3CP1A

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
73
Chain Sequence
b'TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane Protein
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cp1A00
4N21A 2LP7A 3GWOA 5H9CA 1K34A 2P6JA 1QR8A 2X7RB 5KA5A 4JGSA 1MOFA 1DF5A 3CYOA 2MK3A 5HFLA 4N23A 4E2LA 1Y66A 1DLBA 1JPXA 4JPRA 3M99B 1EBOA 3MHHC 2M7WA 1Y4MA 1JQ0A 4FJCC 1DF4A 1QCEA 1F23A 1I5YA 3WFVA 4FIPC 4G2KA 2EZOA 5CN0A 4JF3A 1MG1A 1QBZA 3MHSC 3CP1A 5KA6A 2OT5A 3B8NA 1QR9A 2EZPA 1ENVA 3H01A 5HFMA 1SZTA 1I5XA 3B8MA 3P30A 2EBOA 3B77A 4FK5C 3K9AA 5CMUA 1K33A
chains in the Genus database with same CATH superfamily
2XAHA 4F6EA 3U0ZA 1WLEA 5L3FA 2LQTA 1NTZH 1AP6A 5GONB 2R72A 3QF7A 1PKXA 2JJ1G 4I9QA 4P2ZA 4UVAA 1ZLZA 3R66A 4O4LA 3SYAA 3MDSA 2BE3A 1R3JC 4LF8O 2JVDA 2YC0A 4UCOA 1YZBA 1Z2GA 5FNVB 3G6EV 2HKOA 4YY3O 2DYSC 1XILA 4AHCA 5JCOA 4QJFB 2PI4A 5CA0A 4MTGA 3TETA 2PZSA 3JATA 4P30A 5CBHA 1R3LC 2ZD9A 2Q0AA 3AG3C 5IJ9A 3RYCB 4TT3G 3JAKB 1BT8A 3CJHA 1QQCA 1FFXB 3GWOA 2ITDC 5H6QA 3STZC 1Q7YW 4X8AA 3E89A 3RN4A 3CCUV 3WB2A 1VQ5V 2EIMC 3T1YO 2QWOB 4GLXA 4O4IA 4B3SB 5DM6V 4E2LA 1MMMA 4DV5O 1H2NA 2WLHA 5ITZA 1XREA 2X6BA 3DC5A 3T1YB 1BZKA 3OT7A 4WFBV 5LP6B 2QGNA 4Z2WA 4DR5O 4DV6B 2F23A 4PELA 4X64B 3TJTA 2F93B 2YI8A 4DV5B 2ZE7A 2WLMA 5CB4A 1NH2D 3SPJA 2R9AA 5J9PC 3AG3B 4U3JB 4G28B 1VMGA 4EEQA 2D2CB 4OX9B 5B1AB 1I94O 1ZAUA 2ARHA 4H13B 1BHAA 4TQFA 5LA6A 4EB6A 5LOVA 3BA9A 3E22A 3F7YC 2OT5A 4YJ3B 2B9ZA 1XMOO 1SZTA 1J5EO 4H0LB 2EULA 5DECA 3SPGA 1KQSU 4O2AB 2X7RB 1SQGA 1SA0B 1N4CA 3OTOO 3CXHF 1N34B 3CD6V 2B5UA 5L3BA 5D5PA 4U7NA 2YDEA 1HP8A 4IIJA 4I4TA 3H1LH 2QTOA 3AEIA 1WP7A 1SETA 1QR9A 1TUEB 2JRIA 4IGGA 5JVDB 1XOUA 1RPRA 3N2GA 4G27B 2V1DA 3K58A 4UUJC 4K0KB 2P4KA 4FLTA 3AG2C 2HJDA 3U11A 4JI1O 4DV1O 1G4YB 2CH7A 4PDVA 1EN6A 3D8CA 4PA9A 5C8YB 1IBKO 4IL6Z 3W7XA 3OR7C 4FLWA 3FB8C 4BWAA 2Q9LA 2WLJA 3CCJV 2KG7B 1OCCB 4EKWA 1Y66A 2H94A 1IBKB 4WFAV 4Q6GA 2VQFB 5EYPA 2DYRB 1M9NA 4PA7A 2XUMA 3IC9A 3EVKA 4JI3O 3WB1A 1NU1H 2YIAA 3B8NA 4FLVA 4KHPO 1S3JA 3BVOA 5EZYA 2EBOA 2JGUA 4MT8A 3LSQA 4R7CA 3K03A 1OCRB 1QR8A 4X89A 2R9IA 2KSDA 1JFFA 3CCEV 3K9SA 2YXYA 2QWPB 2HVJC 2ZKOA 3E35A 1AB3A 2YXLA 2P22C 4K8XA 3BABA 3AG2B 4JAUA 2JK5C 2DMXA 2OTJV 2EX3A 4KXRA 4AI8A 1EZJA 4J7JA 3SJBC 1AILA 1QLEC 3BY6A 1HNZO 5KUMA 2QM7A 4JAVA 5FPOA 4X62O 2QEXV 1VF6A 3J81N 3CCQV 1MNGA 4TQDA 4C7UA 2PGGA 3QTCA 1ORQC 1JJ2U 1HDJA 5KLVH 3T1HB 1W2BU 1PNLA 2BTQA 1DK1A 4R50A 5C93A 3N27A 4J42A 1J95A 2Y0PA 4J9ZB 1PD3A 2EZOA 2KB1A 4YXWG 2JEUA 1H8EG 4UCTA 2RCVA 3NR7A 2Q7GA 4UCSA 5J2TA 4XBFA 1JVMA 3ABLC 3K04A 4LF5B 1FD9A 4CS4A 5IYDO 1NS1A 3L71H 3CRAA 3SPIA 4LF6B 1GRJA 2JS3A 1JPXA 3SR2C 2P90A 3RYIB 1QLEB 1VQKV 3JAWA 2KQXA 1I7FA 3BEHA 2YEVA 4DV0O 4YJ2A 4WBNA 4LFBO 2ZM6O 1PNMA 2ZQMA 5K1PA 3ETGA 2ETNA 2BSKB 2Q4PA 2DWDC 3OE7G 4GX5A 5LYJB 4BIZA 5L3GA 3DXRA 3FAVB 2JDIG 5JJJB 5CN0A 2VQEB 4LFBB 1FXKC 2QDOA 4PI0A 4NTWA 1URFA 2OIEA 3SYQA 1KKCA 1Y76A 5HFMA 4I55A 1XL4A 3ZHUA 2QR4A 3D36A 1NR7A 1VEWA 1UJWB 1MSWD 3ABLB 3OEEG 3ZHTA 4UFZA 1WA8B 1OZ0A 5JH7B 3MD0A 1XMQB 1N8RW 1V9PA 2ZIOA 3S3WA 2XOKG 1Y74B 1JX9A 4JI0B 3SYOA 5B3SB 4PV1B 4FFBA 3PJSK 3PN1A 3UT5B 3ZMUA 3TK1A 1HNXO 2YUAA 3CMEV 1GM7A 2CTPA 4JYAB 4JYYA 4A5UB 1YEWA 1KB9F 2IM9A 4I0XA 4FM2A 1N33B 4LH6A 4LH7A 2HG5C 4QIWF 2N74A 4TV9A 4H44B 2Z5UA 2RMKB 1GN3A 3OGCC 1FXHA 4GX2A 1V55C 2WLLA 5BY1A 3RGBA 4R6ZA 3CRQA 3HKEA 1H2LA 4BW5A 3H1JH 4ZOLB 3K59A 2QKSA 4FLUA 1KMIZ 3LDEA 2ZDIC 3CCSV 1B04A 3A0RA 4HZ3A 3B4SA 2XHBA 3JD3A 4MVUA 1RSOA 3JALB 3K5LA 1MG1A 5CA0B 3ZMTA 5IY5C 2JIZG 1THZA 4JGSA 2CTQA 1ZTEA 4ZHQB 4LC1A 5KHIA 3OUSA 1O9GA 4TV8A 3JASA 4JI2O 1OCOC 1E1RG 2LGWA 3SJAC 4MTOA 2AZ0A 5B1BB 2Y69B 2OTLV 3ETQA 5GW7A 2CDYA 4HNAB 3CXCU 3ZMSA 4EFBA 4LF7O 4NR1A 1SZXA 4TOIA 4I9WA 4JI7O 2LP7A 2E74B 4AQYO 4O4IB 3T4DA 1OCZB 4LF9O 3RYFB 3EHBB 4NXMO 1XDCA 1G8MA 4MVZA 1N32B 2EZPA 1H8HG 3P30A 3OR6C 3D3QA 3K9AA 3ML0A 4NXMB 1NTMH 3ZS8C 5CB4B 3HKDB 1S72V 1YSCA 3VQVA 4X66O 2VS0A 4DR1O 3QVNA 5JQGA 2F4VO 1EBOA 3BHPA 4CBCA 4PA4A 2XAFA 2NR5A 1ZL8B 1N36O 4RQEA 4GX0A 2E3CA 3OD4A 3P32A 3E2EA 2LJ2A 2XAQA 3E22B 4DUYB 1IBLO 1BE3H 1MOFA 3ZRWA 2PI5A 5EC2C 4W4LA 2HEPA 1Q81W 2UU9B 3F5WC 1O9HA 4GCZA 4DV2B 3GWKC 3VOUA 2V7QG 1AJQA 1VQ8V 1M5IA 4I4TB 5LHIA 2AXTZ 4F6RB 2Q68A 1T5EA 2XTAA 2E75B 4LP8A 4LWSB 4N23A 3THOA 3AK3A 4X1IB 4O2BA 5B66Z 4XDLA 1JQ0A 2IBZH 2V4DA 2YIBA 2P06A 2ADPA 3CC4V 3CCRV 3JD4A 1KKDA 1W0JG 1QNMA 1R3IC 2Y48A 1E79G 2W0FC 3B8MA 2LW1A 1RP3B 1XNRB 1YTFD 4DR7B 3ZN1A 4KL1A 2A9HA 3OTFA 1GN6A 2Q7HA 1ZX3A 3LSUA 1EN5A 2GTAA 1YJWV 4X20A 1GO3F 2G38A 3K5OA 1S5HC 3APOA 2UXDB 1K5SA 2A3QA 1H2SB 2AGAA 5BMVA 4YIPA 2C2AA 1IBMB 1QVFU 3I5DA 1FYJA 3CMAV 3FB5C 4LNUB 5CBGA 1HW7A 5IYZA 5LP6C 1SESA 4RWUA 1DLBA 2LFRA 5KMGA 1FXKA 4LCUC 2LW7A 4NXNB 5JJEB 1JFFB 1PV0A 2ZCEA 1YCIA 4JI4B 1VQMV 4TUYA 5IJ0A 3ICXA 4JYCA 3OMIB 4UV9A 1CXZB 3F7VC 5B1AC 1EM1A 3ETDA 4FMTA 5LXTB 1FAFA 1TUBB 4B3SO 2CUGA 3ASOB 3KCYA 1SQFA 3BCCH 1DTOA 3Q4HA 3A8TA 3N2KA 2X0LA 4HAMA 4FZ1A 3FKSG 5FL7G 2NN4A 1WPBA 4G2KA 4IT5A 2ATKC 3HKBB 4RQFA 4DV6O 1TA8A 4L8JA 4NVPA 4X64O 2ILMA 1NI8A 1Z5WA 2JGDA 5LGTA 3T4ZA 3RYHA 2FYUH 3W7WA 4OX9O 1S5JA 1L1FA 1B6QA 5KHJA 5KA6A 1IDSA 1M4UA 3ZMZA 4O4JB 2HHHB 4DYLA 4DR6B 3SJQC 3CS5A 4ZI7A 3C90A 1VQ4V 4BW9A 2OCCC 1SKVA 2ADQB 