3COZA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.0 ang resolution- in complex with sulphonamide inhibitor 4
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3cozA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3cozA01
4DNXA 1KORA 1H3FA 5KCMA 3AG6A 4YMIA 5LLTA 2O5RA 1MAUA 5DB4A 1WQ4A 1KQNA 1A8HA 4XSVA 2I1LA 2A86A 1XNHA 1K4MA 1ZUNA 4HJRA 1G8FA 3RHSA 1N77A 1QJCA 3CLRD 3C8ZA 1LW7A 1O0CA 2JANA 1PFUA 1J70A 3FI0A 2QUIA 5TGTA 4MVCA 1IVSA 1KH1A 1TYAE 3FETA 1NUUA 5H16A 5H7XA 4YP5A 2CV1A 3TNJA 1PFVA 2CYAA 3QTTA 1GZUA 4EGAA 2HMAA 1PG0A 3SEQA 3CLRC 3N2YA 3NBKA 1J1UA 4UZEA 1M8KA 1NUSA 1KP2A 2X0KA 5IJXA 3A2KA 3KT0A 3SYTA 3D6UA 4MUJA 3KFLA 1QTQA 2RD2A 4P2BA 5TEWA 4DE5A 1N2GA 1PG2A 1TFUA 2QJTA 4MUGA 2QJFA 2QTMA 3Q4GA 1J20A 5K0SA 1IQ0A 4ZCPA 1TYBE 4I6EA 4EG8A 1MAWA 2GOYA 2YXNA 5K0TA 3UK2A 4EG4A 4H3SA 4EG1A 3H9BA 2X1LA 1JHDA 3HL4A 2Z3VA 4EFKA 2A84A 2VTBB 2CV0A 3IOBA 1N2OA 3TS1A 4PY2A 5J58A 1EFVB 4WSOA 2QTRA 1I6MA 1NI5A 3VGJA 3A04A 3U1VA 4NATA 1H1TA 3S3TA 4QREA 2Z09A 3PNVA 1GAXA 1Q77A 1R6UA 1KAMA 1G8GA 1R6XA 1J21A 1F9AA 4Q16A 4CQNA 1UFVA 3P0JA 4KR7A 1IQUA 1J1ZA 3DV2A 4MW9A 2DERA 1ILEA 3UOWA 4DDMA 1KH2A 2YWCA 1YIDA 4XFJA 1KP3A 1Q19A 2A1TS 4A91A 2AKEA 3M5WA 1WXEA 1IRXA 4ND7A 2C5SA 3FIUA 1V47A 1YUMA 4MWEA 4YP7A 3ILVA 1T9GR 2OV4A 1N2IA 1O95D 1SURA 1M8JA 1VBMA 1D2RA 1MOPA 4RUKA 1F4LA 3IMGA 3FH0A 1PFYA 3SDBA 5J5AA 5FO1A 2YY5A 4MW0A 3CVYA 4EF6A 1U3DA 4KR6A 1DNPA 1O95C 1J09A 3HGMA 4HK4A 1N2JA 1EFPA 4MVXA 1WXHA 3JXEA 4K0RA 2WQ6A 1GPMA 3FWKA 1JEEA 1KQOA 2PZAA 3FY4A 3P0HA 4KR9A 3HZRA 5F23A 3CVWA 4OJMX 4JFAA 4JYZA 3NBAA 5KHAA 1JZSA 1H3NA 4JXZA 3ND7A 3IDFA 2A7XA 1GTRA 3ZGZA 1WXGA 2V0GA 4MQ6A 1N2BA 1ULHA 1OWOA 1O96A 2A1UB 3N05A 4KKVA 2WSIA 4I6JA 3IUEA 4QBTA 3K32A 1GN8A 3K9WA 1I6LA 3N9IA 1IHOA 4MW1A 3H05A 4EG5A 1MB9A 1ZJWA 4MLPA 4NAHA 4G6ZA 3L92A 3COYA 4MW4A 1JZQA 1T6YA 1VL2A 5HUHA 1XNGA 1JGTA 3G59A 3HFJA 4DLPA 1M83A 1JIJA 4KPUA 4YBRA 3CVUA 2J4DA 2DXIA 4TS1A 1YI8A 2QUKA 2E18A 4G5FA 3SZGA 4PBSA 4Q93A 5FO0A 3ZXIA 3QTBA 1EUYA 2E89A 1NSYA 2IELA 3CR8A 3IVGA 2OQ2A 1KR2A 2CFOA 4MW6A 2D13A 4EG7A 2DEUA 1V8FA 1M1ZA 2RE8A 3HMQA 4EG3A 4S1OA 1FFYA 4NX2A 3ISJA 2XRYA 2D5BA 1G8HA 1COZA 3LCJA 3MMXA 3HV0A 1U7XA 3ZIUA 4ZT6A 1P7PA 3KT8A 1QU3A 2DR2A 1XJQA 2X1MA 1QNFA 2PFSA 1PFWA 1EE1A 1X6VA 3F3MA 3LE8A 4OUDA 4MUHA 3P0IA 4G5YA 1Q15A 2EJCA 5HG0A 2QUJA 1JECA 3FOCA 3CA8A 3OP1A 4I6GA 2HZ7A 2TS1A 1B6TA 2IJGX 4U7JA 3UC5A 3GUZA 1WQ3A 2BTEA 1NURA 4L2IA 3UMVA 2GM3A 1OWPA 1MB2A 3AFHA 4R0NA 1TQ8A 1MJHA 2B7LA 1JIIA 3Q10A 1IFXA 3G6KA 4CDMA 4AQ7A 3H99A 2J5BA 4MAFA 4BWVA 1OWLA 3TZEA 1K92A 3ZXSA 3IVXA 1KAQA 1YUNA 3IUBA 1WY5A 1WZ2A 5HUJA 3OTWA 4GU5A 1TEZA 3RK1A 3MLBA 3X1MA 1KQPA 3ND5A 1U3CA 4MWCA 1RQGA 4NAUA 3IODA 3LOQA 1U0BB 2QTNA 1OD6A 1N2HA 3BL5A 1F7UA 4EG6A 1M8FA 1EXDA 1QQTA 2J07A 2PG3A 2ZUEA 3TQIA 5KWVA 4MUNA 3MXTA 1N3LA 3E27A 2J09A 3INNA 2GKSA 3L93A 4HJXA 1X8XA 3CVVA 1WJGA 4PBRA 3MUEA 2DUMA 3TQOA 1O0BA 4XFDA 3SZ3A 1H3EA 3CVXA 4NZPA 3H97A 4X0EA 1KKUA 3QE4A 1QRUA 3GMIA 1WKBA 4JXXA 3H9CA 1Y42X 4ZT4A 2JAXA 4MW2A 4ARIA 1LI7A 1N78A 5LFAA 1WXIA 1O6BA 1VBKA 1M8GA 3AIIA 5BNZA 4E1AA 2PZBA 4ZT2A 2CYBA 2G36A 1HYBA 3IMCA 3IVCA 1T6ZA 3FDXA 4U8HA 2YWBA 1EFPB 4R2LA 2ZP1A 1N1DA 2AG6A 3DO8A 1I6KA 4RPIA 1Q11A 1YIAA 1I2DA 2DLCX 2WQ7A 3UY4A 2QJOA 4ND6A 1T9GS 2NZ2A 1MRZA 2EL7A 3N8HA 3A4IA 5DK4A 4ZCRA 3FHJA 4UZFA 1R6TA 1CT9A 3NV7A 3X1JA 4MVYA 1OWMA 1O96B 1JEDA 1LI5A 3TZLA 4NDAA 1TYCA 2H29A 2CUZA 3G5AA 5J59A 1EJ2A 1GLNA 2V0CA 1GTSA 1FYDA 1S4MA 4DJAA 3ZJTA 1BS2A 5DASA 1F7VA 4GRIA 2IP1A 3AG5A 2D54A 2VTBA 2A1TR 1N75A 1EFVA 1OBCA 2CSXA 5AHWA 3IOEA 3COWA 3D6VA 1ZH6A 2O8VA 4KPUB 4K03A 4ARCA 4MUIA 2E21A 5LM3A 2XRZA 2ZUFA 3VRHA 3IMEA 1KH3A 5IHXA 1IQRA 4J76A 5TS2A 4WNYA 5EKDA 4MULA 1YULA 3P52A 1OWNA 1U7DA 2H2AA 1JMVA 4F3RA 3PRHA 2DETA 1O97D 4U63A 3RJZA 4MW5A 4DDHA 1NYLA 3IOCA 2WB2A 1ZH0A 3RBAA 1QRTA 1QU2A 3KT6A 3ZUGA 2CYCA 4ZT3A 1IH8A 4YP6A 1O5TA 4ZCQA 1NZJA 3CLSD 1VBNA 5JBNA 3GLVA 1O97C 2Z08A 3VU8A 1O94D 3ELBA 4OUDB 4ZCSA 1MBZA 2VXOA 1N2EA 4MUEA 2PZ8A 3PNYA 4MW7A 5TEVA 2PIDA 2PXHA 3CLUD 3COVA 1XNJA 3FNRA 3ZJVA 1JIKA 4F4HA 2E0IA 3CLSC 4J75A 1EUQA 1JILA 4MWBA 3SEZA 2JA2A 4L2IB 3I05A 1O94C 1WXFA 1TYDE 4CT0A 3RFFA 4FZJA 1OBHA 2J08A 2CV2A 2BYTA 4PBTA 4R2MA 3CLUC 1MC1A 1NP7A 4MUFA 1K4KA 3PXUA 3IH5A 2X3FA 4HPWA 3X1KA 3CLTD 3KT3A 4ZT5A 2R5WA 1G59A 1QRSA 2A1UA 3DLAA 3AKZA 2A4MA 1K97A 4MWDA 3RK0A 2NSYA 4AS1A 1T6XA 3AL0C 1WOYA 4MVWA 2AZXA 2QUHA 3DPIA 3MLAA 3ZJUA 1VLHA 3A05A 4JZYA 1M8PA 4QRDA 3Q12A 1NUTA 2CT8A 4DDKA 1NUPA 3CLTC 3FG9A 1NUQA 3ND6A 5FNZA 3SP1A 5DEOA 2DPLA 4MUKA 4CDNA 4ZCTA 4ZT7A 2A88A 3PNBA 2HGZA 3COZA
chains in the Genus database with same CATH superfamily
