81A 1OA1A 3IAXA 1P1FA 4IVRA 3JD1A 2HPHA 3D8HA 2WWFA 5E0KB 2IGTA 3FWKA 5EMJA 2JGLA 2G28A 2A14A 4FKBA 3EVTA 3E84A 4MQ5A 1R4MA 4H0NA 4ZZ2A 1MX9A 5BVHA 2C42A 1A5SB 1IUKA 1UFVA 2AFRA 3LXRA 1UBMS 4JB3A 1QGUA 1L5HB 2QD3A 3IHWA 4MJLA 4ME6A 4TVOA 2ZVJA 4YCAA 1NPYA 3RF7A 3U80A 1F5NA 1MU0A 3QUTA 2PS3A 4KQ9A 4E51A 1RHUA 5KYKA 3GOQA 3U4HA 2BGTA 1VPWA 1IIBA 4ND3A 4R5MA 4PYIA 1YNOA 2EZTA 3GJTA 3UA3A 2FPWA 5IT5A 1YRAA 5KTYA 4MV4A 5JI3E 3IVMA 3EJWA 2C95A 3HTXA 1E2IA 1W7AA 1LPPA 3K73O 4H0CA 1B16A 1G6Q1 3DDSA 4RZIA 3ZQKA 1FP4B 1P1IA 1KFEB 1CV2A 3ZWWA 1THMA 3NDRA 3ORQA 4PZDA 3UEOA 5M7EA 1OWMA 1VE1A 4B3BA 3O1HB 3PSAA 1OE0A 1FYDA 1NUUA 1NYRA 1RNLA 3MTJA 4EB8A 3RJ5A 5AVXA 2OAQ1 1QUEA 2CHGA 5KX5A 5L3QB 3ZCVA 1B4DA 1TYBE 3UJNA 4PU0A 3AF6A 1MDFA 3OTOB 1W88B 3FGOA 2WM9B 4OMFG 3UWMA 2BDEA 1FXWA 1UZLA 1EXVA 1T5HX 2X14A 2Y99A 4QM6A 1ZGJA 3HUDA 2NAPA 4ENPA 4QXPA 3G68A 4ZOBA 3C5HA 1A9YA 2JGMA 2P9QA 3FTFA 4F1WA 1RTTA 2X0IA 3AR4A 1NTOA 4OHBA 2GYVA 4IO0A 2F1OA 4XQ9A 2XA1A 3AOEC 4QUJA 4BNDB 4ZOAA 3KPVA 4TMYA 1RWMA 1GUBA 3OI7A 4JC0A 3K5HA 2BMVA 4KXMA 1LBQA 1ZO8A 1UKVY 4GMXA 1ZXLA 3QKUA 3WHIA 4RTMA 4Q7JB 2YV5A 3JSAA 5JO0A 2IHTA 1MX1A 3W1VA 1JT9A 4LWZA 1SVIA 1HLDA 4OP1A 1FLNA 3AEQA 1ZJ4A 4D99A 4BLOA 1QP7A 1DL5A 2UZ4A 1Y6JA 3JCZA 1BXKA 2P5YA 1AA9A 1W5FA 1VPEA 3PI7A 2AG1A 2Y8EA 1CYDA 1POXA 3CLVA 4UUPA 1PGJA 2HC9A 5KJCA 1Q1NA 4MXDA 4RX1A 2QIOA 3X3HA 3GCGA 1EKXA 3BCUA 4X7RA 4WCFB 2FZEA 4JEUA 4L16A 4JH0A 1O89A 3CVXA 2PMKA 1NBOA 4O1HA 4BNFA 3HFGA 3LGAA 3W8RA 1P5JA 3R9KA 2YJ6A 1TVKB 3I28A 4HR7A 4D4KA 4KN6A 3Q15C 2WMOB 1TCUA 1Y1TA 3USCS 2OZKA 2C9MA 4UQOA 3ZNQA 1JHXA 1WXXA 1T24A 2NXWA 1EWTA 1UPTA 5KREA 2P3QA 1NL3A 3QUSA 3VVBA 3WJ1A 3DCIA 3RU9A 1AXEA 4AJ4A 5EKDA 4GVXA 3GJ5A 5CA0F 3L3BA 4EMTA 1FFWA 3ZY3A 4DNQA 4KRYA 1DHTA 2HD4A 2WHQA 5BQOA 4QELA 2B3TA 3GEEA 2I4TA 2PUEA 4LF5B 1XZPA 2OFFA 3LXUX 4ZAGA 3BKWA 5JALA 3ENWA 3AM4A 3TOZA 3AI7A 4J6EA 1CZRA 2GZDA 3PCRB 4KODA 3ZE0B 2ZCJA 1GG8A 1JMKC 2RCNA 4IICA 2O1EA 5G0SA 1W6RA 2JLXA 4QLBA 1XYVA 3E18A 4YBRA 5JBNA 2YASA 3AEQB 1JL3A 5JS1A 3N2ZB 3JXEA 3PHBE 4IHAA 3F5FA 4TKLA 2FW0A 1G4UR 4R1SA 5LB2A 2ZZMA 2XAAA 4UAGA 2TECE 1M34E 4GOKA 2JEOA 3A6JA 5IUKC 4BP8A 2B37A 1KY2A 1W30A 3LCUA 3U3KA 5KTTA 5HA5A 4MUAA 1YIOA 3GGCA 1JBQA 3COPA 4ZV7A 1ADYA 4COOA 5JCJA 4E07A 1CZHA 3ASVA 3AR5A 1RLTA 1QMPA 4REQB 1QLWA 1WX1A 4W1RA 1PCXA 2ZBEA 4HNRA 1J1UA 3ZCXA 5ISMA 3P9ZA 4G0MA 1NVDA 2HBZA 1Q6ZA 2VBFA 3LBFA 3DYIA 3CR7A 3D7SA 4F96A 3HYCA 4CI0B 2HLHA 3CFIA 1GEGA 2RGCA 1N2CE 4XVHA 4J03A 4TN5A 5L7TA 4QAJA 1UBHS 1CWUA 2BGJA 2BUBA 1TAGA 3A6LA 4Q18A 4PLPA 3TR5A 1L7DA 4E1VA 3CO0S 4FEGA 2VUUA 2N75A 4F60A 2Q1UA 2CF6A 2YZ7A 1T3HA 4BMYA 2DU8A 2AOTB 1ZM7A 1XAJA 3DF9A 1PU2A 1T0HB 2XJ4A 1GILA 3LIPA 2ZS7A 2IHKA 5DBIA 4IX1A 1YI8A 2IYWA 2SCUB 3LYAA 1KYVA 4BQPA 4C2BA 4AL4A 2P6MA 3QEOA 1WTAA 3PLRA 3HYRA 1E7RA 2J5KA 1J06A 4ZODA 3STXA 4NE2A 2AW3A 4DBZA 3W4JA 5GONA 5BSWA 5LWQA 3F1LA 1B1AA 1QB7A 2QNBA 3LLSA 1OHHA 1QE0A 2X0KA 4ZI7A 3IJEB 1Z5UA 3GAFA 4F97A 