3CP1A

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
73
Chain Sequence
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Transmembrane Protein
total genus 34
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cp1A00
2EZPA 3B8MA 1MG1A 3CP1A 3CYOA 1Y66A 5HFMA 1SZTA 5KA6A 2P6JA 3MHSC 4G2KA 4FJCC 1JPXA 1DF5A 4E2LA 1QBZA 1MOFA 1QR8A 5CN0A 4JPRA 3K9AA 4JF3A 3H01A 3MHHC 3GWOA 4N23A 2X7RB 1K33A 2EBOA 5CMUA 1QCEA 1K34A 3B77A 2EZOA 1QR9A 2OT5A 3B8NA 5HFLA 2M7WA 5KA5A 4JGSA 1EBOA 1I5YA 4FK5C 1F23A 4FIPC 1DLBA 2MK3A 3WFVA 1Y4MA 1I5XA 2LP7A 1JQ0A 1ENVA 3M99B 4N21A 5H9CA 1DF4A 3P30A
chains in the Genus database with same CATH superfamily
4PA6A 2CK3G 4TUYA 5KHJA 2W6IG 3VQVA 4CS4A 2LFRA 1M90W 1QBZA 2AGAA 4TV8B 3SPGA 1KECA 2B9ZA 1XMOO 1PD3A 4P2ZA 3H01A 3ASNB 1RM1B 1SQPH 2F4VO 3K08A 3ABUA 2EIKC 3K04A 2CE4A 1HNWO 5B1NA 1VIBA 2ZNJA 3EFFK 2XNDG 4LF8O 1O9HA 1AP6A 4JI5B 1YEWA 3KZIZ 1OCRB 1HP8A 2HP8A 1IURA 2RJZA 1SQGA 3FAVB 1P4RA 3G67A 4WBNB 4J7KA 5IYDO 5JJEB 3EHBB 1D5AA 4X64O 3RYHB 1KBHA 2OIGA 4LFBB 2WPDG 2GUZB 5FNVB 5J9PC 4I9WA 3BRCA 2RDCA 3ZRWB 5JWPA 2EIMB 1QHTA 3CB2A 3JSLA 3ZRXA 5IJ0A 4NXNB 4JAAA 4DV0B 1XL6A 3E8HA 2HJFC 3SYOA 1WAZA 2ZDIC 1R3JC 4JYBA 2QM8A 5L3EA 2KB1A 4FLVA 4ZHQB 3TGUH 3D8CA 2OYQA 1VEWA 2UU9O 1BZKA 1BT8A 1SF9A 2HVJC 1KD1W 3W7XA 4JASA 3K58A 2CH7A 3WG7C 5EC2C 1QVGU 2Q7EA 1QLNA 1KQSU 5EYPA 2Y4UA 5LMUB 1WB7A 4HNAB 3OUFA 1VF5B 3JALB 1H38A 2EINC 3L70H 4F6EA 3WG7B 4TQDA 1PL0A 4B3SO 2OWOA 4UXNA 5EZYB 1Z5VA 5IYZA 1NH2D 1NKDA 4JI8B 2P4VA 3CYOA 2HEPA 3ETQA 1FXKB 3T1YO 4MSWC 4PI0A 3OAAG 1FXVA 3BHPA 2EILB 4BIUA 1YXBA 3T4DA 2YIBA 3CMEV 3CJHA 2YDEA 3LSUA 4GUNA 4FK5C 3CXHF 1OCZB 4R50A 3ZHQA 4EB6B 5J2UA 2ADPA 2CGOA 2W0FC 2HLDG 1CXZB 2IU3A 1SQQH 5H6QA 3ZHSA 1JMKC 5B3SC 5C8YA 4H0LB 5E79Z 1QLEC 4O2AB 3K03A 2DJVA 4FM2A 