2XCSB 4LY0A 5DCLA 1JSLA 2YMLA 3EGXA 3PYMA 4P0TA 4YJ2F 3GW8A 3HGTA 5JDCC 2HWWA 1T3SA 5GIOE 1N2SA 4MCIA 1BMDA 4EVSA 1H2XA 5KJFA 2ZT5A 3TSZA 3JRWA 3WNZA 1DJMA 3NFYA 3P71T 4AWBA 1S2NA 3HQ4O 4FE7A 3PLAE 5CYGA 3NWBA 3CIFA 3K1TA 3B1KA 2XR1A 3WGIA 2A86A 1Z4MA 4AP6A 1SXJD 3GT7A 3NO4A 2R25B 1DELA 2BSAA 4G4SO 3W8FA 4WCFB 1GM5A 5LQNA 3DQZA 1ZMRA 1CVLA 3LBAA 3QGMA 1AKWA 4BNGA 1I33A 2DF8A 4HVCA 2OWEA 3K35A 3OT5A 3QLUA 3OETA 1H1DA 3B9PA 4XUEA 1KKMA 3ZLUA 1Y6ZA 2WV7A 4FSDA 2WKSA 4Q24A 2HHAA 2OHOA 3BMCA 1V7PC 1F8XA 3N3AC 3QTTA 1EUCB 1O9HA 3QEMA 4GXNA 1GZUA 2YZGA 4JJIA 4JH0A 4MH0R 4OQDA 4X7BA 3WMRA 4HDKB 4RELA 1J9EA 3P94A 4J29A 5FOUA 3RUIA 3DV9A 5TF4A 1TK2A 5E3IA 3H8JA 4JP8A 4AUNA 4RPJA 2AB0A 1QCCA 5LQSA 2HSEA 5IMBA 5H70A 3RGWS 2MR5A 3H1EA 4JBXA 3P9NA 2Q99A 4JJAA 3CEHA 4BNKA 3COSA 5I9TA 1W1IA 2JJ1A 3KQQA 2Z04A 4PSVA 4ZCPA 4XH9B 3H5AA 3QBDA 1ZQ1A 5A2QA 5CA1B 5AYVA 3VM6A 4D80A 3EVCA 3K31A 2X1LA 3LIIA 3C4JA 3JWJA 3N86A 4MB6A 4UPVA 1L7MA 2FMXA 4HADA 4WZBA 1XMXA 2B7CA 4J0JA 3OO0A 4N54A 2C7RA 1RYZA 1C3OB 4CVNA 3R3HA 2QTHA 4U6NA 2JF0A 3FTEA 5EJ6A 2FSGA 3W3AD 1N2OA 2WAYA 1D2GA 2DQ4A 2PUWA 5CJJA 2QYHA 5NULA 2XXBA 4PPQA 1XEFA 3PQDA 5B3JC 3ZDDA 1RPTA 1Z5GA 3DNMA 1Q3KA 1U2DA 4FYMA 4TGLA 1GYRA 3ON5A 3S3TA 4DCMA 4DR7B 4JYMA 1A4XA 3LLUA 2PKYX 4MVJM 1R6UA 4Y2HA 3LQYA 1BDBA 3TFOA 2XW6A 4RTRA 4U9IS 2F4NA 3WICA 3B2NA 1G8GA 3RFUA 3UANA 2XRMA 4GQAA 4E32A 2GJ4A 5FPTA 2JBHA 1UFVA 2QZ4A 2R7LA 1YU6A 3GO4A 3H0KA 3W4KA 1IQUA 4HB0A 4IFTA 4IIVA 4F12A 4U7DA 4TROA 1KPIA 4KXLA 3TM4A 3RYCB 1E32A 2H0QA 1EX7A 1X7YB 3CRZA 4KMMA 3AF1A 1QWOA 3FAZA 4KDRA 5A9TA 3MW8A 1MABA 3O8NA 5ILGA 2IECA 5H82A 3PVCA 3NVAA 2AKEA 4XWOA 3M5WA 2Y1XA 5ADHA 1YF3A 1SBNE 1X1SA 4YP7A 1LTHR 2R5NA 3DAPA 1IUOA 2JBAA 1WQ1R 3W6OA 2N47A 2XB9A 3CUKA 3PFGA 4A5OA 3DFUA 4ID9A 1LS1A 1T5IA 2OYSA 2HSWA 3L8GA 4P2GA 4OA8A 4QXRA 1U1IA 2YICA 5BQOA 2RGCA 1OFUA 3JYNA 3VBEA 2F17A 5F7XA 1UEJA 1BXGB 3TCXB 4D82A 3LDFA 3UJ8A 3AERA 4DDUA 3TSOA 2G72A 1OU0A 1NVGA 3IUQA 5D51S 4URFA 1EHYA 2Q3FA 5FYQA 1D2AA 3QX3A 2CB0A 5JNTA 2C0CA 1VLMA 1M6HA 5ECYA 1Q21A 1DWUA 1KR5A 1T0BA 2D7DA 4K3VA 4E07A 2N3ZA 1R4NB 4MRMB 4F96A 4YUXA 1VKOA 1AKUA 1HX7A 1QYVA 3E9DA 1NVVQ 2BH9A 3RYFB 3QHAA 1PGQA 3B3FA 5BRJA 3GK3A 6CHYA 5HJ5A 4DB2A 4DLUA 4P5PA 4DSNA 3QEAZ 2BGUA 3QVLA 4MINA 1DKMA 1K27A 3WA7A 4WEQA 4X71A 5CK5A 4EFLA 1XKLA 5CK4A 4D3DA 2KYRA 3EPKA 4Q6BA 3TRIA 3FHCB 4CMJA 2WJ6A 4UCWA 2Y4NA 4N6GA 3RR2A 2C7BA 2XUFA 4Q3DA 1SOAA 2GWRA 3ZD9A 5BY2A 3ZBPA 2GLUA 2PTGA 5F2OA 4ZOBA 4A2PA 4D6PA 1E2BA 3R0JA 3BTOA 2GT1A 4HNVA 5EWLA 1RWMA 1UQUA 3HXMA 4M1SA 2JHCA 4MKFA 1LZLA 1SNYA 5BPHA 3VOTA 2J0EA 1IK6A 1NI4A 3IE2A 1ZUD1 2J6BA 4KBGA 4CM8B 5JS7A 1YR3A 3RJ5A 2O23A 1ZOLA 4AG6A 1PT7A 1KRWA 5ESDA 1NIJA 1JPJA 1ZM3A 3FWYA 5FADA 5EP1A 3D2BA 2PKQP 3KWLA 3PPXA 4YJ3A 3RF7A 2ESRA 3O9ZA 4INOA 1OMOA 3SXPA 1NBWB 1SA0A 2H31A 3ECAA 5KYGA 1QK3A 421PA 3TG2A 1AC5A 4Q4JB 5HM6A 4EKGA 4NQZA 3ZBQA 2M2IA 3Q5GA 3HDYA 3LY5A 1W36B 1M73E 3WGTA 3VPFA 1U1GA 1C3LA 1GPJA 4YRAA 4J0FA 2SCUA 1OFHA 3A4TA 2O0KA 4HBGA 5CM8B 4JS0A 1PWXA 4BNXA 2OKCA 2EZUA 4NH4A 4Q1FA 4MVJP 4Q93A 5DI3B 1E79A 4BZQA 5L6MB 2NAPA 3BD8A 3DW1X 5E4FA 4UCXA 3QKIA 2OQ2A 4C6TA 3U5ZB 2FK8A 1WXDA 1Q1BA 2YW2A 3E2MA 3UAVA 3UHAA 2WBLC 3ZHZA 2QMEA 5ULLA 1LJLA 1SC4A 3Q15C 1ZJJA 2A3NA 5HBGA 1GCGA 3B3QA 2MSWA 1K8YB 4F5WA 4D8UA 4XVQA 5JMPA 2PGLA 4BNJA 4NCHA 1MO3A 2ZJYA 3ZGVA 2EW1A 4Y8VA 3TX2A 4MV5A 1UMKA 1MVNA 4MQMA 5C5EA 4KO1S 1FNDA 1OIXA 2VHWA 4KE7A 4M99A 1KDOA 3DAHA 5JSKA 1FQJA 1IN6A 2YVUA 3NCHA 1SU4A 2IOFA 3PRKE 1L5LA 1MW8X 2OMEA 1N6RA 3NZEA 1ZA1A 5E6UB 5LP6A 2NU8A 3GAFA 3BIWA 3HUUA 3THXA 4L72A 4BFUA 2EKLA 2D1FA 4E5DA 5J5CA 3JQGA 4M8NE 3TB6A 2H0AA 3TI7A 2JLQA 3MK31 1KFBB 2EYQA 3N59A 5KVSA 2JAHA 1EAYA 5JLJA 1FXUA 4GE3A 3JYOA 3M4YA 1B6TA 4IKEA 1AJEA 1UJ5A 4NXNB 1V1RB 4M0PA 4EB6A 1SG9A 3C41J 5EQDA 3ZIAA 3Q8LA 1S9DA 1I2ZA 3QMWA 2HR1A 3Q3VA 4G0XA 1KSJA 3AHDA 4JUBA 1OWPA 5DLDA 2R7NA 2JHFA 2ETVA 3P0EA 1GITA 5D6NA 3H5VA 3GDFA 3S55A 2WIGA 1MJHA 1UF9A 2FFJA 4M37A 2VPIA 4YT5A 4GRAA 3F9RA 1Z82A 1MO2A 1ZLXA 2AH5A 1B3BA 1XVTA 1USWA 2A58A 3KSUA 4Y2JA 4KUEA 4PZUA 4Z99A 3OJFA 3IKJA 4DOMA 5JYEA 3TEMA 2P9QA 5I45A 1WZ2A 1MQAA 2AW3A 3MJEA 2RJOA 1SXHA 3RKUA 1XMQB 5EP4A 3FMIA 4WRRA 5J9FA 5F64A 1KVQA 3LYLA 4ZYYA 4HFMA 4PSAA 1PT5A 1PO7A 1OD6A 3RFVA 3D3NA 3E3MA 3BL5A 3EQ7A 4YVFA 5MF6A 3KAKA 2J07A 1U0SY 2ISCA 1YACA 1UMCB 4JC0A 1NY5A 1R0BA 4QQRA 1OB2A 4QGHA 4KWEA 4O1MA 1Y8CA 3DP9A 2VZEA 1YZKA 4Y7DA 1IIBA 3ZVLA 5LUAA 4AKIA 4HX2A 4XYEA 4JA2A 2YWDA 5IYZF 3L93A 4PYRA 3IV7A 4YDRA 5IASA 1UMDA 3TDNA 4BV2A 1IWBB 4NSNA 2IY9A 2BVNA 4F9TA 3CPJB 4YLYA 3D7RA 2C2GA 5CB4F 3H97A 2FQ1A 2P2NA 1MAAA 3EEBA 3QE4A 1AK2A 1GPUA 3MJVA 5IVIA 3SS9X 5K0BA 1V45E 5LXTA 4Y1FA 1AXGA 4TYPA 4WQMA 4ZT4A 2MSLA 3NBFA 4ZU3A 1G3RA 2JFOA 1PJLA 4XYBA 3SEFA 3LWNA 4P22A 4ZU1X 1H05A 5IDXA 4XB6B 1XTZA 5JZBA 1M8GA 2JCYA 1YQ9A 1RCFA 2QTFA 3LC1O 3DE7X 3V3TA 1I10A 1II9A 1YRQA 2PZBA 5E3HA 1WY7A 2G36A 1HYBA 1DJPA 1VL5A 2IHYA 1GCAA 2HJWA 3KLMX 4H7FA 5ESRA 1C2TA 1NBAA 3GLGE 3F6YA 3OCWA 4R2LA 2R1UA 1SUPA 3DTVD 2G17A 4LF4B 4BPRA 3A27A 1BZYA 3D8TA 5BNIA 2Q0QA 2O3RA 2GBLC 5EJIA 4MYCA 4DLYA 1W34A 4L15A 3I09A 3KYCA 4HWKA 3EIFA 1X42A 2VHEA 3SKXA 1RVV1 4WV3A 1P3Y1 1UK7A 4NDZA 4MHSA 3PEFA 4F72A 3EA0A 4P35A 4I5IA 1OROA 4WKGA 5J4YA 5DK4A 4J2TA 2X2PA 3RVJA 3BWYA 5A62A 1FNNA 3UB3A 4DKJA 1XGKA 1OFTA 3L8HA 