1AUOA 3R3SA 2NV2B 1U0SY 1X3SA 5DM2A 2VWQA 6AT1A 1EUYA 2VHWA 1VGVA 3E8XA 5JJBA 3NVKI 1NUAA 2O3UA 4EVQA 3Q7RA 4WZBE 5P21A 5K0JA 1SXQA 5FPHA 2QW1A 3GYGA 3I1IA 2UVDA 3R7NA 4DCVA 5KS2A 4C78A 4C7OB 3RVQA 2CBGA 2RAVA 1FNDA 3ZS9A 2W42A 3ERCA 4R2HA 5E4JA 2AV6A 1KMCA 4RYLA 2P35A 3K2IA 4L5BA 3S5UA 3QQ5A 4S12A 1R5BA 3W5SA 1P74A 1JEQA 2PH1A 1N2CB 2Z1DA 3RWOA 4Q01A 5ALJA 1SAYA 3CRZA 4O2RA 3MLEA 5CLQA 4B5LA 2FV8A 4CCAA 3X1MA 2XXBA 1ZI9A 3M3HA 4B17A 4DUGD 1JZQA 1N1GA 4X1YA 3GZ4A 4JI7B 3FB4A 3CRVA 4JXZA 3UAXA 4C0AC 2VJPA 3HDJA 1OPRA 4HAIA 5J2UA 1IVSA 5C1BA 1Z0SA 4M7PA 2VDVE 2YC4C 1B76A 2E4AA 3HYLA 4Z86A 2VEDA 4ZCMA 1NVUQ 3T3PB 4G5GA 4DQVA 3LX6A 2OCKA 4WOBA 1RM0A 3UATA 5GJVC 1GSHA 4EY6A 3O9MA 2BFMA 4L4UA 3JWIA 2VCYA 2B2CA 3RRZA 1XTUA 1U90A 1XRJA 3WS7A 3QPDA 4EFKA 3ONFA 1XBTA 1AUQA 4OHXA 4OQXA 1LJLA 3KL2A 4TM8A 2VUSA 4ZRMA 1GNLA 4KLNA 1P62B 2R2GA 5AM2A 2H1WA 3NHAA 3AI1A 4PNPA 1WW3A 1VRVA 3KS9A 2XEDA 3AW9A 3KZXA 2OFOA 3EVCA 3MCWA 2IF0A 4X1IB 1MV8A 5DULA 2XWPA 1P18A 3QXJA 4ETNA 1XQWA 3FZNA 3UAVA 2R00C 4ZEVA 4JYZA 2ASVA 4G5RA 4R3WA 1J33A 1ZJWA 4KVFA 4J2HA 1TAUA 1TM7E 2H4WA 3ZDBA 2Z2XA 2YW9A 2W70A 4XIYA 2D2EA 1RYYA 4XRRA 3I01M 1SMKA 4ER0A 5EXEA 1R8JA 2AC2A 3HBLA 4IZOA 1E5TA 2C99A 1IY8A 1E4EB 1ML4A 3QUAA 2RGYA 1UKCA 1EINA 3RBAA 3MUOA 2G1PA 1H0KA 2ZRKA 4HLUC 2GPWA 4NYJR 3PTAA 4RY9A 1AK1A 4PTLA 4DOMA 1GCAA 1E1YA 1I4LD 1NAHA 2OHOA 3NNSA 3EW9A 3U2QA 2O0HA 1U3FA 3CF4G 3I1FA 4YJFA 2A84A 4D3FA 4TXMA 2M6SA 3EGDA 1MVOA 3MWEA 1L8OA 2O2DA 2P6NA 4RJ2A 5DI9A 4ZT3A 2Y0BA 1VCOA 2AR9A 3QIAA 3IQHX 3DWEX 4X44A 2Y6UA 5LNK6 5FBWB 3UCFA 4V3BA 5AK6A 5CNMA 3WWEA 3QUQA 1JHQA 1GU7A 3QLTA 1RKVA 1V8BA 3II6X 2AN9A 4KNVA 4L74A 4WY5A 4DEXA 3NXKA 4RELA 4DPKA 3CLKA 4CIVA 3PA6A 1EP1B 3I2IA 3E9RA 4UBIA 3GEMA 2NPFA 3WRWA 1Q1GA 3BXFA 3TNYA 3D02A 2CLEB 1SZDA 3MA0A 1C5KA 5L53A 2I33A 3CX3A 1W2GA 2WZBA 3EB9A 3HY4A 2BE7A 5GOTA 2Q41A 2PBZA 4ZGBA 3R75A 1XFAA 5ELMA 4FQ8A 4IV0A 4MR9B 4MW2A 4QODA 3UHAA 3DLAA 2B6NA 3X1YA 3ZHYA 3K1AA 2FG7C 5FH9A 1YZUA 2JKZA 2Z6AA 4HFNA 4IINA 3P9NA 4LFAB 1SVSA 1K8YB 5EERA 1GGHA 3S8EA 4KXWA 2FRDA 3ITEA 4MQLA 3FFWA 3DTVD 1HYEA 1TYCA 3S2FA 4LSGA 2DEUA 3ENZA 3K4QA 4JC8A 3ZWKA 1T43A 4MV9A 4OKSA 5G02A 1Z18A 3WRXC 3I8SA 2WJWA 2WUEA 3PNYA 5TQJA 2GKOA 4UNSA 2VJMA 1MP0A 4F3CA 2NXNA 3O4VA 2JHAA 2Z3VA 4R9NA 3HJBA 3AW8A 1AF4A 2RG7A 3IKVA 4GHWA 1P8JA 4JL8A 4ANFA 3COWA 4YRKA 1ADGA 3DBRB 1OPXA 1TE2A 1XEWX 2BW0A 4DJAA 2DQYA 5EWLA 1JA9A 2H54A 2IWRA 5IT9A 4ESHA 1T2UA 1ZJJA 3SDZA 4BQQA 5KNCH 5IBPA 3QNUA 5A0VA 4JV5B 3U4MA 2PYZA 5ES4B 4PLGA 4TRJA 3WG9A 1JEJA 3F9IA 4L0DA 4HX2A 4UPDA 1N5RA 1TQDA 4I2VA 4CFSA 2MSCB 5IDQA 1NBIA 1DTWA 3QWHA 2FW9A 3IDZA 1DNPA 2AHRA 3I6ZA 3LUPA 2H1RA 3Q3IA 4MV3A 4NCNA 1AS2A 5C52B 1PW7A 5K4GA 1TZMA 3PHJA 4NCHA 3I2KA 3TLAA 4KIGA 1EBFA 1V1MA 2FRDC 4M9RA 5B1DA 1AH2A 2QSYA 1X19A 2JFQA 2Q5CA 4OXQA 3OZFA 1B8UA 1XDBA 3IURA 4JVNA 3WRXA 3DWGA 2EIHA 2G17A 1JE0A 1B43A 3EXEA 4JNKA 1NSFA 1ZPDA 3K35A 2QAJA 3EPRA 1OXXK 5TE9A 3P9RA 4L5AA 4BO5A 5B1YA 