4RQFA 4ZIBA 1TVKB 3HR0A 1KP3A 4JI7B 3AG4B 2BSKA 2K9PA 3DGEA 1M1KW 5KAFZ 3PJSK 1JR9A 4NTYA 2Z5UA 3Q4HB 3UQ8A 1Y67A 2QWQB 3QF7A 4X88A 4B3RO 3HKDB 3I56V 1Q8IA 4D7TA 1RPRA 1S5LZ 4ZBMA 5LHIA 2FB5A 2Q7GA 5KMGB 3ZMSA 4FLYA 4LNUA 4DR5B 4UV9A 2QJ1A 4DV3B 3T1YB 1BHBA 1QLEB 3K3WA 2A7WA 2DQ0A 3BABA 2R9RB 4BIZA 3X2QC 2NR5A 1XOUA 4YHHO 4O4HB 1A32A 2PI4A 4J7JA 5FPOA 2X6CA 5LHHA 1IX9A 2NNUA 3CX5F 3FD9A 4DUYO 4YJ3B 2IU0A 2BOCC 3ZRWA 4X89A 3W7TA 5JH7A 1AI6A 3E2EA 2C2AA 4ABMA 3K57A 4BR6A 4MVUA 3ABLB 4X65O 1W0JG 2Q9LA 3ABMC 3UT5B 5BY1A 1ZLZA 3TXSA 3F5WC 1NTZH 5B1OA 4X1KA 1Y74B 1K4DC 4RWUA 5KUMA 1AP5A 3SJAC 1SZTA 1YIJV 1S3JA 3FYIB 4KFMA 4IIJA 1MOFA 4DV1O 4B3RB 3LUTB 3AG2B 1BMFG 1PNKA 2EULA 3JD2A 4IYIA 4LF9B 1ROPA 1BSMA 1I0HA 1IBMO 4G27B 4FFBA 3OTOB 2QE7G 2JEXA 5B1BB 5CBGA 4KP4A 4FLUA 3D3IA 1VQOV 3OGCC 4P30A 1OCRC 3FFQA 3FKSG 2NLJC 1QR9A 4UCRA 1ZWIC 2ZM6O 4AQYO 2ZIOA 2PI5A 3N27A 3SR2C 2GTAA 3ZN1A 2DWDC 4JI4B 1TUEB 2ZE5A 4PI2A 1AVMA 1YF2A 1XNRB 4HAMA 1XI1A 4K8XA 1X59A 4UB8Z 4B3TB 5IWAB 1F7YA 4UVCA 2BSKB 4J42A 4XDJA 1OJHA 4FPPA 5KA5A 3W7WA 1N34B 5DM6V 1K5QA 2JDIG 4DR6O 1SC5B 3CEIA 2QTOA 2WLNA 2E3CA 3ABLC 4K35A 1SS3A 2L6LA 4CS3A 3BPZA 4DR1O 4UCSA 2EJRA 4HZ3A 4WF9V 3AK1A 1PNLA 1FS0G 4B3MO 3E86A 4BAYA 3CMAV 3AG1C 4DV2O 5KX5A 2QGNA 2ILMA 1BQZA 5KHGA 2YS8A 5FL7G 3JASB 5JQGB 2JIZG 3OTOO 1M9NA 1RPOA 4DV6O 1XUQA 3MD0A 4QGPA 3CSXA 1N36O 3DXRB 4YHHB 1G6UA 3ABTA 4DV2B 1WJZA 4DYLA 5BR8B 2HJDA 5BMVA 1SETA 1KKCA 2VWKA 3CRMA 1YTFD 4IIJB 5GONA 1TVKA 5EBLC 3CRAA 1TUBB 4XBFA 4LCUC 3BA9A 3Q4HA 1AJPA 1LR1A 4FVMA 1B6QA 5CMUA 1SERA 4NTXA 2ZQMA 2UXDO 1KYOF 4DV0O 4IYHA 2A79B 2PYJA 1M57B 3ZHVA 3CCEV 3AG3C 2GHYA 3LSSA 3OUSA 4LC1A 5DN6G 1K5SA 3JD1A 1S77D 3U11A 2WLLB 2ZE8A 1XILA 3UT5A 1N32B 5J2UB 4EB6A 5LHGA 5L3BA 1S0VA 3B4SA 4JI2O 2P4KA 4DV6B 3IGAC 5FPRA 3OM3B 