2BMJA 4AKHA 4ZEOA 2EZ4A 2GBCA 4NABA 3HB5X 1V8OA 3BB3A 3PI6A 4O4JB 1LNSA 4YNBA 2P9HA 2QW1A 1MMFB 2XMPA 2B4AA 3LW7A 3N6RA 3IXLA 3LVRE 4TT3D 5IULC 1YAJA 3U09A 4DIFA 2VDJA 4DG8A 3I23A 3C3CA 2CLDX 4XARA 4ZVRA 4JJ8A 5B1EA 1JBKA 4QZVA 1PAUA 3RU7A 3BGIA 2LR0A 1M66A 3HR4A 4QHSA 3WWDA 1SG6A 2JRLA 4O2AA 1BCSB 1CXZA 5DNEA 1CU1A 4IH1A 3A1EA 2CXOA 2ODPA 2OSBA 2OCBA 2NOAA 3DZGA 2RK3A 1ZL0A 4BCDA 4DT1B 2CE7A 1T2FA 1B0AA 5EPOA 1KIMA 1WHTA 1KO4A 2F1RA 1QQ5A 3KXKA 4OXQA 3JZFA 3QVWA 5B1DA 2WTUA 2J9FA 2R1TA 2ZQ5A 3C1OA 1CTQA 3QEJA 2GK7A 2P0YA 1WULS 4G5GA 4KC0A 2ONJA 4AMYA 3IJ5A 2CJPA 1D1SA 2WDZA 2QSZA 4I36A 4F4CA 3D3KA 3NT2A 4RS4A 5TR9A 3AFOA 3LRTA 1TVKB 2YC4C 5DGHA 3DUFA 1EHIA 3IVMA 1U7DA 5EMNA 4H1WA 4TYNA 1NT2A 5I5GA 2TMDA 4B83A 1T5OA 1BWQA 3DKKA 5JJCA 3RJZA 3AM4A 4PO3X 3UKJA 2EFCB 2J87A 3T52A 1EK0A 4IF6A 5EQTA 1DTWA 3P2JA 3BAFA 2IYQA 3E3AA 3OZSA 3PQ7A 3GA0A 3PICA 4HBZA 3HU2A 2JGNA 4R4JA 5E38A 5ENDA 3WSWA 2ZUTA 6GPBA 4DMRA 2OGFA 4G8DA 1GFWA 1DEKA 1AUPA 2GZ3A 1KK1A 1AUOA 1B43A 1MJGM 3BYZA 3O1LA 4FR2A 5EHQA 3VZQA 4AZ3A 1SKUA 2GKOA 5TX7A 3JPWA 1M1YB 1NULA 1ZHHA 3JYPA 3OF5A 4OQNA 5AI6A 4DLBA 3E18A 2VJAA 3M6MD 4I9NA 3GGDA 4YCLA 3KELA 3ABSB 4QUGA 4OUDB 1L7VC 5ALNA 2HV9A 4AFNA 4YRBA 3U44A 2E6KA 3OIVA 1NQOA 2Q1SA 4MYTA 4MUEA 2M6KA 4MW7A 2WAAA 5DZSA 3KQNA 1HG0A 3LDUA 3OOJA 1S02A 1BFDA 3PRJA 1I3CA 4G1VA 3VDNB 1IN1A 2VWHA 4B9AA 1ZP6A 2JC3A 5KEIA 4LYHA 1ZH8A 2VPZA 1Z16A 3FHLA 2FP4A 1QTNA 4OM8A 5A4AA 1K6XA 3D59A 1VE1A 5IRCD 3FWHA 1EUQA 4N41A 4HXEB 2J3JA 2GD0A 4MV6A 1F60A 1QDUA 2ACEA 3FHTA 5JDIC 1ZZGA 2RAVA 2P8SA 3DZCA 3O21A 3ODPA 5CB0A 4UDNA 4WLVA 4CEJA 4GWKA 2FWPA 1SIOA 2VUIB 3UUFA 1JKJA 4L3WA 1IHUA 2WJHA 3NX4A 1QRSA 2FR0A 2OYRA 2ZYIA 4WZAE 2JRCA 5EQJB 5LUBA 5AK5A 2HSZA 3CFIA 4YRJA 5HZHA 3M0EA 1DTEA 2D1RA 4F3CA 3BF7A 2NN3C 1QH9A 3EK2A 4J0EA 1G3UA 2GAOA 4KN5A 4EY4A 3D9QX 1JH8A 4GOXA 5EP2A 5EUQB 3ZKWA 3KJQA 3WP1B 3L8DA 3EW7A 1B14A 3AU8A 1V7ZA 2ATIA 3CN9A 3H75A 2F8MA 4BTLA 1L9KA 3SICE 4CIVA 3GI1A 3WHKA 1HZZA 1PT9A 5T4FA 1DUVG 4PYJA 4N0QA 1XRSB 4ZD6A 4FC7A 1ADYA 5DEOA 1QB7A 1U2GA 2A5FA 1TI7A 3JASA 2IBMA 5DO9A 3TM5A 2A3RA 3FLAA 4EHLA 2V4ZA 2RFLA 3ER6A 3VR3D 1X1TA 3KPJA 5KKAA 1ZINA 4Z7QB 1QLJA 3PJGA 4WOPA 3TR5A 4YTEA 4UNNA 2H48A 3U5TA 3KJHA 5IF9A 1ICEA 1MHPA 1T5TA 2XTJA 1QV9A 5K6AA 3DF9A 3O92A 1SRQA 4KIGA 4U2CA 2BFEA 4EPWA 4DR3B 2E2WA 2XEXA 5DB4A 5BWCA 2H4FA 2LDXA 5FBZA 2IU6A 1KJNA 2I03A 1G3IA 5AKKA 3ICWA 3CWCA 1XNHA 3JCZA 4Q12A 4CTOA 2JLVA 1FVFA 1PT6A 1PDOA 1C0LA 3IERA 3FPKA 5AVWA 1KZ1A 1ZICA 3DMTA 2IYEA 3TJRA 4EF4A 1H6DA 4EABA 4TWRA 4ZA2A 4MIOA 1SC3A 1NUUA 4UVDA 1SHLA 1T4BA 3OKFA 5HEKA 5FTKA 2FKAA 2ONKA 4Y3UA 3BX1A 1JQLB 1Z33A 3H5TA 4CIXA 4Y6LA 3CF0A 4MR8A 3T1VA 2FMKA 4MZXA 1QHYA 2FRXA 3JVDA 4YPFA 3M49A 1VKNA 1E89A 3CRQA 4FFRA 4AXXA 2BRUA 4Q7JB 4BLQA 4XIFA 1G1MA 2DFKB 3W0LB 3ZQ6A 3L77A 3A4MA 1T3TA 4I3HA 3DVSX 2YS6A 3ORYA 3VTZA 4BUJA 1F8YA 1G60A 2B1RA 3M1YA 1QGUB 2R96A 4D0NA 4G07A 3AF2A 5DWQA 1HDYA 4DE5A 3BMOB 1FU4A 1EFKA 1PG2A 2TSYB 2ZRGA 3BFXA 4MUXA 1GUZA 3TUJC 2X9GA 5ALHA 1L9XA 3LDHA 4JI5B 1JZTA 3JAMA 2BFMA 3GLGA 1XPRA 2Q8QA 2M9MA 4BFYA 1MQ8B 4HWOA 1DZ3A 3LMKA 3TN7A 2G83A 3WL6A 3K70D 3BXEA 2VNIA 1L5RA 1ZKMA 3TZHA 1ISHA 3HCOA 2IRWA 4RJ2A 3D4BA 4DWOA 4GYWA 3AJAA 3M70A 1DKLA 3L79A 2Z8YA 1E59A 4Q0MA 1T13A 1PK9A 1XL1A 3UXHA 5A04A 1GDTA 1RWVA 3NGLA 1VFPA 3GNSA 3EXHA 1KNXA 4N7MA 4NYMQ 4RK5A 4XJVA 5B53A 5ICEA 3HXQA 2QX8A 2HT6A 1SZPA 5JXHA 7AT1A 5L3QA 1I6MA 5MDHA 1AMUA 2JJ8A 4L02A 3A04A 2VOJA 1RQXA 1P2FA 3QNWA 3JQCA 2PX4A 2M1XA 3REFA 5UKDA 1IOLA 3EPRA 4QNNA 2EFYA 2Z5LA 2NTYC 1RC1A 2LTAA 3QFCA 4R1SA 5IU6A 1H2AS 3HUEA 1LV7A 4UOQA 1JDNA 4P5DA 3AFGA 3DXFA 4DMLA 4UM9B 5A9RA 2CLKB 2RIPA 3NDRA 4L6AA 3P0JA 3SQNA 4C4PA 1RTKA 1BG6A 1DFHA 1T26A 5I9LA 4BLVA 5AJVB 3IE1A 3H87A 2VP3A 2Z5FA 3NWJA 3I9NA 4U2BA 1NJSA 1TVCA 4F21A 2WQZA 4CLOA 1EQUA 3F8WA 3KQSA 4QDUA 2PGOA 2YWCA 3EVTA 5HFNA 2XOEA 1YDGA 2ZBVA 2UZIR 3UK6A 4ENQA 2FWNA 1GTMA 3A1NA 3MTDA 4ND7A 1E4YA 2Q6OA 4HNRA 4XGKA 1SUEA 1ISGA 4HKTA 4RV9A 5IDYA 4EX6A 3SQOA 3BWDD 3O74A 2OV4A 2F62A 1Z8FA 4XASA 5SY9A 2ZJ7A 2I67A 3L7LA 2G8LA 3T9BA 1Y5NA 3MUFA 4TTVA 1UZNA 2HMUA 3IBFA 1FUEA 4UNSA 3DD5A 4P7FA 3UH0A 2GM4A 3NS7A 3ORSA 4NF2A 4A16A 2ID7A 1TRKA 3ET4A 4IKPA 2Q4EA 1QAMA 1HE1C 5DNVA 1NP3A 3L4JA 3ZHQA 3EBLA 1GVHA 4JFRA 1QO9A 2A57A 2YY5A 4Q9JA 4M0KA 3L0PA 2ZRBA 4E22A 5I3ZA 3U16A 2HU2A 2P9FA 3N7TA 1CY4A 1OJ7A 4KR6A 4KW7A 2NXJA 4GECA 1U7PA 4W6ZA 1XLTA 1P0CA 2ZOSA 3CZPA 1NVXQ 3GJ3A 1FJGB 1KSFX 1KJ9A 3TQCA 8ATCA 1I2CA 3P0HA 3ZZ0A 3H2GA 3M6FA 2JLAA 1TZBA 4I8IA 5EUBA 4X1IB 4MRAA 2RHWA 1XTRA 2QLMA 2HHCA 3L7MA 5LMUB 2XY4A 5E2IA 1YC2A 2IFTA 2XA9A 3EZ7A 4X24A 3T3HA 1UBJS 3TPFA 2XF8A 4C14A 1YJ5A 3L4KA 3ND7A 2Q0HA 2ZQZA 1W76A 2ZDQA 1CUFA 4X3PA 4DKXA 1T36A 4MQ6A 1YKSA 3K6SB 2CHQA 3A06A 1ULHA 1MH9A 1RRVA 1M2HA 3A1VA 3I2YX 4G26A 1U2EA 4L28A 3PDUA 4RCZA 2Q6TA 1K5DA 5EXDA 2PSHA 2VNHA 2X5NA 4EYKA 2MCFA 1O5OA 3ESDA 3K9WA 2GN4A 2VDNB 4JB3A 4YRFA 1KJQA 4BGEA 3GLQA 4CEIB 2D7CA 2W71A 2YXLA 3H05A 4EELA 2C1XA 2HEIA 3RVNA 