5KVCA 1DIGA 2HYIC 3ONNA 1K7SN 1BGXT 4XIGS 3E5NA 4QXAA 5AVQA 4LDNA 4ONEA 5ENZA 4YREA 3W7AA 3P1JA 4FDTA 1A04A 1AU9A 2PKQP 1P2SA 4KLRA 5HMMA 1G20E 4QGFA 5LA6A 3GLSA 2E48A 4NENA 1A9QA 2P3OA 4M88A 2AXQA 2IYSA 3F6BX 2PANA 1N5DA 2HMTA 2PFGA 4QUAA 1ETUA 3HWWA 1LDEA 1J07A 4DCUA 1D1SA 1DAOA 3DLIA 2CHEA 2VNKA 3FKSA 1VKZA 1VHJA 2QD1A 5T8KA 2VS1A 3U17A 2IQ5A 1G8HA 3PXAA 2G1UA 2O2ZA 4F4IA 3MCTA 3OQIB 4RHCA 5G1OA 3JZFA 3MHTA 1X8JA 5J4LA 4Q7EA 3CS3A 3GIDA 2REXB 2WKWA 4AMZA 4IHKA 3MBIA 1EUZA 4MVJG 1VLMA 4CF7A 2O4CA 4QOFA 2WUFA 2Z5VA 5BT9A 3T1YB 1WXGA 4DZTA 1A9RA 4J4TA 1PGPA 1H2XA 3Q5EA 1KGDA 2DHRA 3PYXA 2Z43A 2G7MC 1F14A 1Y3BE 3C45A 5FFFA 5T4BA 1DEHA 2GLUA 2NSYA 2YBDA 4JLOA 2JLAA 2Z95A 1NBME 1JH9A 4HADA 1UJMA 4YB8A 2XWBF 4GGPA 4GOXA 3IUBA 1QHFA 2B61A 1XRSB 4Z4EA 3BH6A 5HRUA 2JI7A 3CWZA 1BFDA 2CFOA 5EPOA 1E9FA 1W49A 1U65A 5C3UA 4MVYA 3DWFA 3S55A 3DDUA 1GL6A 3TKLA 4I99A 1U9IC 1GNSA 4AX4A 2XVMA 4NSNA 2PK3A 2WLTA 1XMQB 4F86A 3KT6A 2VP3A 2RK6A 5F76A 1PEDA 1XXHB 1U7OA 3O0TA 2V6IA 4I5GA 2H31A 1TZ2A 3MSCA 4E21A 3OCYA 4QHYA 4G97A 4P4TA 4TTVA 5LZ5A 2X7JA 2YXDA 4NFLA 3THSA 1YJ5A 3C6KA 5TPZA 1W581 3FKJA 3KVRA 4OHWA 4E1AA 4R8LA 5PNTA 1WB4A 3IPRA 1P0QA 4K8OA 2FSHA 4HCJA 4EHDA 1NE2A 4BKRA 3P8ZA 1OCEA 2FG6C 2ROQA 4ZKDA 2VAVA 3NJ8A 1OVMA 3C3PA 1LBHA 3R7AA 2X15A 4B79A 1QZTA 1LPAB 1TECE 3G8YA 3K32A 1JMYA 3WLAA 1ODLA 4RIIA 1OFUA 1TJPB 3QHAA 3CVUA 2ZAYA 1KMHA 4BASA 2Q5QA 2PTHA 3PRKE 4JA0A 1WWKA 3GA0A 3SMQA 4YRZA 3RADC 2XKKA 3ZD6A 3K30A 2P77A 4MKIA 4CVNA 3FZGA 3ROPA 2COKA 2A33A 1EB8A 5G53C 1OXBB 1XD9A 1D4AA 2ZRCA 2ZS9A 3ZC3A 4ARUA 2OORA 3LVQE 5LL6P 3F6YA 1DUIA 1O54A 2JFPA 4M8NE 4DCTA 1OLUA 2Q27A 3I72A 2W8BA 3JVEA 3VKUA 1N33B 1PFWA 1LRJA 5CGZA 1EUCB 2QJTA 1G2OA 5FOXA 1R4ZA 3JWHA 3EXHC 5CYGA 2PLFA 2QT0A 2ZEJA 3DBVO 2NZ8A 2IZ6A 1JZSA 1L3CA 2A6PA 2WFMA 4EO4A 2ZXUA 1ZN8A 4U7GA 1TW2A 3HNPA 1GV1A 1GPMA 5P8WA 1MMFB 2AEEA 4R81A 4BLPA 2XNKA 1G59A 3ZD7A 1P0IA 2XLCA 1VL8A 3I52A 3K0HA 4ZRNA 3QHQA 4KPUA 1BQ3A 4TT3D 5BW8A 1XQYA 2PX6A 3OEYA 4L3WA 1ZW6A 3N2KB 5CT6A 4UTNA 1LPNA 3UPDA 2X8LA 4IZHA 4J2OA 2QR2A 3UFBA 4TWRA 5IK2D 5JQGA 4OD0A 6ABPA 1T6ZA 1DSSG 1GQYA 5KYXA 3SD7A 1F6BA 1BDHA 1GKKA 3P52A 4P5EA 3VNRA 1PVOA 1B00A 5AVVA 2CBXA 4OOFA 1T29A 3SY8A 4Z4QA 3SR3A 4QUGA 3EWNA 3N5KA 2NNWB 2WK1A 3C39A 5ERGB 1P4GA 3A1WA 2COUA 4R8SA 5HVNA 2V45A 4MITA 4JJ7A 3D3WA 3F6CA 1I0IA 4V0MA 4P33A 3U09A 3L07A 1NULA 2NO1A 3BD7A 4JSYA 5U4XA 4JI1B 1WF3A 3I42A 4NBKA 5B6JA 1C50A 1LQTA 5AR1A 3PGA1 3PNVA 4KQJA 1UXIA 2DHQA 3PI6A 2QDXA 3QFHA 4NHEA 3K1JA 5A9SA 2BEJA 3C1UA 3CE9A 5K3AA 1CEYA 1M1YB 2XE7A 2ZQ5A 3EMBA 5CLLA 1NNI1 1YHNA 1Y3AA 3JYPA 3MGAA 4C08A 3QOXA 2G80A 2HWWA 2F62A 3ZK9A 2MINB 4YCJA 3T5AA 1VL2A 2O9JA 3GRPA 3TFWA 2NO6A 1SA0A 4PGMA 3EMDA 4REOA 2GETA 3KAJA 4WZ6A 2GPTA 3IH5A 3NBYC 1VYHA 1U0OC 2G04A 4RHYA 3V8RA 4IQFA 4KQFA 4G5QA 2Q99A 2ADFA 4IL5A 5KTSA 2EBUA 1LRKA 2G4CA 3UWSA 4F2PA 1Z2AA 4XPIB 1OTYA 3V1TC 3G0BA 1KJ8A 2N3ZA 2VXCA 4C21A 5CG1A 4TUYA 5B2EA 4HBGA 4KE7A 5DGDA 1E7SA 