2XAQA 1Y4MA 3ZMTA 4QPKA 4CBCA 4R7CA 4LNUB 4LF6O 4E2LA 2Q67A 3SPHA 4GKJO 4FMTA 4LF9O 2QTSA 3MDSA 5L3FA 1V9PA 3CC4V 3F7YC 4LF4O 2XAJA 5IYCO 2BTOA 5IYZB 1G1XB 4WFGA 2QKCA 3T2MA 4DR7B 2R9AA 3B09A 1FKAO 1H8HG 2Q69A 1P84F 2WLIA 4MVRA 1PNMA 1AROP 1V54B 4ICGA 4IGGA 1SQVH 2KG7B 5CB4B 2ZR3A 4UCVA 3ZRVA 2YICA 1XDCA 4O4JA 1ZTEA 1CP9A 2IH1C 5IE9A 4J9YB 3RT3C 4NTWA 1AI7A 3OMNB 2IW5A 5FLXN 3AK3A 2KSDA 2P7TC 3SYCA 5KA6A 2BTQA 5AG2A 3ML0A 1ZX3A 2YXYA 3L9DA 3EXAA 2QR4A 1N34O 2DW4A 1H2GA 4PA7A 3WB0A 1NU1H 4GT1A 4MW3A 2P90A 2CAZC 2JEUA 3L74H 2QKSA 5A9GA 3NXSA 4LFAO 4QJFB 2E5LB 3RVYA 2ZKOA 5H2FZ 1S72V 1I08A 4GKKB 2AHYA 4MVMA 3J81N 1IBKO 2GSMB 3SJBC 4MT8A 4QE7A 2Q73A 4O4LB 3BVOA 4JYYA 2LFSA 4DW1A 2M7WA 2WLLA 2RN9A 4FIPC 1MSDA 1M93A 1TA8A 4BW9A 3QO8A 3FB5C 2QWOB 1GN6A 2YEVB 2IJIA 4B7KA 3HKCB 4CC5A 4PELA 3ZRSA 1Q90D 3QVNA 5F2VO 2OCHA 1FFTB 5D5PA 4I0XA 2IBZH 2P5OA 1ENVA 1EN5A 1TUBA 2UXXA 3JCUZ 3P32A 1HDJA 2CGNA 3S3WA 4JAVA 3IAYA 2QM7A 1DTOA 2F1MA 1NQTA 1VQMV 5IJ9A 2AZ0A 1IDSA 3OEHG 2B1IA 1JFFB 5BMVB 4EFEA 3ASNC 5HFLA 2ATKC 1OV9A 3RVZA 4A5UB 3K0GA 2EX3A 2QEXV 1YVWA 4GKJB 5KHHA 4NXNO 4MTXA 1AILA 3CWBH 4FJCC 1H2MA 4LBEC 3JAWB 3K5MA 2AHZA 4U3JA 3STLC 3CRQA 4IT5A 2BOBC 2XHBA 4GZRB 4TV9B 1M56B 2V7QG 1DF4A 4JI3B 3MAQA 1Z5WA 3H1KH 3T1HO 1WP7A 5IJ0B 2DN9A 3E22A 4TV8A 2RMKB 2EIMC 4O4IA 4MTGA 2B5UA 4I4TB 5H5NA 2F66C 2HHHB 1KB9F 4PDVA 4NXMO 3BY6A 1R6NA 1D5NA 3E22B 5BXZA 1YDXA 3HPLC 3SYQA 4O4IB 4J10A 5JCOC 1XEQA 2QKAA 3SPIA 4LFCO 3FB7C 2N74A 4P9OA 1ZUQA 1XQ8A 3GVMA 1CPYA 2XOKG 4X66O 2QWPB 1XMOB 4IL6Z 2ITDC 3E83A 5LP6B 2Q5ZA 1XHZA 3QNEA 4HBNA 4R8CA 4JGSA 2YSUB 2Y69B 3AG4C 1P49A 5H9CA 1BQ0A 1SESA 5CBFA 1N0JA 4JV5B 1LUWA 3G71V 4FLXA 1PL4A 5ITZB 5C93A 2Q4PA 1UPGA 1Q43A 3RBZA 2ITCC 2EJ7A 4I7ZB 4X1IA 3ZHUA 1YCIA 4QNHB 2UUAB 4TUYB 4XDKA 4JI5O 2OCCB 2UUCB 