4F45A 4WY8A 1G98A 1FRNA 4UD2A 4MWZA 2HU8A 4IGKA 4NJMA 3CB2A 3OJWA 1M5RA 4L51A 3IXMA 2V5VA 3BHIA 1GKKA 2QRLA 2Y1WA 3INGA 3NWEA 4S1NA 4AY6A 1D9XA 1P0QA 3O3OB 4M0DA 1HNZB 4ME6A 2V1UA 2CJWB 2DGDA 2EQ5A 3V2GA 1P75A 1PHRA 2XB6A 4CR7A 4MHOA 1SC1A 2JKVA 4WZAA 1IEXA 1MXHA 1BHJA 1Y9ZA 5F1KA 3QYPA 4KPYA 3BCHA 1IY1A 1AHIA 1XVVA 2QRJA 4BVAA 5JD6A 3U7FB 3OSUA 5JI3E 2WWGA 1AXEA 4P0QB 4W5RA 1XP8A 3OPYA 5B3LA 4O1HA 1XF9A 4W5HA 4FFVA 4TUYB 4BZPA 4C6HA 5AW8A 5JC1A 4MRVA 3GRFA 3KJGA 3IHTA 1P4AA 1IWOA 1P1JA 2C78A 4KK4A 2HC9A 4KXFB 1ZUNB 5BSUA 4EG7A 4BLPA 2R8XA 4MS4A 3IDQA 3LJKA 5ALRA 4EARA 1T4CB 1KRHA 4EW3A 4JP2A 4IUCS 1M1NB 4CT4B 2VSFA 4AJLA 4C0AC 2C3PA 4IXTA 5FUVA 1CUAA 3FOFC 5D6OA 4EVIA 1KI9A 1G8HA 3W05A 2O8CA 5CGQB 4BQOA 1F2TA 3E5RA 3OPMA 4CM9A 4IDNA 3V7UA 1SC9A 1QJ4A 1UOEA 2P5UA 2QRVB 4KX5A 4X8OA 3VZCA 3ZWXA 1FMCA 2ATEA 1SCAA 5BOSA 1NNSA 1YO6A 3IUNA 1JHVA 4LDPA 2O8BB 5LP1A 3I4FA 4L7VA 2QY6A 4XQEA 2CL7X 2B1QA 4BBZA 4E5UA 3ZDBA 2B99A 3AHEA 3A1DA 3P0IA 2EU8A 1PUXA 1DIGA 2QHXA 2ZIXA 5HG0A 3SF8B 1ULTA 2IPLA 3RUFA 2VCYA 2W8BB 5CCXA 3VFDA 4ARZA 1S8NA 5EXXA 2G77B 5CR9A 5EC8A 1B2RA 1UZMA 4U7GA 1RVDA 3V2UA 2VSNA 4M9ZA 1YS9A 3K0EA 2QPOA 4EMSA 4QLOA 2OVBA 2ZE6A 3GUZA 4NCIA 2H1SA 1GA1A 2H9AA 4L2IA 5G4LA 2XE8A 4QFCA 1T6NA 1SZDA 3LCCA 5FB3A 2A6PA 3TOVA 3LT1A 5JS1A 2C84A 1EFRA 3MT7A 3STTA 3UJAA 3A0UA 3AUSA 4AJ2A 2Y6UA 1JIIA 4TKVA 4AQ7A 4QBGB 4TWBA 4UZSA 4ZOLB 4PZ0A 5KIAA 1CJBA 1ELOA 4R1QA 2COUA 1J99A 4EAAA 1RKBA 4I4TF 2SKEA 1UKVY 4G8CA 3MB8A 3IAEA 3P9IA 4N9WA 3RVMA 2PWYA 3C45A 4BO5A 2XNHA 1YUNA 3IUBA 2DRIA 3N2EA 4I4LA 4W7HA 1WY5A 5LIRA 2WSYB 4CXMA 4DFDA 4W5NA 1LUAA 3FKSA 1TAGA 2PRJA 2O5VA 2L2QA 3X1MA 3FBTA 4OU5A 4I1UA 2Y2UA 3VC3A 4GKVA 3LOQA 3UB2A 3ZE2B 4HUQA 3A28A 1XO1A 1DAIA 5CAEB 3I1YA 1KWGA 3D6MA 3ACBA 1YK0A 1PJAA 4GMHA 2UVDA 5CBPA 1P2VA 2AA3A 1DO8A 2VK2A 1Y6RA 2G5TA 3OWXA 2ZRLA 2WKQA 1BXZA 3FFAA 3N39C 1DG9A 4N3GA 3TIXB 1DGQA 5JROA 2J09A 3KB2A 2HMYB 2ZUSA 1YOVA 1XMPA 1TF5A 5F4BA 3VR5A 1RLOA 1NW8A 2GKSA 2GZDA 2NT3A 3PFFA 3VPDA 1FMLA 1NVTA 4K8RB 4PV7A 2GJKA 4B0PA 5CW1A 4Z4GA 5FUWA 4TKLA 4S0ZA 3TQOA 1H6BA 2WE7A 4FFMA 4MKIA 3TD2A 2HUNA 3VU9B 5TXGA 3JZAA 4E30A 1H3EA 4MIKA 4L0CA 1A97A 3O73A 4KACA 1A9QA 1OTXA 4LJLA 4DAOA 5KYKA 1DAHA 1FPMA 1MPXA 3ZKAA 4L5IA 3QUBA 3W06A 5K99A 4UUNA 1I2BA 3H2SA 1P7CA 1ZRSA 4N40A 2BMVA 2D8MA 3DCJA 3PFNA 2WSLA 4XQ0A 1WKCA 1U0EA 4QJIA 1WVGA 5AKIA 3JR3A 4CIBA 3P9QA 5EIAA 5IC6A 4IJKA 4LMRA 2YWBA 2A0FA 2I4TA 1RQRA 3CINA 3O95A 2X7XA 4FR0A 3CZRA 4Z8XA 3B9RA 1I6KA 3EWAA 2PMEA 2DQKA 4L75A 5AVQA 5IDQA 1NHGA 3OHMA 4EI9A 5JWRA 1JR6A 3MNFA 2YFKA 1UP4A 5KAPA 1A8IA 4ZYWA 2HO4A 1VB3A 4ZJZA 2FSUA 5L7WA 3WJ2A 4AJEA 5JCOC 2XTNA 2OG1A 1BX0A 2P9TA 3DHEA 1XTBA 4IWYA 1G42A 1OA0A 1EP2B 1Q1EA 1I36A 1ZNWA 3E6AA 1XQWA 2X0RA 2AJDA 2Y0EA 1A4IA 3FHJA 3LKDA 2GSDA 4R9UC 5DI3A 3Q7RA 1DKRA 4LRWA 3HDJA 4QBIA 4XYGA 1XYVA 1J0BA 3KEQA 1GQFA 3OU6A 1OWMA 2OXFA 3PXAA 4FI3F 2GB4A 3Q2IA 5DIFA 3TZQA 3DQQA 5EXPA 1K66A 2JH8A 3FKJA 1HE5A 5ERGB 4BE7B 1C1YA 4V2UA 4RS3A 2ICAA 1OI2A 1QXSA 2IUSA 4PGAA 1O6GA 4N7BA 8LDHA 5LU9A 4ERNA 5CH3A 3OG9A 1YB6A 2G0NA 1T2VA 2WI8A 2XMDA 2IP1A 2ZJ2A 2IV2X 2ZPUA 4J0HA 3FPCA 4HNGA 4RH3A 2WYHA 5EJFA 2C7PA 4RKYA 1ADBA 2KM1A 5HA5A 3MLEA 3I64A 4JJZA 3D8UA 2C57A 4GVXA 1YCHA 2ZSKA 3EIOA 1GT6A 1SM4A 3HA3A 5CVJA 5FKJA 4CLHA 4D25A 1JVBA 1OX6A 1FP4A 3BMXA 4AY2A 4ARCA 1AHNA 3MMPA 5A4IS 5C1DA 2FPOA 1Y9JA 3IAUA 1K6EA 5EWMB 4REOA 4V0SA 2I4NA 4Q03A 4GR9A 4HWPA 5JSZA 5B6JA 2DB3A 4OHPA 2AXEA 4PE5B 2G9VA 4FIZA 3VPHA 4B7ZA 5DW0A 2RHTA 4I1IA 5H3CA 4OQMA 1U11A 4RHXA 4DLWA 2FN8A 3A6FA 1GSHA 3DQPA 3OE7A 4U63A 1EWRA 1MA3A 1WB5A 2WMDA 4I9FA 3UJCA 3ICQB 4OLJA 2C42A 3UV3A 4UFOA 4A8PA 3UCEA 5FR1A 2F2TA 5JADA 3E5HA 3NBUA 3KT6A 4RIFA 4IIJA 5C8XA 1KOLA 3CZCA 4GF5A 4GBGA 2IU0A 3VR6A 1O5TA 1MZVA 4EHBA 4C7BA 3LPLA 2JHPA 3GLHE 4KPEC 1IB6A 3LCVB 4UOZA 1IBSA 1EWKA 4B74A 1Y6JA 4EKDA 2WWRA 4ARAA 1Z0FA 3K30A 2JI6A 5C8YF 4UD6A 2GPTA 3UC9A 1B2LA 2FUNB 4EYGA 2XMRA 4DBLE 1U4OA 5TEVA 1CHNA 1ZM7A 2CLFB 2QP3A 1OPRA 4O3MA 1Z9BA 4CJXA 1WS6A 2HREA 1CDZA 4N1AA 3JQBA 4OSEA 4AU1A 1IBLB 3ZJVA 1EB8A 1XRQA 2E0IA 2AV6A 3D3WA 2O2CA 1WX1A 4LXQA 1ZHOA 3BD9A 3M6LA 4KAXA 2ZJ4A 3AY3A 3W8NA 3ECSA 4W8HA 2A56A 2CUTA 3C87A 1O94C 3I05A 2F8TA 2WNHA 3BH6A 2VT3A 3KKEA 3L7KA 3NHFA 1WXFA 1Z6XA 1HORA 3CRNA 2NPFA 3KJFA 3ISTA 1NXVA 3ZIAD 4ER3A 1E1KA 1MB4A 2E9SA 1QZTA 4RTPA 1UMBA 1UBEA 3R3XA 4OA5A 1XEAA 1SXGA 4LY6A 1MC1A 1HG1A 3NTVA 4MEAA 1KO5A 5B55A 2VLBA 1J42A 1WSWA 2YJ5A 3KT3A 4HN2A 2C00A 4FN5A 1DOHA 1NVUQ 3WGUA 3EUEA 3ZJ4A 1CJSA 1M6EX 4XWGA 3PPVA 4I0WB 3ED5A 4CFYA 4AS1A 1SU8A 3KCQA 4AICA 4BEWA 5IWAB 1VGVA 1M54A 4HYQA 1G6Q1 2GEJA 2HQRA 3GFPA 2ZTMA 4U2GA 5EWJB 1SHTX 2XKBA 2I2BA 1PV2A 2PCLA 2PMCA 5HGJA 1VKRA 2ZI3A 4JENA 5C0OE 3OLZA 4DUGA 1XV5A 4XCXA 3ZVNA 2EKZA 3BTVA 1FDWA 4ND4A 2BGTA 3IIEA 4WESA 5TB5A 1R4MB 2DPHA 3N8KA 4IDDA 1NZFA 1A9XB 3IDSA 4ROSA 4DUPA 1M5UA 3CRVA 2ECOA 3BBPA 1DAKA 5I9SA 3GJYA 4P53A 4DQXA 1HDRA 3FNBA 2XUAA 3QJGA 1CY7A 2HYDA 2QBYA 3SYKA 2FRVA 5EGSA 2HGZA 3SVZA 2BHSA 