1ORWA 5CA1F 1IUPA 2ET6A 4ZEXA 1GRCA 3ZD9A 3CW9A 1MQAA 2C9ZA 3D7LA 2P9CA 3DW3X 2DH6A 3OLQA 3LI2A 3Q3CA 4QIHA 4R3UC 3L4JA 2CUKA 4B8YA 5ALGA 1T3GA 1U9CA 2AXPA 1Z88A 2AFIA 1L4HA 4DDUA 3FOFC 1RPTA 3JAKA 5JS6A 4EI8A 1JMVA 2BCJQ 4ZV4A 4O0MA 2IH2A 4OHPA 4GSKA 4S1WA 3LF4A 2EIXA 4MQEB 4MGEA 3CKLA 3JQ9C 2NYUA 4WY8A 1GTG1 2ACVA 2J7PD 3FPKA 4ASUD 1JG6A 4Q1VA 4MINA 5T57A 3MG9A 3UXMA 1SVUA 4IIJB 5KNDH 2FX5A 3FMIA 3OKPA 1SQ5A 2IYTA 3SIPA 1OR8A 2D13A 3AQIA 2G71A 2KYRA 4BNYA 2P40A 3L6EA 2J6BA 4DDKA 4HDNB 5FTWA 1HV8A 4G1VA 2LCQA 3EARA 1QYVA 1CE8A 2NW6A 3N2NA 4Y1FA 3MS4A 3RROA 4RLHA 1J0XO 1SEPA 2AA3A 2EF0A 4Q05A 4XWTA 4C7KA 3NGMA 5BQXA 1N57A 2CDAA 3DTVA 4F3RA 3ZXXA 1XC7A 5FOUA 3P32A 4BFCA 4HWOA 2FVYA 4FFLA 4O33A 3IIEA 3M5PA 4C30A 1FFCA 1EDOA 2JGRA 1X7DA 1N5OX 2CXXA 4B9AA 1SQ0A 1D3AA 1W88A 4BS9A 2PMDA 5IWCA 1PYOA 2Y1EA 4XSVA 1KRWA 1DCTA 1GCGA 2O3RA 2J45A 1YL7A 4RV9A 1DQSA 3EUWA 1I24A 2ZWAA 4IUDS 2IWHA 1LQ2A 1PNVA 6LDHA 2QGFA 2ZTHA 1Z75A 3IAHA 3OM8A 4IQ4A 2A1UB 2A53A 1A8HA 2IYXA 2VPZA 2B1RA 2IDJA 4JAVC 3LT5A 3EJ6A 3R3UA 4KFTA 3IQWA 4M0FA 4DA6A 5IUJC 2FLWA 1UQRA 2C5LA 1ZSNA 1GUZA 4J1SA 4X20B 1JLSA 4BXOA 4FZRA 1GKYA 4N54A 3UV3A 2XVZA 4WK0B 4ARBA 1L8QA 1Y3HA 3USES 4AZWA 1P9OA 5BVHB 3R7BA 3WFZA 1TGVA 4Q3BA 1DRWA 2BFFB 1QX4A 3VI3B 4Z7OB 5A0TA 1H0SA 1XWIA 4FFBB 3H6HA 1E2UA 2DHDA 3IS3A 3FMVA 3OA0A 4W63A 3UT5B 5JVDA 4TUYB 4OK5A 3JAKB 1QH9A 1UOEA 5SY6A 4DR1B 4X8LA 2CFCA 4D82A 1ZOPA 3VZDA 1T6BY 4I50B 5IN4A 3W5CA 1HF3A 3PKZA 4KBFA 5ICGA 4L1KA 3SOPA 1CJTC 4ROSA 2FGKA 3NHSA 3UMCA 4D9BA 1G66A 3ITNA 3JQAD 4TROA 4GP7A 3C6YA 3R2JA 1FXUA 4PO8A 4BUCA 4PBRA 1K89A 3AHIA 4G0ZA 1V2HE 3UC5A 1E9CA 4P38A 3E22B 3PPIA 1IZ7A 5FWDA 1WPQA 3NC4A 1SU8A 2D8AA 1USVA 1PD0A 2GARA 5FBKA 3QPWA 4DT1B 3MMPA 3PKJA 2I4LA 1Q5PA 1ZIYA 1EI9A 5KOHA 2V7TA 1JQLB 3KSDO 5ALNA 4URXR 4EKNB 5AHXA 2BTOA 4RDCA 2W6IA 5KC9A 3QBDA 2WQ6A 5CA0A 4MWTA 3BSWA 3SDSA 3DMHA 1SO8A 2Y66A 4DBLE 9LDTA 4E0BA 2WJVA 1ZN9A 2JAOA 2GEUA 1R88A 4KXUA 3FBWA 3ANSA 1AXGA 1VI6A 1EFTA 3P7MA 5HJEA 1NVMB 4RTSA 4KAXA 1WW2A 1F0NA 2WWTA 2PBLA 1XVVA 3AM1A 3OESA 1ABFA 2PH7A 3C7TA 3EG5A 1C7FA 1EGQA 4ZWNA 1MT0A 1WP4A 1P73A 2IYRA 1VTKA 3NX4A 4PEVA 3L1UA 4BGDA 5KTMA 3MC1A 3EGXA 2AVNA 4YHBA 4FM9A 3DBHB 3LQRA 2WUWE 5KNCA 2WSBA 3K16A 3WO0A 1GZ6A 2C9YA 4ZOQI 1YULA 2D5CA 1E7YA 1T6YA 1G1AA 1KOFA 4AMUA 4OHFA 5LP1A 4Q4LA 1OAOA 2PWZA 4ZQIA 3KOYA 3R5HA 5KWSA 3GHHA 3ZCUA 1G16A 3UAGA 5TQ2A 2C4NA 2YS7A 5K03A 1GPLA 3HEAA 5CCBA 3ZE7A 1J2YA 2XCIA 3MJSA 5JEEA 1U7HA 1U9YA 4OUKX 4PGAA 3IELA 4PM4A 4TS9A 5FWNA 1V6CA 1N0WA 4PS1A 4B84A 3OQOA 2BM1A 3NTLA 2YZ2A 1R64A 3HA3A 2R6DA 3ZVKA 1ABEA 3HVRA 1HDGO 3ADKA 4IMRA 5A5GA 3FUWA 1V16A 2PGJA 2PT7A 3P9XA 3W5IA 2AZXA 4N65A 4E2YA 3LQQA 4JYBA 1APBA 4M54A 2O7RA 2DBQA 3VSEA 1AKQA 3VX4A 3AXSA 4FE7A 3FPHA 3NFYA 1W0CA 5I8ZA 2JFHA 3BK1A 4CMHA 3H6GA 1OV6A 1P4JA 1UBSB 4KWIA 3EXIA 3CC8A 1V3TA 2ZRQA 4UNQA 3KETA 3D0RA 3OE4A 5BYBA 4KQKA 3BTSA 4LOJA 5JMOA 5HF6A 1G18A 4RJIA 4RGQA 1JAHA 1NW9B 2OHIA 4O4JB 1QH1B 