2GV9A 4NB5A 3C90A 2ZD9A 2ZXWB 4O2BB 3KCXA 4MVOA 4WFEA 2EZPA 3TK1A 4ZOLA 1GH6A 2Q0AA 3ETDA 3IJ4A 1SRYA 1Y76A 4KL1A 3W7UA 2RNBA 1W59A 2ZXWC 2ZIMA 4ZI7B 2GDSA 2QM4A 1GKFA 3SGIA 4PV1B 4LR3A 2A0LA 4I5SA 4MTOA 3ZN0A 5GW7A 3LNNA 4W4LA 4DUZO 4PHZA 2YEVA 1XNRO 1R3KC 1GK9A 1CEZA 4CS2A 3OT7A 4TT3G 2OCCC 1OCCB 4HYOA 4K8ZA 3MHSC 2LQTA 3OEEG 2O57A 4FM0A 1W2BU 3JATB 1XL4A 3MHHC 2EIJB 1YI2V 4O4LA 5LYJA 1ORQC 3H1JH 5JCOA 3E8BA 2PZSA 2BE3A 1Y6XA 3HB3B 1U96A 2XT9A 2PY5A 1ZSPA 1MG1A 1WPBA 3LSQA 5IJ9B 1FXKA 4PA3A 3D36A 4IHJA 1IBKB 5IY5C 2FYUH 1XBLA 1BL8A 2CDYA 2XAGA 4PA9A 1L0LH 4X62B 4DV5O 4I0XB 4RQEA 1HR0B 2X6AA 2IJHA 3HKEA 2UUCO 2WLHA 1MZFA 3ZX6A 1KKDA 3KKYA 3R66A 3B40A 1AI4A 4CC6A 4BW5A 1FYJA 4KUMA 5LXTA 2W0XA 1M57C 3C3TA 5LMNB 2DYSB 1SA0B 4I9QA 4YIOA 1L8DA 3JARA 5L3CA 4JI4O 2G38A 3CCSV 2DYRC 1EM1A 5IT9N 1H2SB 3K5NA 4JZ2A 1MNGA 5TISZ 3U10A 4DV4O 4BIOA 2VS0A 5KMGA 3G6BA 3ZS8C 3ASOB 2DMXA 4PDMA 3CPWU 4RUEA 4GLXA 4DO2A 5LGTA 5B1AB 3AG2C 1K92A 3GWOA 4WFAV 1B04A 3RN4A 1K33A 1NZ6A 4QPJA 4DR2B 3DC6A 2QA4V 1VQ4V 1VQ5V 4JYAB 3RYIA 3JATA 5IY5B 3VQXA 4B3TO 4N21A 5C8YB 4X20B 2KKWA 3FAVA 1L0NH 4WBNA 5LL6Y 4K0KB 2Z0AA 2QWNB 4Q6GA 1VMGA 3LDEA 1K73W 2K1EA 2ZM6B 1IBLB 4AQYB 5KLVH 4UFZA 4QE9A 2NN4A 2WLKA 3THOA 5L3DA 1K8AW 1FXKC 5GONB 2ZDIA 1WA8A 2X0LA 4UB6Z 5CBHA 4FLWA 2D2CB 1COWG 4DR4B 2GBOA 1AB3A 2PF4E 1JVMA 1GTOA 1H2KA 4X1IB 4JI1B 4CH6A 3GWKC 2PYLA 1RSOB 2VQFO 1SQXH 2Q68A 2UXDB 3H1HH 5BZBA 1Q81W 4LF8B 3IC7A 2ADQB 3CC7V 2R9IA 1SZXA 4W4KA 5IDJA 4TOIA 2HG5C 3RWRD 2Y0PA 5HFMA 5EIBC 1AJQA 4CH3A 4FM1A 2A06H 4LH7A 1WP8A 3JCZA 2YXLA 2UUBB 2WWWA 1MA1A 3I55V 3CC2V 2MK3A 2X6BA 4CH4A 4F6RA 3X2QB 2R72A 2UUAO 1WB8A 3CCRV 4LF6B 1Q6UA 3M7MX 1PPJH 5B66Z 3CCMV 1ZL8B 3FB6C 4DUYB 1Y76B 4DXWA 5EIBD 2E76B 3JSNA 4X1YB 2YC0A 3B77A 2OT5A 4GX1A 4WCEV 1Q3EA 1S5HC 