3COZA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.0 ang resolution- in complex with sulphonamide inhibitor 4
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3cozA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3cozA01
4H3SA 1QRSA 3P0IA 2A1UB 1YUMA 2A7XA 5KCMA 4KR9A 1N78A 3ZJUA 4R2MA 2QUKA 3KT6A 3QE4A 2RD2A 1QTQA 3UY4A 5K0TA 1T6ZA 3PNVA 3A05A 4MUIA 1KKUA 3D6VA 1YIDA 1R6XA 5HG0A 2CYBA 1VBKA 4I6EA 2CUZA 4ARCA 3INNA 4U8HA 2GM3A 2XRZA 1K92A 3LCJA 4DNXA 4EG7A 3G5AA 4YP7A 3ZJVA 3CR8A 2DUMA 2DXIA 4EFKA 1QJCA 1MAUA 3H97A 3IVGA 3MMXA 1O94C 4P2BA 4S1OA 3DV2A 1MB9A 1GN8A 3ND7A 1PFUA 1KH2A 1IHOA 2J09A 3UMVA 1ILEA 2DEUA 4MWCA 1OWNA 1LW7A 1GLNA 4HPWA 1WXHA 4PBTA 1YIAA 3I05A 3FIUA 3TS1A 2R5WA 2BYTA 5HUHA 1EFVB 3JXEA 1H1TA 1ZH0A 3SEQA 4DDMA 3MUEA 4MW0A 3ISJA 1JGTA 4R0NA 1BS2A 3COWA 1WXEA 3X1JA 2NSYA 3RJZA 1O97D 1F7VA 1FYDA 1O5TA 3CLUC 4HJXA 3GMIA 4ZT7A 4ARIA 1M83A 3CLTD 3H9BA 4G5FA 3ZUGA 1MBZA 4ND7A 4EG3A 1PFYA 2HZ7A 4CDMA 3AL0C 3CLTC 1WJGA 4J75A 2QUHA 4DDHA 5DASA 5H7XA 5IHXA 1M1ZA 3X1KA 4MVWA 1JHDA 3TZLA 1K4KA 5J5AA 1G8FA 1PG2A 2PZAA 2QTMA 1IH8A 1O94D 4RPIA 1T6YA 4MVCA 2OQ2A 1T9GR 1B6TA 4QBTA 5TS2A 1I6LA 1VBMA 3G6KA 3Q12A 5DB4A 1OWOA 3ZJTA 5KHAA 2O8VA 1TQ8A 1IRXA 3ND5A 1M8FA 5FNZA 2QUIA 2A4MA 3KT3A 3CVWA 3BL5A 4ZT5A 1OWPA 3IOBA 2E21A 1COZA 4ND6A 3LOQA 1V47A 1EJ2A 3SZ3A 3QTTA 4MUNA 1O96A 1Q11A 4I6GA 2RE8A 4MW4A 1IFXA 2ZP1A 3TQIA 1K97A 3DLAA 4JFAA 4NDAA 1DNPA 1WQ3A 1H3EA 4PBSA 3H99A 2PXHA 1EUYA 5EKDA 1JEDA 4YMIA 4DE5A 4OUDA 2HGZA 3CLRC 3PXUA 4QREA 3HGMA 3N8HA 1TEZA 1I6KA 1N75A 3AKZA 3FI0A 4MWBA 1J1UA 1GAXA 3DO8A 2QJTA 5H16A 3VU8A 2CT8A 2Z3VA 4MWEA 1EFPA 4U7JA 4MVXA 1JMVA 3K32A 4J76A 4ZCRA 2A1UA 3ZXSA 3A04A 3IVCA 1MB2A 3RK0A 4YP5A 2X3FA 2G36A 3A4IA 4BWVA 2CV0A 3COYA 3SZGA 1Q15A 4MW6A 1HYBA 2JANA 3F3MA 3FNRA 4XFJA 1QU2A 2H29A 3CVXA 3CVVA 5LLTA 2PZ8A 4ZT2A 3QTBA 1J21A 1NUUA 1MOPA 1XNGA 1R6TA 3IMEA 2QTNA 3ILVA 3K9WA 2Z08A 1QQTA 1YUNA 3GLVA 4ZT6A 3ZGZA 3VRHA 4FZJA 3MXTA 1NP7A 2HMAA 4TS1A 1RQGA 1G8HA 1NURA 1WZ2A 1TYBE 3HFJA 4DDKA 4I6JA 4F3RA 1ZJWA 1QRTA 1GPMA 4MLPA 2A1TS 4L2IA 4HJRA 2DETA 1IQRA 3RBAA 1VBNA 3L93A 1NUTA 4MUJA 3COVA 3P0HA 1U7XA 3IUBA 1YULA 1I6MA 1M8GA 3OP1A 2PZBA 3SYTA 3GUZA 4MQ6A 1T9GS 4Q16A 3FHJA 1EXDA 3CVUA 1H3FA 3PNYA 4YBRA 1WKBA 2JAXA 3CLUD 1KR2A 4PBRA 4PY2A 2WQ7A 2X1LA 4MW1A 4A91A 1GZUA 1WXIA 3MLAA 3PNBA 3DPIA 1WQ4A 1T6XA 4MWDA 1J20A 2DR2A 1U3DA 3SDBA 3RHSA 4EF6A 4JXZA 3FWKA 1G59A 3IMCA 3CA8A 4KR6A 3UC5A 4KPUA 1MJHA 1PFWA 1N2HA 1WXFA 2D5BA 4Q93A 1CT9A 2J08A 4HK4A 2BTEA 1GTRA 1WOYA 3IODA 1JEEA 3H9CA 4DLPA 1J09A 1KQNA 4ZT3A 3RK1A 3UK2A 4MVYA 3AFHA 2CYCA 1ULHA 2PG3A 1MC1A 3COZA 4DJAA 4ZCTA 2XRYA 1JZSA 2Z09A 1U0BB 1X6VA 4XFDA 2IJGX 2A1TR 3N2YA 2A86A 1N77A 3FETA 1KH3A 5TEVA 2CFOA 3CLSC 3CLSD 2CV1A 3PRHA 4JZYA 4QRDA 1JZQA 4MW9A 1WY5A 4WSOA 5IJXA 3VGJA 1IVSA 1F9AA 2D13A 2NZ2A 2QJOA 2CV2A 1PFVA 2I1LA 4MW2A 3IOEA 4AQ7A 3ND6A 3M5WA 4KKVA 2J5BA 3IMGA 1MRZA 1ZH6A 3N9IA 5F23A 5K0SA 2QTRA 4CQNA 2CSXA 5DEOA 1TFUA 4EG4A 1U3CA 4OJMX 1VLHA 4EGAA 1U7DA 1VL2A 1QU3A 2V0GA 5DK4A 1O0BA 4E1AA 1N2EA 1LI7A 1UFVA 1N2GA 3HL4A 1A8HA 5LM3A 4ZT4A 1QNFA 4ZCPA 4MW7A 1H3NA 2AG6A 3AIIA 2VTBB 1XNHA 2JA2A 5J58A 1X8XA 1KAMA 2GKSA 4UZFA 3L92A 3AG5A 1Q77A 1O97C 3TZEA 4EG8A 2D54A 4KR7A 2QUJA 1F7UA 4MUHA 4CT0A 1EFVA 4GRIA 4OUDB 4F4HA 2PFSA 1SURA 4NAUA 3UOWA 1P7PA 1IQUA 2OV4A 4YP6A 1N2BA 2EJCA 1PG0A 4UZEA 1M8PA 1NUQA 4ZCSA 3TQOA 1O96B 1XJQA 1OBHA 3KFLA 1JIIA 2TS1A 1KP3A 3H05A 3OTWA 1N2JA 1WXGA 2ZUEA 3E27A 3X1MA 3P0JA 1F4LA 1QRUA 3AG6A 2J4DA 1OD6A 1KAQA 3NV7A 2DERA 3ELBA 3SEZA 1KORA 3HZRA 4RUKA 5AHWA 1R6UA 1YI8A 1MAWA 2H2AA 1NYLA 1TYAE 4NATA 3RFFA 5JBNA 3NBAA 1Q19A 2WSIA 1KP2A 5TEWA 5J59A 4CDNA 4MUFA 4K0RA 4JXXA 2GOYA 3D6UA 1O0CA 4GU5A 2YXNA 1N2IA 1NI5A 1LI5A 4MUKA 3IVXA 3FH0A 3NBKA 3C8ZA 2AZXA 1XNJA 2E89A 2EL7A 5FO1A 3G59A 4K03A 3FDXA 3FY4A 2CYAA 3N05A 3Q10A 4NAHA 3CVYA 5KWVA 4EG1A 2WQ6A 1OBCA 3ZIUA 2X0KA 1M8JA 3HMQA 1M8KA 3LE8A 1NZJA 3FOCA 3MLBA 3CLRD 4MAFA 4U63A 2B7LA 1KQPA 2YWCA 1EFPB 4MUEA 1G8GA 2IELA 2ZUFA 4XSVA 1J70A 5HUJA 1I2DA 3KT8A 2VXOA 3ZXIA 1JIKA 1O95C 4X0EA 2J07A 1NUSA 4MUGA 3SP1A 1S4MA 3KT0A 1TYDE 1OWMA 4AS1A 2X1MA 1IQ0A 2O5RA 2QJFA 4EG6A 1N1DA 1Y42X 1OWLA 1N2OA 4EG5A 3A2KA 3P52A 3FG9A 2V0CA 5BNZA 3IOCA 1FFYA 2DPLA 1KH1A 1O6BA 1N3LA 2E0IA 4MULA 4R2LA 2E18A 4JYZA 1NSYA 1EUQA 2DLCX 1EE1A 5FO0A 1K4MA 4MW5A 1TYCA 1J1ZA 4G5YA 2YWBA 4KPUB 4WNYA 3S3TA 1JECA 2A84A 4ZCQA 5LFAA 2YY5A 3TNJA 4G6ZA 2IP1A 3U1VA 2A88A 1KQOA 3HV0A 3IDFA 4NX2A 4NZPA 5TGTA 3IUEA 1GTSA 1D2RA 2C5SA 3IH5A 1JIJA 2VTBA 1V8FA 3Q4GA 2AKEA 1O95D 1NUPA 2PIDA 2WB2A 4L2IB 1JILA 1ZUNA
chains in the Genus database with same CATH superfamily