4REQA 3OQVA 5BWLA 2LGJA 3KZCA 1I3LA 5L8VA 1MAAA 3EGDB 3NVMB 4JR0A 4UNPA 5E1MA 3A10A 4P93A 1QTQA 2B99A 1EWVA 2ZRPA 4UDOA 3GELA 4MJXA 3TX2A 1Z7YA 5LQMA 1HLFA 4EVRA 3GJRA 1JKJA 2IBMA 3DE5X 2G0AA 1EK5A 2G07A 2QT9A 3L5OA 5FI1B 4ALIA 3MWJA 5JAMA 4PNHA 4CM4B 2JFGA 4ETIA 1JHMA 2QL7A 3KD2A 4AQ7A 4PSDA 1G41A 4BGEA 4URUR 3QVLA 5BWCA 3RTGA 2O6LA 4RL6A 4IGIA 4QTXA 4YRQA 3K6JA 5K01A 2QD2A 4RGVA 1D1QA 1OLXA 2V0NA 4XIJA 1EEHA 2XYQA 2FZCA 4HWPA 4EL5A 5BSHA 3DOCA 4KRXA 1RWOA 1T3TA 3U4QB 1T1GA 3UHPA 3IQZA 3RKSA 4QYIB 2G77B 4Y1GA 4NZMA 5CH3A 3BYZA 5BP7A 2D00A 1BCRA 1HZZC 2VT3A 3E23A 4CUZA 4E7OA 1ENPA 1KP2A 1EFPA 2H2DA 4N7JA 2GVDC 1REQB 1EE2A 5DP1A 2ZJ6A 2Q9CA 4RTKA 1KI7A 1AKUA 3HLYA 2OR3A 1NFRA 4F84A 3S2SA 1M9NA 3VTZA 2AZ4A 3INYA 2PR7A 4U7FA 1IXSB 4UM9D 1SBNE 3H99A 2BHRA 2XEXA 3L4EA 4TOIA 4AIRA 5KVAA 4FYKA 5EP1A 2X8JB 1F12A 4POOA 3NHJA 1S3FA 4Z0NA 3M82A 1PYDA 1TKRA 1VYUA 4U7WA 4KVZA 4WUTA 4WESB 1XZLA 7GPBA 4MUGA 4L5JA 4LMPA 5G3ZA 1GAXA 5K8IA 4GR5A 3SBEA 4N3CA 3EVBA 2O1XA 3QY0A 4R1UA 3BMNB 4FU0A 5IAAA 1ZAYA 3CW8X 3GUYA 4D98A 3ONDA 4ENUA 3M81A 3AVPA 4IMJB 3DZ8A 4ZCRA 3TECE 3GCDA 3PUWA 3L4SO 1P9RA 1GQFA 3HY3A 5I8WA 1XA3A 1AO3A 3P27A 3V1UA 1T4BA 2X4GA 3E70C 4LJ9A 4B6JA 1T9HA 2W6PA 3U6KA 2GXUA 2IF2A 1N7HA 4DUYB 1ORTA 1Y4SA 4WLUA 4GI5A 1VLVA 2I03A 2GXAA 4GP6A 4O4JF 3P45A 5LOVB 4J7AA 3Q40A 4X7MA 1XMJA 3ROKA 4JLKA 2B5OA 4QD3A 5CBPA 5HJ7A 4KTVE 1PI3A 5AI4A 1OX4A 4ESVA 4UFOA 4W7HA 4KRFA 1K8QA 4QYWA 1RPJA 1Q14A 3A1EA 3RKUA 4YP7A 2I6XA 1E60A 4QBKA 4UDYX 1JI3A 1RI4A 5I45A 3GLHE 2L2QA 1PJCA 4FHCA 4KXQA 1T2NA 4H1HA 5DVZA 1LX7A 2H9YA 4ND8A 1TM5E 4UUAA 5KTOA 2IHJA 1E8DA 4PX3A 2IZZA 1QCZA 3K2EA 4ILKA 3TMAA 3ZQ4A 1IEXA 2J3EA 3U9TA 3WQBA 1C3LA 3T7TA 1Q21A 2G6TA 3W6OA 1B3RA 1Z73A 2YJ3A 3L01A 1DXOA 3QF4B 4W1SA 1FF9A 2ZAOA 4BBZA 4CETA 2C9DA 2PBRA 1DAPA 3WK4A 3OVMA 1E3EA 2DPLA 2H51A 2ZVPX 4DA8A 3RIYA 3RAGA 1OKKA 3NDPA 3ZLBA 1XHLA 2MR6A 3KOOA 5L4NA 1V39A 2XX3A 3E15A 4LVOA 3LKDA 3ZWYA 2VF2A 4N0PA 4ZZ3A 4E15A 5M2QA 3SVLA 1UIMA 1N6PA 2VJAA 3ABSB 3CURA 4V24A 4X6UA 2EJTA 1TCVA 4EB6A 4UTVA 3ZI7A 1PJZA 4FFMA 4BIMA 3JASB 4GOJA 3ICVA 4RF3A 3RC7A 4KXNA 3JQGB 4EJSB 4LRQA 2IP4A 1GYRA 1T25A 1J42A 1M0SA 1TO2E 3JX9A 1WPRA 3D3QA 4IAOA 4DDWA 2RKWA 3TLMA 4A92A 4TVSA 3CJQA 1R5JA 5TGTA 1XJ0A 5DHPA 1EVKA 5FL7A 5H83A 1M7GA 1PWHA 3OWOA 2HY7A 2QAIA 2LPMA 5GV8A 2OBMA 4WFQA 4KMRA 4MDFA 3OTQA 1GG2A 1TYDE 4WNAB 3DEHA 1NX9A 3TI7A 4Q34A 4OLBA 2AI2A 3AIMA 5K3BA 1DZIA 3P94A 5FWYB 4UHJA 3SKVA 3VYSB 3X0DA 1K7FB 4Q4HB 1QG6A 1AS0A 4N7BA 4QJ5A 4HNSA 1T1IA 3A4TA 1CUHA 3ZU5A 4ZDWA 1SY7A 5KTKA 1N25A 4BU1A 1EP2B 1XF1A 2TMDA 1RU3A 5EESA 4MVCA 5DTIA 2V7VA 2VH2A 4R1LA 5JG7A 1I4DD 2ECFA 4MKZA 4DS3A 4BN0A 3GJXC 1YCFA 1XK6A 2HCTA 1KDVA 2VP9A 4CTNA 1DJPA 4LRXA 1X1RA 2H1LA 4ITUA 4E5UA 4F0JA 3D6TB 3F6EX 3MTDA 1H66A 3ZBUA 2A35A 3IVAA 2AJLI 3GW8A 5EEGA 1VMAA 4HDKB 4EBFA 1U80A 3IUQA 5BXYA 2UYYA 1UZAA 2QMUA 3ZGYA 3CFYA 4K8RB 5I47A 5KPJA 4YN3A 3WOHA 1BSVA 1YBFA 2A58A 5FI0B 1DP4A 1CC1S 4XD2A 5FWXB 