2FL4A 4Q20A 1SRYA 4LFAO 4JPRA 3MHHC 1JA8A 2Q6AA 4O4HB 1YXBA 4X9QA 1N34O 2IH1C 5GTIZ 4J7KA 4LBEC 1IXBA 4F4LA 3OEHG 1K4DC 4J80A 4FPPA 1OCCC 3K5NA 2Z3YA 3OMNB 3SPCA 3W7UA 4LFAB 3AG1B 1UPGA 5E79Z 1WP8A 2DYRC 2OCHA 2FKXA 1XI1A 4K0KO 5IDJA 1KUQA 1IX9A 3CRRA 1NR1A 1OHHG 1KC8W 1K7DA 4D7TA 1K9MW 1OCRC 2WLKA 5IYCO 3R65A 1M1KW 2FTKA 1VP7A 3SGIA 3STLC 5L3CA 1B3QA 4DV7B 1FFTB 3J80N 1JJOA 2H3OA 2OCCB 4CH3A 3H1KH 2AW9A 2YXHA 4B3RB 2PY5A 4JTCB 4DW0A 2DE0X 2UXXA 1R6TA 2VQFO 1Q90D 3A0HZ 4CC5A 3ABUA 3FB6C 1MABG 3DC6A 3IFXA 3OW2U 1R1BA 4OPHA 1E1QG 1GM8A 3OGIB 2Q69A 3G80A 4MTFA 3SJCC 1F23A 1XNQB 2F43G 1MZEA 3UO3A 4X1KB 1Y6XA 4DXWA 5J2UB 2BTOA 4TV9B 3ZCCA 5KHHA 3O65A 2MW2B 2EJ7A 3LDCA 5GONA 4ZKIA 1M56B 3E8BA 1NZ6A 1BHBA 1TVKB 2WLLB 3P3NA 2NNUA 3IAYA 2R70A 1G6UA 5EK0A 4J11A 4B7KA 3WFVA 5EBMC 1XHZA 3BRCA 5FNVA 2GV9A 1PNKA 4IYHA 3RBZA 4I50B 3L73H 1RSOB 3LNNA 2JEXA 1IURA 3J7AU 3ZJZA 1LNQA 1KP3A 3WG7B 3E86A 2ZNIA 1GK9A 2CTWA 3CB2A 3D3IA 2WA4A 1BGYH 4IYIA 4WFGA 3RYCA 3T1HO 1OV9A 3JAKA 1FFXA 4ABMA 4P9OA 3JD1A 4NYKA 4UCUA 2O57A 5IE9A 2ZINA 3FX7A 5L3EA 3RT3C 1BQZA 4DRXA 4LF5O 2EIKC 4DUZB 4GX1A 5B1NA 3M7MX 5DN6G 4LF6O 3JD2A 2BOBC 2N05A 3CCLV 4PDLA 4GYCB 3AK2A 1IVSA 2WSSG 3ASNB 3B40A 2RQ6A 3CCMV 3E8FA 5LP6A 1LR1A 2AHYA 3CYOA 2DJVA 2XAJA 4CZZA 3E8HA 1JR9A 2DN9A 5B3SC 4CS3A 4U3JA 5IYBO 1LUWA 4U3FH 3MAQA 4FLYA 3WB0A 2VWKA 1Q86W 1W59A 2Q67A 2VQEO 5H9CA 5EC1C 2P6JA 4IHJB 3UKMA 4LF4B 2PTMA 4YJ3A 1X59A 3C3TA 2EIKB 1XMQO 4O2AA 1SA0A 3K0GA 3NXSA 1NVPD 4RAIA 2E76B 1R6NA 1RPOA 2RJZA 4JI0O 4JI8B 3HR0A 1GN4A 5B1OA 1FS0G 3LUTB 4PI2A 1GKFA 4OGQB 3CSXA 4B3MB 5H2FZ 4JYAO 2FMLA 3AK1A 2WA3A 2XNDG 1B06A 3H9VA 4CH6A 4GUNA 5JVDA 2BCCH 2HLDG 1N33O 1S77D 2RDCA 1WB8A 1K4CC 4XDKA 1S5LZ 3K08A 1WNSA 3RWRD 1A32A 2HR3A 5B1BC 2Y69C 4ZIBA 1Q3EA 5HFLA 2ZR2A 4PA3A 4JI5B 3LNMB 5C8YA 3E8GA 5LHHA 4OXSA 2W6JG 4PDRA 1YF2A 5EIBD 3EXAA 2KG7A 1F51A 3F5TA 2CGNA 3L9DA 4WCEV 3TXQA 1NQTA 2UUCO 2K1EA 2WLNA 3L72H 1OCZC 3ZX6A 4O4LB 1YDXA 2M6YA 4LFCB 3K5MA 1GMGA 1MZFA 1AR4A 4UB6Z 1RM1B 1SQXH 4JTDB 4QGPA 5IYZB 2AZ2A 2UUCB 2IJHA 2RN9A 5KHGA 3UM7A 4DR2O 2DQ0A 4DR3B 3VQYA 3OAAG 1V54B 1YTFB 3JATB 3ABMB 1MA1A 2KKWA 1WN7A 2ZNJA 4TUYB 3RVZA 2FB5A 4W4KA 5IJ9B 5TISZ 2WLIA 3JCUZ 4X88A 3CJHB 4DR2B 1W0KG 4RUEA 1WPXA 2HVKC 4Z1VA 5EBWC 1N32O 3FB7C 1F7YA 5IWAB 2Z0AA 1K92A 1YJ9V 5L3DA 3HKCA 2XASA 1QVGU 1DF5A 2EIJB 3ZBHA 4UV8A 4H33A 2QWNB 5ITZB 2IJKA 4FJCC 3SDLA 5BR8B 2HJFC 1VQLV 1S0VA 4DV4O 2F95B 2YS8A 1VQNV 1AR1B 1K8AW 2DWEC 3APQA 3CEIA 1YHQV 1Q8IA 3CPWU 3K06A 4UCVA 3ZHVA 1D5NA 2GSMB 4DV4B 4DUYO 2GUZA 1H2GA 2OIGA 4K35A 3H1HH 4YIOA 4WFEA 4RO2A 4JASA 1AI7A 3VQWA 5LA6B 4EB6B 1Q6IA 2UU9O 1Q43A 5LOVB 4DV2O 3RYIA 3OFNG 2YIBD 3I56V 1AR5A 3VBBA 2VWJA 2Y4TA 2Q7EA 1L0NH 4PD4F 5IT9N 3ABTA 1VIBA 2BSKA 3FFQA 2ZR3A 3AG7A 1FKAO 5LYJA 4DV3B 4JZGA 4IIJB 1FJGB 1HNWB 3O9OA 3FAVA 5KA5A 2UXCB 1N0JA 3A2FA 4K8ZA 1H2KA 1GN2A 1M57B 2ZXWC 2QKAA 1KU9A 3JSLA 1XNRO 3M99B 1KECA 3G4SV 2UUBB 3N2GB 3K57A 3KZIZ 4DR7O 1GH6A 3CRMA 4B7EA 2EINC 5LMUO 2UXBO 2IU3A 1WA8A 5JH7A 2F1MA 3BAAA 1HR0B 3TGUH 2W0XA 2CH7B 3AG4B 4N21A 1VQ7V 1CPYA 2UXDO 5BZBA 3ASOC 4JAAA 4MVQA 1IBMO 1VQ9V 3UT5A 4UVBA 5LMUB 1QU7A 4YHHO 4NB5A 1VQOV 5BXZA 1KP2A 4JI6B 4GKKO 4QE7A 5H5NA 4NXNO 2A79B 5EYPB 5B5EZ 1I0HA 3JARA 4UXNA 3ZMVA 1N0NA 3JSNA 4JI4O 1K34A 4DK1A 1NTKH 1AROP 3T1CA 2Q8VA 1BS3A 2QA4V 5LGNA 4YHHB 5EZYB 5A9GA 3CRCA 4MW8A 1FPOA 1UFIA 3CC2V 4GKKB 2HP8A 2ZXWB 4CC6A 4X65B 2YI9A 2UXBB 3ZHQA 4ZOLA 5CA3A 2EINB 2LGQA 1ZUQA 1Q6UA 1YIJV 4JV5O 1FXVA 2RNBA 3JALA 4B08A 1D2DA 1M90W 1BMFG 4LF8B 4ZHQA 1K3EA 3IC7A 1Q6HA 3HPLC 2ZIMA 1ZWIC 3CP1A 3X2QB 4JV5B 1ENVA 4YY3B 3AG1C 4KFMA 2PYLA 2UXNA 3VQXA 3BPZA 2ZE8A 2ZE5A 4HNAA 1DGSA 2HHHO 4DR6O 4OPAA 4ASUG 1D5AA 1SQQH 1YVWA 1AI4A 3ZEDA 1R73A 3ETEA 1Y4MA 3IJ4A 4DRXB 3CC7V 1ROPA 2BTQB 2CTRA 3MHSC 1OJHA 3ZRVA 3L75H 3RYFA 2QM4A 2QWRB 3ZN0A 1P84F 4H37A 1HWYA 2ZDIA 3D36C 3QO5A 3ZRXA 1VQPV 2MK3A 5CA1A 4MVSA 5J2TB 2CK3G 2DYSB 1AJNA 1PL4A 3CWBH 5A2QN 5KHKA 4JTAB 4TWKA 1WAZA 3HKDA 5AG2A 3DTUB 4J10A 5CMUA 3JAWB 4EFEA 4PDMA 4DR5B 1ZL8A 2YEVB 5JWPA 4MS2A 4YJ2B 4WBNB 2PUSA 1H2MA 1QCEA 1RFYA 4I7ZB 2UUAO 4DV7O 4E4EA 2EIMB 3JD0A 4QE9A 4I5SA 1P7BA 3DXRB 1M56C 1I94B 3B77A 4B3RO 4X1YA 4UVCA 1AI5A 5LMNO 3UCSC 1Y76B 4I55B 2UUAB 2PYJA 5JJNB 4K3AA 4PA6A 4FZ0A 1XMOB 4DW1A 2DOSA 1J5EB 2E5LO 4F6RA 4BIUA 1XBLA 4LWSA 3OTOB 4J41A 4WFFA 5LMNB 4KP4A 4X1IA 2X6CA 1XNQO 3DSQA 4FFBB 5EIBC 3WG7C 3P3PA 2E5LB 2GDSA 4NKGB 3H1IH 3C3SA 4R8CA 5KX5A 1IZ3A 5KUKA 1NVPB 1SQPH 4I0XB 4JF3A 4ICGA 5FPRA 1PM9A 5K1XA 5CBFA 4GKJO 1VF5B 4JI1B 4HBNA 4DV1B 2Q5ZA 4MVRA 1JMKC 2R9RB 3HKEB 4GT1A 1R3KC 4FLXA 2CE4A 1S76D 4Z1MG 5LBQA 3ASNC 4GKJB 2PF4E 1COWG 4LNUA 5D5QA 1LUVA 4FFKA 1SQBH 1VQ6V 3KCXA 4ZBMA 1XQ8A 5FLXN 1K73W 4JI3B 5KAIZ 3ZHSA 4TV8B 4KHPB 3JASB 2WWWA 1US6A 3GB7C 4QNHB 2WLIB 3ZRSA 5LXTA 1U97A 3CCVV 4QPJA 2CGOA 2QWQB 1NJIW 3JAMN 4FM1A 2OWOA 4DUZO 1TUBA 2D3OW 1KYOF 4AILC 3ZIAG 3TXSA 1AP5A 3T2MA 4BIOA 2EJRA 3HKBA 3HKCB 1L8DA 3E83A 3G67A 1I5XA 2GTSA 1HNZB 3SYPA 3K3WA 4X62B 3EFFK 1CP9A 3ZHRA 1NKDA 2VRZA 2Q0OC 4D6TH 4O4JA 4FLZA 2JS5A 1P49A 1XHXA 4LF4O 5JQGB 2GUZB 4D7SA 1AVMA 1PP9H 3U10A 3K0DA 3L74H 2L35A 5DEDA 2ZT9B 1K97A 3JYCA 3M8AA 1CEZA 4O4HA 4FM0A 5E1AC 1EFRG 4JI8O 3SPHA 1JOYA 5H6RA 1IXMA 2M7WA 4CS2A 