4N1AA 4EY8A 3QE3A 4G36A 3A9CA 3BD6A 3IQGX 2HTFA 3DVAA 1O03A 3B48A 2FGKA 3OCYA 1T6ZA 2D2XA 4OMFG 5AK5A 5DPMA 4F3CA 4YRSA 1UMBA 2B1JA 2VBCA 2JW5A 3DP9A 2JIPA 3ONNA 4ARCA 3UT0A 1OMOA 2HHLA 3QELB 3RH0A 4DWWA 4PVCA 1BG6A 2RGUA 4X1YB 5KNBA 1G8AA 4YRPA 3G5AA 1HEUA 2E6UX 2F1HA 1SUPA 3LFHA 2AX3A 3U3RA 4F5WA 1U8XX 5J4YA 5FLXA 1U4OA 1XJCA 5NULA 1BQEA 1MAUA 3W3ZB 2O06A 4B3DA 2Q4OA 4LZNA 2OT3B 5E7JA 1MR3F 1WB6A 2DHEA 4PIPA 4DCPA 2VPIA 1OA1A 3DV2A 4U9IS 4Y8VA 1CZNA 1JSRA 3TNLA 4MQEA 2VP9A 5JSYA 4HDKB 1WMDA 3OLXA 2ZDGA 3R1IA 2BEJA 3IJPA 1IIBA 1M0TA 1YRYE 1EUCA 3H2KA 2OWDA 4RFSB 2Z5FA 2DEUA 1YQGA 2B92A 3MS2A 4MP8A 4Q15A 3NYWA 3FOBA 1M33A 2B8EA 5DBEX 5FPTA 4CR8A 221PA 4WJZA 2O8CA 1LXCA 3P9SA 2H2WA 3ZDFA 3FMPB 3K0HA 2PSJA 3RUEA 1XQ1A 1H1TA 2QZZA 3O8QB 3V46A 2A35A 2D0DA 2XUPA 5KEIA 2TMGA 3AJAA 2V8BA 3FYUB 3QY0A 4BZPA 2WTNA 5C8XA 3VJRA 4I9HA 5H68A 2E48A 4PZEA 2F9FA 2E3JA 1Q50A 3ENVA 5DLEA 3L6EA 2G83A 5KQPA 3DEAA 4EI8A 2CHFA 5GGYA 4LV6A 5I48A 3GCGA 2RH9B 1EX7A 1OQAA 3AVWA 2QD3A 2OAEA 1U8EA 2DR0A 1EB9A 1N1MA 4K6GA 1KIMA 1MRNA 2OC4A 4I1YA 4DVGA 4MCJA 4NOJA 4QGSA 4RHCA 2IT1A 5BR7A 3IVRA 5HGXA 2YINC 3BGVA 1DIAA 2VR1A 3OU7A 4IRMA 1GM5A 3MAGA 2HZ7A 2EQ5A 4CDMA 4Q37A 2WYIA 4TVBA 4O3MA 4URFA 3DLHA 1KFKB 1VYVA 4J75A 1EM6A 3S2FA 5ICEA 1G3IA 4KB5A 1NQOA 2R86A 4ZI7B 4FDLA 3LQYA 4XLLA 3GGJA 3N2LA 3PQ7A 4XPZA 2DTXA 2VJMB 2NO5A 3NWBA 5AOBA 3HXMA 5JJLA 3NNDA 3HO6A 4EZEA 5JQGF 2C5HA 2HIMA 1OFHA 4UTPA 3BTUA 1Q1EA 1T5DX 2HB6A 2J0QA 1TF5A 3ZXYA 2WFZA 1S2GA 4IEFB 1NJ2A 4TTSA 5DNYB 8ABPA 1B0UA 1VI5A 2JLSA 5EE5B 2NWQA 1TJ3A 2H2HA 3RT9A 2GERA 3EZGA 5J2TF 1P33A 4F46A 2BPOA 2VJPA 4EKNB 5BNWA 1ZAKA 1PSZA 2V5AA 5AFSA 2Q9AA 4ONEA 1DXOA 2I34A 2JZCA 1GRRA 1FUIA 1NXSA 2JS7A 4C6TA 1GZ4A 4G01B 1JSXA 1MEJA 2PD3A 1QX3A 3ND5A 1H85A 2PX6A 2X3YA 4MSUA 4TWRA 4OQDA 1GTL1 3BWMA 3DBIA 2C7BA 3Q1KA 5LB4A 3T5DA 1L7PA 5KWIA 2ZRCA 3HBNA 3OU6A 4S35A 1WUTA 4M38A 3L7DA 2PEZA 2QVZX 4KQKA 3RF7A 3CO0S 3LBFA 4PO1A 4Y2QA 3AJ9A 3WG9A 1MD9A 4KWEA 4E12A 4F5ZA 3LWZA 5ENZA 2RE8A 1K97A 3A28A 2Z30A 3K2IA 3ISTA 4BCBA 3E7WA 4F21A 2ZYHA 3UJAA 3BMOA 4B46A 4RPCA 1K8ZB 421PA 1U5CA 2NPFA 1SVNA 4MYUA 2KX7A 4OUDA 4YREA 5LQSA 2BISA 3E35A 4UM8B 4X44A 5JNUA 2J45A 2BEWA 2BF4A 4WT7A 3PUIA 3N8HA 5LYYA 4UAJA 1QKJA 3I01A 3N70A 3EIWA 4N49A 3ZR4B 4MWBA 4ZMRA 9MHTA 1WBJB 2Q5OA 3NEYA 4KAFA 3GT3A 3DTNA 1Y8CA 1RS0A 4L0DA 4MLDA 3C5WP 3UUEA 2P75A 3RQIA 4BO9A 4FKBA 4JR2A 1UM8A 3DGEC 4BBAA 3N07A 3C1AA 2GUWA 4TYMA 1PS9A 2Y6UA 3ZXSA 3L8HA 3NFYA 1ZU4A 3OCVA 5CUQA 1YRWA 3R6WA 2RGNA 1Y81A 2RG1A 2ZSFA 2QY6A 5ALPA 1H9BA 2FY8A 2RHBA 1A9XA 1NY6A 3C5CA 4A8JA 3AFNA 4PC2A 4R2WA 1KHHA 3F3MA 3BB3A 3B3FA 1LRJA 3TXAA 4B81A 4FIZA 2AUTA 3M5CA 4WTOA 3P45A 4ZVMA 5AVTA 1JDBC 4OX9Y 3A3NA 2AZMA 4BO2A 4Q47A 1RXIA 1G3MA 1YL7A 2DT8A 2O8NA 5G4KB 5LCXA 2HMYB 4C0XA 3I1FA 4DCOA 4ES6A 1TLLA 2V4MA 3OPYI 3K70D 4QJBA 2GFHA 2ZU0C 5DGIA 1KSHA 2NTVA 4PG4A 4INZA 3GDGA 4LPKA 1JJIA 3M6AA 1EH5A 1UKAA 2QS9A 3HB7A 2HU7A 1DJLA 1N8TA 5L3QB 2VF2A 3C3AA 3LQFA 2WMDA 1UT8A 4ZKDA 4LQCA 5EZ5A 2ZUWA 1K63A 1QHXA 5NLLA 5E1DA 5IKMA 5K0GA 2EKZA 1OI7A 1XCPA 2I6FA 3U49A 3WYBA 4NDNE 4OOEA 4MHOA 4C3OB 4F60A 3HVHA 1D07A 5HBGA 2DBVO 3PQFA 5KSOA 4I5GA 5K5EA 1PVVA 4HSGA 3E9ZA 4ZZ0A 2D7CA 1W85B 3U48A 3WMGA 4BO3A 4XJSA 1XFDA 3WY9A 2D1TA 3SVLA 4J8PA 4ZC1A 3ZC3A 1CJBA 2R66A 4I0WB 5JLAA 1X1BA 2HNAA 5FQOA 1Z5UA 2YCBA 4OX9B 1T4BA 4Z49A 1X19A 4PY2A 5BVHA 4FDVA 1SG9A 4K3VA 3FYCA 3A9TA 4DQDA 3GYGA 1H5NA 1U1FA 3JZMA 4KLAA 4ZHQA 3JASB 3KB1A 4ENVA 3ERCA 2KWIA 3V3KA 3B8EA 4MV4A 2GZSA 1SXJD 5BOSB 2QK4A 4WXMA 4DNFA 4COKA 4LF9B 3BC1A 4AD8A 4Y0NA 4YAIA 4JBYA 2HA4A 4CTNA 3DP7A 2XYVA 3E82A 1HPLA 4P81A 3IB3A 2GDZA 4DOMA 4GWLA 4X7BA 4MYSA 2RKWA 3LPDA 4K6KA 4XIFA 2NUTA 4QG3A 4G0PA 2Z9BA 8ADHA 4AN4A 5JBQA 5AHRA 1N6PA 1JLSA 1MO6A 1X15A 3K1AA 1L1RA 2X4DA 4OMCA 2O8DB 3UMMA 5CH5A 3X1WA 5FOQA 1UQUA 4Z4IA 3TAUA 5BWMA 2QRHA 1JA0A 4MIEA 4WKCA 1C9NA 4YP9A 5DCYA 3MFYA 4EB3A 4AO6A 1W2HA 4QYIB 4ZCTA 4LISA 1GLVA 3ZWWA 2KLHA 4E5SA 3DUFA 4KH1A 1ZR4A 3JD4A 4HH3C 4BYMA 3MA0A 5FBLB 1QLJA 1NOJA 2YJNA 3WK8A 4JSYA 4GD3Q 5IDVA 4QHTA 5LZ2A 1ESCA 2FHPA 2VNJA 3PF8A 1J2RA 1KI2A 2PPLA 1A9RA 2J3EA 3BQNB 2W7TA 3VM6A 3QPVA 4CT5A 3BXZA 1X7XB 3QNUA 5BURA 4B6PA 3IAS1 3MWFA 5F35A 3VGJA 3BTVA 4NH0A 2G25A 3OICA 2G08A 4KAJA 3JAKA 5ALDA 2DPGA 1AKNA 5M7EA 2V9PA 2VDLB 3ZE1B 1A0OA 3QOWA 3CVJA 4J1TC 1QTNA 2HJVA 4LKOA 4PLTA 3CRW1 1IBLB 4W8GA 3N7UA 4EJ2A 1XZBA 2J5BA 3S1AB 3T5CA 1MABA 3ZWMA 2C9MA 3SCZA 4GOLD 5BQ5A 4Q6WA 1Y4UA 3T5TA 4DA6A 4D9HA 4UEJA 5BSHA 4YJFB 1E1DA 1TF2A 3QUSA 3WLQA 3SQMA 1U7DA 4PIVA 3TLEA 1G42A 2O50A 4NQRA 1I9CA 2R48A 3VVBA 4CKXA 2CMHA 1QFMA 1DAGA 2FFHA 3E3LA 1KYWA 3IIIA 4IJUA 4REQB 4J49A 2XMBA 3G0CA 4ASUA 3LAWA 3QU7A 4EUSA 1QNFA 5IKOA 1E2BA 2ZT8A 3KOMA 2XYHA 1B6GA 3V5NA 2PYDA 2RAUA 5JH7B 1QWSA 5KMGB 4F12A 1CY2A 4M0UA 1H3NA 1OIXA 3MJFA 5GV7A 2VTBB 2X15A 2JA2A 2PUDA 1X8XA 1F8FA 1GAWA 2GKSA 2A9OA 2VPYA 3DVRX 5L4LA 1MZVA 1V48A 1E0DA 3N2ZB 5BYBA 2ZYUX 3EVCA 4WZZA 4AK9A 2CXUA 2P1RA 4H9GA 2AD5A 1DDOA 1K6MA 3D0KA 2JFNA 2FLVA 4F3YA 5K4AA 5K8UA 1EEXB 3GO4A 2Y1FA 3V4SA 1P1IA 1V6CA 2Q6VA 4IJVA 5ILQA 1VJRA 5DM1A 3L8YA 5TQ2B 5L7YA 4CMHA 2XQVA 4E09A 4JS0A 1L8QA 1ZSNA 3TQOA 3U3KA 1XXHA 3K4QA 1GXSB 2Q7OE 5IT5A 4CVNA 3H42B 3O3OB 3QGMA 4YT8A 3SXJA 1KP3A 5IAKA 2FVYA 1HF3A 2B35A 2OV3A 5GONF 1M6WA 3VPXA 2GX6A 4CF3A 1PWXA 3TW0A 3QKTA 