3MWLA 1TVEA 1D07A 1GQQA 1XOIA 4KX5A 1YFLA 4WESA 4CLOB 2Z8ZA 1X7YA 3AHFA 1SCUA 2YFYA 4BKMA 2Y67A 2FW6A 4L51A 3WYGA 2XB4A 3DZIA 1GUFA 1E79A 1N8NA 2P1RA 1DV2A 1PZXA 2VC2B 3L0BA 4Q1BA 1SELA 1R10A 3RABA 2D1YA 1HL3A 4Z99A 3RAFC 10MHA 3EPLA 2CV2A 1F4VA 2J46A 3QKTA 3WLIA 3VR5A 5K8UA 1P1CA 2G67A 3HKCA 2BFBB 2XCUA 4Z8XA 3DPIA 4MQBA 4PG6A 1K2WA 3OQMA 1XD2A 4DV3B 1X1SA 4RVSA 4TXLA 2EQBA 1IK4A 1NKSA 3JSXA 3VUFA 1VG8A 3KEOA 2Y9PB 4UAVA 1T4GA 3A4LA 5CLIA 4DNOA 4K6GA 1VL1A 3DMPA 2PXHA 3F73A 2WVGA 1VLQA 3PDUA 4MUFA 1E9SA 3EQZA 1D5WA 2FZGA 3OM0A 4JBIA 3ZGLA 2RGNC 4KN9S 3FNEA 2XDWA 4MVJI 4N6OA 4UREA 5IVPA 1K3UB 3EXAA 3OOHA 5DNDA 4G4GA 3SM9A 2YJ4A 4CM1A 2XQIA 3QWAA 2JG3A 1JIVA 1QS0A 2FDXA 2N0SA 1B0AA 1KS2A 4JI6B 4JY7A 4H3HB 3N3BC 5BOSA 2RD2A 1QJ4A 3KYDA 2R0QC 3CONA 1RE0A 3KCQA 4MR8B 2BSAA 3UJBA 2JA1A 1T4MA 4AXXA 3NOOA 4O4LA 1UMBB 5EJEA 3BHJA 3TZQA 1MEEA 2GN9A 2QZSA 4BLVA 1W25A 1W59A 1Q7CA 1S89A 2EEPA 3PDWA 3GUZA 3AIKA 2XUGA 3DW1X 3QKSB 4HS4A 4OO3A 1FFXB 3AVVA 5T6BA 5BW0B 5JI2E 4DLKA 5DTQA 1FYEA 3JV7A 3I9LA 2VUTA 2IFTA 3SNHA 2I2AA 4O2AF 2GQ0A 2B9EA 1OXMA 1Y5LA 3Q11A 1QVZA 4ARIA 3A1NA 1H2EA 2RG1A 1MO5A 1L9XA 3SC4A 3GGOA 1E5VA 5CFNA 2DH5A 4R7ZA 16PKA 2F1KA 2VZLA 3LOPA 4N5LA 1MEOA 2BJHA 4RQBA 3EY9A 5HCNA 3WGQA 3IC5A 1SIUA 5KKCA 2ZG6A 4Q9JA 1KZ7B 1NPDA 3ELUA 3OICA 4MQFB 4YAIA 4LK3A 3A8TA 3K96A 3S8MA 4GX0A 5ARDA 1AX9A 1PKEA 1ZK3A 1D7AA 4ZT7A 4MUYA 4TV9F 3U4DA 1X9IA 2BHSA 3E7XA 4JLJA 1UIRA 4MQEA 4NVRA 4DY6A 4F5WA 2BRUA 3LUJA 1ZMBA 4FBMA 4DRXB 1G1MA 4M1MA 5CDFA 2ZYWX 3KLBA 1Z45A 1T2EA 1QIMA 4FDUA 4JB8A 1YUBA 1Y37A 3VNAA 3QHPA 2FPMA 4LQ4A 3ROGA 2I91A 2A9FA 1J0BA 4XYGA 3Q8KA 3RRYA 3ZIAD 3ZWXA 3RR2A 3L4KA 1XVUA 1RLIA 5K0CA 3PC3A 1CG6A 1KJQA 1KVSA 4H6WA 2QN3A 1P5RA 3I34X 1TQ8A 3CCCA 2A56A 5EKTA 5TY0A 2DR3A 3ZWPA 4B82A 5C51B 4IGAA 3B38A 3ENNA 4GM0A 4J0FA 1EQ2A 1HXHA 1W1UA 3HKBB 3KPYA 4EHKA 1CERA 3LE8A 2FPKA 1U5BA 1D09A 2R00A 1NP6A 4TVKA 3TLYA 3WYEA 5K0BA 2BI7A 3KAPA 4E88A 3AEXA 4GZ3A 3JQEA 4Q19A 4R4JA 3VO9A 3WWCA 3O3NB 5IZCC 3OPYA 1N92A 4UPVA 3CVYA 3SZGA 1LDNA 4HAXA 4H3VA 5JHHB 1RI2A 3RVOA 3TDMA 3JS5A 3O31A 4QBIA 5I8PA 4OFZA 3QY9A 3U37A 3ED1A 3GMSA 1I4WA 1PNRA 4QRIA 4MCHA 1P1RA 2ZT6A 1Q0PA 1FTGA 4RD3A 4TRRA 5DCUA 4HWSA 2QNIA 4HQFA 2AX4A 3AHDA 3RRXA 1JLLB 4CQJA 4CLRA 4KPEC 3GH1A 4RZUA 5LB4A 1H23A 2BGGA 4W5NA 2REBA 3LHIA 2ZYRA 4PXYA 1R4NB 1XRRA 3NBMA 3ZXYA 2DERA 1QZZA 5EJ7A 1FDTA 1P7VA 2NZWA 2D1SA 2HRZA 2Q8NA 3Q7SA 1SUPA 2FFRA 2PLWA 2XZPA 4QQ8A 4RHFA 1J09A 3D7RA 4B6PA 1GN9A 5EZYA 4KXYA 3LZ6A 2W2NA 3ZDEA 2YWFA 5AUPB 2GAJA 4B75A 4NATA 2C1EA 3F9RA 2B4TO 2QNRA 2DC1A 1NW4A 3D4NA 3IKTA 2I5PO 3GPLA 4WZAA 2OCAA 2BV3A 4RSRA 2XVXA 1I80A 4ZYYA 4BRWA 4BO3A 1XAGA 5DN9A 2QMZA 2W6ZA 3O2NA 2H3HA 1UODA 1XROA 2NWQA 4XA8A 2QLJA 3DXYA 3M6UA 2RE8A 1DARA 2BEUA 3QVVA 2EX1A 1YIAA 4C06A 2XXAB 4EGCB 3IERA 4K6OA 1XZJA 3W9YA 8ADHA 3EH1A 8OHMA 3HO1A 3OX4A 2V74B 4C4YA 2ATCA 4FFVA 4KO3S 3TMKA 4EG3A 2YUIA 1EG2A 4PG5A 3ZE1B 1DG9A 2DR0A 5TLSA 5EQFA 3PPXA 1ZJZA 3KLOA 