1Q5OA 3ZRWB 4B3MO 3ABKC 1QLNA 2F66C 1AI6A 2IU0A 2LO1A 1F4NA 4QPKA 1EZVH 4UB8Z 3KG2A 1VF7A 1JCHA 3L70H 1RM1C 3RW0A 1TGOA 4L87A 4UCRA 2QE7G 1XEQA 5JCOC 2P5OA 1AJPA 4DV0B 2ZM6B 4JI5O 1QBZA 2AHZA 4BR6A 1V54C 4O2BB 2A7WA 3ABMC 1Y67A 1SS3A 3UO2A 5KAFZ 3BFRA 4J7ZA 1M93A 4WF9V 2YICA 2IH3C 4NTXA 4MW3A 2P7TC 4CH5A 5LL6Y 4WFHA 2WAMA 1P7GA 5F2VO 4FVMA 4LFCO 2LFSA 1YJNV 3CHXA 4XDJA 2W6IG 5LGUA 1EN4A 2P4VA 2HFEC 3ABKB 4X20B 1WB7A 4DO2A 1SERA 1I08A 2EIJC 2GBOA 3CE2A 3SYCA 4J9YB 4DR3O 1SC5B 5BMVB 3W7TA 1PL0A 3JARB 4X1KA 3W7SA 1HNXB 2YSUB 5J2UA 4GZRB 2QJ1A 3KKYA 1H38A 5KMGB 2QSAA 3CX5F 1TVKA 1FXKB 4U7OA 2IJJA 3OMAB 2DQ3A 1GTOA 5IJ0B 1MSDA 3QNEA 2WPDG 2NLJC 1GAXA 5IWAO 2GHYA 2CAZC 4I50A 2L6LA 4KUMA 4FIPC 2XT9A 5EBLC 1BQ0A 2JJ2G 3Q4HB 1NBMG 1YI2V 3N2KB 5BR8O 1P4RA 2EILC 4HYOA 4DK0A 3TCUA 2QTSA 1XL6A 2Y0IA 2ZE6A 3FYIB 1NT2B 2X6AA 3OM3B 4LR3A 1DF4A 1BL8A 2JGDB 2QM8A 3G71V 3B09A 4JI2B 3RYHB 2DW4A 3H01A 4CH4A 1YITV 4P9PA 1V55B 3S3XA 1M57C 4BAYA 1Q82W 1SQVH 3HB3B 4DR4O 4MSWC 1BSMA 3QO8A 4JYBA 3WU2Z 4PJ0Z 3I55V 4LF7B 5GTHZ 4ZI7B 1KBHA 3K79A 5CA1B 4PHZA 4JI7B 4AQYB 2YIDA 1VARA 1PPJH 4DR4B 3QO7A 4LF9B 3AG4C 3LDDA 3DGEA 1Z5VA 4FK5C 1U96A 5IY5B 3JCZA 3QG5A 2H8PC 1F4MA 4NTYA 2ODMA 4DV3O 2EILB 1OCOB 1FJGO 1HNWO 3FYEB 2Q73A 1GM9A 2UXCO 2A06H 3FD9A 5LHGA 1SF9A 4B3TO 4TSFG 3IGAC 3RFRA 2UUBO 4IHJA 2B1IA 4X66B 4DR1B 4MTXA 2F4VB 1KD1W 2P67A 3A0BZ 1ZSPA 2K9PA 2BOCC 1N36B 1BCCH 2OYQA 1HR0O 4B3TB 1X4TA 4X1YB 2ITCC 3BA8A 2IW5A 1NH2B 3G6BA 1IBLB 3RVYA 2XAGA 4MVOA 3GVMA 3LSSA 2N04A 2A0LA 4RUFA 4JI6O 2QKCA 1WJZA 2B1GA 1K5QA 1Y74A 3B2EE 4MVMA 4JZ2A 1XUQA 1G1XB 2Y4UA 1TAEA 1I5YA 1L0LH 3X2QC 1QHTA 1VF6C 2IJIA 1R6KA 3OUFA 5KX5B 4X65O 3UQ8A 1K33A
chains in the Genus database with same CATH topology
4LC1A 3CCMV 2XAHA 3E8FA 3OUSA 1WLEA 4UVCA 5L3FA 1AI5A 1OCOC 1E1RG 2AHYA 3CYOA 4MTOA 2XAJA 5B1BB 4CZZA 2Y69B 3E8HA 2OTLV 4PA6A 1PKXA 5B3SC 2JJ1G 5GW7A 5IYBO 4P2ZA 4UVAA 4BIUA 3CXCU 3SYAA 3ZMSA 1Q86W 1R3JC 4WFFA 4KP4A 2X6CA 2Q67A 4I9WA 2LP7A 5H9CA 5EC1C 2P6JA 3WG7C 3T4DA 3G6EV 2HKOA 1OCZB 2DYSC 3UKMA 3EHBB 4QJFB 2PI4A 4MTGA 1G8MA 4MVZA 3TETA 4R8CA 2EIKB 4P30A 5KUKA 1NVPB 5CBHA 1R3LC 4JF3A 2ZD9A 3AG3C 3K0GA 3NXSA 2EZPA 1NVPD 4RAIA 1H8HG 3P30A 4TT3G 3OR6C 1R6NA 3K9AA 3ML0A 1RPOA 5CBFA 3GWOA 5B1OA 1FS0G 2ITDC 3LUTB 5H6QA 3STZC 1Q7YW 1S72V 1GKFA 4X8AA 1YSCA 3E89A 4MVRA 2R9RB 1EBOA 4CBCA 2XNDG 1R3KC 4GT1A 3CCUV 4PA4A 1VQ5V 2XAFA 2EIMC 1S76D 4RQEA 4Z1MG 4GX0A 2HLDG 5LBQA 3ASNC 1S77D 1COWG 1K4CC 4XDKA 3P32A 3E2EA 3K08A 1VQ6V 5DM6V 2XAQA 4E2LA 4ZBMA 2WLHA 2HR3A 2X6BA 5B1BC 2Y69C 1K73W 1MOFA 5HFLA 2ZR2A 4PA3A 3ZRWA 2PI5A 3LNMB 5EC2C 3E8GA 5LHHA 4OXSA 4WFBV 2W6JG 4PDRA 1Q81W 2WWWA 4PELA 3GB7C 3F5WC 4QNHB 2WLIB 4GCZA 1F51A 3ZRSA 2WLMA 3CCVV 4QPJA 3VOUA 2V7QG 1NJIW 4WCEV 1NH2D 1AJQA 1VQ8V 3SPJA 1NQTA 2D3OW 5J9PC 3AG3B 5LHIA 2K1EA 4G28B 2WLNA 1OCZC 2Q68A 3ZIAG 4LP8A 5B1AB 4N23A 3T2MA 1GMGA 2EJRA 1BHAA 1RM1B 4XDLA 1JQ0A 4JTDB 3E83A 2IJHA 3CC4V 3CCRV 3JD4A 3UM7A 2DQ0A 3F7YC 1KKDA 1W0JG 1R3IC 2OT5A 2Y48A 1E79G 3OAAG 1SZTA 1I5XA 2W0FC 3B8MA 3SYPA 1V54B 1YTFB 3K3WA 3ABMB 3SPGA 1KQSU 3RVZA 2X7RB 1YTFD 3EFFK 3ZN1A 1CP9A 2A9HA 2WLIA 1NKDA 3CD6V 2B5UA 5L3BA 4X88A 1YJWV 1W0KG 4U7NA 1GO3F 4RUEA 1WPXA 2HVKC 1S5HC 2QTOA 3AEIA 5EBWC 1K5SA 1SETA 1QR9A 1TUEB 2C2AA 3FB7C 3K0DA 1QVFU 3CMAV 3FB5C 1K92A 1YJ9V 1RPRA 4G27B 1K97A 3JYCA 5L3DA 1CEZA 2V1DA 5CBGA 2XASA 1QVGU 1DF5A 2EIJB 4UUJC 5E1AC 1SESA 1EFRG 4UV8A 1DLBA 4H33A 2LFRA 3SPHA 1JOYA 1FXKA 4LCUC 3AG2C 5H6RA 1IXMA 2M7WA 2IJKA 4FJCC 2HJFC 1VQLV 3ZRWB 1G4YB 4PDVA 1QLNA 3ABKC 4PA9A 1AI6A 2IU0A 1S0VA 1VQMV 3W7XA 1F4NA 4JYCA 1VQNV 1AR1B 4QPKA 3OR7C 3OMIB 1K8AW 3FB8C 2DWEC 3KG2A 4UV9A 3F7VC 5B1AC 3ETDA 2WLJA 4FMTA 3CCJV 1YHQV 1JCHA 1OCCB 3CPWU 3K06A 4EKWA 1RM1C 3RW0A 1Y66A 2GSMB 3ASOB 2H94A 4L87A 4WFAV 1DTOA 2QE7G 4HAMA 2X0LA 1H2GA 2DYRB 3FKSG 5FL7G 1AJPA 1M9NA 4PA7A 4G2KA 4WFEA 2ATKC 1QBZA 4RO2A 2AHZA 3B8NA 1V54C 1AI7A 4JASA 4RQFA 3ABMC 1S3JA 2EBOA 4MT8A 3LSQA 4R7CA 3K03A 1OCRB 1QR8A 4X89A 3OFNG 2R9IA 4WF9V 3I56V 3VBBA 5LGTA 2IH3C 3CCEV 3T4ZA 4MW3A 2P7TC 2HVJC 4WFHA 2WAMA 3E35A 3W7WA 1L1FA 2LFSA 3ABTA 1YJNV 3AG2B 4JAUA 4XDJA 2W6IG 1B6QA 5LGUA 5KA6A 2HFEC 2ZR3A 2JK5C 3ABKB 3ZMZA 2OTJV 3SJQC 4DO2A 1SERA 2EIJC 3SYCA 1EZJA 4J9YB 1VQ4V 5KA5A 2OCCC 1M57B 2ZXWC 1QLEC 3BY6A 3W7TA 1PL0A 1SRYA 4Q20A 4JPRA 3W7SA 3M99B 2YSUB 5KUMA 2QM7A 1KECA 3MHHC 3G4SV 4JAVA 2QEXV 2Q6AA 3CCQV 2EINC 2IH1C 1H38A 4LBEC 2IU3A 1FXKB 4F4LA 3OEHG 1ORQC 1K4DC 4U7OA 4FPPA 1JJ2U 1OCCC 2IJJA 2Z3YA 3OMAB 3OMNB 4N21A 3AG4B 1VQ7V 3SPCA 3W7UA 1CPYA 2DQ3A 3AG1B 1GTOA 5BZBA 1W2BU 3ASOC 3QNEA 2WPDG 1PNLA 2NLJC 4R50A 4MVQA 1VQ9V 2DYRC 2GHYA 4UVBA 5C93A 1J95A 4J9ZB 1PD3A 4KUMA 4FIPC 5IDJA 2EZOA 2KB1A 4YXWG 1VQOV 1KP2A 2JEUA 1H8EG 5EBLC 1NR1A 4QE7A 1OHHG 1KC8W 1K7DA 2JJ2G 2A79B 1NBMG 4XBFA 1YI2V 1JVMA 1OCRC 3ABLC 3K04A 1K9MW 1P4RA 2WLKA 5IYCO 3R65A 1M1KW 2FTKA 4UXNA 3ZMVA 5IYDO 2EILC 1K34A 4HYOA 1AROP 3SPIA 3STLC 3T1CA 3TCUA 5L3CA 1XL6A 1FFTB 2QA4V 5LGNA 3FYIB 1JPXA 4MW8A 2P90A 2OCCB 3CC2V 2X6AA 2ZXWB 1QLEB 3OM3B 1VQKV 1DF4A 1BL8A 4JTCB 2QM8A 3BEHA 3G71V 2UXXA 5CA3A 2DW4A 2YEVA 3H01A 2EINB 1YITV 3ABUA 3FB6C 4P9PA 1MABG 1PNMA 2ZQMA 1V55B 1YIJV 3ETGA 1M57C 4BAYA 3IFXA 3OW2U 1Q82W 3HB3B 4MSWC 1FXVA 2DWDC 