2WWRA 1KDTA 5L3RA 5H8WA 3AT1A 3ZHZA 4HI0E 4ITUA 1T91A 4DC0A 2Q3BA 4HAVA 2GEBA 1MP0A 4FC6A 4NCIA 1BYUA 2RI1A 4QNRA 4R1MA 3SEZA 2XUHA 1CQJA 2J31A 4ESEA 3A3KA 3FVVA 1O6FA 1SKYB 1GQRA 2FMHA 2AMJA 2FPWA 4QX6A 5A5EA 1ELOA 2CCJA 4JB0A 3Q1LA 3M9XA 1SWWA 3EYWA 4N6OA 1D3AA 3TZBA 1PJ2A 1TO1E 2HBZA 1X2EA 4KO8A 1HT3A 4R81A 1YL6A 3LUPA 2QTCA 4IZIA 4UBJA 3I73A 2FZ4A 1ZOOA 2FQWA 3RFFA 1SU4A 1EAYA 2AE2A 1AMNA 1POXA 2L17A 4LOJA 3KZ1E 4X00A 3E03A 1Q0UA 3UMSA 4E33A 1W30A 2ACVA 4FNOA 4D8VA 5AUNB 1LI5A 1LU9A 2HSDA 1PJZA 1GU0A 2ZE7A 4QXAA 3WI7A 4BNFA 2VYFA 5J2UB 4EKYA 1Q1GA 3VR5H 1IBKB 4B3XA 4N0MA 3TXXA 3FDXA 4FMCB 2ZI3A 4H2DA 1XLWA 1R8SA 4EDFA 5KWVA 1YZGA 1ZN7A 4E3WA 3W5BA 2BFFA 4MUAA 5JSZA 1KVUA 2XUFA 4RPKA 3ITDA 4RQTA 3GRAA 4DLNA 3GVXA 2OKCA 3C3BA 1FC0A 2O0MA 2WJVA 2WF7A 1XVLA 1PGQA 1LX6A 1QK3A 3KP1A 5JCZA 1VYHA 2PA3A 1SVSA 1NMQA 3IHWA 4NH4A 4I46A 4US0R 1BXRA 2ZIAA 1QYVA 2YDYA 4DKXA 1K3FA 5EY5B 3R8FA 2PTHA 1ODFA 4W99A 4Q34A 2Q5JA 1NUSA 3SP1A 5A71A 2ZTLA 2FMTA 4CQMA 3H11A 3M83A 3EIHA 5CXUA 1GPDG 3CZ9A 1J0DA 3WP0A 3PI7A 3TTSA 2QJFA 3Q9LA 4B6RA 2YXLA 3QQPA 5KNDA 3FNQA 3JYQA 1WSBA 4CMEA 1PHRA 1KKMA 1CUVA 1LV8A 2IYAA 4QT4A 3OPMA 3JWHA 1A82A 3R77A 2W48A 4IJKA 4K9DA 1KI9A 1DTWB 4YHBA 3J81k 5EHIA 2BHLA 3FDFA 3VR3A 3EAFA 3G2OA 3ZDRA 1ZSVA 1HQDA 1ODKA 3T99A 2XXBA 4R2LA 3G1TA 5FNVF 2QTTA 3VC2A 4H15A 4M1WA 4WECA 2HWKA 2SKCA 3WLFA 4OLHA 3E3OA 4E14A 2W6CX 3ED5A 3OE4A 2C2HA 1IY9A 3VR5A 4FFLA 1OFTA 2ZUCA 3G2KA 1W25A 1QK5A 3L4BC 4AS2A 1NHGA 1SD2A 2OPHA 3BSFA 2A88A 1J97A 1G5IA 2FPLA 4BGUA 4PX3A 4P3NA 3NTVA 4GWKA 2OAQ1 3IOMA 2VDWB 4HZUB 3TF5A 1P7ZA 4D96A 3TIVA 2FAXA 3ZVRA 4IKEA 1ZY2A 4Q3BA 1PSDA 2I9PA 4X1YA 4A36A 2Q5IA 3R6LA 2E6KA 3JQAB 3ZZUA 1QH8A 3FIJA 2OGFA 1R50A 4E46A 2V7QD 4I3FA 1YI1A 1H94A 3OOYA 4EHBA 4TVSA 4LXHA 4CIWA 2QLJA 5AW0A 2NUBA 3M1IA 1J42A 2VDWA 4HZUA 1M2JA 3ZBTA 1JILA 1IBMB 1VHWA 3AINA 2VSOA 3P0IA 2A1UB 1GSOA 2R6FA 3A1WA 4YLEA 3SF0A 1ESDA 2XECA 4OM7A 3RTBA 2REOA 4GYKA 3FE2A 1SUFA 4MXDA 2O8CB 1TUIA 3GLTA 1MFZA 1VBKA 3GGSA 2X9LA 3A6DA 4J0FA 4EAQA 4EVQA 1G1AA 4F3TA 1W36B 1XNRB 2YHAA 3B6EA 1A7UA 5E8JA 3SMQA 3WMXA 4B6FA 3UBTA 2HCFA 4GE0A 3TLBA 3JQ8B 3HQ4O 4JCCA 4J3NA 2WUWE 1G4UR 1OIVA 4U0JA 4RKYA 3IVGA 5EQDA 1CS4C 3GLHA 4OJKA 2C59A 4A6PA 4DA7A 1R18A 4UATA 1OHHA 5HFNA 1I7LA 4DIDA 4RA9A 4XVCA 3F8WA 5KTNA 2O5CA 1DC4A 4JBIA 2QRZA 2EEZA 2VEDA 1WZEA 4NU5A 3THYA 4LVUA 4UM5A 5LDDC 1UDBA 1PFGA 1Z5WA 2VDMB 2XB8A 3NHWA 3N6XA 5FUVA 1GGEA 3TS1A 1YHNA 1Z6YA 4Z1MD 1RR6A 1X0VA 1Z4JA 4E6PA 1KE2A 2OLJA 2JH3A 4LX8A 2Q3DA 1RBMA 3DSRA 5PGMA 1A69A 4NZMA 2Z58A 3T0IA 4LJYA 4CODB 1NSFA 4H35A 4RA9B 3CCFA 1EVEA 2RGGA 4NNOA 1Z63A 3B89A 1E58A 4G41A 4MGYR 1SVMA 2IHYA 1K08A 1JR4A 3TECE 1O5TA 1E2UA 2VYNA 2XGGA 1EFHA 3BXOA 3LPMA 4LVNA 3SIWA 3WLAA 2BGTA 5BV7A 2R1TA 2W71A 4PLFA 1UBTS 4X93A 3M9LA 1Z56C 3RC2A 2DZDA 1P77A 2FCAA 4FCCA 2R5FA 4ZALA 5UKDA 1Y3HA 2HQRA 5ALVA 3HU5A 4P0PB 1BAPA 2AEFA 2CVHA 2P1ZA 3H9BA 4DSUA 3PSHA 4RWZA 4HEHA 1YZVA 4OB7A 1F38A 3VJLA 2IUEA 4MI9A 1R6DA 2NSHA 2PJUA 5ICFA 3VO9A 5ALLA 2P0YA 1WJGA 5A6SB 1WB4A 4S12A 1T24A 3GEHA 4IXJA 4K86A 2PR2A 2XGMA 4QXMA 4QYMA 3OHPA 2I54A 4HAYA 5C2JB 3I5YA 3K6KA 5A4JA 2ZRDA 4TGLA 4YCCA 1Z2OX 4UULA 1AKYA 5FOSA 4XJVA 1E0KA 3DOFA 1AGNA 1ORRA 3GJ4A 3TD6A 1IH8A 4X91A 1R37A 2DE0X 2IV7A 4CHTA 3P2IA 4BQPA 1E6CA 5EXTA 4L6AA 1WA5A 4U7TB 1CEEA 1RPJA 2ZIZA 3Q7QA 4FN4A 4NY1A 3WL8A 4DWOA 4JI1B 1E3SA 3MHPA 3CWQA 4YUWA 2GPJA 4DC9A 3TRIA 2I66A 2PWYA 2XOKA 1OXXK 4GBJA 2A67A 4PFKA 4GOXA 2C88A 2XUKA 3H2BA 4YRQA 2P4SA 2BEKA 2GK3A 2J4FA 3AF2A 3GDOA 3IERA 4LYGA 4TSKA 1L4KA 4I3HA 3FZGA 2QUIA 3RTDA 1TGVA 2FN3A 4GX5A 4UBLA 5CH8A 1ISMA 3NBMA 1IWPB 3DB1A 2RK6A 3QEKA 2Q6OA 2IECA 4G0UA 1IL0A 2CJYA 2XRMA 3FTCA 3ODPA 4IFEA 1BC5A 4C88A 5CDSA 3Q8KA 2LPMA 4X3OA 3I1YA 2OLKA 2WMNB 1JFRA 1J7KA 2WA2A 4GPAA 2ZP1A 2BVNA 1KMQA 4Y1FA 1RZVA 4NDAA 2EZUA 3PQ4A 4LDZA 3IURA 4J07A 4MV7A 4KNVA 4AIRA 3KZVA 4MAAA 5AK3A 3SYNA 4D9FA 3D8SA 4AS3A 4Y2RA 2BN4A 2RI6A 3PNLA 4YJ2F 3GC6A 3AETA 3HB4X 3JVVA 4RULA 1G4HA 5FFNA 3FNGA 4IX1A 3BDIA 4IQ8A 3ML1A 2I29A 2AN1A 2F3RA 4Q3EA 4QBGB 3N58A 2FEKA 1KZ9A 4PNZA 1D2NA 1KJIA 3QE0A 2ZSAA 3DZBA 1I7SB 3G0HA 4YMVA 4B4UA 1MXFA 2ORYA 4ALKA 5EJ4A 2GARA 4HFRA 1GY8A 2OM6A 4ZQBA 4I14A 4IXDA 5FHRA 2IV3A 3VZCA 3HR7A 4ZGWA 3DKPA 4PTYA 3KQHA 3AVUA 4BJ1A 2M2IA 1IN8A 2ORVA 3BGOS 4M6WA 4I66A 3A04A 4O1HA 2XAAA 3R41A 1UJ2A 3BX1A 1SQ0A 4ZOLF 3SC6A 4R2IA 4B7ZA 4Z9BA 2PS1A 3CNBA 2QD2A 3A6FA 3DBVO 2Q3CA 2DLDA 4RVGA 1TYZA 2NT3A 5LC1A 4GAEA 1BDBA 5B64A 5HYVA 1YL5A 1VJTA 2BJWA 3NIFB 4X9XA 5BSMA 1ZC3A 1Z12A 2EFDB 4WKOA 1HTWA 2H07A 1U8AA 2RGEA 3P8ZA 4UTXA 4CQLB 3H9QA 1I2MA 1U80A 5LU8A 3PYLA 2P2YA 1QLHA 3IP1A 2QP9X 2WJ4A 3K3PA 5INTA 4N48A 2ZI4A 4R84A 4GVPA 1EP2B 1XLTC 1GGFA 2Q8PA 4DIBA 1R00A 3KZNA 3OHSX 4MQEB 1W36C 3FXAA 1MC4A 5DYYA 2Z6AA 1P9NA 1U99A 4UAUA 2A50A 1PJ3A 4A2PA 4BV9A 1G8HA 1H6CA 1BVHA 6GPBA 1K3TA 4YECA 1GG8A 1DOHA 3T9FA 1W4LA 1AGYA 1HURA 3LXUX 5KDLA 4F3RA 2V6FA 3ZWOA 4YCMA 5FADA 1FSGA 2HFJA 4FLEA 1U8CB 3NT5A 2FH5B 2IYPA 2V03A 