3VDXA 1VYVA 2XKAA 3MINB 2YOGA 1OHHD 1CQZA 1SEVA 1XDSA 2I3GA 3K5PA 1BQEA 1L6RA 2MIIA 3N9IA 4IQ0A 5ALWA 4F06A 4UM9B 2ZE8A 3H8SA 3RYCB 3FD8A 4RPKA 1F8FA 2ZRIA 3QEMB 4X61A 1VOTA 3KCNA 4EX7A 4M0PA 5F2EA 3BQMB 4WECA 1L1FA 4NK4A 2R7AA 3RYFA 4FMDF 4CM5A 4JI5B 2ABWA 5AVOA 3P9IA 4D8YA 1B42A 4QRDA 1OC2A 2BKUA 4GP9A 4JZKA 4BAGA 1OYOA 4W8OA 2V6GA 1ZMOA 3CX7A 2XNDA 5FF9A 1V5GA 1A4UA 4PO1A 3UMJA 1Z38A 2KQUA 4DJJA 4DMLA 2IW1A 2Q28A 3MQ2A 3HBFA 2WJAA 2HH9A 3OQBA 3SDBA 3M6MD 1DO2A 3B2NA 5C37A 2A4MA 4KJZA 3GGJA 2CKDA 3IIJA 4IJQA 4BX3A 4F91B 1SUDA 4RVUA 1T10A 2OILA 1Z6QA 1CQXA 1VKOA 1C2TA 2HHCA 1Q6YA 2P68A 2QX7A 2R85A 1DELA 2WOOA 2Y0EA 4JIGA 4MQUA 4HVAA 1Y1LA 5DRYA 1CPYA 1YHYA 3AHCA 3ENKA 1GSIA 2WA1A 1P17A 1HYHA 3WGNA 4JBHA 3F3SA 5E0OA 5ALVA 1NVWQ 3CPSA 4I66A 3NCTA 1N6HA 2NP6A 1DKLA 1VG9B 2GF9A 3GBVA 4L15A 4MB2A 4CGYA 1TC1A 5HNKA 1NOKA 2J7KA 4CMIA 3L7KA 3DTVB 1JX6A 1WU8A 4MTLA 4YRGA 1HQCA 3D3NA 3KR2A 1G19A 2PN1A 1HNNA 1M74A 1M2FA 5A4JA 3N6RA 1DKQA 3SVTA 1R74A 2ZIEA 1IVYA 3H2SA 2W5UA 1Q7GA 2FFJA 3OLZA 4ZANA 3LRTA 5K5EA 1G8GA 2EATA 2I6TA 4P4GA 4BLSA 2GH1A 2P9FA 2FK7A 3K2QA 2O5VA 2NP7A 3RU3A 3PQ4A 5A5VA 4J9VA 1YDWA 4C4TA 4LW8A 4E5PA 2Z3ZA 3DD5A 1UM8A 1R4MB 2J9RA 5MFZA 1KIFA 1PQ4A 3CH7A 4UUNA 5KU1A 3R7WA 4E4RA 1C14A 3UTDA 3NBAA 1AKVA 2FZLA 5T8KC 4B3HA 3UGTA 1DBSA 4C88A 4YV7A 8ATCA 4JI8B 1DQPA 1G8KA 1HE3A 1P3Y1 2RC5A 3IRVA 2A50A 3DVAA 2O8FB 1E2BA 5F35A 1A7JA 4H7HA 1H1LA 4REMA 3K5WA 4MV7A 5DXAA 3ILYA 1YJQA 3HSYA 2OHHA 3R7SA 4XZ3A 1YA8A 3WMEA 1WHSB 3OLVA 1W44A 1HLGA 4X6XA 1HGXA 1IEVA 4F9TA 2Q8PA 1H1TA 3NWPA 2PJDA 3IPAA 5ICEA 1SVNA 4FGLA 3VR1A 4P86A 5DWVA 1GZHB 5KX5F 1KA9H 1NMSA 1QHGA 3K0AA 5AI6A 1R2QA 3UK0A 3KSZO 4YDRA 3ZCTA 2ZS8A 3TS1A 1IY1A 1EJBA 1Z36A 2EG9A 3K8YA 1TVKA 4L8YA 4F46A 4J29A 1NVXQ 3OE7D 2HGSA 4M8KA 4E08A 4BDTA 1X1TA 2H1OA 3HCWA 1JDTA 1V11A 1OQAA 5J2TF 2CEKA 5JARA 2FQYA 2CD7A 2F48A 2GEFA 1YZLA 2QL5A 4N9QA 4FDAA 1E5LA 1J9GA 1YR6A 1XL0A 2HTEA 4XJTA 2B25A 1V25A 1M1NB 2GZSA 2Q46A 3ACBA 3AL2A 4FFOA 4NYMQ 3RRNA 1CUBA 1FTNA 3W1EA 1Q95A 5I7OA 1XLVA 3BRQA 4ZOCA 1GD1O 5IVDA 3FNBA 3WBKA 2VP5A 3GPCA 4J43A 2AK2A 1DVRA 2FCRA 3MM4A 3I6MA 2V5AA 3QU4A 3BB3A 4K26A 4FWIB 1ZC4A 3VA7A 1YE8A 1WUIS 4Q47A 5ERXA 4LYAA 2GOYA 1K9VF 4MCAA 3TM5A 4DJFC 4EY5A 4YV1A 1VL0A 2HA3A 2RB5A 4ZAWA 1SWWA 5D5PA 2W2XA 3AUAA 3IA7A 4XDHA 3WGYA 2GR9A 1Z12A 2PA3A 4OMDA 2X8JA 2B4QA 1HG1A 3ABOB 3OIYA 4AYWA 5HEKA 3SKXA 2I2WA 4EG5A 3HCFA 3ILHA 4XR4A 3CQ9A 5AJHA 1Q7TA 2F59A 3F47A 4Y6PA 3GPDG 1LVUA 2HT6A 3V8BA 4RDHA 2QTRA 4MDYA 2YH2A 2YWBA 3WTCA 3DL0A 3B51X 3ZH2A 1C1DB 4YYEA 2JCGA 1Z29A 5CMLA 1M76A 2YYAA 4V0SA 1L8AA 1CK4A 5JASA 3TTXA 3WTBA 2G88A 3WMXA 5BW6B 3GCZA 5F7JA 1SQGA 1ZK1A 5T67A 1N5IA 2F3TA 1C7RA 2ODTX 4OJMX 3D5TA 3V6MA 5JAUA 1D4ZA 2HBRA 1KBQA 1N9KA 5ESXA 5TX7A 2G9ZA 4V1CB 4I5IA 3SHQA 3WAJA 3LWDA 1Y7IA 3KT0A 3IEMA 1DXHA 1FP2A 1R8YA 2YY6A 2WPDA 4YIHA 1XMOB 5JZVA 4B87A 4ZJPA 3NIBA 4CQMA 5JYDA 3BN3A 1U4SA 4DG9A 4BQFA 3JATA 2Q2VA 3I6IA 3WGTA 3MWGA 1FOEB 2JC3A 