3QO8A 3OE7G 4JYBA 1E1QG 4GX5A 1GM8A 4BIZA 5L3GA 3I55V 1M90W 1BMFG 3K79A 2Q69A 4MTFA 1F23A 2JDIG 1K3EA 3IC7A 5CN0A 1FXKC 2F43G 3HPLC 1ZWIC 3CP1A 3SYQA 3X2QB 4DXWA 1ENVA 3QO7A 5HFMA 3AG4C 3ZCCA 3LDDA 1XL4A 3DGEA 4FK5C 3AG1C 4KFMA 3LDCA 3D36A 1NR7A 2UXNA 1M56B 4ZKIA 5IY5B 3JCZA 3E8BA 1UJWB 1MSWD 3ABLB 2H8PC 3OEEG 1F4MA 1BHBA 2WLLB 1OZ0A 3MD0A 2EILB 1N8RW 2NNUA 4ASUG 1OCOB 3FYEB 1AI4A 5EK0A 1GM9A 1R73A 1Y4MA 3ETEA 2XOKG 5LHGA 1JX9A 3WFVA 3SYOA 3CC7V 5EBMC 1ROPA 5B3SB 4TSFG 3PJSK 3MHSC 3ZRVA 3ZMUA 3IGAC 3TK1A 1PNKA 3RBZA 2B1IA 3CMEV 1GM7A 2JEXA 4MTXA 3ZN0A 1KD1W 2P67A 4H37A 2BOCC 1HWYA 2ZDIA 3ZRXA 3QO5A 1VQPV 2MK3A 3ZJZA 1LNQA 4MVSA 1KP3A 3WG7B 2HG5C 3E86A 2CK3G 4QIWF 1GK9A 2DYSB 1AJNA 3D3IA 2ITCC 4WFGA 2IW5A 2Z5UA 1NH2B 4JTAB 4TWKA 4P9OA 3JD1A 3OGCC 3RVYA 1FXHA 4GX2A 2XAGA 4MVOA 1V55C 2WLLA 3DTUB 4R6ZA 5CMUA 3LSSA 2A0LA 4RUFA 4BW5A 4PDMA 5L3EA 2B1GA 1K5QA 2QKSA 2YEVB 3LDEA 4MS2A 2ZDIC 2EIKC 3CCSV 4MVMA 3A0RA 4HZ3A 4GX1A 3JD3A 5B1NA 4MVUA 1QCEA 5DN6G 1I5YA 3X2QC 3JD2A 2BOBC 1MG1A 2EIMB 3JD0A 4PDLA 3CCLV 3ZMTA 2IJIA 4QE9A 4I5SA 1P7BA 2WSSG 1R6KA 1M56C 3ASNB 3OUFA 2JIZG 1THZA 5IY5C 3B77A 4JGSA 1K33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N21 A;  2LP7 A;  3GWO A;  5H9C A;  1K34 A;  2P6J A;  1QR8 A;  2X7R B;  5KA5 A;  4JGS A;  1MOF A;  1DF5 A;  3CYO A;  2MK3 A;  5HFL A;  4N23 A;  4E2L A;  1Y66 A;  1DLB A;  1JPX A;  4JPR A;  3M99 B;  1EBO A;  3MHH C;  2M7W A;  1Y4M A;  1JQ0 A;  4FJC C;  1DF4 A;  1QCE A;  1F23 A;  1I5Y A;  3WFV A;  4FIP C;  4G2K A;  2EZO A;  5CN0 A;  4JF3 A;  1MG1 A;  1QBZ A;  3MHS C;  3CP1 A;  5KA6 A;  2OT5 A;  3B8N A;  1QR9 A;  2EZP A;  1ENV A;  3H01 A;  5HFM A;  1SZT A;  1I5X A;  3B8M A;  3P30 A;  2EBO A;  3B77 A;  4FK5 C;  3K9A A;  5CMU A;  1K33 A; 
#chains in the Genus database with same CATH topology
 2XAH A;  4F6E A;  3U0Z A;  1WLE A;  5L3F A;  2LQT A;  1NTZ H;  1AP6 A;  5GON B;  2R72 A;  3QF7 A;  1PKX A;  2JJ1 G;  4I9Q A;  4P2Z A;  4UVA A;  1ZLZ A;  3R66 A;  4O4L A;  3SYA A;  3MDS A;  2BE3 A;  1R3J C;  4LF8 O;  2JVD A;  2YC0 A;  4UCO A;  1YZB A;  1Z2G A;  5FNV B;  3G6E V;  2HKO A;  4YY3 O;  2DYS C;  1XIL A;  4AHC A;  5JCO A;  4QJF B;  2PI4 A;  5CA0 A;  4MTG A;  3TET A;  2PZS A;  3JAT A;  4P30 A;  5CBH A;  1R3L C;  2ZD9 A;  2Q0A A;  3AG3 C;  5IJ9 A;  3RYC B;  4TT3 G;  3JAK B;  1BT8 A;  3CJH A;  1QQC A;  1FFX B;  3GWO A;  2ITD C;  5H6Q A;  3STZ C;  1Q7Y W;  4X8A A;  3E89 A;  3RN4 A;  3CCU V;  3WB2 A;  1VQ5 V;  2EIM C;  3T1Y O;  2QWO B;  4GLX A;  4O4I A;  4B3S B;  5DM6 V;  4E2L A;  1MMM A;  4DV5 O;  1H2N A;  2WLH A;  5ITZ A;  1XRE A;  2X6B A;  3DC5 A;  3T1Y B;  1BZK A;  3OT7 A;  4WFB V;  5LP6 B;  2QGN A;  4Z2W A;  4DR5 O;  4DV6 B;  2F23 A;  4PEL A;  4X64 B;  3TJT A;  2F93 B;  2YI8 A;  4DV5 B;  2ZE7 A;  2WLM A;  5CB4 A;  1NH2 D;  3SPJ A;  2R9A A;  5J9P C;  3AG3 B;  4U3J B;  4G28 B;  1VMG A;  4EEQ A;  2D2C B;  4OX9 B;  5B1A B;  1I94 O;  1ZAU A;  2ARH A;  4H13 B;  1BHA A;  4TQF A;  5LA6 A;  4EB6 A;  5LOV A;  3BA9 A;  3E22 A;  3F7Y C;  2OT5 A;  4YJ3 B;  2B9Z A;  1XMO O;  1SZT A;  1J5E O;  4H0L B;  2EUL A;  5DEC A;  3SPG A;  1KQS U;  4O2A B;  2X7R B;  1SQG A;  1SA0 B;  1N4C A;  3OTO O;  3CXH F;  1N34 B;  3CD6 V;  2B5U A;  5L3B A;  5D5P A;  4U7N A;  2YDE A;  1HP8 A;  4IIJ A;  4I4T A;  3H1L H;  2QTO A;  3AEI A;  1WP7 A;  1SET A;  1QR9 A;  1TUE B;  2JRI A;  4IGG A;  5JVD B;  1XOU A;  1RPR A;  3N2G A;  4G27 B;  2V1D A;  3K58 A;  4UUJ C;  4K0K B;  2P4K A;  4FLT A;  3AG2 C;  2HJD A;  3U11 A;  4JI1 O;  4DV1 O;  1G4Y B;  2CH7 A;  4PDV A;  1EN6 A;  3D8C A;  4PA9 A;  5C8Y B;  1IBK O;  4IL6 Z;  3W7X A;  3OR7 C;  4FLW A;  3FB8 C;  4BWA A;  2Q9L A;  2WLJ A;  3CCJ V;  2KG7 B;  1OCC B;  4EKW A;  1Y66 A;  2H94 A;  1IBK B;  4WFA V;  4Q6G A;  2VQF B;  5EYP A;  2DYR B;  1M9N A;  4PA7 A;  2XUM A;  3IC9 A;  3EVK A;  4JI3 O;  3WB1 A;  1NU1 H;  2YIA A;  3B8N A;  4FLV A;  4KHP O;  1S3J A;  3BVO A;  5EZY A;  2EBO A;  2JGU A;  4MT8 A;  3LSQ A;  4R7C A;  3K03 A;  1OCR B;  1QR8 A;  4X89 A;  2R9I A;  2KSD A;  1JFF A;  3CCE V;  3K9S A;  2YXY A;  2QWP B;  2HVJ C;  2ZKO A;  3E35 A;  1AB3 A;  2YXL A;  2P22 C;  4K8X A;  3BAB A;  3AG2 B;  4JAU A;  2JK5 C;  2DMX A;  2OTJ V;  2EX3 A;  4KXR A;  4AI8 A;  1EZJ A;  4J7J A;  3SJB C;  1AIL A;  1QLE C;  3BY6 A;  1HNZ O;  5KUM A;  2QM7 A;  4JAV A;  5FPO A;  4X62 O;  2QEX V;  1VF6 A;  3J81 N;  3CCQ V;  1MNG A;  4TQD A;  4C7U A;  2PGG A;  3QTC A;  1ORQ C;  1JJ2 U;  1HDJ A;  5KLV H;  3T1H B;  1W2B U;  1PNL A;  2BTQ A;  1DK1 A;  4R50 A;  5C93 A;  3N27 A;  4J42 A;  1J95 A;  2Y0P A;  4J9Z B;  1PD3 A;  2EZO A;  2KB1 A;  4YXW G;  2JEU A;  1H8E G;  4UCT A;  2RCV A;  3NR7 A;  2Q7G A;  4UCS A;  5J2T A;  4XBF A;  1JVM A;  3ABL C;  3K04 A;  4LF5 B;  1FD9 A;  4CS4 A;  5IYD O;  1NS1 A;  3L71 H;  3CRA A;  3SPI A;  4LF6 B;  1GRJ A;  2JS3 A;  1JPX A;  3SR2 C;  2P90 A;  3RYI B;  1QLE B;  1VQK V;  3JAW A;  2KQX A;  1I7F A;  3BEH A;  2YEV A;  4DV0 O;  4YJ2 A;  4WBN A;  4LFB O;  2ZM6 O;  1PNM A;  2ZQM A;  5K1P A;  3ETG A;  2ETN A;  2BSK B;  2Q4P A;  2DWD C;  3OE7 G;  4GX5 A;  5LYJ B;  4BIZ A;  5L3G A;  3DXR A;  3FAV B;  2JDI G;  5JJJ B;  5CN0 A;  2VQE B;  4LFB B;  1FXK C;  2QDO A;  4PI0 A;  4NTW A;  1URF A;  2OIE A;  