3TQQA 3M4NA 4BLQA 2R8EA 3LLUA 3ZY4A 2PDAA 4DSZA 2GYUA 3AR7A 5CB8A 5JUWA 1UH5A 4DR5B 2BTOA 3V8EA 2BELA 3PJEA 4LI0A 4M9CA 2ZIXB 2C03A 5DCLA 4D3FA 3OZRA 3R0VA 4P54A 4R9RA 4MVJE 2Y0PA 1H23A 2ATXA 1Q0SA 4O2AB 4U1RA 5EC8A 5JQGB 1I6MA 1M8GA 2H5JA 4LHSA 2D5IA 4KO2S 1YBFA 5BSTA 3TSWA 5I9SA 1RAIA 3CBQA 3WXMA 1NJ1A 1YJXA 2G17A 3DTVA 5E7IA 2Q41A 3R3SA 4XIIA 3VH4A 4YBRA 3EARA 3VUEA 3NIGB 4B6EA 4OGGA 5I7OA 3I42A 3B7WA 4Q1BA 3DQZA 4LHZA 3CG4A 5ALOA 1HDZA 5BR4A 3NTQA 2P69A 3VOSA 3GELA 4GGOA 3HCDA 4X8OA 4X7MA 1ZUNB 3C1TA 3DPIA 4CMBA 1P4RA 4MTCA 2NO9A 5DJ5A 5E95A 3VSEA 3OCUA 2DPXA 1AQYA 1TCBA 4L8WB 4U2EA 1N6OA 2PWPA 4HQRA 2ZAOA 3GNTA 3NWPA 2IPLA 2ATCA 1HZJA 4HCJA 2C4TA 3RJ5A 5JNWA 3EG9B 1TQ6A 4GG1A 3PHHA 2QHXA 4M46A 4YJGA 4C7XA 1YB6A 2TMDA 3IVAA 4PN3A 1CYDA 1Q84A 4ECEA 1E9CA 1U0EA 3A2LA 3IR7A 3VNQA 4POAA 3TDNA 2H8GA 4E94A 4F3NA 2ECQA 3OJOA 4NONA 5DXJA 4W9NC 4LWPA 4AT1A 2FVXA 3CN9A 1WDWB 1REQB 2GS9A 2CXPA 4KFSA 4YA6A 4NCNA 4ZT3A 3FMGA 2CXXA 2HWWA 4XWOA 4DMRA 2FSFA 3Q85A 5F7OA 3TX6A 1XX6A 2VQEB 3H5WA 1RWQA 4ODIA 1WF3A 4QT0A 4YRMA 1B0PA 3IP8A 4E32A 2AI3A 3EGDB 3U26A 2OFWA 4U3JA 1Q1BA 2VRCD 5KU7A 1BE1A 5G2FA 1KTVA 2Z56A 3ODGA 3A3YA 1YRLA 4EJFA 1AMUA 3GUCA 4I4TA 3D6JA 4FQ7A 4DG8A 1TZ2A 3PRHA 3T35A 4NU6A 5JFTA 4UDXX 1L5LA 4TWIA 4BBJA 1T9ZA 4DCVA 4J03A 1UKBA 1XU4A 3LGSA 3EOZA 4IG4A 4D9CA 5JAIA 5BR8B 1WF6A 4JENA 4BNYA 2JGDB 1GO2A 2XYRA 2QVLA 3HRKA 1FFGA 4PHTA 3A11A 4WXEA 3LYUA 4NE2A 2AK2A 3RIHA 5JCJD 1PJ4A 3AB3A 4A27A 2Q5CA 5AI5A 1L0BA 4MR7A 5LZ8A 3ZOKA 3FUTA 1ST3A 5K0SA 1SFRA 1NVXQ 1T1RA 2ZAIA 4OK5A 2RCYA 2OZLA 3KHKA 3NANA 4R16A 3EZFA 4RJLA 5CXXA 3I0NA 4YTEA 3ZWQA 4EGAA 1T1GA 1MO5A 2JFOA 2F62A 3WGZA 2Y1OA 4ZOLA 1KRXA 3ZK8A 3MGCA 3SSAA 1UR5A 3H9JA 3PD0A 4HAUA 1NE7A 1Z5VA 4MLZA 1EK5A 1J8FA 3FUCA 4JK3A 1ZWLA 1XTSA 2QAGA 2H52A 2OXRA 2EZTA 3DR3A 3IE2A 3SU8A 2H59A 5B1HA 3VHXB 4XVUA 2JIRA 3JASA 4JJKA 4N9WA 4CM8B 4YAKA 1PUIA 1VLVA 3AIIA 2B0CA 1EWYA 3GROA 4IMRA 4WBNF 1YMQA 4RL4A 5AK0A 3QV1A 4L4YA 3MFQA 4H1VA 4UZFA 1VJ0A 3ZVKA 3IFSA 2D54A 5G02A 3VC3A 4E5MA 1EWTA 3FRHA 2LWIA 3ZCPA 2YWDA 4EH1A 1T8PA 4JYAB 3PEYA 5B30A 1ZM9A 1BGWA 1FPMA 1QHIA 3B1KA 4D4LA 1SKAA 4CMCA 1LPAB 4RX1A 1VLZA 1KJYA 1P7CA 1M1YE 2G5PA 1YDEA 3GVCA 4IKPA 5HF9A 5D1NA 3GCZA 2B5WA 4FGSA 4BX9A 4EIWA 3VO2A 1TJNA 4GI5A 4Q39A 1TPZA 4O1IA 1D4AA 3ZQUA 2JLQA 2VJOA 3QW4B 1FXWA 2TS1A 5IYZA 1IWBB 5K0BA 4O4LB 3JSAA 3I9V1 4H1HA 3FVWA 4MVJP 3JQ7A 3OKPA 1OPRA 5LLSA 1EUQA 2ZRPA 1OB2A 2YHUA 4CNQA 2HYIC 1X1QA 4XDYA 2C5EA 1P44A 2GVDC 3ITKA 4P7BA 4UM9B 4IOKA 2YV3A 4KUEA 1B23P 4CETA 4L9WA 3K9FC 4ZO7A 1FFEA 4GPIB 4NJEB 2KLBA 3PFBA 2EBWA 2Q2OA 3Q15C 2QGNA 4RA6B 3QVSA 4OL0A 2B0JA 2Q0SA 2P6RA 3CQ9A 3NBAA 3C4JA 3OLQA 4NFHA 4NWIA 2OD9A 4WQMA 4X20A 3DFZA 3UAXA 3T06B 5D6OA 1FOEB 2IXTA 2LP4Y 5CW2A 1L4BA 1MUUA 2R6ZA 2BKUA 3ZGYA 1QKKA 4Q1AA 3WTBA 5EJEA 2FJPA 1YGPA 1U3VA 5ALZA 5HDQA 3WC4A 4BO6A 4F2GA 3C8ZA 1PYGA 3A14A 3PVCA 821PA 3LXMA 4X20B 3H5TA 3H11B 3WXBA 3RE1A 2GDJA 3ZWNA 3I37X 3WE7A 2RKOA 1C80A 1ZW1A 5AI8A 1YFLA 2OLEA 3D3KA 4EVRA 4EAAA 1NJ5A 1KMIY 2I4TA 3ESCA 1CTQA 3F4KA 3Q6IA 1NATA 1FJ2A 2XNKA 1YE8A 1JFVA 2IHTA 3BBLA 1PX2A 4YJ3A 1YO6A 5K3CA 1OXUA 1DVRA 3FGNA 4CKEA 3TZKA 1EFPB 4MUEA 5SYMA 2A3RA 2ZJ3A 1TMGE 2ALJA 3CX8A 3DT9A 5IVIA 5JHGB 2YKGA 3GX1A 3GLGE 3FOWA 3ETEA 1SG0A 1K6EA 3FPCA 2CKMA 2V96A 3GCWA 1KAOA 2J07A 2PBZA 3DCIA 4E7OA 1XMJA 4YJ3B 4D0NA 1I51A 5B4TA 4A0HA 2IDZA 3OO0A 3EDQA 4W63A 3FR8A 1H69A 1NL3A 2X1MA 1IQ0A 2AQIA 3OIGA 1WDLA 4QWMA 4URYR 1K4YA 5I9BA 4KN5A 2QGFA 1RLIA 4AY4A 2GRJA 4DIMA 1M9NA 4QGBA 4G1FA 1PK7A 1V1MA 3EQ2A 2Z1DA 2C2MA 2FJ0A 3CWZA 3PGXA 2OV8A 1HKHA 1NW3A 2WTMA 2W93A 4BP3A 2C0CA 4U39A 1D7AA 2BUCA 5EPOA 1N0UA 2YWGA 3EGCA 1JLKA 1G60A 2BM1A 3IKLA 4UMEA 5EXEA 5GVRA 3B6MA 4JU9A 4CI9A 2CHUA 3D8BA 4LYHA 9ABPA 3ER8A 3LL7A 5TF0A 2VNHA 3B5EA 4OP3A 1U7OA 2DLCX 3C41J 3VPHA 1DT5A 4KPEC 1DZIA 3T3NA 4KXNA 2PMFA 4G86A 2G1AA 2YWBA 4LEIA 4DUGD 2EP7A 2CXRA 1N0IA 4EKGA 2P9EA 4P58A 3EQ9A 2NXNA 5HMLA 2A84A 2YYYA 5CYPA 1KO1A 2YY5A 3C1UA 2QLTA 3PXBA 3T7KA 3PD7A 4PAOA 3JR3A 4ZZ3A 3JD3A 1P2BA 3UXEA 3LBAA 1Z7YA 4DCNA 1U8TA 1LF0A 1PDVA 1WDKA 2L82A 4JR1A 3VH3A 4BFUA 5JSUA 4HATA 4NZPA 2VKQA 4LWQA 3VISA 3WBFA 2X13A 1I1OA 1T29A 3R75A 3VPBA 3ZV7A 1HFKA 3BL6A 4KLZA 4ALMA 3VX3A 2XR1A 1TKBA 4ARSA 2QWXA 3K9NA 4MR8A 2VTBA 2OCYC 4BLOA 1CBUA 4TT3D 2NUAA 1T3ZA 3Q4GA 1NG1A 4QDKA 3QPDA 4BLVA 1LF5A 2PH1A 2W00A 4IDFA 3QQ5A 5IAGA 3MWDB 4QYWA 3ZVMA 3LC7O 1XI2A 4DB2A 3MJDA 4MV5A 4NJOA 3GAMA 1ST2A 5HM8A 5HQ3A 3ZBUA 4RVSA 2OVFA 4H3SA 3RIEA 4BWFB 2A7XA 4PQYA 2CCGA 1HA3A 2ZK7A 3A6KA 4Z51A 4EKEA 1OX4B 2Q8QA 1W1IA 4X1IB 3P0FA 1ISGA 2AJ8A 2I55A 5DHTA 2QJRA 1HOTA 1V43A 3U9LA 2GPYA 1CDEA 4OAOA 4A0QA 5KYWA 4PU0A 4AJ1A 5A05A 4HVTA 3FTFA 1SKBA 3EIOA 1HNNA 5E1BA 3MYYA 3VSAA 1IMOA 1XVVA 1PD1A 4OTZA 3MMXA 2YDXA 3L8EA 4X3PA 2HDWA 2B78A 1L5WA 3PNMA 2UYCA 1E3LA 3G9QA 4WNIA 4OGLA 3BJZA 1PR5A 1OWNA 1ZONA 2GYWA 1JW9B 2IPXA 5IT0A 4QUIA 3HDGA 4GXQA 3IP6A 4XAQA 3FDZA 1FQOA 1YIAA 4KXUA 3DH0A 4GLLA 3V42A 3I4LA 2QRMA 3OIFA 1VXOA 2YYSA 