5BVGB 1Z06A 1YBHA 2H4HA 2WPDA 1U0OC 4Q3CA 3JZIA 4IFEA 3EXFB 2O20A 4CF4A 3RWOA 5EUMA 4Q9AA 3CZQA 3FPBA 1FTNA 1PNOA 1V5EA 5AQEA 2H5JA 4RVHA 2I6XA 2A94A 1RPAA 4DIDA 2D4AA 3TXYA 1E7WA 3IAXA 1GGFA 1I0IA 1N5DA 3HABA 3U6KA 4K9MA 4QJ3A 1TU4A 3Q1LA 4UQLA 2GCGA 2IWRA 2VIIA 3H1TA 4H3KB 1YL6A 2H63A 3HH8A 5CB8A 1OZ0A 2C7VA 4C04A 4MS3B 3OE1A 1N5RA 1NQWA 1U7WA 4F4IA 2VYQA 3GZNA 3OKAA 3QKSB 4QFDA 5HJ2A 4HVAA 4E51A 5LNK6 3PD0A 4G0VA 3R7DA 4TMXA 3WYEA 3PX7A 4YQYA 4M54A 3U3XA 4EW1A 1MUUA 2QRNA 2HF2A 3MD0A 1M1UA 4LDRA 3WNDA 2VJMB 2V98A 1JR3E 1QMGA 4B2YA 7YASA 2GCNA 3OIGA 5AT1A 1WR8A 1KP2A 1Y5MA 1PS0A 1U1EA 3K20A 3SBOA 3ZHRA 1JMYA 4ER0A 3A3PA 4OIFA 3KPVA 5J43A 1XQ9A 3CXUA 1GPH1 1FBTA 4N65A 4RDIA 4JC8A 4G01B 5EPUA 2A52A 4GI2A 2ZVQX 3HJTA 4MTLA 3GMSA 3E3OA 4WJKB 2NP7A 4P34A 2CL5A 2HA5A 2I6FA 3FCXA 2KBFA 3SC3A 4J0QA 3E0QA 3K0HA 2GD1O 2I99A 3C3EA 3PYLA 4QEZA 3S2SA 4G0WA 3EA5A 1E9BA 2HH9A 4EFKA 4G09A 5A1TA 4JL5A 1LFAA 3Q98A 10MHA 1UEIA 2NUPB 5KTPA 1SPXA 4UUQA 3E03A 2CDCA 2AUTA 2Z43A 4NCXA 3KALA 4B6JA 4X64B 5I9NA 1RZRA 4ZO7A 4Y6SA 4DXHA 4KX3A 1RXWA 1SULA 1M6VB 4WSOA 1RYYA 3RWBA 5TRTA 1TEHA 4BVLA 1NQTA 3OPYI 4QYSA 4QC2A 1HETA 2Q1TA 2G1JA 3ZE0B 4HZUA 2EWWA 2YV5A 5CNMA 3URMA 1CUWA 4WHMA 3TD6A 4B4UA 4HAOA 3GIDA 5TPZA 1P74A 3EUAA 3QKTA 5KTNA 4UPDA 1ZOOA 3EAFA 4LXYA 4C4ZA 1PJCA 5F3WB 4L5JA 2WR8A 1IJFA 1GXSA 1QE5A 3RROA 1NYTA 3V7YA 1YBFA 4YJ2A 1CY2A 3F7OA 1LD3A 1NXPA 5B58C 2P69A 5CPBA 2Q3MA 3RIXA 2WVGA 1MC4A 2UYCA 3R0ZA 1P0IA 4GMXA 1DDIA 1ILEA 1TAHA 2QX7A 3TLAA 3UF0A 2VJDA 3IPRA 3UPUA 3ETGA 1YQEA 1ADFA 3HYLA 4JNCA 5DF1A 3SNKA 3C16C 4RCVA 2A1TS 3VU3A 3G0OA 4WLFA 4JI7B 2BL4A 3PWSA 3TL6A 1M2JA 1V71A 5AW6A 3L2OB 4EJFA 3R0VA 1KI8A 4MLCA 3U3MA 1HUQA 1E92A 2VAMA 3BKWA 4HI0E 3WBJA 4AS2A 2FSVA 1M8JA 3CBGA 3EIUA 3D31A 4UBNA 4DCJA 3F6EX 1JIVA 2HSGA 2AZXA 3P9ZA 4TTSA 1Y7IA 3D1LA 2NUAB 3N0TA 1SUDA 2WJ3A 2EFGA 3DBHB 3ZNPA 2YNMA 4FB4A 4MR9A 4LTDA 2ID9A 3TLGB 3VC2A 5J2TB 3RF6A 1EK5A 2E4YA 4RLFA 3BRWD 3O8OB 4WACA 3ZGXA 1TE2A 5ED0A 4U0KA 2QRUA 2X5XA 3IBCA 1R8YA 4JNKA 3JALA 3RCBA 3N0WA 4DA6A 4ZPXA 3ULKA 3AOEC 1PNTA 2JI9A 3HJGA 2WA2A 1QHIA 5BR1A 4FMDB 5FI1B 2XGJA 3PFBA 4GPEA 2PQMA 1CS4C 1TVMA 3ORFA 1NXQA 2VDRB 2AN9A 5EIOA 3EG9A 4BL5A 2V6BA 3VYWA 4C0XA 3GLHA 4G0YA 4JVLA 5I8ZA 4EGJA 1JZSA 4L27A 3W2FA 2HXGA 3K4QA 3OF3A 3ZTTA 4W5QA 2O57A 4KQHA 4UNQA 3UPTA 5G2OA 5J23A 2ERYA 1ZIDA 5HF6A 1OT3A 3A1WA 2VHTA 3F1KA 2PMFA 1YJCA 4II3A 3LUAA 3ZEIA 4Z7JA 3AEKA 3ROKA 1ZM4A 1J0CA 1UM8A 3NM5A 3TIFA 3A3YA 3BG5A 4BX8A 3EH1A 4HDSB 4EMUA 1I6LA 1PI3A 2FPKA 5BO5A 2I5PO 2YASA 3L7OA 2GARA 1VI2A 4OQZA 4TKMA 3WYBA 1ZJWA 1K8RA 2XIJA 1BJRE 2O0MA 1K68A 1IPEA 2GN8A 1BMFA 4UNPA 3CX3A 5CM9C 3R6GA 3E7PA 5JWOA 4RANA 3P19A 1T6YA 4BLSA 4GYYA 1MOZA 4ESOA 5CFRA 1KI6A 1IY2A 3HG7A 1UPTA 1BE0A 4P81A 1AKRA 1JQEA 1IRIA 5JAPA 1T91A 2GWHA 3TB4A 1KK3A 4YRGA 2R7MA 3CVUA 3CUTA 4WXEA 5SYNA 2QTCA 1LX6A 2FEXA 3KV1A 1P33A 4QHYA 3AP1A 3ROEA 3I6QA 4IL5A 4ZVVA 3BMOA 4FBLA 4EQ6A 5K3FB 1GG2A 3O9MA 5A4MS 1VCMA 3SZGA 2CEKA 3A31A 4QL3A 3QLVC 4WE3A 1YB1A 3UTCA 4DZZA 3QHQA 2DG2A 2JLUA 4OMDA 3OLCX 4QULA 2PA0A 4YFVA 9GPBA 3ADBA 2GHIA 3O2NA 1X3SA 4XWKA 1A5AB 2Z6VA 1NLUA 1N92A 3TW4A 1P4SA 3Q5DA 4S1OA 5ALPA 4W9MC 1N0VC 1Y37A 4Y2SA 1F3LA 4ECEA 3EMDA 2IOQA 2BJVA 2VJBA 4UM7A 3T54A 5AOBA 3ES9A 3W77A 4E4YA 1TTQB 3F74A 1MP0A 1RBQA 2Q41A 2ADFA 1TLTA 4LJ9A 4NMHA 2J6IA 4Y1EA 3REQA 3TBKA 3OIYA 2J3EA 4GLFA 1VA5A 2JHGA 4V2IA 4C7KA 4TLLB 2ZYWX 2AMJA 1E3JA 3F78A 1ISPA 1BO6A 1N57A 4JYPA 1HI9A 4JUCA 4MEJA 1L5KA 1P1RA 1A4RA 4J0GA 3RU3A 5JJBA 3O83A 1MGPA 2GCEA 5EIBD 1VL1A 3HCDA 3IQZA 2GUWA 2IF2A 3N0VA 1STOA 4JBWA 5CPFA 3D6FA 4WL0A 3UATA 1INLA 1NN5A 2GPYA 3O9VA 4CCYB 4DIEA 1XD9A 3AUYA 2H1FA 1CZOA 4TMTA 4D8YA 2GCOB 1YVPA 1KIAA 3SEAA 4G1EB 3JQ9A 2YFQA 5ELLA 4AJIA 3RT7A 5LQKA 4CRWB 3T7KA 1FW8A 5EKTA 1NURA 3K6KA 3GDOA 4HLQB 2OV2A 1SCQA 3K9GA 3CY6A 3W8EA 1QG6A 2NSDA 1A9YA 2H1RA 3FE2A 3AFHA 1D7AA 3AQIA 1SKAA 1QH1A 2XMBA 1V95A 1CPYA 3LECA 3RS9A 3KTAB 1JR3A 1I01A 4EUSA 4RF3A 2NU7B 4RU1A 5BSRA 2WFAA 2Q1UA 3CGGA 3F2IA 4YAWA 5LDGA 2KW5A 4GDMA 1XZHA 1R10A 1K4YA 4OREX 3ZV7A 3F71A 1GQQA 4XR4A 4A5SA 4AK9A 3MLBA 1KYZA 4JYAB 3IKLA 5DNYB 1Q0PA 4NARA 1KE1A 2PJUA 1RQGA 4DSTA 5JDCA 2FW1A 1LPPA 3IODA 1TIKA 3IFSA 2QTNA 5G0UA 5ALFA 2XNDD 3LQRA 4HTFB 3RRYA 3ZWOA 1XEXA 5JPIA 5HK8A 4I4NA 3KSRA 1JDUA 3DM5A 1E5VA 3AY0A 1XCGB 4PQEA 2IZOA 4NNJA 1KZHA 1OB5A 3HFGA 1XDUA 1Z35A 4UULA 3E27A 2GBIA 2B1IA 3PTZA 5KTYA 3INNA 1ISRA 4LN1A 3QIVA 3TZCA 4DCNA 1Z0DA 2V6GA 2YTZA 4PFSA 2AL7A 2CW5A 4WFIA 4PO8A 3MUEA 5K8CA 2WYWA 2EZ8A 4RWEA 3PIDA 2KS6A 2DWOA 2WD8A 2QRGA 2IPOA 2NQ8A 3PEVA 3L04A 1BVHA 4LF5B 1R2QA 4FFSA 3VHRA 2B35A 1NNI1 3FGPA 3W6UA 3GG9A 5EKUA 3L0CA 4HYEA 1W0CA 1XRNA 1XJ5A 5CLIA 1I13A 5ES4B 1YZNA 4C4XA 5IKEA 3VDQA 1G8JA 3RHFA 1ZCJA 1X7XA 2ECKA 3JAWA 3KAQA 3SSOA 1AZTA 4FFNA 4E1AA 4KHZA 1KEUA 2JFZA 4MUAA 3CX7A 3ZLJA 1SOMA 3LX8A 2Y1KA 6PFKA 3STYA 4DM3A 2CLHB 2D2EA 2ZAYA 2WV9A 5K1ZA 4PEVA 2ISSD 3EULA 1VSTA 3ZXYA 4NYIQ 4JEMA 1RWBA 4QAJA 3CRMA 5KOHA 2B69A 1VCOA 2H1VA 