3SYQ A;  1KKC A;  1Y76 A;  5HFM A;  4I55 A;  1XL4 A;  3ZHU A;  2QR4 A;  3D36 A;  1NR7 A;  1VEW A;  1UJW B;  1MSW D;  3ABL B;  3OEE G;  3ZHT A;  4UFZ A;  1WA8 B;  1OZ0 A;  5JH7 B;  3MD0 A;  1XMQ B;  1N8R W;  1V9P A;  2ZIO A;  3S3W A;  2XOK G;  1Y74 B;  1JX9 A;  4JI0 B;  3SYO A;  5B3S B;  4PV1 B;  4FFB A;  3PJS K;  3PN1 A;  3UT5 B;  3ZMU A;  3TK1 A;  1HNX O;  2YUA A;  3CME V;  1GM7 A;  2CTP A;  4JYA B;  4JYY A;  4A5U B;  1YEW A;  1KB9 F;  2IM9 A;  4I0X A;  4FM2 A;  1N33 B;  4LH6 A;  4LH7 A;  2HG5 C;  4QIW F;  2N74 A;  4TV9 A;  4H44 B;  2Z5U A;  2RMK B;  1GN3 A;  3OGC C;  1FXH A;  4GX2 A;  1V55 C;  2WLL A;  5BY1 A;  3RGB A;  4R6Z A;  3CRQ A;  3HKE A;  1H2L A;  4BW5 A;  3H1J H;  4ZOL B;  3K59 A;  2QKS A;  4FLU A;  1KMI Z;  3LDE A;  2ZDI C;  3CCS V;  1B04 A;  3A0R A;  4HZ3 A;  3B4S A;  2XHB A;  3JD3 A;  4MVU A;  1RSO A;  3JAL B;  3K5L A;  1MG1 A;  5CA0 B;  3ZMT A;  5IY5 C;  2JIZ G;  1THZ A;  4JGS A;  2CTQ A;  1ZTE A;  4ZHQ B;  4LC1 A;  5KHI A;  3OUS A;  1O9G A;  4TV8 A;  3JAS A;  4JI2 O;  1OCO C;  1E1R G;  2LGW A;  3SJA C;  4MTO A;  2AZ0 A;  5B1B B;  2Y69 B;  2OTL V;  3ETQ A;  5GW7 A;  2CDY A;  4HNA B;  3CXC U;  3ZMS A;  4EFB A;  4LF7 O;  4NR1 A;  1SZX A;  4TOI A;  4I9W A;  4JI7 O;  2LP7 A;  2E74 B;  4AQY O;  4O4I B;  3T4D A;  1OCZ B;  4LF9 O;  3RYF B;  3EHB B;  4NXM O;  1XDC A;  1G8M A;  4MVZ A;  1N32 B;  2EZP A;  1H8H G;  3P30 A;  3OR6 C;  3D3Q A;  3K9A A;  3ML0 A;  4NXM B;  1NTM H;  3ZS8 C;  5CB4 B;  3HKD B;  1S72 V;  1YSC A;  3VQV A;  4X66 O;  2VS0 A;  4DR1 O;  3QVN A;  5JQG A;  2F4V O;  1EBO A;  3BHP A;  4CBC A;  4PA4 A;  2XAF A;  2NR5 A;  1ZL8 B;  1N36 O;  4RQE A;  4GX0 A;  2E3C A;  3OD4 A;  3P32 A;  3E2E A;  2LJ2 A;  2XAQ A;  3E22 B;  4DUY B;  1IBL O;  1BE3 H;  1MOF A;  3ZRW A;  2PI5 A;  5EC2 C;  4W4L A;  2HEP A;  1Q81 W;  2UU9 B;  3F5W C;  1O9H A;  4GCZ A;  4DV2 B;  3GWK C;  3VOU A;  2V7Q G;  1AJQ A;  1VQ8 V;  1M5I A;  4I4T B;  5LHI A;  2AXT Z;  4F6R B;  2Q68 A;  1T5E A;  2XTA A;  2E75 B;  4LP8 A;  4LWS B;  4N23 A;  3THO A;  3AK3 A;  4X1I B;  4O2B A;  5B66 Z;  4XDL A;  1JQ0 A;  2IBZ H;  2V4D A;  2YIB A;  2P06 A;  2ADP A;  3CC4 V;  3CCR V;  3JD4 A;  1KKD A;  1W0J G;  1QNM A;  1R3I C;  2Y48 A;  1E79 G;  2W0F C;  3B8M A;  2LW1 A;  1RP3 B;  1XNR B;  1YTF D;  4DR7 B;  3ZN1 A;  4KL1 A;  2A9H A;  3OTF A;  1GN6 A;  2Q7H A;  1ZX3 A;  3LSU A;  1EN5 A;  2GTA A;  1YJW V;  4X20 A;  1GO3 F;  2G38 A;  3K5O A;  1S5H C;  3APO A;  2UXD B;  1K5S A;  2A3Q A;  1H2S B;  2AGA A;  5BMV A;  4YIP A;  2C2A A;  1IBM B;  1QVF U;  3I5D A;  1FYJ A;  3CMA V;  3FB5 C;  4LNU B;  5CBG A;  1HW7 A;  5IYZ A;  5LP6 C;  1SES A;  4RWU A;  1DLB A;  2LFR A;  5KMG A;  1FXK A;  4LCU C;  2LW7 A;  4NXN B;  5JJE B;  1JFF B;  1PV0 A;  2ZCE A;  1YCI A;  4JI4 B;  1VQM V;  4TUY A;  5IJ0 A;  3ICX A;  4JYC A;  3OMI B;  4UV9 A;  1CXZ B;  3F7V C;  5B1A C;  1EM1 A;  3ETD A;  4FMT A;  5LXT B;  1FAF A;  1TUB B;  4B3S O;  2CUG A;  3ASO B;  3KCY A;  1SQF A;  3BCC H;  1DTO A;  3Q4H A;  3A8T A;  3N2K A;  2X0L A;  4HAM A;  4FZ1 A;  3FKS G;  5FL7 G;  2NN4 A;  1WPB A;  4G2K A;  4IT5 A;  2ATK C;  3HKB B;  4RQF A;  4DV6 O;  1TA8 A;  4L8J A;  4NVP A;  4X64 O;  2ILM A;  1NI8 A;  1Z5W A;  2JGD A;  5LGT A;  3T4Z A;  3RYH A;  2FYU H;  3W7W A;  4OX9 O;  1S5J A;  1L1F A;  1B6Q A;  5KHJ A;  5KA6 A;  1IDS A;  1M4U A;  3ZMZ A;  4O4J B;  2HHH B;  4DYL A;  4DR6 B;  3SJQ C;  3CS5 A;  4ZI7 A;  3C90 A;  1VQ4 V;  4BW9 A;  2OCC C;  1SKV A;  2ADQ B;  2FL4 A;  4Q20 A;  1SRY A;  4LFA O;  4JPR A;  3MHH C;  1JA8 A;  2Q6A A;  4O4H B;  1YXB A;  4X9Q A;  1N34 O;  2IH1 C;  5GTI Z;  4J7K A;  4LBE C;  1IXB A;  4F4L A;  3OEH G;  1K4D C;  4J80 A;  4FPP A;  1OCC C;  3K5N A;  2Z3Y A;  3OMN B;  3SPC A;  3W7U A;  4LFA B;  3AG1 B;  1UPG A;  5E79 Z;  1WP8 A;  2DYR C;  2OCH A;  2FKX A;  1XI1 A;  4K0K O;  5IDJ A;  1KUQ A;  1IX9 A;  3CRR A;  1NR1 A;  1OHH G;  1KC8 W;  1K7D A;  4D7T A;  1K9M W;  1OCR C;  2WLK A;  5IYC O;  3R65 A;  1M1K W;  2FTK A;  1VP7 A;  3SGI A;  3STL C;  5L3C A;  1B3Q A;  4DV7 B;  1FFT B;  3J80 N;  1JJO A;  2H3O A;  2OCC B;  4CH3 A;  3H1K H;  2AW9 A;  2YXH A;  4B3R B;  2PY5 A;  4JTC B;  4DW0 A;  2DE0 X;  2UXX A;  1R6T A;  2VQF O;  1Q90 D;  3A0H Z;  4CC5 A;  3ABU A;  3FB6 C;  1MAB G;  3DC6 A;  3IFX A;  3OW2 U;  1R1B A;  4OPH A;  1E1Q G;  1GM8 A;  3OGI B;  2Q69 A;  3G80 A;  4MTF A;  3SJC C;  1F23 A;  1XNQ B;  2F43 G;  1MZE A;  3UO3 A;  4X1K B;  1Y6X A;  4DXW A;  5J2U B;  2BTO A;  4TV9 B;  3ZCC A;  5KHH A;  3O65 A;  2MW2 B;  2EJ7 A;  3LDC A;  5GON A;  4ZKI A;  1M56 B;  3E8B A;  1NZ6 A;  1BHB A;  1TVK B;  2WLL B;  3P3N A;  2NNU A;  3IAY A;  2R70 A;  1G6U A;  5EK0 A;  4J11 A;  4B7K A;  3WFV A;  5EBM C;  1XHZ A;  3BRC A;  5FNV A;  2GV9 A;  1PNK A;  4IYH A;  3RBZ A;  4I50 B;  3L73 H;  1RSO B;  3LNN A;  2JEX A;  1IUR A;  3J7A U;  3ZJZ A;  1LNQ A;  1KP3 A;  3WG7 B;  3E86 A;  2ZNI A;  1GK9 A;  2CTW A;  3CB2 A;  3D3I A;  2WA4 A;  1BGY H;  4IYI A;  4WFG A;  3RYC A;  3T1H O;  1OV9 A;  3JAK A;  1FFX A;  4ABM A;  4P9O A;  3JD1 A;  4NYK A;  4UCU A;  2O57 A;  5IE9 A;  2ZIN A;  3FX7 A;  5L3E A;  3RT3 C;  1BQZ A;  4DRX A;  4LF5 O;  2EIK C;  4DUZ B;  4GX1 A;  5B1N A;  3M7M X;  5DN6 G;  4LF6 O;  3JD2 A;  2BOB C;  2N05 A;  