5H6RA 1G8MA 5JH7B 2HKOA 1FD9A 2LP7A 4Z1MG 3RYHA 1H2LA 1ZAUA 5J2TB 2ZCEA 4B08A 3GB7C 4OXSA 2ARHA 3STZC 3CCLV 2AZ2A 1MZEA 3UO2A 3N2KB 2EZOA 1VF6A 4JI1O 3JD3A 3M8AA 1M4UA 2XAHA 2JJ1G 2EILC 4H44B 4DV1B 1YTFB 1BGYH 1US6A 1R6KA 3RYFB 4UVBA 1MSWD 1W0KG 1XMQB 4JI6B 3K79A 5LP6C 3JAKA 1OCOB 2IJJA 3QO7A 2QSAA 2VRZA 4JI6O 2RCVA 4JI0B 3TJTA 3OR7C 2PTMA 1JFFA 2H8PC 2CUGA 2LW7A 3WB1A 1HNZO 1N8RW 2WSSG 3TETA 1NR7A 1F51A 3HKCA 4JYCA 4G28B 4JZGA 5DECA 3R65A 3CCQV 1N33O 4J7ZA 2CTRA 1XREA 3K5OA 4RO2A 4NYKA 1KUQA 2BTQB 4DR1B 3BFRA 1R1BA 3I5DA 4FZ0A 4UV8A 3RYCA 3C3SA 1D2DA 2UU9B 1AJNA 1OHHG 1DGSA 5B3SB 5DEDA 2OTLV 2AXTZ 2Q6AA 4FFKA 1DF5A 3JASA 5JQGA 2HHHO 3WU2Z 3SPCA 4F6RB 4MW8A 5EYPB 3SYPA 4DR5O 3OE7G 1R73A 3OMAB 2YXHA 1JA8A 4LFCB 4DV4B 3ZEDA 4LFAB 2KQXA 2VWJA 3HKBA 2DQ3A 1EN4A 2Y48A 1FJGO 1NTMH 4PA4A 3JYCA 1GN2A 3K9AA 4J41A 3L72H 2X7RB 5K1XA 5EC1C 5B1BC 2F43G 4JI3O 1XMQO 4L8JA 4OGQB 2ODMA 3CD6V 4PDRA 1BHAA 2LW1A 1WN7A 4K0KO 1IBMB 1G4YB 1NBMG 3RW0A 3ZCCA 4IHJB 4TSFG 4PDLA 3RGBA 2W6JG 4JPRA 3BA8A 4FFBB 2LJ2A 4X62O 4MTFA 4JTAB 3T1CA 2EBOA 1HR0O 4O4JB 3D3QA 2OIEA 3N2GA 3PN1A 1H2NA 2IH3C 3NR7A 4JTDB 1LNQA 1J5EO 3IFXA 1AR5A 2JGDA 1SQBH 4OX9B 2A9HA 2DOSA 1Y66A 3EVKA 1VF6C 2QWRB 3W7SA 1VQLV 4D7SA 2GTSA 1B3QA 1SKVA 1Q82W 4MVQA 3IC9A 1F4NA 3SJCC 4AI8A 1I94O 1VQ8V 5EK0A 1F23A 1P7BA 1OZ0A 3OR6C 4L87A 1L1FA 3JARB 3CRCA 4X66B 3APOA 5LGNA 4JI2B 2WA4A 4O2AA 3D36C 2Y0IA 1Q6IA 2HFEC 2Q8VA 1VQPV 4JYAO 1TAEA 4LWSB 5KAIZ 4J80A 3BEHA 2Y69C 2V1DA 3ABKB 3P30A 2CTQA 3J80N 2F23A 1FXHA 3O9OA 3FB8C 3JD4A 4GX5A 1E1RG 4UCUA 2UXCB 3UO3A 3G6EV 1GAXA 5JVDB 3ZMUA 4H33A 3HKEB 3SPJA 3LDCA 4DRXB 2WLIB 2M6YA 4NR1A 1RM1C 4LF7O 4JI7O 1K97A 2L35A 4U3FH 2JGDB 3CP1A 4R6ZA 3RYFA 2H3OA 1QNMA 1JCHA 1GO3F 2JJ2G 5LMNO 4LF5O 2XASA 3E35A 3K06A 3RYCB 1GM8A 1FFXA 3VQWA 2FMLA 3CE2A 