1ND6A 1CQPA 1MO5A 1DPGA 3QWHA 1N3BA 1ZEJA 2ZJ3A 2JIMA 3ZLBA 4DDWA 2HDHA 1TD1A 1B41A 1FLAA 1RJ9B 3F6BX 4K40A 3HFRA 2A9RA 3JD3A 4LOJA 4RMGA 1Z28A 1ZU4A 3AF3A 1LGYA 2JLCA 2QVBA 4N03A 4PG4A 3HVKA 4H7EA 1E0JA 1V11B 3LSYA 5LMZA 3KQMA 1MHTA 3G5AA 3AHCA 1YRYE 2R6AA 4EIWA 1N8KA 3E9QA 4NLLA 1U8AA 1KEEB 2C5BA 4Q7LA 3OPXA 5DHAA 1DZIA 3O3CA 3R6WA 4XD2A 2JIDA 2AFIE 3ITEA 1CB0A 1QFMA 2OXIA 3SAJA 4D0GA 2DT8A 1IG3A 1Z4IA 1ZAYA 3ROGA 1EA5A 3ZVRA 4HUTA 1GFIA 2ZVJA 4LE2A 2PL3A 1JR4A 3PV0A 3I2JA 4MQ4A 3WO0A 1XEWY 4D9NA 1JEYB 3G0HA 3KSMA 5AD1A 2CSXA 3OCUA 2DH5A 1G7RA 2O8VA 1Z0IA 2RAFA 5LMCA 3D5TA 4KREA 4KLRA 3UJNA 5IYZA 2OESA 5A5FA 5CDHA 4TWAA 5KWEA 2RCNA 1HDZA 2PR7A 2NSLA 3AJDA 2PGDA 2K87A 2F55A 4W6QA 4OBXA 2WK1A 5CB4A 1K7CA 4ZPJA 1XQVA 2HB6A 3OX4A 3C6QA 4GBMA 3A9UA 2BDTA 1IEWA 1AE1A 1OWNA 2J5KA 2ZSFA 3DW3X 2EWMA 2R84A 3LT2A 3A2NA 1C7JA 1PQWA 2SNIE 4HR7A 3GLFE 3SLRA 1T2DA 3FDZA 5EHIA 1T4GA 1YB5A 1EVKA 4WKBA 4DDHA 3W5SA 1DIRA 1KFJB 4LQ4A 4WBSA 2B5VA 4EHHA 5I8WA 1SMKA 1SCJA 3O8CA 3T3IA 5ALYA 3O4GA 5FQOA 2JFGA 3LHDA 4U9UA 3G2KA 1E2FA 3WR5A 4ZT3A 4RTOA 4CM9D 2JFVA 3UGQA 2EKDA 1Y6FA 5H59A 1XR3A 5TVKA 3OCZA 2IIVA 4M9UA 4UEWA 4NS1A 3AHJA 1R18A 4RV4A 2K6GA 1FSFA 3MRSA 2K7FA 1HH4A 3QG1A 5A1JA 1QWSA 2QN9A 3WNCA 1NW6A 2KLBA 3UOAB 2FN9A 2RMKA 4KLCA 2WJIA 4DSOA 1UFOA 4G2TA 1M2WA 2PZ8A 3PS9A 4IHJB 3WBBA 2WOOA 1UM9B 2LD4A 4RETA 4DR6B 1ZUHA 3KJIA 4LHYA 2C2BA 4XIYA 1E7QA 3EE6A 1ODIA 2X58A 2NPIA 4O2BF 3K4PA 1VMEA 2OFWA 4R1NA 5KQSA 1J0DA 1SJ9A 1Z2DA 3OOHA 1Q1NA 1GHTA 1U2SA 2D06A 2F00A 2Q4DA 2XTMA 2JA2A 3NASA 4NMWA 1S7CA 3R0XA 5EIHA 1QIDA 1TAUA 2Y93A 2IF0A 4TRMA 4PFKA 3FOBA 3RKSA 1DRVA 1UZUA 2AZ4A 3OQPA 1Z4QA 1VPEA 2PBLA 3DHWC 1Z5WA 4TRNA 3SZUA 1TCBA 4A10A 3L0DA 5JZOA 2FX3A 2X6QA 4A15A 4F97A 1EFRD 2FWJA 2O1SA 5F5LA 4YV7A 3IS3A 2F1OA 2VEOA 2B9VA 2ZUWA 2ZSEA 1QH0A 4IXMA 1ITZA 1PD1A 4E11A 4ZZIA 5IF3A 3VVBA 1FQKA 1X9HA 2QL7A 1Y4DE 5KYWB 1NKTA 4RABA 4AO7A 4COKA 4I50B 1Y3AA 2HTFA 2Q5LA 2X2EA 1ACLA 1YFLA 3QENA 2WWFA 1R0KA 4A3SA 2YHUA 2YWGA 4PGGA 1DC3A 4EEKA 2ZS8A 4PYQA 4F4DA 1THGA 1EFHA 2AQIA 3HYSA 2WILA 1T3LA 3UNXA 2F90A 1POWA 1I4TD 1MW9X 2C4TA 4I9UA 4V0KA 1OF1A 5KPDA 3WLRA 4BWYA 3GUUA 4CTNA 1RWXA 4KWTA 3FG9A 4QPZA 1XMJA 1QYCA 1TUBB 3W8RA 4EHJA 3SP1A 1BX3A 1L5MA 4CDNA 1XALA 4NBNA 2PS1A 1S5PA 3G9QA 3IUSA 4W63A 3NAMA 1Z8HA 2ZIZA 4EGSA 4JJ7A 1FF9A 1K08A 2F9MA 3AINA 4KYTA 2IZ1A 3A0RB 4WXYB 4R1OA 4NZ9A 2VAPA 1Q0HA 3ZI7A 2VKTA 3VR5D 4NZZA 4NK4A 5EXTA 5IK2A 4HAVA 3R3VA 2D5IA 4TN5A 3KOYA 4GP9A 5B7PA 1LPMA 1CJVC 1NVMB 2DOKA 1SXQA 3PGKA 3LA8A 1XCBA 3N2GB 5IT4A 2VEDA 1B4DA 1XDSA 4PR3A 4ZZ1A 1CYEA 1OY1A 3L0YA 1KP9A 4M4SA 3CUWA 4EZEA 3ZDAA 4LQCA 4KE8A 5J4LA 1CUVA 1LDMA 2FQWA 4O0MA 5F33A 3R9XB 3CLRD 3I34X 1LW7A 1AQLA 1P4RA 4JLUA 4DTCA 1JHOA 2CXHA 2CN1A 2F64A 1SXIA 1MOSA 1ZD5A 1J2TA 2H4XA 2JDIA 3AFNA 3GRZA 5JSUA 5D7BA 3E4DA 3DDZX 4OH1A 5A7FA 1OZFA 4R2HA 1PFVA 5LOVF 4RZ3A 1PZNA 1ZM2A 4XJTA 3OIFA 4TMWA 3NIDB 4F46A 2WUGA 3GLSA 1NT4A 3V1KA 2EF0A 1RJDA 4X44A 3QNUA 2UVPA 3K8ZA 2ZROA 1YI0A 4Q9DA 4CUZA 3GFQA 1Y1SA 1W36D 3KSZO 3AF4A 3RV4A 3PDIB 4CPDA 5AVSA 5AXDA 2X0KA 2ZZKA 3UENA 4FC6A 3SLKA 2HYIC 3PEYA 1W88A 4Z4IA 3PX2A 3KT0A 1ZK1A 4GEGA 4NZYA 3D6UA 5LBUA 2XCOA 2JLWA 1E61A 2FGJA 4QEDA 3PL1A 4E5YA 4P2BA 1N2GA 4RBNA 3S2ZA 4OSPA 1AF7A 1E2KA 1YS1X 4JLWA 2NZVG 1Z2EA 1TO6A 2NO4A 3JYLA 3MJFA 4CI0B 4EG8A 3EARA 3L5OA 3RSFA 5B6PA 3QVUA 5K0TA 2O59A 4JGGA 3RTDA 3MCUA 4EG1A 2ECQA 4RENA 4WWHA 1SELA 5BSTA 3NWPA 4ZVUA 4CDRA 1GFZA 2IZ5A 2XLBA 4LVCA 5DGDA 2C2MA 1PT8A 2YJ6A 3A1CA 3AYZB 3PRYA 4PC1A 4X5OA 4RTKA 3UTDA 1QPZA 3MZ0A 3CF4A 3WL8A 3BMQA 4JODA 4W1SA 2GETA 3OVMA 4IYRA 4B35A 4N0PA 3TS1A 4C1BA 4P33A 4Q4HB 4UMFA 1DRKA 4XX1A 1FRFS 2BGIA 4IEIA 3AU9A 4QJ5A 1KDVA 3BDIA 2O8FA 4KFCA 5CDGA 4QKQA 4QSMA 3U1VA 1KS9A 2OSVA 4JJKA 3RUCA 3T7TA 2VTVA 3EMOA 1CR6A 4PQYA 1GZDA 2CXTA 3CR3C 3E48A 4Q48A 4YASA 3TH5A 4BRSA 4EBFA 3WLSA 3BULA 4PSKA 4LMPA 2R79A 4HDRA 4HQRA 2OCPA 4NBVA 4RH1A 1EDZA 1J21A 5EY5B 5KWSA 3RIGA 3L1JA 2QOEA 4Y9RA 2DPMA 4KLNA 3FYDA 2AFIA 2P6RA 3OQIA 3EOBI 4BVHA 5EZ5A 3EQZA 4F3NA 2Q9BA 3I9LA 4XFJA 1UPFA 1JG4A 2J30A 2V65A 3OE7D 3T5TA 3RYTC 1X80B 5D2CA 2ZCJA 3AL2A 2C5SA 4DABA 4NENA 3P9YA 4BKOA 1U4SA 2D4HA 1WTAA 3JD4A 4S0XA 4I4CA 3T5BA 1O95D 3H9EO 2VDWA 2JH3A 4ZTUB 1E5LA 4IDHA 4RVNA 3CZ9A 4BJ1A 4ATNA 1T25A 2UU9B 3IBSA 1CZNA 2GBLA 4TZTA 3AWDA 2P2DA 3K1AA 4J0IA 4U9HS 1HE3A 3AHGA 3E1SA 3HNRA 3R1IA 3NORA 1PFYA 2YUTA 3WA6A 1RHMA 3ZY4A 4F3KA 3HXLA 4GO1A 2HA4A 3RYHA 1FNSA 4ALMA 2RHBA 3TYXA 5KU1A 3HEAA 3LO8A 3VVMA 3C5CA 3H83A 4B3CA 2DX7A 4D44A 5T7BA 2L0XA 1EVQA 2UUPA 3DL0A 1H5NA 5L4NA 3GLFA 3AETA 4JZKA 3R77A 4YUYA 1V5WA 4O4LF 2A30A 4ICIA 3ZBTA 5F78A 5F9MA 4M8LA 2XUPA 4GX5A 4Z3DA 1ABFA 4CTJA 1E3LA 5FR2A 3IP9A 2P2CA 2ZWIA 1LI4A 5IAKA 1RPJA 3L43A 2V1XA 5C1OA 2LE0A 1DEHA 2WU4A 3EDMA 3JVIA 1N9KA 3FSEA 4OQPA 5LMNB 1WMFA 2HMSA 4MVJF 4FILA 4IMRA 3OJXA 1JTEA 3OAAA 2J9XB 3MERA 2FZ4A 2OO7A 2YWHA 4IS2A 4NE2A 3NAGA 4MPTA 1UXOA 3N8GA 5F35A 3SHQA 5HIKA 2BEVA 5MGBA 1L6RA 3KVOA 3T7RA 4DLXA 4JKOA 