3CCL V;  4PDL A;  4GYC B;  3AK2 A;  1IVS A;  2WSS G;  3ASN B;  3B40 A;  2RQ6 A;  3CCM V;  3E8F A;  5LP6 A;  1LR1 A;  2AHY A;  3CYO A;  2DJV A;  2XAJ A;  4CZZ A;  3E8H A;  1JR9 A;  2DN9 A;  5B3S C;  4CS3 A;  4U3J A;  5IYB O;  1LUW A;  4U3F H;  3MAQ A;  4FLY A;  3WB0 A;  2VWK A;  1Q86 W;  1W59 A;  2Q67 A;  2VQE O;  5H9C A;  5EC1 C;  2P6J A;  4IHJ B;  3UKM A;  4LF4 B;  2PTM A;  4YJ3 A;  1X59 A;  3C3T A;  2EIK B;  1XMQ O;  4O2A A;  1SA0 A;  3K0G A;  3NXS A;  1NVP D;  4RAI A;  2E76 B;  1R6N A;  1RPO A;  2RJZ A;  4JI0 O;  4JI8 B;  3HR0 A;  1GN4 A;  5B1O A;  1FS0 G;  3LUT B;  4PI2 A;  1GKF A;  4OGQ B;  3CSX A;  4B3M B;  5H2F Z;  4JYA O;  2FML A;  3AK1 A;  2WA3 A;  2XND G;  1B06 A;  3H9V A;  4CH6 A;  4GUN A;  5JVD A;  2BCC H;  2HLD G;  1N33 O;  1S77 D;  2RDC A;  1WB8 A;  1K4C C;  4XDK A;  1S5L Z;  3K08 A;  1WNS A;  3RWR D;  1A32 A;  2HR3 A;  5B1B C;  2Y69 C;  4ZIB A;  1Q3E A;  5HFL A;  2ZR2 A;  4PA3 A;  4JI5 B;  3LNM B;  5C8Y A;  3E8G A;  5LHH A;  4OXS A;  2W6J G;  4PDR A;  1YF2 A;  5EIB D;  3EXA A;  2KG7 A;  1F51 A;  3F5T A;  2CGN A;  3L9D A;  4WCE V;  3TXQ A;  1NQT A;  2UUC O;  2K1E A;  2WLN A;  3L72 H;  1OCZ C;  3ZX6 A;  4O4L B;  1YDX A;  2M6Y A;  4LFC B;  3K5M A;  1GMG A;  1MZF A;  1AR4 A;  4UB6 Z;  1RM1 B;  1SQX H;  4JTD B;  4QGP A;  5IYZ B;  2AZ2 A;  2UUC B;  2IJH A;  2RN9 A;  5KHG A;  3UM7 A;  4DR2 O;  2DQ0 A;  4DR3 B;  3VQY A;  3OAA G;  1V54 B;  1YTF B;  3JAT B;  3ABM B;  1MA1 A;  2KKW A;  1WN7 A;  2ZNJ A;  4TUY B;  3RVZ A;  2FB5 A;  4W4K A;  5IJ9 B;  5TIS Z;  2WLI A;  3JCU Z;  4X88 A;  3CJH B;  4DR2 B;  1W0K G;  4RUE A;  1WPX A;  2HVK C;  4Z1V A;  5EBW C;  1N32 O;  3FB7 C;  1F7Y A;  5IWA B;  2Z0A A;  1K92 A;  1YJ9 V;  5L3D A;  3HKC A;  2XAS A;  1QVG U;  1DF5 A;  2EIJ B;  3ZBH A;  4UV8 A;  4H33 A;  2QWN B;  5ITZ B;  2IJK A;  4FJC C;  3SDL A;  5BR8 B;  2HJF C;  1VQL V;  1S0V A;  4DV4 O;  2F95 B;  2YS8 A;  1VQN V;  1AR1 B;  1K8A W;  2DWE C;  3APQ A;  3CEI A;  1YHQ V;  1Q8I A;  3CPW U;  3K06 A;  4UCV A;  3ZHV A;  1D5N A;  2GSM B;  4DV4 B;  4DUY O;  2GUZ A;  1H2G A;  2OIG A;  4K35 A;  3H1H H;  4YIO A;  4WFE A;  4RO2 A;  4JAS A;  1AI7 A;  3VQW A;  5LA6 B;  4EB6 B;  1Q6I A;  2UU9 O;  1Q43 A;  5LOV B;  4DV2 O;  3RYI A;  3OFN G;  2YIB D;  3I56 V;  1AR5 A;  3VBB A;  2VWJ A;  2Y4T A;  2Q7E A;  1L0N H;  4PD4 F;  5IT9 N;  3ABT A;  1VIB A;  2BSK A;  3FFQ A;  2ZR3 A;  3AG7 A;  1FKA O;  5LYJ A;  4DV3 B;  4JZG A;  4IIJ B;  1FJG B;  1HNW B;  3O9O A;  3FAV A;  5KA5 A;  2UXC B;  1N0J A;  3A2F A;  4K8Z A;  1H2K A;  1GN2 A;  1M57 B;  2ZXW C;  2QKA A;  1KU9 A;  3JSL A;  1XNR O;  3M99 B;  1KEC A;  3G4S V;  2UUB B;  3N2G B;  3K57 A;  3KZI Z;  4DR7 O;  1GH6 A;  3CRM A;  4B7E A;  2EIN C;  5LMU O;  2UXB O;  2IU3 A;  1WA8 A;  5JH7 A;  2F1M A;  3BAA A;  1HR0 B;  3TGU H;  2W0X A;  2CH7 B;  3AG4 B;  4N21 A;  1VQ7 V;  1CPY A;  2UXD O;  5BZB A;  3ASO C;  4JAA A;  4MVQ A;  1IBM O;  1VQ9 V;  3UT5 A;  4UVB A;  5LMU B;  1QU7 A;  4YHH O;  4NB5 A;  1VQO V;  5BXZ A;  1KP2 A;  4JI6 B;  4GKK O;  4QE7 A;  5H5N A;  4NXN O;  2A79 B;  5EYP B;  5B5E Z;  1I0H A;  3JAR A;  4UXN A;  3ZMV A;  1N0N A;  3JSN A;  4JI4 O;  1K34 A;  4DK1 A;  1NTK H;  1ARO P;  3T1C A;  2Q8V A;  1BS3 A;  2QA4 V;  5LGN A;  4YHH B;  5EZY B;  5A9G A;  3CRC A;  4MW8 A;  1FPO A;  1UFI A;  3CC2 V;  4GKK B;  2HP8 A;  2ZXW B;  4CC6 A;  4X65 B;  2YI9 A;  2UXB B;  3ZHQ A;  4ZOL A;  5CA3 A;  2EIN B;  2LGQ A;  1ZUQ A;  1Q6U A;  1YIJ V;  4JV5 O;  1FXV A;  2RNB A;  3JAL A;  4B08 A;  1D2D A;  1M90 W;  1BMF G;  4LF8 B;  4ZHQ A;  1K3E A;  3IC7 A;  1Q6H A;  3HPL C;  2ZIM A;  1ZWI C;  3CP1 A;  3X2Q B;  4JV5 B;  1ENV A;  4YY3 B;  3AG1 C;  4KFM A;  2PYL A;  2UXN A;  3VQX A;  3BPZ A;  2ZE8 A;  2ZE5 A;  4HNA A;  1DGS A;  2HHH O;  4DR6 O;  4OPA A;  4ASU G;  1D5A A;  1SQQ H;  1YVW A;  1AI4 A;  3ZED A;  1R73 A;  3ETE A;  1Y4M A;  3IJ4 A;  4DRX B;  3CC7 V;  1ROP A;  2BTQ B;  2CTR A;  3MHS C;  1OJH A;  3ZRV A;  3L75 H;  3RYF A;  2QM4 A;  2QWR B;  3ZN0 A;  1P84 F;  4H37 A;  1HWY A;  2ZDI A;  3D36 C;  3QO5 A;  3ZRX A;  1VQP V;  2MK3 A;  5CA1 A;  4MVS A;  5J2T B;  2CK3 G;  2DYS B;  1AJN A;  1PL4 A;  3CWB H;  5A2Q N;  5KHK A;  4JTA B;  4TWK A;  1WAZ A;  3HKD A;  5AG2 A;  3DTU B;  4J10 A;  5CMU A;  3JAW B;  4EFE A;  4PDM A;  4DR5 B;  1ZL8 A;  2YEV B;  5JWP A;  4MS2 A;  4YJ2 B;  4WBN B;  2PUS A;  1H2M A;  1QCE A;  1RFY A;  4I7Z B;  2UUA O;  4DV7 O;  4E4E A;  2EIM B;  3JD0 A;  4QE9 A;  4I5S A;  1P7B A;  3DXR B;  1M56 C;  1I94 B;  3B77 A;  4B3R O;  4X1Y A;  4UVC A;  1AI5 A;  5LMN O;  3UCS C;  1Y76 B;  4I55 B;  2UUA B;  2PYJ A;  5JJN B;  4K3A A;  4PA6 A;  4FZ0 A;  1XMO B;  4DW1 A;  2DOS A;  1J5E B;  2E5L O;  4F6R A;  4BIU A;  1XBL A;  4LWS A;  3OTO B;  4J41 A;  4WFF A;  5LMN B;  4KP4 A;  4X1I A;  2X6C A;  1XNQ O;  3DSQ A;  4FFB B;  5EIB C;  3WG7 C;  3P3P A;  2E5L B;  2GDS A;  4NKG B;  3H1I H;  3C3S A;  4R8C A;  5KX5 A;  1IZ3 A;  5KUK A;  1NVP B;  1SQP H;  4I0X B;  4JF3 A;  4ICG A;  5FPR A;  1PM9 A;  5K1X A;  5CBF A;  4GKJ O;  1VF5 B;  4JI1 B;  4HBN A;  4DV1 B;  2Q5Z A;  4MVR A;  1JMK C;  2R9R B;  3HKE B;  4GT1 A;  1R3K C;  4FLX A;  2CE4 A;  1S76 D;  4Z1M G;  5LBQ A;  3ASN C;  4GKJ B;  2PF4 E;  1COW G;  4LNU A;  5D5Q A;  1LUV A;  