3DOCA 4RDIA 3U1TA 3F6CA 3SEQA 1JKJA 1RXUA 4B44A 4EVIA 1LPMA 3EFOA 1NQTA 4LTMA 1OVMA 2PH7A 4C7VA 4Z3KA 3E9QA 3ZH9B 4MI3A 1UFKA 4NR0A 5KAMA 1J99A 3NBFA 2V9ZA 1GG2A 3HBLA 3CJRA 1DBQA 4DY6A 5FWNA 4UDNA 5HCIA 3T3EA 4NE9A 1ZGGA 2YS6A 2CBGA 1QVZA 1ZPDA 2O5EA 2GCOB 2V55B 4CM6A 3JALB 3M81A 5AYVA 5BN5A 3LC0A 1RFLA 3LY5A 1SOVA 3LP6A 1NDHA 4MJLA 4YPFA 4A8HA 5FL7D 2OBBA 5DHUA 1O9HA 1HDEA 1P0FA 1KO4A 3EODA 3KJGA 3P71T 3OKCA 5JPIA 4YJKA 1XU7A 2DB3A 1B7GO 2TRSB 4EW6A 1JBEA 4HWSA 1V5EA 3NC0C 4EMBA 4JY7A 3GT0A 4UEWA 5KYXA 3GLFB 5KTYA 5I7UA 3TJZA 2RARA 2H6EA 3KU4A 2XUIA 2BRUC 4R0VA 4MVWA 2UDPA 2JEZA 4FMCF 1QF6A 1UWLA 1R4NA 2G8NA 4DG5A 5DNWA 5EPUA 4LRXA 3V4PB 2QTMA 1AHIA 2P6NA 2P2SA 3O91A 1YRQA 4JLOA 4U7WA 4ZANA 3WYCA 1KEKA 4NECA 1AXEA 3ZIDA 2AC7A 2BHSA 2GYVA 5IANA 3KUXA 1VA5A 1NW5A 3FNEA 5DX1A 2HA6A 4BMCA 2CFRA 4RQAA 4JELA 4D44A 5P8WA 3EDRA 4ZXPA 5CT8A 1PGJA 3Q12A 4NL4H 4P4NA 5AESA 1SXHA 1UBMS 2XKBA 4GOND 5JD4A 2IPOA 2X7JA 4BFLA 1SUIA 2O8VA 4NEHB 4NKRA 2XBLA 1FSZA 2G06A 4PLGA 2RHLA 3IUQA 3K72B 4DC1A 1NMZA 1W5TA 4BFCA 4NK4A 1X42A 4BNUA 2GBFA 1E94E 3OEYA 4EO9A 4U2FA 2QW0X 1I0IA 2Q4EA 1J90A 5LP6C 2JGKA 1COZA 5F1OA 5EMMA 3R9IA 2V3WA 2FHSA 4JITA 3U9SA 4EZBA 4F91B 2PO5A 5J5VA 4HYYA 1NFRA 3V34A 1Z16A 1A4UA 1W4BA 2L42A 2XHEA 3AZQA 1PV1A 3K5HA 4EW3A 1CIPA 1V45E 5I9LA 2X0EA 3LCRA 4RV9A 4FR2A 1IDN1 1TD9A 1DP4A 3BHJA 2O19A 3GRRA 1ZU5A 1EP3B 1YDMA 1ES9A 2FW6A 2YOHA 1HUQA 1YVRA 3LKZA 3TAHA 2EF1A 4S0ZA 2B61A 3PL1A 3WLPA 3CUVA 3GJYA 3WSTA 4JEIA 2XUZA 4Y6SA 3V2GA 3FOFC 5H83A 2Z3VA 4RSHA 1IN4A 4U5XA 4U7JA 3ZY3A 4QJ5A 1ZBDA 2NO6A 1PFKA 4MGKR 4OXXA 2R1ZA 1Q7CA 2YZKA 3MT9A 1XZDA 2A1UA 2X1HA 1V8BA 3H7AA 1PG5A 3NNNA 3PXDA 3R44A 2VT2A 4ZOBA 5KJCA 2YRFA 3QEAZ 4MQFA 3K9QO 1F8XA 3PRJA 4JODA 4IWNA 5DTEA 4HC4A 1CPYA 2V7UA 3E9YA 2RGRA 1AXGA 3G7NA 3L8GA 3I5UA 5DH9A 5L45A 2REBA 1P7WA 1T15A 2X0RA 2PZ8A 5AOAA 4LK3A 2WIKA 3GH3A 4ZEMA 3JQ8A 4ZCIA 4MQFB 1UK6A 2X2EA 3IR5A 1RAEA 3P2KA 2XADA 3BT7A 4B1FA 3P2JA 3K9WA 1MAVA 4K05A 4U2DA 1QQTA 1T3TA 1CDDA 1E9RA 2BFBA 2OK7A 2X8LA 4ZVOA 4D4KA 1XPUA 1FDRA 3LX8A 1TEXA 4NF2A 1E5LA 3N76A 4K1LA 2BFMA 5JT1A 4YCNA 2WKQA 3IBTA 4JAVC 1TA0A 4BXOB 5JS2A 2G6TA 3QBVA 2B83A 2A0YA 4ZU6X 3NOXA 5E3JA 4IUCS 5SZHB 2Y9MB 3EIFA 4R9VA 1G18A 4TYNA 3KL2A 3O2QB 1CZRA 2IY8A 2W9XA 2Z8XA 1JHZA 3B3QA 2I4RA 4B3CA 1SCAA 4OXRA 5JXHA 3DLTA 5TT0A 1WZIA 1ZM3A 1NUHA 1WMFA 2WJYA 3WKCA 4N47A 3VI4B 4IW3B 3ZHTA 1G5QA 2EWMA 2QG9A 1SUAA 3TJMA 3TSAA 4B79A 4B7XA 4CKCB 4B3TB 2JASA 4XD2A 4RAQA 3KRTA 4DCUA 3A9VA 1W4RA 2B4KA 1EAMA 1EVIA 2H57A 3TSYA 4Q9JA 3C85A 3GPDG 1MA0A 2X42A 1RJEA 3FHJA 4J4BA 2WF8A 1JSZA 1UC4B 2P5SA 5JRZA 4LMBA 3IC5A 4ESHA 1JQKA 3BWVA 2RKBA 4DR7B 1SM4A 3W5HA 4PBRA 1WOMA 5H02A 5IVPA 1DAOA 2OR3A 4EJSA 2NO7A 2G9VA 1Z25A 2ZRJA 3VOBA 1A2OA 3JQQA 4MWDA 1P6XA 2VT6A 4I1UA 4DMMA 5AUOB 4YROA 3W1EA 2GTIA 2XGJA 3RU2A 1ZW6A 2XH8A 4MVJG 4QTUB 3IEPA 4TYPA 4U7PB 4YQZA 4RY8A 3T7AA 3BMCA 1X70A 2H7VA 2JLBA 4HQKA 3AVVA 5AHOA 4XE5A 1SPBS 1OHHD 4ZU3A 4BV8A 5MFPA 1N5KA 4XJTA 2GD0A 2VLBA 2QTZA 3Q3VA 3ORHA 3QHQA 3EXHB 1LLDA 1AC5A 1V11B 4I8XA 4UDYX 1BS9A 2QLFA 4D42A 1DCTA 3QK7A 5JJIA 1J09A 4TV9F 5HOQA 5LJLA 1JPVA 1KWGA 1LSSA 2W6JA 4LJ7A 1M1XB 1X1CA 1F9EA 3A1TA 4TRMA 4D9IA 1HI9A 4RVUA 3MWKA 4GECA 1F20A 1T9BA 1IEVA 3DZ8A 5K03A 1Q44A 3O0TA 2GN0A 2VHWA 2I3GA 2PBFA 3S81A 1L5OA 1QHHA 1FA9A 1ETUA 1NFFA 2EV9A 4QAQA 2HRRA 4EL0A 1KH3A 3VDQA 1RI4A 4YR9A 3WYGA 4R1SA 2QDKA 3W6UA 1Z74A 3PQDA 4PZLA 4JZYA 4RBNA 3FKSD 3UOGA 4F85A 3USES 1SOUA 5A02A 1AHNA 2XWSA 4MWSA 3BD7A 4RESA 3MHTA 2E4WA 4LPSA 4WSOA 16PKA 1HEIA 3ME5A 1GFWA 4ZQEA 5IJXA 4BO0A 3Q72A 4UXIA 5F7ZA 2PQ6A 3SJCA 3NVKI 4XZ3A 2OMKA 4C20A 3D4OA 4O4HB 4OK6A 1QCDA 1W5BA 5B6IA 3TQRA 3GRUA 4MW2A 5HS6A 4LGVA 2NXWA 1Y8ZA 3M5WA 4M1KA 2GR7A 1KMCA 2OYCA 1KQFA 1WXDA 1ZEJA 4O2AA 4QPDA 4ACBA 4MDHA 4BN5A 2EFHB 2X4LA 3I64A 4QDTA 1JEQA 1O0BA 1V8ZA 4DPLA 5BXYA 3T4UA 3U6KA 1YB4A 1Y3BE 4M6WB 4REMA 4KNWA 4ZVQA 4IIYA 4KACA 1L7VC 3QOYA 1Z0ZA 4R8MA 1Q6ZA 4OI0A 4OIFA 1JDJA 3D59A 1M2KA 1NM5C 3D54D 3TN7A 2ZRLA 1E7WA 1D03A 3LFTA 4J9VA 2JI8A 1C3OB 3OPNA 3V7NA 1TKAA 4CWAA 3HLKA 2C2XA 3LGAA 2LVBA 4PG5A 1BKYA 3G7SA 4EK9A 1GQSA 1EZ4A 5ELMA 1ATIA 1OGJA 3AG5A 1ZOLA 1XQ9A 2AVNA 3O83A 4GUDA 1F14A 4TTPA 4YMSA 1THZA 3RRNA 1XA4A 3K6SB 2WWFA 1KEWA 2G82A 3OUTA 2ONYA 1I4OA 4GRIA 2ZWIA 4TLCA 4BMXA 5JY6A 3EFBA 2CSUA 1U8YA 5G41A 5KDDA 3OBBA 3EXG2 4LZOA 1E9BA 2AG8A 5EL0A 3PT5A 1PG0A 1D4OA 4MR9A 2HJWA 2I6XA 5DYWA 3WHIA 2WAYA 5K0FA 3EEFA 2ZBUA 3H16A 4F4JA 1ADJA 1IXRC 1JFSA 3FVRA 3DBRA 5K99A 4XUDA 4GEKA 3DKRA 1PJLA 1D4ZA 1O96B 5I3ZA 4JP8A 1QZZA 1VBFA 5KTOA 2E4VA 5GGXA 3EQZA 3KFLA 4D79A 1FUUA 5CLFA 3WA7A 2X19A 2P9CA 3VTAA 4RZXA 3OQNA 4LF4B 3KETA 3MT0A 2GBCA 5U4XA 1NJ6A 4GPEA 5J3JA 3RG8A 2GNPA 1EFRA 4N5MA 3VX4A 1W4AA 3ZK7A 4MRPA 4PYMA 4FOLA 4D4IA 3K0KA 3NRBA 3KZKA 2UV8A 3NOQA 4CR7A 4LSZA 4FYIA 3S2SA 2O23A 5BQXA 4B3RB 1MZPA 2D5CA 5H0IA 3SDSA 4LXTA 3TMYA 2BBOA 2ZITA 1HYGA 4LJKA 1PZNA 1D5CA 3BFJA 4NATA 5F2OA 3H9EO 5JBNA 1JJ7A 1V39A 4D45A 1Z0SA 1JN0A 3ROTA 3LUCA 1AQJA 