2X4IA 5KNBD 5B58T 4QUBA 3KD2A 1XK6A 2ASVA 5JSYA 4TKUA 1I7NA 3ED1A 1I1OA 4B73A 3D02A 1EESA 2LIPA 1JPVA 4DR4B 2JNWA 4WLEA 5IVDA 5BN4B 1GDDA 2ZANA 3HTXA 1UIRA 3HBJA 2XVXA 2JAPA 1E5QA 4KYIB 4RHCA 3CNEA 2O1WA 1R4AA 4C29A 2OL4A 4NAHA 1BGXT 1KYWA 1UBCA 2PSDA 4QSHA 2SKDA 1RE0A 4LNHA 2VJOA 5IJWA 3IILA 3U4IA 1NG1A 3L3BA 3IX7A 3DZFA 1ZNZA 3LBFA 1JHMA 3OE4A 4FOOA 5KYYB 2CDNA 1EZ4A 2CLIB 4IVRA 4HC4A 4C87A 2BF4A 3VAAA 4CM6A 4CNQA 4QUKA 5U4XA 2HI0A 5T67A 3I9KA 4GMFA 1WMSA 2WJJA 3QE2A 4Y1RB 3I2IA 3E22A 3OZWA 3QFFA 1SKBA 3W9BA 1G5IA 2ZIWB 4BVBA 4KGZA 3VC1A 3R76A 2G4CA 2PZMA 4JASB 4PLPA 4PONA 5BMVF 4UBMA 5HS6A 3I92A 1P1CA 1VSBA 1I7DA 1PZMA 4BTVA 1E3WA 1UBFA 1CS0A 3REOA 3FYCA 1R7RA 4JELA 3ETJA 2IL1A 4UVGA 3GJSA 1BWPA 2YV3A 3MILA 4HAZA 1HEUA 4L4RA 3UZUA 4DXAA 3IQFA 1XTJA 4AULA 2XAAA 1JFFA 1I30A 4HQLA 3EF3A 1BYIA 2Q5QA 2O2XA 3DHNA 5A5EA 3CO0S 4A8JC 4IGEA 1RI4A 4B80A 2IY7A 2Q3LA 8GPBA 1QU3A 2I62A 2ZWVA 4ZGWA 2RHLA 1LS6A 3VNRA 2YH2A 3RE1A 3ZGLA 3THYB 1ZBQA 5JDIA 2HFJA 3PXEA 4G86A 1DHRA 5CFQA 5KMGA 3LE8A 2V74B 3PEUA 4ZI2A 1SVUA 4BB6A 4DS3A 2C9MA 4RQAA 4AUEA 2C77A 2OAEA 1TB4A 1LB1B 1YE8A 3FDFA 1NUAA 4IDCA 1E98A 1WP9A 5BV2P 4J1TC 3CNBA 3TVTA 1ZVQA 2DQSA 4IQ4A 2TS1A 3RRXA 2RK6A 4QYIB 3UMGA 2PXCA 5BNTA 4YPOA 2C2KA 1GPDG 4BOYA 1DC6A 1ECFA 2PH3A 3DV0B 3J7TA 5DLYA 3CVOA 1ES9A 4A0GA 4YRIA 4PM4A 1JAYA 2C5HA 4Y2XA 2J6CA 1OX4B 2REBA 1MB2A 3DDWA 4YWJA 5HMMA 5I7RA 1W46A 2GPJA 3IULA 3Q10A 5GM1A 3GVCA 3TRKA 3AEUA 1M9NA 1JXAA 1HLDA 3B6KA 1U4NA 1O87A 3HB7A 1KZGB 3QFRA 4OHOA 1NXOA 5AXBA 4AROA 2MT9A 1KAQA 3N70A 3JQDA 5ESXA 5A5DA 1K98A 3BJRA 2YYAA 3CW8X 4BGVA 1GNVA 3AIMA 1C8KA 3IPAA 2IIPA 3Q5EA 4Z4EA 2HLNA 4YQZA 5EERA 2ZTVA 1LRJA 2VZ0A 2Q7XA 5DBGA 2JH9A 3QKUA 1ZISA 3O8OA 5EE5B 5E4YA 3ZWVA 1QDLB 2IZ7A 1BFKA 2AG8A 3G3EA 3IAHA 3KPUA 4EA8A 5U9CA 4GKKB 2VBFA 1ZIOA 4DYDA 5TIIA 4WZ6A 3FF1A 4OHRA 1AM4D 1WUJS 3P9RA 4IEFB 1EG7A 4GAEA 3HV2A 4KMSA 1F7UA 4DV6B 1N0HA 4BNNA 5G41A 4GLBA 1U6KA 1ZCBA 3WZMA 2ZUEA 1K5HA 4BMXA 1C9JA 4GUAA 1I4OA 2PH1A 2WJWA 3FDIA 3WYGA 4D6YA 3E9MA 4N8DA 3OFKA 3UHFA 2FSHA 4GI5A 2FLWA 4RKWA 2WU0A 5KO2A 3R3SA 2YXEA 3OIUA 4G5XA 4G5QA 1J39A 4QFMA 2FX2A 3ZHOA 1T9HA 4TTAA 2WIFA 5JO9A 4RD0A 3JQFA 2BM1A 1KKUA 4US0R 5ELMA 4RTSA 2HKIA 4V0MA 1U2QA 5IJ9B 4ILEA 2ZWPA 5TY0A 2VK4A 1DJNA 1TQ4A 2GAAA 4ARIA 1B8NA 1SWVA 5LFAA 1Y7TA 3FAKA 3KWMA 3L06A 4I5GA 4ZQGA 2XVZA 1BRTA 4HH0A 2F3SA 3WIVA 4ZC1A 2AWNA 1N6NA 3NEAA 4WY2A 4RY2A 5IEBA 5FHRA 3GRKA 3WAKA 1N1DA 1ZVMA 4QUJA 3N28A 2OHVA 4CKCA 4YX9A 1Z6AA 3NNDA 1H0HA 2N46A 3FPFA 3K2QA 1JWAB 2XAUA 5DULA 3OZTA 1SUWA 1XZKA 1CE8A 5LNK1 1WV0A 3WDMA 4DCTA 2I6SA 2POCA 2LZ0A 4NZNA 1L5HA 1KU6A 4EF5A 4JGBA 3A1TA 3QU2A 1P31A 3UCXA 4M60A 4OP1A 1Q5PA 5LKAA 1AN9A 4I4TA 5FBLB 1LI5A 2VDKB 4YAIA 4XSHA 4A1OA 4C3UA 3QE9Y 1S1CA 3ZGOA 4KSBA 5K4AA 2GLXA 4KXWA 1TNDA 2QMYA 4P1ZA 3R6DA 2IXGA 5LC1A 3RRNA 5CX4A 4KQXA 3KKZA 1G64A 3IOMA 1S4MA 1DC7A 4E5PA 4KUHA 3WWZA 2CHUA 4HWGA 1AVTA 4M55A 4RXUA 2WNIA 3RNLA 3NUGA 1Z0JA 4NU8X 2X8LA 3RARA 3DO6A 3GRVA 1P9OA 5DASA 1MZPA 5AJXA 3E9CA 3LT5A 2HRDA 4XUGB 2QLLA 2PJZA 4B46A 1BMFD 2JD0A 2BUAA 2I22A 2BFCB 3HSYA 3V8VA 4B3IA 2IC5A 2UKDA 3K09A 1R8JA 5FFNA 1F5NA 2A9QA 3BT7A 4EJMA 5I51A 1VHDA 3BA6A 1NLYA 3D6VA 4JOCA 3M1AA 3EMVA 1XUOA 3SMVA 1G8MA 4Z49A 5KCZA 2I65A 1KVTA 3QW2A 3VVLA 1M2OB 2I0FA 5CFZA 5B1YA 1N2CA 1Z25A 3LFTA 4YXFA 2AZTA 2P4UA 5L7TA 2BE7A 2Z56A 3WYDA 3IQXA 3HO1A 4B75A 2VF7A 3ZHYA 1SN7A 1RCTE 3LBHA 2X6RA 3RSLA 3GJ6A 4J76A 3TW8A 2NM0A 3CKYA 3LP6A 5K4GA 2KI5A 1YQWA 3NIBA 3WRVA 4YAJA 3K0CC 4UTVA 4MDEA 1FC0A 1ZD8A 2R85A 2VFAA 1C7EA 3KU4A 4RIHA 3L1KA 5F7JA 4C4YA 2P4SA 3FWPA 2OA0A 4RA9B 1ZH0A 2MR6A 1ZD9A 4N5DA 4TL8A 5HWSA 3TE6A 4LNUB 1XMOB 2Q1XA 1B73A 2QM3A 3O8LA 2HK7A 2GO7A 4OHFA 5IZCA 2KMLA 3GUVA 3OHPA 5FWXB 3KQHA 1T2AA 3QSGA 2FE4A 1OGIA 2ZETA 1FFHA 1ZN7A 2D2IA 5ALTA 4CG3A 1P2UA 2JAUA 3NC0C 4FFBA 4NBKA 3KUCA 3KUXA 4KVGA 4IIDA 3MGGA 3I12A 3IAS1 3QMPA 1G8KA 4FVTA 1PEDA 3E2IA 4QUHA 4CI9A 1ZYUA 1GPLA 1L7OA 2PXHA 1FB5A 4GPD1 4L16A 4L1KA 4UNRA 3UMMA 1EWVA 4XKJA 1JBQA 2ET6A 4GW3A 3NDJA 4MA5A 1A95A 4F4JA 2H07A 4J75A 3F0TA 2BJHA 2BKXA 3FXAA 4MWBA 4DG5A 1VFNA 4FYHA 3IDOA 2J45A 2XNKA 4JBHA 4AF7A 2MINB 4RTQA 1YNOA 2P3LA 1U81A 4CT0A 4L8YA 1CUZA 4A4DA 3VKWA 2VP5A 1HYGA 4RLHA 4Q4DA 5TQ2B 2VSQA 4R2MA 2G71A 1S3IA 2HU5A 2ILVA 1OQAA 1C9DB 2OHGA 5FBVB 3UH1A 4JUIA 3IEXA 1V5IA 2A53A 4LJ8A 3TGLA 2Q4OA 4DDTA 4ZIRB 4L5YA 1JR3D 3TMYA 3PSHA 2L82A 3LRPA 5IT9A 2B25A 2A1UA 3OM1A 3BCUA 1A5BB 1Q44A 5D3MB 1Y4UA 3Q7SA 2VP6A 3O03A 4GICA 2ATCA 3DBIA 4JHLA 4OJNA 2HJHA 5T5QA 4BJ3A 4BJHB 4YEDA 1EIZA 1W5SA 4TMZA 1L5VA 1QIKA 1F9EA 3QWIA 1DBPA 1E1NA 1GU7A 2Q5OA 1NF8A 4HN4B 1YZYA 3TTTA 1RIIA 4I8DA 4XPZA 3OY7A 1D3AA 1JI3A 2CLCX 1FL9A 2BE9A 2OOKA 2PLFA 4YYEA 1KYIA 2PN1A 3W3AH 2QTTA 5EL0A 3JQRA 5DGTA 3EDQA 5BT8A 1QORA 3DPUA 3T9DA 4Q15A 1CY0A 2Q6IA 5DTRA 1KC1A 2DPLA 2DR3A 3BORA 3F5FA 1CUCA 3RRMA 3WXMA 1HFJA 5IG2A 3GARA 4RO0A 3UJHA 2JLXA 5A3QA 3FZEA 2AR0A 3ZDZB 3HKCB 4WX2B 1RYNA 1S01A 1RJ9A 3HU3A 1V7CA 3BHJA 1N8NA 3OTHA 2YN2A 4MWGA 