4FFK A;  1SQB H;  1VQ6 V;  3KCX A;  4ZBM A;  1XQ8 A;  5FLX N;  1K73 W;  4JI3 B;  5KAI Z;  3ZHS A;  4TV8 B;  4KHP B;  3JAS B;  2WWW A;  1US6 A;  3GB7 C;  4QNH B;  2WLI B;  3ZRS A;  5LXT A;  1U97 A;  3CCV V;  4QPJ A;  2CGO A;  2QWQ B;  1NJI W;  3JAM N;  4FM1 A;  2OWO A;  4DUZ O;  1TUB A;  2D3O W;  1KYO F;  4AIL C;  3ZIA G;  3TXS A;  1AP5 A;  3T2M A;  4BIO A;  2EJR A;  3HKB A;  3HKC B;  1L8D A;  3E83 A;  3G67 A;  1I5X A;  2GTS A;  1HNZ B;  3SYP A;  3K3W A;  4X62 B;  3EFF K;  1CP9 A;  3ZHR A;  1NKD A;  2VRZ A;  2Q0O C;  4D6T H;  4O4J A;  4FLZ A;  2JS5 A;  1P49 A;  1XHX A;  4LF4 O;  5JQG B;  2GUZ B;  4D7S A;  1AVM A;  1PP9 H;  3U10 A;  3K0D A;  3L74 H;  2L35 A;  5DED A;  2ZT9 B;  1K97 A;  3JYC A;  3M8A A;  1CEZ A;  4O4H A;  4FM0 A;  5E1A C;  1EFR G;  4JI8 O;  3SPH A;  1JOY A;  5H6R A;  1IXM A;  2M7W A;  4CS2 A;  1Q5O A;  3ZRW B;  4B3M O;  3ABK C;  1QLN A;  2F66 C;  1AI6 A;  2IU0 A;  2LO1 A;  1F4N A;  4QPK A;  1EZV H;  4UB8 Z;  3KG2 A;  1VF7 A;  1JCH A;  3L70 H;  1RM1 C;  3RW0 A;  1TGO A;  4L87 A;  4UCR A;  2QE7 G;  1XEQ A;  5JCO C;  2P5O A;  1AJP A;  4DV0 B;  2ZM6 B;  4JI5 O;  1QBZ A;  2AHZ A;  4BR6 A;  1V54 C;  4O2B B;  2A7W A;  3ABM C;  1Y67 A;  1SS3 A;  3UO2 A;  5KAF Z;  3BFR A;  4J7Z A;  1M93 A;  4WF9 V;  2YIC A;  2IH3 C;  4NTX A;  4MW3 A;  2P7T C;  4CH5 A;  5LL6 Y;  4WFH A;  2WAM A;  1P7G A;  5F2V O;  4FVM A;  4LFC O;  2LFS A;  1YJN V;  3CHX A;  4XDJ A;  2W6I G;  5LGU A;  1EN4 A;  2P4V A;  2HFE C;  3ABK B;  4X20 B;  1WB7 A;  4DO2 A;  1SER A;  1I08 A;  2EIJ C;  2GBO A;  3CE2 A;  3SYC A;  4J9Y B;  4DR3 O;  1SC5 B;  5BMV B;  3W7T A;  1PL0 A;  3JAR B;  4X1K A;  3W7S A;  1HNX B;  2YSU B;  5J2U A;  4GZR B;  2QJ1 A;  3KKY A;  1H38 A;  5KMG B;  2QSA A;  3CX5 F;  1TVK A;  1FXK B;  4U7O A;  2IJJ A;  3OMA B;  2DQ3 A;  1GTO A;  5IJ0 B;  1MSD A;  3QNE A;  2WPD G;  2NLJ C;  1GAX A;  5IWA O;  2GHY A;  2CAZ C;  4I50 A;  2L6L A;  4KUM A;  4FIP C;  2XT9 A;  5EBL C;  1BQ0 A;  2JJ2 G;  3Q4H B;  1NBM G;  1YI2 V;  3N2K B;  5BR8 O;  1P4R A;  2EIL C;  4HYO A;  4DK0 A;  3TCU A;  2QTS A;  1XL6 A;  2Y0I A;  2ZE6 A;  3FYI B;  1NT2 B;  2X6A A;  3OM3 B;  4LR3 A;  1DF4 A;  1BL8 A;  2JGD B;  2QM8 A;  3G71 V;  3B09 A;  4JI2 B;  3RYH B;  2DW4 A;  3H01 A;  4CH4 A;  1YIT V;  4P9P A;  1V55 B;  3S3X A;  1M57 C;  4BAY A;  1Q82 W;  1SQV H;  3HB3 B;  4DR4 O;  4MSW C;  1BSM A;  3QO8 A;  4JYB A;  3WU2 Z;  4PJ0 Z;  3I55 V;  4LF7 B;  5GTH Z;  4ZI7 B;  1KBH A;  3K79 A;  5CA1 B;  4PHZ A;  4JI7 B;  4AQY B;  2YID A;  1VAR A;  1PPJ H;  4DR4 B;  3QO7 A;  4LF9 B;  3AG4 C;  3LDD A;  3DGE A;  1Z5V A;  4FK5 C;  1U96 A;  5IY5 B;  3JCZ A;  3QG5 A;  2H8P C;  1F4M A;  4NTY A;  2ODM A;  4DV3 O;  2EIL B;  1OCO B;  1FJG O;  1HNW O;  3FYE B;  2Q73 A;  1GM9 A;  2UXC O;  2A06 H;  3FD9 A;  5LHG A;  1SF9 A;  4B3T O;  4TSF G;  3IGA C;  3RFR A;  2UUB O;  4IHJ A;  2B1I A;  4X66 B;  4DR1 B;  4MTX A;  2F4V B;  1KD1 W;  2P67 A;  3A0B Z;  1ZSP A;  2K9P A;  2BOC C;  1N36 B;  1BCC H;  2OYQ A;  1HR0 O;  4B3T B;  1X4T A;  4X1Y B;  2ITC C;  3BA8 A;  2IW5 A;  1NH2 B;  3G6B A;  1IBL B;  3RVY A;  2XAG A;  4MVO A;  3GVM A;  3LSS A;  2N04 A;  2A0L A;  4RUF A;  4JI6 O;  2QKC A;  1WJZ A;  2B1G A;  1K5Q A;  1Y74 A;  3B2E E;  4MVM A;  4JZ2 A;  1XUQ A;  1G1X B;  2Y4U A;  1TAE A;  1I5Y A;  1L0L H;  3X2Q C;  1QHT A;  1VF6 C;  2IJI A;  1R6K A;  3OUF A;  5KX5 B;  4X65 O;  3UQ8 A;  1K33 A; 
#chains in the Genus database with same CATH homology
 4LC1 A;  3CCM V;  2XAH A;  3E8F A;  3OUS A;  1WLE A;  4UVC A;  5L3F A;  1AI5 A;  1OCO C;  1E1R G;  2AHY A;  3CYO A;  4MTO A;  2XAJ A;  5B1B B;  4CZZ A;  2Y69 B;  3E8H A;  2OTL V;  4PA6 A;  1PKX A;  5B3S C;  2JJ1 G;  5GW7 A;  5IYB O;  4P2Z A;  4UVA A;  4BIU A;  3CXC U;  3SYA A;  3ZMS A;  1Q86 W;  1R3J C;  4WFF A;  4KP4 A;  2X6C A;  2Q67 A;  4I9W A;  2LP7 A;  5H9C A;  5EC1 C;  2P6J A;  3WG7 C;  3T4D A;  3G6E V;  2HKO A;  1OCZ B;  2DYS C;  3UKM A;  3EHB B;  4QJF B;  2PI4 A;  4MTG A;  1G8M A;  4MVZ A;  3TET A;  4R8C A;  2EIK B;  4P30 A;  5KUK A;  1NVP B;  5CBH A;  1R3L C;  4JF3 A;  2ZD9 A;  3AG3 C;  3K0G A;  3NXS A;  2EZP A;  1NVP D;  4RAI A;  1H8H G;  3P30 A;  4TT3 G;  3OR6 C;  1R6N A;  3K9A A;  3ML0 A;  1RPO A;  5CBF A;  3GWO A;  5B1O A;  1FS0 G;  2ITD C;  3LUT B;  5H6Q A;  3STZ C;  1Q7Y W;  1S72 V;  1GKF A;  4X8A A;  1YSC A;  3E89 A;  4MVR A;  2R9R B;  1EBO A;  4CBC A;  2XND G;  1R3K C;  4GT1 A;  3CCU V;  4PA4 A;  1VQ5 V;  2XAF A;  2EIM C;  1S76 D;  4RQE A;  4Z1M G;  4GX0 A;  2HLD G;  5LBQ A;  3ASN C;  1S77 D;  1COW G;  1K4C C;  4XDK A;  3P32 A;  3E2E A;  3K08 A;  1VQ6 V;  5DM6 V;  2XAQ A;  4E2L A;  4ZBM A;  2WLH A;  2HR3 A;  2X6B A;  5B1B C;  2Y69 C;  1K73 W;  1MOF A;  5HFL A;  2ZR2 A;  4PA3 A;  3ZRW A;  2PI5 A;  3LNM B;  5EC2 C;  3E8G A;  5LHH A;  4OXS A;  4WFB V;  2W6J G;  4PDR A;  1Q81 W;  2WWW A;  4PEL A;  3GB7 C;  3F5W C;  4QNH B;  2WLI B;  4GCZ A;  1F51 A;  3ZRS A;  2WLM A;  3CCV V;  4QPJ A;  3VOU A;  2V7Q G;  1NJI W;  4WCE V;  1NH2 D;  1AJQ A;  1VQ8 V;  3SPJ A;  1NQT A;  2D3O W;  5J9P C;  3AG3 B;  5LHI A;  2K1E A;  4G28 B;  2WLN A;  1OCZ C;  2Q68 A;  3ZIA G;  4LP8 A;  5B1A B;  4N23 A;  3T2M A;  1GMG A;  2EJR A;  1BHA A;  1RM1 B;  4XDL A;  1JQ0 A;  4JTD B;  3E83 