2QMZA 3P27A 2ZWPA 3HWSA 1IATA 3JD2A 4N3CA 4ZVVA 1IXKA 4AMBA 5K8JB 3WHKA 1SD5A 3D6UA 3LHSA 4RWEA 1AZLA 4Q4CA 1YH3A 1B4DA 1ZITA 3S7TA 2R25B 1E60A 1E1LA 1IU9A 5TRTA 4C4XA 1Z13A 2F1IA 4HLQB 1C4XA 1I3OA 3AETB 4XYLA 4XB6B 3Q3CA 3E7FA 5F98A 4FFPA 3N7AA 4GNRA 4PLVA 1KKLA 1XN4A 3MCAA 2P9FA 3OTGA 4RVHA 4PRKA 5I7SA 3RYCA 3R9KA 3EPHA 2H0AA 1D6SA 2PCJA 3PGJA 3U2QA 4N3BA 3IVMA 2YR0A 4MAFA 3CLRD 3WLJA 4FJ2A 1SULA 2G76A 5B4VA 1EJ0A 1NLMA 1NONA 2QPLA 2NXJA 2ZQ5A 3W3AD 4Z1OA 2XVZA 5CLJA 1LBEA 1CQJB 4DV3B 3UAWA 3FCCA 5L3ZA 1H4VB 2VUUA 4OXIA 4TT8A 5L3QA 4X65B 3B78A 3GEEA 4BLWA 2HIAA 2Z4SA 1EJBA 1OA0A 1ULTA 2GMWA 2QZPA 2QLLA 3F6RA 3KWJA 5AVJA 1WV1A 3FTEA 1DMSA 3QOXA 4HB3A 5F2EA 2XX3A 1VG0B 2RHTA 1THGA 3MTQA 3QU5A 3QWAA 2VHJA 4V0LA 1U8FO 3QLEA 2CE2X 3OC0A 3HPRA 4TL7A 4I4TB 4CTOA 4F4IA 2QBYA 5HFJA 3GP5A 5HNKA 3WLHA 3PC6A 1DBVO 3VV2A 3TEMA 3F73A 1WVMA 3A2KA 4Y3UA 2O2GA 3STWA 2J87A 4JMPA 3CF4A 3FUWA 4JC0A 5HK9A 2I7DA 4GL2A 4ENTA 2HEIA 1FVXA 4G0MA 3CEAA 4B4VA 1CQWA 1MPXA 2G07A 4GRDA 1GZHB 3WL4A 3I61A 2ZB7A 3NVAA 4IBOA 1X80B 2VUHB 3G2LA 3TD9A 2BI4A 2ZJAA 4KXLA 3HR4A 5DK6A 2BLLA 3V80A 2ENWA 2IHBA 2P41A 1R5JA 2EFEB 3MYRA 4J1SA 3GXOA 2X9NA 3OURA 3V7YA 3VNAA 3AILA 1IWOA 1Z88A 4MI1A 2J3DA 4S2EA 3U17A 5FD8A 1Z5PA 4K7JA 4WK4B 3PYMA 2GESA 2J7PD 5CU7A 3GN1A 3GZNB 2CNLA 3WDSA 4D41A 5KOHA 4NENB 5KOYA 3R8XA 1QHEA 4EY4A 3E9DA 3BMQB 5DW0A 4FS8A 4CMIB 4LHVA 5CDFE 3MWEB 1TCAA 3C1OA 1WZCA 2IIVA 3UIEA 2JA1A 5F76A 2FPMA 3GRKA 2H9YA 1A1SA 4RY9A 1KXZA 1V5GA 4I5DA 1XCGB 2EQAA 4JBGA 1CUFA 2AQ8A 3CW8X 4MQ4A 5F3RA 5K3SA 2CLLB 3QPCA 1JR3A 2O8DA 5EMNA 2BBWA 2WQZA 1YS7A 5AXCA 4LXQA 3DE0X 1KOJA 5LR6A 3AYZB 4D97A 5AK6A 4YCDA 4R1LA 1TEVA 1ZUNA 1BCSA 3ASYA 2VLIA 2AVDA 2ZOSA 3PNPA 3L41A 5HS4A 3WJ2A 3U7HB 4WZAB 5GAJA 2VWQA 2A30A 4RPLA 3PNVA 5JAHA 1N33B 3OCXA 5I4CA 2KB0A 2XVAA 4I6EA 1D9ZA 1C3JA 3CH6A 1JTVA 3H1FA 3V1TC 3E5RA 3SHQA 1SKUA 1WVIA 1U4NA 1LPPA 2PVCA 2PRZA 1ZK0A 3A7EA 3RRYA 4DLKA 1JUDA 4FYXA 3OI7A 1BX1A 3AUXA 3DAGA 2IYSA 1S3GA 4QBIA 4RK4A 4K6OA 2OESA 1J2EA 2C9CA 1H4TA 3LLCA 2W22A 3SC2B 1S8FA 1A2BA 4W5HA 1CB0A 3ZY6A 5KQSA 4GPZA 2NP6A 4JEMA 6NULA 4UBNA 3JR7A 1IHOA 1K5HA 1XTBA 2VOJA 3AW9A 1FNBA 3K09A 3QKSA 1AKVA 1S2DA 4OO3A 3HUEA 3I83A 2ZCVA 2BFNA 1SVWA 4MKXA 2Q4TA 1WXHA 3TRJA 4MV0A 3EGDA 3O93A 4YRKA 4U3JB 3DW1X 4FZVA 4TT3A 1EFVB 3F9IA 2AZTA 3IS3A 1PRYA 1DX9A 3VVLA 4RPGA 4DMKA 1X74A 2WI8A 5FOXA 1QAMA 2Q62A 3CUUA 4L5BA 1SAYA 2AFHB 3CMMA 3QNWA 4F6LA 1JGTA 2GN6A 2P65A 5FAKA 4G8DA 1WW3A 4K81B 2FPKA 3DNMA 2YASA 4YAFA 3RJZA 1OAKA 3NBQA 2XCIA 3L6BA 3SQDA 2BP7A 4QGGA 3GGGA 5CDGA 1JMKC 1HWYA 2WJPA 5EA2A 5IMBA 1P73A 1H4QA 3PPVA 4PSAA 4JJFA 2FEXA 2ZZKA 1VMKA 2KPOA 3GMSA 3PX2A 4IDCA 4HH0A 3IMKA 4ISCA 1RHQA 2PL1A 1XOIA 2WT9A 2P2ZA 3B1ZA 2Z98A 1V4BA 3O2SB 3RUAA 1ECCA 3W0LB 3PQCA 1GZ3A 4BIMA 4LY9A 1J39A 1XDBA 2XDQA 4AMYA 3NOOA 4ZYVA 3AL0C 2GJAA 1RKVA 5REQB 2JJ1A 4HQ6A 3NEAA 3V9AA 2PX4A 2XB9A 3GFGA 4ZPJA 5HJ7A 3NDBB 3F2IA 1JA9A 2AMYA 3KQUA 3C97A 5EPEA 3K0CC 1M1ZA 3EGWA 3L8CA 3W3AH 4C0KA 4ZOLB 5AKHA 2O3JA 3GIDA 4E30A 2QE6A 2BMAA 2Q5HA 4P5PA 3QYFA 1JDPA 1F06A 3AR8A 4I9GA 1N34B 1GGJA 1Y33E 1OXMA 4EEKA 1G8FA 1VRCA 4CM5A 3CH5A 1VMIA 2ZWOA 1UJ4A 3PHCA 3VHXA 3CUKA 4WERA 3MCWA 5BORA 4RPIA 3QOFA 4INPA 4JI8B 2O2SA 2VNSA 3ICQB 4OCZA 3WLOA 1VKNA 5CTAA 3RAPR 1F8UA 5DZSA 4LFAB 1Z0FA 3E70C 4Z5XA 2BMEA 2AA3A 3Q7EA 5HZHA 3VAYA 5JR3A 1U8ZA 2Y77A 3RUPA 5KBYA 4OEHA 1HY3A 2EF0A 3G6KA 3OTIA 1WD7A 5DF1A 4CLXA 5IJ0B 4CEHB 3S1LA 3Q2OA 1NBHA 1RYEA 4QQRA 1TQ8A 3EPJA 4NRDA 4F8EA 2IZ0A 2GILA 1M34A 2Q49A 3KEFA 4HWGA 4IQGA 4EABA 5CA1F 1EG2A 1VDZA 2B7BA 3VQTA 1CKEA 1YTLA 3K8QA 2B34A 4GP6A 3TKLA 4CKBA 4TYWA 3LQRA 4XLZA 2RHHA 4QFDA 2HBYA 4I99A 4Z9FA 1PS8A 1L5GB 2VP3A 5CFLA 2E21A 1UBUS 3ISVA 1RZ3A 2Q1TA 4QXPA 4YPOA 3KCNA 1X8KA 4TKUB 1CB7A 2DKNA 1XLVA 1Q11A 3F49S 3NP7A 5JCJA 5K6AC 2PGNA 1CJTC 2LV8A 5KQGA 2ERCA 3FRIA 1FE8A 2YN4A 2YYZA 3E2IA 4D9MA 1ZJ4A 4D46A 4F1WA 2PMDA 4ZARA 3ZH2A 2AV6A 4E4YA 4H7PA 9GPBA 5HW0A 1H5QA 1ZMRA 1JEDA 4OBBA 4U2KA 1P5ZB 2HLHA 1Y6GA 5ALYA 4AB1A 4AP6A 3DHYA 3IHLA 3E8SA 4ARBA 5A5FA 4B3SB 3ZHCA 2D4AA 4HYEA 4RHTA 4XM1A 5H1YA 1U0TA 1USVA 1ZL2A 4MZXA 3MN1A 1CEQA 3O90A 3GJTA 4CN9A 3COJA 1T1SA 2PLFA 4I5FA 3RT1A 4WD3A 2J3IA 3S2UA 3TSZA 4C5BA 5I7EA 2QUZA 4CE6A 5JTTA 1W0KD 1M2OA 1UFRA 2GKOA 2ZBEA 1T3GA 2HL6A 4PPNA 3QEBZ 1YNOA 4BV3A 4RTOA 3PQ8A 3OZBA 1OROA 3EHDA 3CZ5A 1TZBA 2XCLA 4P36A 4EMTA 3KHTA 3AF3A 4K8RB 2H4FA 1XMPA 1NULA 3QBTA 2E87A 1FP1D 4QDOA 5FNVB 2UVPB 4F6RA 2ZIEA 4A6EA 1A8SA 2JH9A 4HGNA 3DLCA 4X60A 4UQOA 1OZ0A 2GR9A 4TROA 4GZMA 4YCJA 4B35A 4DCCA 1FLAA 2PKQO 4XFJA 4PZDA 1QORA 1XLUA 4TQ9A 3WX0A 3QF7A 5J47A 3DL2A 1BWRA 3O8DA 2VJDA 1XDZA 4TZ0A 2DT5A 1UOQA 1YZNA 2HWXA 3LBNA 1MN6A 3SQWA 3G13A 3TNFA 4GI1A 4M9UA 3I2YX 1CQPA 2DY1A 1OYOA 2GZ3A 4AO7A 4GYJA 4FLFA 5TLSA 3C3YA 1E1NA 3AEKA 5G3YA 3PYXA 1N8NA 4HQ0A 1RVV1 3L46A 4RVFA 5BUZA 4NHEA 2INGX 2Q5QA 1BE6A 1FTWA 4DDKA 3MB8A 4PO3X 4ZJPA 2ZKIA 3PC3A 4CFZA 5CBKA 4BE9A 3NEPX 5FOUA 1ACJA 3L01A 3B1VA 2CNNA 2O4CA 2R7AA 4OB8A 3X44A 5JCOA 