3ASOC 1NR1A 2P06A 3H1LH 1NI8A 1OCCC 1EFRG 1WPXA 3N2GB 2YI8A 1HNWB 4DR4O 1MMMA 4DW0A 2E5LO 4YY3B 4FZ1A 3G80A 2EIKB 5ITZA 4EEQA 2FKXA 4ZI7A 3A8TA 4MVZA 1WLEA 4P9PA 1N0NA 4AILC 4I55B 3AG7A 2JVDA 2RQ6A 3ZJZA 1JPXA 1JJ2U 4YIPA 1PM9A 1PKXA 3A0RA 3APQA 3VQYA 3OTFA 5LA6B 3ZHRA 1WNSA 3QG5A 1XNQB 3TXQA 1M5IA 2BCCH 3K59A 4WFBV 3T4ZA 3BCCH 2MW2B 2V4DA 1V54C 5CA1A 1FFXB 2N05A 3WB2A 3A0HZ 1IBLO 4NVPA 5B5EZ 2WAMA 3CCJV 2Y4TA 1DK1A 1MABG 5KUKA 3U0ZA 4JAUA 3DSQA 1YSCA 2DYRB 1I94B 1RFYA 4GX2A 1ZL8A 3ZHTA 2F93B 1JX9A 2ZINA 4ASUG 4DUZB 4OPAA 4X1YA 3AEIA 4I4TA 4LF5B 2LGWA 3VOUA 1J5EB 3OW2U 5KX5B 2E75B 4DRXA 4RUFA 1Q6HA 4TV9A 2ZR2A 1FAFA 1QQCA 1Q86W 1X4TA 1YJNV 4MS2A 1NS1A 5LA6A 1WA8B 2EIJC 4LP8A 3K5LA 2ZT9B 1HNXB 2UXBB 1UJWB 1N36B 1HNZB 2LGQA 2XAFA 4DR3B 3K9SA 3L73H 1S5JA 2FTKA 4C7UA 4XDLA 4O4HA 1O9GA 3OGIB 2XUMA 5K1PA 5GTHZ 1VF7A 1AR1B 1NT2B 4I50A 1XNQO 1AR4A 1HW7A 3FYEB 2YI9A 4JF3A 1NJIW 5EBWC 2VQEB 4J11A 2R70A 1IXBA 3H9VA 4MVSA 4X9QA 4DR7O 1RP3B 2OTJV 1QCEA 1KP2A 1I7FA 1VQNV 3KG2A 4X8AA 1JJOA 1BS3A 4OX9O 4J9ZB 1VQ7V 3ZMVA 4FLTA 1GM7A 1EN6A 1THZA 1K4CC 3AG3B 2KG7A 5CB4A 1IXMA 1FPOA 1BCCH 4H37A 1EBOA 5LMUO 1EZJA 1PP9H 1OCZC 3OMIB 4X64B 4WFFA 4Z2WA 4H13B 4CH5A 3N2KA 3CRRA 4ZHQA 2PGGA 3L75H 4LH6A 3RYIB 4B3SB 3ZBHA 4KHPB 5JVDA 3QTCA 4OPHA 5KHKA 3SYAA 1U97A 1URFA 1VP7A 1Y74A 1K7DA 3ETGA 4DR3O 1RSOA 5D5QA 4YJ2A 4Q20A 2YIBD 2JK5C 1T5EA 3ZIAG 1GMGA 2P6JA 1KMIZ 1KC8W 1GM9A 2P22C 5CA1B 3B2EE 4UCOA 1GN4A 2UXCO 1R3LC 3ABMB 4F4LA 3G4SV 4FLZA 3JAWA 5IWAO 2E74B 3DC5A 1SA0A 2N04A 2FL4A 4DV7O 4I55A 2Q7HA 1NVPD 4B7EA 5EBMC 3J7AU 3ICXA 1QR8A 3LDDA 3OFNG 1VQ9V 4YXWG 1YZBA 3AG1B 1TGOA 1YHQV 4UUJC 1LUVA 2IJKA 4DK1A 3UCSC 4B3MB 2D3OW 3RFRA 1HWYA 2JRIA 3ETEA 4KXRA 3L71H 2XTAA 1VARA 4DR6B 1JOYA 3CCUV 4U7OA 1KU9A 4HNAA 3A2FA 3E8GA 1IZ3A 3DXRA 4GX0A 4YY3O 