A;  2IJH A;  3CC4 V;  3CCR V;  3JD4 A;  3UM7 A;  2DQ0 A;  3F7Y C;  1KKD A;  1W0J G;  1R3I C;  2OT5 A;  2Y48 A;  1E79 G;  3OAA G;  1SZT A;  1I5X A;  2W0F C;  3B8M A;  3SYP A;  1V54 B;  1YTF B;  3K3W A;  3ABM B;  3SPG A;  1KQS U;  3RVZ A;  2X7R B;  1YTF D;  3EFF K;  3ZN1 A;  1CP9 A;  2A9H A;  2WLI A;  1NKD A;  3CD6 V;  2B5U A;  5L3B A;  4X88 A;  1YJW V;  1W0K G;  4U7N A;  1GO3 F;  4RUE A;  1WPX A;  2HVK C;  1S5H C;  2QTO A;  3AEI A;  5EBW C;  1K5S A;  1SET A;  1QR9 A;  1TUE B;  2C2A A;  3FB7 C;  3K0D A;  1QVF U;  3CMA V;  3FB5 C;  1K92 A;  1YJ9 V;  1RPR A;  4G27 B;  1K97 A;  3JYC A;  5L3D A;  1CEZ A;  2V1D A;  5CBG A;  2XAS A;  1QVG U;  1DF5 A;  2EIJ B;  4UUJ C;  5E1A C;  1SES A;  1EFR G;  4UV8 A;  1DLB A;  4H33 A;  2LFR A;  3SPH A;  1JOY A;  1FXK A;  4LCU C;  3AG2 C;  5H6R A;  1IXM A;  2M7W A;  2IJK A;  4FJC C;  2HJF C;  1VQL V;  3ZRW B;  1G4Y B;  4PDV A;  1QLN A;  3ABK C;  4PA9 A;  1AI6 A;  2IU0 A;  1S0V A;  1VQM V;  3W7X A;  1F4N A;  4JYC A;  1VQN V;  1AR1 B;  4QPK A;  3OR7 C;  3OMI B;  1K8A W;  3FB8 C;  2DWE C;  3KG2 A;  4UV9 A;  3F7V C;  5B1A C;  3ETD A;  2WLJ A;  4FMT A;  3CCJ V;  1YHQ V;  1JCH A;  1OCC B;  3CPW U;  3K06 A;  4EKW A;  1RM1 C;  3RW0 A;  1Y66 A;  2GSM B;  3ASO B;  2H94 A;  4L87 A;  4WFA V;  1DTO A;  2QE7 G;  4HAM A;  2X0L A;  1H2G A;  2DYR B;  3FKS G;  5FL7 G;  1AJP A;  1M9N A;  4PA7 A;  4G2K A;  4WFE A;  2ATK C;  1QBZ A;  4RO2 A;  2AHZ A;  3B8N A;  1V54 C;  1AI7 A;  4JAS A;  4RQF A;  3ABM C;  1S3J A;  2EBO A;  4MT8 A;  3LSQ A;  4R7C A;  3K03 A;  1OCR B;  1QR8 A;  4X89 A;  3OFN G;  2R9I A;  4WF9 V;  3I56 V;  3VBB A;  5LGT A;  2IH3 C;  3CCE V;  3T4Z A;  4MW3 A;  2P7T C;  2HVJ C;  4WFH A;  2WAM A;  3E35 A;  3W7W A;  1L1F A;  2LFS A;  3ABT A;  1YJN V;  3AG2 B;  4JAU A;  4XDJ A;  2W6I G;  1B6Q A;  5LGU A;  5KA6 A;  2HFE C;  2ZR3 A;  2JK5 C;  3ABK B;  3ZMZ A;  2OTJ V;  3SJQ C;  4DO2 A;  1SER A;  2EIJ C;  3SYC A;  1EZJ A;  4J9Y B;  1VQ4 V;  5KA5 A;  2OCC C;  1M57 B;  2ZXW C;  1QLE C;  3BY6 A;  3W7T A;  1PL0 A;  1SRY A;  4Q20 A;  4JPR A;  3W7S A;  3M99 B;  2YSU B;  5KUM A;  2QM7 A;  1KEC A;  3MHH C;  3G4S V;  4JAV A;  2QEX V;  2Q6A A;  3CCQ V;  2EIN C;  2IH1 C;  1H38 A;  4LBE C;  2IU3 A;  1FXK B;  4F4L A;  3OEH G;  1ORQ C;  1K4D C;  4U7O A;  4FPP A;  1JJ2 U;  1OCC C;  2IJJ A;  2Z3Y A;  3OMA B;  3OMN B;  4N21 A;  3AG4 B;  1VQ7 V;  3SPC A;  3W7U A;  1CPY A;  2DQ3 A;  3AG1 B;  1GTO A;  5BZB A;  1W2B U;  3ASO C;  3QNE A;  2WPD G;  1PNL A;  2NLJ C;  4R50 A;  4MVQ A;  1VQ9 V;  2DYR C;  2GHY A;  4UVB A;  5C93 A;  1J95 A;  4J9Z B;  1PD3 A;  4KUM A;  4FIP C;  5IDJ A;  2EZO A;  2KB1 A;  4YXW G;  1VQO V;  1KP2 A;  2JEU A;  1H8E G;  5EBL C;  1NR1 A;  4QE7 A;  1OHH G;  1KC8 W;  1K7D A;  2JJ2 G;  2A79 B;  1NBM G;  4XBF A;  1YI2 V;  1JVM A;  1OCR C;  3ABL C;  3K04 A;  1K9M W;  1P4R A;  2WLK A;  5IYC O;  3R65 A;  1M1K W;  2FTK A;  4UXN A;  3ZMV A;  5IYD O;  2EIL C;  1K34 A;  4HYO A;  1ARO P;  3SPI A;  3STL C;  3T1C A;  3TCU A;  5L3C A;  1XL6 A;  1FFT B;  2QA4 V;  5LGN A;  3FYI B;  1JPX A;  4MW8 A;  2P90 A;  2OCC B;  3CC2 V;  2X6A A;  2ZXW B;  1QLE B;  3OM3 B;  1VQK V;  1DF4 A;  1BL8 A;  4JTC B;  2QM8 A;  3BEH A;  3G71 V;  2UXX A;  5CA3 A;  2DW4 A;  2YEV A;  3H01 A;  2EIN B;  1YIT V;  3ABU A;  3FB6 C;  4P9P A;  1MAB G;  1PNM A;  2ZQM A;  1V55 B;  1YIJ V;  3ETG A;  1M57 C;  4BAY A;  3IFX A;  3OW2 U;  1Q82 W;  3HB3 B;  4MSW C;  1FXV A;  2DWD C;  3QO8 A;  3OE7 G;  4JYB A;  1E1Q G;  4GX5 A;  1GM8 A;  4BIZ A;  5L3G A;  3I55 V;  1M90 W;  1BMF G;  3K79 A;  2Q69 A;  4MTF A;  1F23 A;  2JDI G;  1K3E A;  3IC7 A;  5CN0 A;  1FXK C;  2F43 G;  3HPL C;  1ZWI C;  3CP1 A;  3SYQ A;  3X2Q B;  4DXW A;  1ENV A;  3QO7 A;  5HFM A;  3AG4 C;  3ZCC A;  3LDD A;  1XL4 A;  3DGE A;  4FK5 C;  3AG1 C;  4KFM A;  3LDC A;  3D36 A;  1NR7 A;  2UXN A;  1M56 B;  4ZKI A;  5IY5 B;  3JCZ A;  3E8B A;  1UJW B;  1MSW D;  3ABL B;  2H8P C;  3OEE G;  1F4M A;  1BHB A;  2WLL B;  1OZ0 A;  3MD0 A;  2EIL B;  1N8R W;  2NNU A;  4ASU G;  1OCO B;  3FYE B;  1AI4 A;  5EK0 A;  1GM9 A;  1R73 A;  1Y4M A;  3ETE A;  2XOK G;  5LHG A;  1JX9 A;  3WFV A;  3SYO A;  3CC7 V;  5EBM C;  1ROP A;  5B3S B;  4TSF G;  3PJS K;  3MHS C;  3ZRV A;  3ZMU A;  3IGA C;  3TK1 A;  1PNK A;  3RBZ A;  2B1I A;  3CME V;  1GM7 A;  2JEX A;  4MTX A;  3ZN0 A;  1KD1 W;  2P67 A;  4H37 A;  2BOC C;  1HWY A;  2ZDI A;  3ZRX A;  3QO5 A;  1VQP V;  2MK3 A;  3ZJZ A;  1LNQ A;  4MVS A;  1KP3 A;  3WG7 B;  2HG5 C;  3E86 A;  2CK3 G;  4QIW F;  1GK9 A;  2DYS B;  1AJN A;  3D3I A;  2ITC C;  4WFG A;  2IW5 A;  2Z5U A;  1NH2 B;  4JTA B;  4TWK A;  4P9O A;  3JD1 A;  3OGC C;  3RVY A;  1FXH A;  4GX2 A;  2XAG A;  4MVO A;  1V55 C;  2WLL A;  3DTU B;  4R6Z A;  5CMU A;  3LSS A;  2A0L A;  4RUF A;  4BW5 A;  4PDM A;  5L3E A;  2B1G A;  1K5Q A;  2QKS A;  2YEV B;  3LDE A;  4MS2 A;  2ZDI C;  2EIK C;  3CCS V;  4MVM A;  3A0R A;  4HZ3 A;  4GX1 A;  3JD3 A;  5B1N A;  4MVU A;  1QCE A;  5DN6 G;  1I5Y A;  3X2Q C;  3JD2 A;  2BOB C;  1MG1 A;  2EIM B;  3JD0 A;  4PDL A;  3CCL V;  3ZMT A;  2IJI A;  4QE9 A;  4I5S A;  1P7B A;  2WSS G;  1R6K A;  1M56 C;  3ASN B;  3OUF A;  2JIZ G;  1THZ A;  5IY5 C;  3B77 A;  4JGS A;  1K33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...