3KFXA 2OGTA 1XWFA 4IHQA 1KJJA 1JR6A 3N75A 2V6BA 3U26A 3QX7A 2V1XA 3SX2A 3LU1A 4C0WA 2GM4A 2GESA 5AJZA 2JGNA 4U2KA 3GLFA 1RIIA 2W2LD 2PCJA 3QEKA 1GTZA 2DYKA 2A88A 2RAPA 3KZOA 3ZIAA 1XZIA 3FM9A 3VU8A 2PD6A 1YQ9A 2IUYA 3D1VA 1UM9A 1NVVQ 3LD9A 4H17A 1WRBA 1G8FA 2R6FA 2FUCA 2AFVA 3DCNA 3EDQA 3IT2A 4KO2S 4GPZA 3WL4A 3SXUA 2FMUA 3RLIA 1Z6GA 2C2ZA 2VP2A 2WZQA 1UFKA 3DAPA 4RK0A 5CVVA 3PEFA 4E5DA 3D9QX 4NZNA 3TEJA 2AOTA 3ENQA 4GSYA 5COBA 3UOGA 3KBOA 1HO3A 4JYPA 3Q0TA 3D54D 3IO3A 2YYZA 5EJ9A 1Y82A 5KWIA 1E8NA 1T3LA 2IITA 2J41A 4MP3A 4M53A 2L42A 2ZWOA 2NUPA 3OFSA 2H0RA 4MB0A 3WL5A 1X1EA 4D56A 3K94A 1FVOA 3GJ4A 4X93A 3TQOA 3K15A 2HREA 3DGEC 1OYVA 1AN9A 1G6KA 4KQIA 4MICA 3LBHA 1XTKA 2RSLA 1J5PA 3EXFB 1FXWF 3KWLA 3PTZA 4D46A 3RT9A 1ZN2A 1OLSA 1VJCA 3W0LB 4DLTA 2P41A 3K0EA 1R3DA 3RHTA 3VV3A 4XFKA 1V9SA 1ZLYA 2R86A 5KJ6A 2H59A 1TVCA 3GYBA 4I1RA 5DGXA 3ZW9A 4MUEA 3HYTA 1E7MA 3T1NA 3I5MA 2Y0CA 1XA4A 3RUDA 1ISHA 1Y5RA 1BXRA 4HB0A 4HZUA 3T4XA 4DHEA 3EPHA 1C3XA 1KI6B 1UT6A 5AH0A 1R0BA 4JJFA 3FWYA 1W4CA 1Z6TA 2RGBA 4HEQA 4IZIA 3UJHA 4TL7A 3GZJA 4UASA 4YAEA 4FSDA 3GRRA 1QH0A 3JQRA 4LISA 1VPVA 4Y6GB 1I7PA 1S2NA 2FETA 3I58A 3NATA 4IDBA 4IEIA 5DM0A 1W4RA 2EYUA 3I0NA 3V00A 4NJOA 2JJMA 2C8VA 1K3TA 4IHJA 1DOZA 2WA2A 3TLJA 2AVDA 3ZZ1A 1ODJA 5E6UA 2TSYB 1WM1A 3GFRA 2I7TA 4A15A 1JKIA 4AAYA 1PJ3A 1UMDB 3QQPA 1USKA 3UMYA 2DXIA 3NUZA 1FNNA 1O96A 1SK9A 3RIXA 2IL1A 1H69A 3W3AD 2GM9A 1TK2A 3ZZTA 2JFYA 4LRSB 2YHIB 1O5OA 4HDKA 1VHDA 1Z0FA 3OAAD 4BUJA 4DLZA 1M8FA 1QO9A 2P90A 2Q0QA 3R3WA 1XV5A 2GWRA 3HZRA 4GVPA 5HKLA 4QGHA 4RPJA 1BHQ1 4LSZA 3GXBA 4E09A 3NYIA 3A0RB 2QVLA 3HLTA 3QKRB 1EFAA 2RJNA 2FY8A 3GRCA 5DLPA 1RRKA 4W9RA 1TUEA 1UFQA 4GC9A 3TGPA 4YALA 4UMDA 2P1DA 1LNSA 4G2TA 1JHOA 1FQWA 1QFXA 3OX1A 3WIOA 3CVWA 4G1MB 1VL5A 1P2GA 2CVOA 1HM5A 3QG5A 2HBYA 1L5YA 2XRZA 4PGHA 4ZVTA 5ICMA 1FRNA 3WGUA 1EFRD 4FZJA 1L8XA 4RD6A 1HE2A 5AVKA 3EQ6A 1E77A 1FP6A 5CX1A 4MGYR 4MP6A 3B12A 3C5CA 1IL0A 4LHZA 7MDHA 2VG8A 3D59A 3O8QB 3DKVA 3LXMA 1E59A 2XV1A 5AXCA 5H4GA 2GEDA 1ZOLA 2VEOA 1N4AA 5ECGC 1KK1A 3GL9A 4ISCA 3IB3A 1OREA 5DHTA 4MUKA 1KPGA 3WA6A 5LZ2A 1RC8A 3Q2KA 4A8HA 5JH7A 2RI6A 4YRBA 1P3JA 3DBOB 1CUCA 1II8A 3L7YA 4OFWA 3BBPA 2VQEB 2WF8A 3VC7A 4M9SA 1UEXC 4XDYA 3JYQA 4Q3DA 2VH1A 5DWDA 4PG7A 3I2FA 4FI3F 4Q4AA 5F5XA 3K1AB 4R9UC 3DXXA 1EK6A 3KG2A 4IRMA 4B71A 3T5PA 3TG2A 1YK1A 4D74A 1SKQA 3H9UA 2PXXA 4JU9A 3LTNC 2KSQA 3T7CA 1K86A 1JYSA 4B44A 4CZ2A 3L7IA 2FNAA 3UAZA 4AN4A 5JZOA 4BPRA 3KSRA 2AD5A 4NBLA 4RTPA 1IXYA 5F9FA 3CI0K 4HAZA 5TGDA 4DW8A 1QC5B 2BR5A 5FAKA 3OKFA 1J9EA 1JQ3A 5EJ4A 2G0TA 3TNJA 5L7WA 1P45A 1Z16A 3N59A 5C53B 1C8LA 4G4SP 4LF6B 3HMQA 1CY8A 3E3OA 5FNVA 1QIGA 3H0CA 3B6ZA 3RO7A 2X0JA 1TNDA 5DGHA 3ZY2A 4DIBA 1PEYA 4TLLB 2XTMA 1RYZA 1XTIA 4CIDA 3IVGA 1NQOA 4E13A 2PIDA 3QKRA 4ECEA 4RORA 3SN6A 2WSYB 3AVWA 1I6KA 1QV9A 5C4GB 3DO6A 1UC9A 1KI3A 2FPSA 2QI9F 5DEIA 1Q91A 3OIUA 4M83A 3N2IA 5GIOE 5F9HA 3DOFA 1E61A 3JPYA 1CB7A 1CUYA 5K0LA 5DGTA 3DMFA 2XOEA 4HY3A <