3ZDZB 2ANCA 2D1YA 2GLTA 2GHRA 1NR1A 3AIKA 2QN6A 3FBWA 3JATA 5CPBA 1FS5A 2QYTA 4FJ1A 1T4GA 4HRVA 4HXYA 3CM0A 4KYIB 3B3GA 4MV3A 4PC1A 3AV3A 3SJZA 1DKMA 1N3IA 3G2JA 2QLMA 3I9V6 2KYRA 2OBLA 3CZMA 3N8KA 2AT1A 3PUZA 3FOZA 3GRFA 2ZZNA 1RJWA 2VA8A 3OIYA 1GZ6A 4EEXA 3F0TA 3U5TA 1KK1A 4DABA 3D64A 1T0PA 4V03A 2FEOA 2VJAA 2YC4C 3WGIA 1Q21A 2X0IA 3CLUD 5IJ9A 1FTQA 1JG1A 2IH2A 1RIFA 1ZZGA 3KQVA 3WLEA 2FN4A 5ADHA 1KJWA 5JIBA 1KZ4A 2Q9BA 3KE8A 4KW7A 4BDSA 1C30B 1NVBA 3HJNA 1NV8A 4UAVA 3WRXA 5KYXB 1FMFA 1U3DA 1K0UA 3F98A 4IFBA 3AONB 2VZ8A 3DCNA 3FWKA 2WM8A 1C9EA 2ZSEA 3CFYA 1ENPA 1ESMA 4XA8A 1YT5A 3UK1A 2ZUUA 1DLJA 3DONA 3EMBA 4RV5A 4YDHB 2OB2A 2QSUA 3LQ2A 2L19A 4KPUA 3UWKA 2HX1A 4DZRA 2DPMA 2CL0X 1WXFA 2C7RA 3RS9A 4CM9D 3CT4A 4R9UC 3OZVA 2Z4TA 3IEUA 4UNRA 3DOIA 3ONEA 5F3DA 4ZGGA 2ZSJA 2DBQA 1YR7A 1NP3A 2RGDA 3W2GA 3CLKA 1SZJG 1T8WA 2JVJA 5EG5A 1KQNA 1BFKA 2R6DA 1W93A 2IQIA 4GBGA 4O4IF 4I8IA 4GQBA 2DQSA 2VAMA 2OG2A 3OZWA 2R60A 3OX1A 4AMUA 2OHJA 3TE7A 3VZQA 1BXRB 4ZTUB 1T5BA 3RYHB 5FF9A 4RPJA 3AY6A 3D6MA 4N0DA 4Q7JB 4HNVA 4IIGA 2EX0A 2QG4A 3SZOA 1CYEA 4DMHA 5ALFA 3FETA 1EXMA 1GN9A 1YGYA 5E9JA 2NVUB 1OTYA 1IN6A 3PNQA 1JEQB 3ILYA 1V35A 3WK4A 1M2FA 3D6NB 3MUFA 3C3KA 4MVJF 3HDTA 4ER0A 1C1DA 4I1RA 4YBZA 1ISRA 2OQRA 1ZZEA 3RJMA 2GSWA 4FYVA 2B21A 3EXAA 1IVSA 5JH7F 3OEEA 1RTKA 3SFTA 3V4LA 2NVUA 3BFPA 2G71A 1YBMA 1FK8A 4B31A 2FFAA 1A5SB 1YI0A 3F46A 4HGQA 4U8GA 1G63A 5F2NA 1SHTX 5KTMA 3DZKA 1P4AA 1OJ7A 3IMGA 1NWHA 4QULA 1I3LA 1OVGA 2JVIA 3FPSA 1TPYA 3NHFA 3CC8A 5AKLA 1RYYA 2O0HA 1M6VB 5C53B 1FXSA 2JJ2A 4WGFA 4X8MA 3IOYA 4ZI3A 5DK4A 1ISPA 4FFWA 3C4QA 1C3VA 1FY2A 1DBSA 3Q7PA 3V8NA 2ZATA 1F3OA 1VP9A 1OTXA 3HL4A 2BFFB 3OAAA 3R7SA 1VTKA 4PTZA 3OFSA 5KYGA 3PC7A 3FPLA 1IEWA 3CFIA 3QUTA 2FPUA 4CCWA 4WFJA 1PJTA 5LNK6 4MKIA 1KBZA 3SZRA 4HYTA 2UKDA 2JFPA 2EG5A 1PJ8A 3PRKE 1LY1A 4X6LA 4W7HA 2NTJA 4EG8A 4BX3A 5KNCD 5J1TB 3ANXA 1QRDA 3EXHC 1GEGA 1CR2A 4Z3DA 4E2WA 3BULA 4OHPA 2JFXA 4QOIA 1NAIA 4PFSA 1FTNA 2IIPA 3FFBA 2LD4A 4P9NA 3ZZMA 1N2BA 2IX9A 4WXYB 1JHQA 4C4YA 1QCYA 1Y6RA 1ZD5A 1R0SA 4UZEA 5KTTA 4DV5B 1M2EA 1TYEB 1V11A 1NUQA 4HZIA 1TC1A 1QUEA 2DQYA 1HC7A 1WWKA 2IOHA 3E3AA 5ALJA 5EZYF 3ET5A 1UPUA 3GJ3A 3EC7A 1OUMA 5ALEA 4O4JB 3T95A 2PS9A 2AI2A 3G2MA 1IHPA 1HE4A 1YKGA 1G6OA 1NKVA 2FPGB 4GC9A 4ZICA 4M87A 3I2IA 3OP4A 3RUCA 1NLUA 5HA5A 5A1TA 621PA 1L5RA 4YGXB 4KYVA 3RU7A 3UMFA 1XZKA 3D6AA 2V7TA 5I01A 3F2VA 1T8TA 3QI7A 3LK6A 3GRPA 3PXCX 1F1BA 1KAQA 2CVFA 3DMNA 3KOZA 4W1SA 2J3QA 3CW9A 4ILEA 2PD4A 3RBVA 5I9IA 2F1KA 3H3FA 2JAUA 1KP9A 4DLZA 3Q3JB 3THYB 5EERA 4DY4A 4M3NA 4A03A 2Q4BA 5C8YB 3L8ZA 1TQ4A 2H31A 3BPSA 4M8IA 1UPXA 2HCTA 4N01A 1OH6A 3DOEA 2H9AA 2DQKA 2IE0A 3DXZA 3H0EA 1KP2A 1IJKA 1NF3A 1E1RD 3RIGA 4XH9B 1IAVA 1C1YA 4MK4A 4KVFA 1RLUA 2DH5A 2J9RA 1DRVA 2BR3A 2PFKA 3CH4B 1YS1X 2HK9A 4C4OA 2OPBA 3HG7A 1XCBA 5IZCC 4QPPA 1L9KA 3W1VA 2VT3A 1N7GA 2VAXA 3DLPX 3EZYA 4P7KA 1E0SA 4WPGA 5JWHA 3CZ4A 4JT8A 1DT3A 1VIYA 4BNJA 4CGYA 3UHFA 1D4FA 2VSNA 1NOKA 3HJGA 4PPQA 3WISA 3O1JC 1WO8A 1L5SA 1OYVA 2V59A 3O4HA 2DUJA 4DQ0A 3W5VA 3SS8A 3ZIUA 4G8JA 4XI9A 3S2GA 3C8MA 4A7PA 1I0ZA 1NZJA 3OFND 5A7HA 3V7UA 2CBXA 5H59A 3R0QA 3L6UA 1UDXA 1RLOA 2HK6A 2ZBRA 3N39C 1SXGA 3ONFA 1YRHA 1YRAA 3QP9A 1KTIA 3B6IA 1SHUX 4B4OA 1O2DA 4B0PA 5K3OA 3QI2A 1MHPA 3M33A 5DYNA 2WZQA 4HEJA 1UDRA 1IEXA 4AJNA 2WM2A 2VBFA 5JDIC 1TYDE 5BSVA 4ZV7A 2P9HA 3AHDA 2LKCA 3QYJA 5EJ7A 4DTCA 5ALHA 5EJ9A 2CHQA 2PNFA 1BHSA 3ROQA 2XE8A 1UFQA 1F0KA 1QYCA 1NF9A 2QN7A 3FCUB 1U0HC 2DFTA 3AM5A 3R40A 3VNRA 1RT9A 4TKVB 2RC6A 4FFNA 1NYTA 3HYNA 4GUAA 4L85A 2F90A 1O6BA 3BTOA 3JWJA 3T5BA 3A10A 5EHNA 2YVKA 3VDXA 2E4AA 3FGZA 2E0IA 1ENOA 5TQJA 4IMJB 2A14A 3ZE6A 1AZSC 2G5TA 3ONWA 4MP3A 1SZCA 4U7GA 4B34A 3L4EA 1S2LA 3H1PA 3HBFA 2WU0A 3KR1A 4YRDA 2JFVA 4TN1A 2PSSA 5TQVA 4MPDA 1L5NA 3KB8A 4B47A 3A9WA 2IXDA 4WNYA 2YTZA 3ROFA 2RAPA 3E81A 1XTVA 4XYGA 2QN1A 1JH9A 3LT1A 4WE3A 1NDQA 3NOVA 5CFPA 4LFBB 1ZESA 4C5CA 1R66A 5C81A 1TK2A 3IDFA 3O84A 1T6NA 4OF4A 1QYIA 4PRZA 2C99A 2C2KA 2VI5A 5FFMA 1CLUA 4AZ0A 5CCEA 1NW7A 3UZUA 1E4VA 3DMTC 1YBVA 3MGKA 5ERXA 2OZKA 3C15C 4JBHA 4BECA 5ITVA 4XW2A 4DHEA 4M9XA 3IUYA 1UBLS 2ID9A 3FTNA 3LBIA 1UDWA 1ZG3A 3V4VB 4B4WA 5EE3A 4C7MA 5BN4A 5I4IA 2QL5A 2FW9A 4TXMA 2E5LB 4PZ9A 1VE7A 2JH8A 1CNFA 4URHA 4D74A 1Y7LA 2IYEA 5DWQA 2DKFA 1PEKE 2XD4A 1XHLA 4H7DA 3W4IA 1XEWX 5DGCA 3GL9A 2PMKA 3EEQA 1PZFA 3RNOA 1CY6A 2XRFA 3PE3A 1ZNYA 2D8MA 2JRLA 1B0ZA 4IXWA 2CZQA 2DCUA 4LC1A 3ZHUA 4DV0B 2CGEA 3J7AC 5G0VA 2FLWA 3SFZA 1QIEA 4BKRA 1U98A 4C6RA 2IOYA 2Z2KA 2NZWA 4DHWA 1P17A 2OXCA 1JR2A 3P7MA 3ONDA 5FTLA 4LF6B 4X97A 1SG6A 4K6MA 1JBKA 3CR8A 4YAJA 5FA5A 4CL3A 2ZT7A 1VP3A 2I99A 3KM0A 2RH5A 1S1MA 4MB6A 2YRWA 4ZEOA 3R3VA 4FYJA 4TTIA 4A8PA 4EMUA 2CLHB 3LF4A 1QPBA 4JGIA 1Z2PX 3KJZA 5H3LA 4LZPA 7REQB 1QO9A 3UAZA 3A9SA 1KH2A 4JJ7A 4ZO6A 1AN0A 1X2BA 4ISBA 1A50B 1XZAA 4L0CA 5JG7A 5BSUA 4L15A 1TJ4A 2NPIA 1AKTA 1RPNA 1LW7A 2QLBA 2ZRAA 3O21A 4KFTA 2P11A 1K0FA 5DT2A 3UB3A 3KB2A 3PDHA 4YXWA 1QHHB 4WVFA 2EATA 3GVIA 1VCHA 2IXAA 