3LQKA 3TAUA 4DNXA 4MAMA 2FWBA 5I3CA 4NHOA 2BN4A 5J2TF 2X9LA 1Y6GA 4YJGA 1E1QD 1P72A 1AZWA 1IHDA 1QPGA 2OCKA 1U3UA 1NVKA 2ZYUX 4HVLA 3FTQA 4ZQCB 4YP0A 5ES3A 3ASVA 1Q57A 4S24A 4WY5A 1UWKA 2HA2A 3R20A 2P6UA 4WIAA 2X0DA 4DCSA 4HQOA 1NRJB 1WW3A 1G8FA 1JB9A 4K3UA 4BFWA 2Z9BA 3BJEA 2CZCA 1S6YA 3ZWNA 4KQ2A 4ZQBA 2IPAB 3O8BA 5C8YA 1Q50A 2QUIA 2QF7A 1HFEL 1AZSC 1NVWQ 3QFTA 2FW9A 2ZB8A 2BGJA 2V5AA 2WM2A 2PEZA 3EXIA 2Q0SA 4PLFA 2GF2A 1M6NA 5HE8A 4YP5A 1ECJA 2NMVA 2ZT6A 2NXEA 4FYKA 3RW9A 3ZU4A 2HDOA 3V00A 4XPIB 2XOKA 3BH7A 4G36A 4NNPA 2NUTB 3KR0A 4OQFA 1TM1E 4RHYA 1QUFA 2CHGA 3F9CA 4HVTA 5JAUA 2J7PA 3RDPA 3ZHXA 1PG0A 2OYCA 4CTKA 3WDKA 2RIRA 3F5SA 4JAVC 2CVOA 3UYLA 4PHGA 3BQNB 4PINA 2VQFB 3ICEA 4X8HA 2FW8A 1JIUA 1GU1A 1HLFA 3AI2A 3B3JA 3SWWA 2XUQA 1KMIY 4Y2UA 1IXRC 4I9HA 3C6XA 4IJMA 4MTCA 4PO1A 4R98A 4U0JA 1MXFA 1QP8A 3OZDA 3EUFA 4V0NA 1PLLA 4LI3X 3LWDA 5IXYA 1Y89A 2C5EA 5BSHA 3RU9A 4BJ5A 2EX4A 3FX2A 4AN1A 5IBCA 4JJGA 2O4CA 2AUNA 4KVFA 1DJLA 5DLPA 3MQFA 1H9BA 1J06A 1T9KA 2RHHA 3V6MA 2YYSA 2XZDA 4FWTA 4KSCA 1WXQA 2UZ1B 3AR4A 2RB4A 2AYXA 1S2IA 1URPA 2H2FA 4JLNA 4Y7CA 5FT9A 4OLBA 3H2YA 2FOIA 1QMPA 4Y2RA 3ZV5A 2Q45A 3I53A 2AD5A 4ZAXA 4BDTA 1XF1A 4BQQA 5K0ZA 2REOA 1DFIA 1Z88A 5U4QA 1OX5A 1UKZA 1US8B 4PY2A 5DIZA 5JE8A 5AI5A 5J58A 3VR0A 5M04A 5BUSA 3OJEA 2P5YA 2GPAA 3HSSA 5DN9A 3CCBA 4R84A 3KC2A 4K87A 2I1WA 3PNVA 3C8HA 1PW5A 3NEYA 4QREA 4F91B 3AKYA 3R5FA 1G8AA 3KUUA 1QKKA 1O03A 4AZWA 1PBNA 2WUFA 2ONZA 1W94A 3KLNA 1F9AA 3KJNA 2YN4A 1YGYA 4OO3A 2FFHA 3EGDB 3RVRA 2AMVA 2PD4A 3B9QA 4DIBA 1L4UA 4YRDA 2QN7A 2X2FA 5IW8A 4DDMA 4P84A 4ZO6A 5ADUS 3ENNA 1VJTA 2ZIVB 1Q19A 5B2EA 2QXYA 3S7TA 6YASA 3I4CA 5AOAA 3BF8A 1YVEI 3OOEA 2P2ZA 3QUTA 1G6OA 4GWGA 4UHDA 1VG8A 4IOKA 2W43A 7REQB 3EX7C 4FNGA 2JJMA 2FPWA 3EOAI 3I8SA 4YUWA 5G2FA 1RTTA 2C9BA 4YJKA 4QGBA 3F73A 2QD1A 4I50A 3W79A 1MOPA 5C4IA 1A9ZA 1LZKA 1NW3A 3QOXA 4LX8A 2IVFA 3S2YA 4K7JA 3T7CA 3UOGA 5JCOA 4EATA 1OLOA 1XP5A 2C2OA 4K6FA 4C43A 3SDBA 2ZIEA 1DC5A 3B36A 2HM7A 4B71A 5FO1A 5IP5A 5JRDS 2GEKA 2BP7A 2XZLA 1CVIA 2ZSUA 4C6SA 3C1TA 2HFKA 1E3IA 4AX4A 1UBOS 1KY4A 3G1TA 3V8EA 2GZMA 2IEIA 3PYXA 4HK4A 5CYPA 4FCVA 4BGIA 3BERA 3TVYA 2GYWA 3AT1A 3TF5A 2V7EA 5GY7A 1NM5C 3B1YA 1BDJA 4L4XA 2F4VB 3EOZA 3ANXA 4TMKA 1LKZA 3WIEA 4ALIA 1ADCA 3OMXA 2ZUCA 1K3FA 3I76A 2RGBA 1APBA 1LY1A 1V8DA 3GELA 3DWEX 1A82A 4DMHA 3DLBA 5TLSA 2PO5A 3BM5A 1CK4A 5EJ8A 3WLJA 1HMYA 1YDHA 1WXGA 3OEWA 3ZY2A 5BUQA 1RLIA 3ZGZA 1LBEA 2IX9A 3KTOA 4UU8A 4R3NA 1JYSA 1E8NA 4DGQA 1D8AA 2XODA 3BQMB 4I14A 3HKBB 2QRZA 2GZAA 2I8CA 3DAFA 4OXYA 4FQ5A 1W4AA 2ACWA 3KQKA 4YK7A 2HIGA 1TDJA 2ZSDA 3U4AA 2PRIA 4NE9A 1M10A 1XU4A 4N48A 2JCSA 1P5FA 4YBZA 1DCMA 4R8RA 4TZKA 4RGVA 1ODKA 3OFVA 4LZLA 5BORA 1NNLA 4O4HB 2CMHA 2RG1A 3A6LA 1PE0A 2Q6KA 2QT9A 3HPRA 4HP8A 2ARKA 1WRBA 2PUTA 3DVRX 1NC3A 4QJ4A 2JFHA 4OHMA 4G3XA 2FJUA 2PMKA 3HFJA 1JSCA 1YR7A 2DBQA 4I1RA 5ALIA 4KPUA 4XQCA 1MX1A 3ENQA 5B1HA 4LWZA 4Z0NA 2OC9A 4BXOA 5JJLA 1NVDA 1WVIA 1CX9B 2V96A 3U0BA 5JOQA 5ALLA 1QB8A 4FYIA 4GG1A 5IK2D 1GQSA 3AOGA 4LGMA 3ZCRA 4B4KA 4DNFA 3ICOA 4MQEA 4LF9B 2X22A 1T8SA 3WGQA 3IVGA 1KZYC 2WTEA 3LUHA 2CFOA 1YNSA 2FOLA 4J3JA 2PTHA 1RXIA 5F3DA 3UGKA 3W7AA 4KDCA 3VXKA 4EB3A 1CIVA 3H4VA 3PZRA 5GGYA 3HL0A 3N1UA 2X8AA 2YWFA 4EG3A 3DJYA 2A5JA 5ITVA 4TS3A 3UMJA 4TYWA 4LHXA 2D5BA 4LXGA 2L17A 1B3RA 4ZQIA 2AXNA 3DZHA 2GS9A 3HY6A 2DT5A 4V02A 4ZV9A 2JDID 2W2QA 3G79A 3IEIA 4EGFA 3LK6A 4JMLA 4QGSA 4ZVNA 4X6YA 1IN5A 1W29A 4B6RA 2NO5A 2DLDA 3WG9A 4EMBA 1X87A 4F2DA 2DKOA 1O94A 1KSHA 2PPVA 3OJ0A 2BUBA 1AQIA 2CMGA 2Z2ZA 3HEMA 4IR7A 4ZDKA 1RC8A 2E1RA 4U39A 1PSZA 2G9QA 3U7HB 4P3OA 3CVJA 4TKZA 2W11A 2H9IA 4D02A 3VZPA 2PRSA 2REQB 1QS0B 5IBRA 5DTEA 3WMWA 3ZQ4A 1UPCA 4AZSA 3ZLVA 2I8LA 2H17A 2W6QA 1C0IA 5CLLA 1J5XA 1DFGA 1LTQA 1HPLA 3JS5A 1K86A 4I6GA 1ECGA 2HZ7A 3DR3A 5BVHA 5DCWA 3TKYA 6REQA 2VHZA 3LG2A 1G2QA 2HBYA 4W82A 3F98A 2IJGX 3OHSX 3UJBA 2J3HA 1HDEA 1ZPDA 3MQ2A 3ZY3A 1FFXA 1XKTA 1SO8A 1N3IA 3QLJA 3IV9A 4X1KA 4EDHA 1XVUA 3GPIA 2ODWA 1Y0BA 1C2YA 1OLSB 4AYWA 1RMYA 1ECCA 1W47A 4FZVA 4JL8A 1RYFA 1UIMA 1O54A 1OTHA 2Z2JA 1AT1A 1EDEA 1GOTA 3O4HA 3OUUA 5JJ5A 4K9DA 4MAFA 3E5NA 1A69A 2QXTA 3WQRA 1RYMA 1EJ0A 3L0IB 4QYWA 2AOXA 2OCGA 2ZJ8A 1V7QA 4X20B 2FPIA 1L4EA 4R8LA 5HUJA 4PF1A 3R8CA 1OU4A 3ISVA 2VNAA 4GI1A 4YIKA 4I5FA 2YMQA 5J47A 2FPSA 5L7YA 2EG5A 4KXQA 3T3DA 1KBOA 2Q4TA 4A2QA 2QMZA 4O2LA 4BB5A 2VWGA 3UEOA 1LK5A 5IDWA 1LLCA 3ICCA 4L85A 2BHTA 1P6XA 4TTQA 2HNBA 2ZRJA 1SD1A 4UXHA 5TMBA 2FGKA 1QZZA 4CTMA 3HCBA 4MV8A 1KKLA 4WKOA 1H0RA 4DLAA 4MUNA 5G0TA 2AJBA 4AECA 4LJ6A 1JAZA 1T0PA 2A0YA 3IPLA 3NIGB 3PHHA 4M46A 4PSUA 4B09A 3OQNA 4NFLA 1VRCA 2GR7A 5AIAA 1X8XA 3ZXXA 2PAAA 3RRFA 5JSHA 1M6YA 2ERCA 2PL9A 3UT6A 2GN6A 1TTHA 4UASA 1EVIA 3G2OA 3CF4G 3R9IA 4E33A 4KL8S 4M88A 4FX5A 1WETA 1KETA 2X9VA 1A7KA 3NHAA 1O4VA 1UXKA 2A5LA 2FJ0A 5FTNA 3ZI4A 3EVZA 3R2JA 4RKRA 4XM1A 4CHGA 1T8WA 1LI7A 3LY9A 1T9DA 2WMYA 2DUUA 1KMHA 1VBKA 3G5UA 2C4VA 2Q8PA 2R4TA 1XTQA 3DDSA 3VAYA 2OZEA 3DMFA 2BGKA 1IAVA 3KZNA 5KNCA 3E4CA