2Q6TA 5GOTA 1CR0A 1QV7A 1J0EA 1UM9B 1WKCA 3IKTA 4YV0A 3PS9A 1HFJA 1R4ZA 3I04M 3UG7A 1PTJC 1JYEA 4J2TA 4R0NA 1V7ZA 1K2VN 2I8CA 4B8WA 2BMWA 3KOUA 3VHLB 3IBYA 1L8LA 2ZJ1A 3C7KA 1PIWA 4IR7A 1MQAA 4Q3LA 2VK8A 1YKFA 1G2OA 2YZMA 4HJXA 2BZSA 4Q5IA 4Q3DA 3VBEA 1YR3A 5KQLA 4RDCA 4G0OA 2ET6A 2XF8A 3JWEA 3NHAA 1F6BA 2BHNA 2LIVA 3TW4A 4IF6A 4QELA 5JJKA 2ZYGA 1TVKA 4GKVA 2ADOA 5C1PA 4ZQCB 3W79A 3OQMA 3W9YA 2HEGA 1ND5A 3MWYW 2NUPA 5MN6A 6ABPA 3WLSA 3U7GA 3LT4A 3AFOA 3DMHA 1F60A 3G2HA 1F8GA 3CSUA 4B8ZA 1M0EA 2Q50A 2XSZA 2ASVA 3K5PA 2V1UA 2AMVA 2PRJA 3E2PA 1DCMA 1FRZA 2WVAA 1B73A 2GN8A 4F2WA 1AZWA 5ESWA 2ZJBA 2B2XA 1Y9DA 3REFA 3A06A 721PA 3LECA 2HT6A 1LDEA 4ZAFA 4BQQA 3D7RA 3FLMA 1DV1A 1TF7A 3PDWA 4KXFB 3QKUA 5JROA 3CNNA 2WDPA 4L8LA 4N5NA 3RVBA 2E37A 1BCSB 1QQ7A 3OO1A 3PFFA 5FEMA 3MW8A 2WUGA 1XMSA 2V7BA 3HRHA 3UJNA 5I7VA 1SR8A 1QTRA 3IT0A 3TSOA 1VBMA 1EM8A 2XMSA 3B7PA 4F45A 1G0NA 1DU4A 2PT5A 1LPOA 3ZX4A 4HP8A 2J7KA 5KZMB 1U7PA 2NU7A 1DAHA 1JJBA 4XRRA 5FNZA 1QO7A 1HSOA 3NBZC 2ISCA 3PQ6A 4URVR 5KQRA 1XZJA 2JZOA 3RDPA 1IK6A 3LOQA 3RAGA 2HNKA 4W6ZA 3ZQ6A 1O96A 3P9YA 4KJZA 1CWUA 5T8KA 2V8OA 3ABOB 2W11A 2FNAA 5AO9A 3EBPA 5KINB 1P9RA 3B53X 3MVEA 3UTDA 1CHNA 1DNPA 3A0RB 3B1JA 3C5HA 3H8JA 3NUQA 1UMDB 4MGEA 4KGDA 1QFSA 5AJYA 4TV8A 1L6RA 1VHJA 5C1BA 3CEPB 4UVHA 1R4MA 4JLVA 2Q45A 3QU9A 3T0FA 2XA1A 3OPYA 1TMOA 1Y4AE 2PT7A 2JGDA 3H3XA 1H2FA 3A6LA 2AFHA 1E8MA 3GDWA 3GLUA 2VDJA 1BMDA 4RMGA 4YALA 3WHLA 1X7ZA 5CAEA 1L7BA 1UZMA 2P30A 2WG2A 1GP2A 1EX6A 3HC7A 4B3FX 1EIZA 4EFDA 4AKGA 3EIQA 2ZR7A 4LHYA 2UXBB 1A9XB 1PZEA 3PFGA 1XXHB 1D7OA 1YAHA 4PX2A 3SHTA 2I4OA 4A8JB 1U0GA 4CV3A 4ETIA 1P75A 1EFPA 4REOA 5KU1A 1THMA 5A4FS 4ALIA 5EVJA 2RB4A 5AOVA 3K32A 4LX0A 1MGOA 2Q3FA 1NN3A 1E1QD 1GA6A 1R5BA 3K71B 1D1PA 3OZTA 1K98A 3EAGA 1FYVA 1MB2A 4HX9A 3PR1A 1KGDA 4YP5A 1DX4A 2AR9A 3FHOA 4XD7D 3U62A 3W7BA 2CV0A 4BQOA 4FLMA 2O6HA 3G9XA 3SY8A 1HXHA 3QVMA 2R85A 1VCNA 4EUKA 1XZLA 2VTKA 4ND8B 3CTPA 1BH6A 2I2XB 1E32A 4RJ2A 3SR0A 4C6SA 2O2ZA 5DHAA 1T2CA 2XLCA 3JATB 4UHBA 2FOXA 3SF8B 3HYTA 3PNKA 4KR0A 3UT6A 1J5EB 2EZ4A 4JHLA 3MWLA 1TJYA 1YUNA 2P3QA 3GIWA 1B6SA 3JV7A 3HO8A 3SC2A 2WSSD 3C4VA 2YV1A 4BNNA 1OLXA 2Q21A 1Q1AA 2FRDA 4L3WA 4EYQA 2JBHA 2V1XA 2YS7A 2P6MA 3ABRB 4FKZA 1H2AS 3CMCO 3FM9A 3S40A 5JASA 3DL0A 4R5HA 5AVWA 3ZD6A 3LCCA 1YC5A 1EFUA 4LJ6A 3EGOA 4UHEA 1RYDA 1JT9A 2M32A 4RJTA 4KX5A 1M34B 3R3UA 4W6QA 4O3FA 3QU2A 3ZWPA 3HM2A 4I5IA 4IHQA 1O9BA 1J4AA 1JA1A 1TK3A 2MSDB 1T6BY 2NVBA 3CTMA 4C78A 3NGMA 3COVA 3RADC 1SCBA 4QJ4A 1NRIA 2Y92A 4G0VA 3E61A 2YZ2A 4DAEA 4OJYA 4RTQA 3W5CA 1SEPA 4XQCA 2BGWA 4AJJA 1H5UA 4QUBA 3S55A 1IG0A 2Z83A 4NJEA 1TA4A 2P1DA 2WF5A 4I55F 1H3FA 2FW8A 2A1IA 4G1EB 2FW7A 4OREX 1DGQA 3OCCA 1UZLA 2DWPA 2G63A 4P3YA 3E7PA 1QF7A 4YYZA 5BSKA 1E0AA 5FTKA 2QR2A 3M82A 1O8CA 2R1VA 2CJFA 3PNBA 2P40A 3QUAA 1GZDA 4NI5A 4OD0A 3HCPA 3V8RA 4CU2A 4QPNA 2ZPUA 4OL9A 3RHSA 5DGHA 1GKLA 4NENA 2B4YA 5AXDA 1O95A 1NNUA 2J5QA 2YZNA 3HKBB 4H6XA 3F74A 1J8DA 4H3HB 2A4KA 4G5OA 2CY0A 5FI3A 4UEQA 1JPJA 1VLLA 4GRAA 1RQRA 4KK3A 3SBXA 2B6HA 1OLUA 3M6VA 5CM2Z 4US1R 2CLSA 2H92A 1FCJA 2NYAA 1X8JA 3H2GA 1K7SN 5HTKA 2FZ5A 3QVKA 3II6X 2OORA 4GOKA 3WQHA 3PDCA 1PSWA 2GD2A 3JD0A 3OJEA 4MWTA 1E79A 2OP1A 1ECGA 4B71A 1ZVVA 4J16C 5T4HA 4B5LA 3RQSA 4I4LA 3VTZA 1EEHA 4II2A 1RM5A 1U04A 5IDYA 1CULC 1OB5A 1FPQA 1XEXB 1I4LD 1UBGA 3AQIA 3GBSA 3AR5A 3JQ9A 4W8OA 2PKXA 1JV2B 5K3FA 2FJUA 3NT4A 4UFPA 3GEDA 1PGNA 1G6Q1 5FBQB 1CEXA 1L5QA 4AZ3A 2VC2B 2IITA 1JAZA 1LC0A 5DLQC 4Y1GA 5FB3A 4QZVA 1S2IA 1TIKA 2JHPA 3TQCA 2FQYA 1N77A 2IP2A 4LAFA 4DMFA 5DN6A 3K1YA 2ORIA 2VHUA 1W88B 2O2JA 1E6MA 2VJQA 5K3FB 3O4FA 3DZCA 3EWIA 1A9ZA 1A5BB 3UCFA 3KBBA 3L6DA 3LD9A 1WY5A 4PHFA 2RBEA 5EJ2A 3FB4A 4U7HA 1UXIA 3K1ZA 1KAEA 2D13A 2GZDA 5EIBC 2GCOA 2M6LA 1KDOA 1P8JA 2OZEA 2RHRA 3KSMA 2JNWA 4TWAA 2YHIB 1HDCA 5BMVF 5M5BA 4U0KA 4D25A 3H86A 3T3IA 2XCRB 4I4IA 2PQMA 4WMLA 2ZJ8A 4XSGA 1BQ4A 3G5TA 2UZ4A 1U9IC 2Y1WA 1PW5A 1R0RE 3OOWA 1J00A 1DHTA 1XAGA 3IO3A 2PKQP 4UBMA 3RSGA 4IWYA 3ZEIA 5E6UB 1B93A 3A1SA 4OJMX 3VDMA 1QP0A 2XCQA 4IIXA 2GN4A 4YO7A 1E1YA 3DE3X 4PZAA 3H6GA 3ZWAA 1ZQ1A 5DV9A 2Z5GA 1UFVA 1ND6A 3MCUA 4RMJA 4ROTA 3NR2A 3KUKA 3R0XA 4NHOA 3KDPA 4ZT4A 5EJGA 2YWRA 1LDGA 4OGWA 3VKUA 3KLOA 2XQGA 2C1XA 3RRMA 2PX5A 2Q6IA 3VR6H 4F5DA 1BHJA 1C7EA 3P19A 3TOCA 4NBLA 3WS7A 3IQEA 2AG6A 3HXLA 4U7FA 1XNHA 1E8NA 2BZ1A 3DCJA 2HA7A 3DTTA 4I7EA 1C4OA 4Q1VA 1KEEA 1C0IA 2IPMA 5AKKA 3JQ6A 1C9YA 1MJ5A 1Q77A 3QLVC 4LDPA 5A4DA 2BFWA 4M98A 1RSZA 4NS1A 1AJEA 3LYHA 1XRPA 3ZKAA 2XMPA 1X9GA 4U00A 5AK4A 4A1OA 4S0XA 1TM5E 4KFUA 4YP1A 3TQFA 1L3BA 3E18A 4MKHA 3UOWA 3FZEA 3MPOA 3QM1A 2R4UA 3V9PA 2PUGA 2VDNB 3L7AA 1SVLA 2EYQA 1WULS 5DNDA 1SQFA 4EP1A 3JQFC 1K8YB 2PT6A 2OO5C 5FJJA 3VO1A 1CUGA 5J43A 3M6LA 3ROEA 1N2ZA 1WCV1 2GW4A 4UNIA 5I6DA 1DQRA 4G5QA 3AGQA 3WVNA 2X0DA 1XBTA 4BV2A 3NPAA 1BDJA 1WIWA 1ZXBA 2C54A 4WV3A 3EVDA 1LFAA 2O7QA 2D59A 3IXMA 4I4TF 4NCHA 1BFDA 1Q1QA 1RJ9A 1U7ZA 3KAQA 4Y9SA 2PX0A 3RYHA 3S99A 3NYIA 3X1MA 3ADDA 1MDBA 2VS1A 4G0NA 2B