2Z3YA 4DV3O 5GTIZ 4GKKO 1NTKH 5FNVA 1F4MA 1I5XA 4NKGB 1S76D 4YJ2B 4X20A 3B8MA 5LXTB 1NH2B 4NXMB 4ZOLB 1P7GA 4U7NA 3HKBB 2CH7B 3FX7A 3VBBA 5CA0A 5LYJB 3K0DA 3KCYA 1K34A 3JALA 5LOVA 1YJ9V 4K3AA 4PJ0Z 3AK2A 1DLBA 5CA3A 2UXNA 4JI0O 1Q5OA 1E1QG 3CJHB 2EINB 1YITV 2F95B 1N33B 2DWEC 4X65B 1K9MW 2YIDA 1V55B 5EZYA 3A0BZ 3UM7A 2ZE6A 3CS5A 1AI5A 1SQFA 1B06A 3H1IH 5E1AC 1Z2GA 1N32O 4LFBO 3CXCU 2HVKC 4ZKIA 1QVFU 3CCVV 1PV0A 4DR2O 5JJNB 1GRJA 3DTUB 1M56C 2A3QA 2ZE7A 1BE3H 1GN3A 1VQ6V 4N23A 5LOVB 3B8NA 3OD4A 4GYCB 3UKMA 4JI8O 2ETNA 2CTWA 5A2QN 2WA3A 3P3NA 3QO5A 2VQFB 3JAKB 2P67A 1K3EA 4EKWA 2YUAA 2B1GA 2IM9A 4EFBA 2WLMA 3JD0A 5LBQA 1OCOC 4CZZA 2UUBO 4Z1VA 4O2BA 5B1AC 4U3JB 3M99B 2VQEO 5J2TA 4DK0A 2AW9A 4BWAA 4G2KA 2JGUA 2HR3A 1IVSA 1VQKV 5KHIA 5L3GA 3TCUA 1J95A 2GUZA 5IYBO 3E89A 3ZMZA 2CTPA 4AHCA 4I50B 1I5YA 4UVAA 2QDOA 1JQ0A 1UFIA 1YJWV 1N4CA 3ABKC 3F7VC 4DV5B 2LO1A 2JS3A 2YIAA 5CN0A 1R3IC 2JS5A 4TWKA 4GCZA 2WLJA 4YJ3A 3S3XA 3JAMN 3BAAA 4LF4B 4KHPO 3T1HB 3E8FA 2H94A 4UCTA 2DE0X 4WFHA 1E79G 1V55C 5LGUA 1XHXA 4D6TH 3F5TA 4E4EA 1R6TA 5BR8O 1FJGB 5CA0B 1H8EG 2ZNIA 5LP6A 3SDLA 3P3PA 4PD4F 4RAIA 4QIWF 1QU7A 1HNXO 2UXBO 1EZVH 2DYSC 3HKDA 4X1KB 4TQFA 5JJJB 4LF7B 4JTCB 1Q7YW 4JV5O 1NVPB 2PUSA 4LWSA 3SJQC 3WFVA 3LNMB 4DV7B 3CHXA 2Q0OC 2F4VB 3O65A
chains in the Genus database with same CATH topology
3OUSA 4LC1A 4PA6A 5DN6G 1K5SA 2CK3G 3JD1A 1S77D 3ZJZA 2W6IG 1JPXA 2LFRA 4DO2A 1M90W 1JJ2U 1QBZA 3SPGA 2WLLB 5LGTA 1PKXA 3A0RA 1KECA 5B1AB 1PD3A 3AG2C 4P2ZA 1K92A 3H01A 3GWOA 4WFAV 5LHGA 1K33A 5L3BA 1S0VA 4WFBV 3ASNB 3T4ZA 4QPJA 1RM1B 1V54C 3IGAC 1VQ4V 2QA4V 1VQ5V 3K08A 3OM3B 2XAQA 1Y4MA 2EIKC 3ABUA 3K04A 4QPKA 3ZMTA 5IY5B 5B1NA 4CBCA 4N21A 2WAMA 3CCJV 4R7CA 3EFFK 2XNDG 1MABG 5KUKA 4JAUA 4E2LA 2Q67A 1YSCA 2DYRB 3SPHA 3LDEA 4GX2A 1K73W 1OCRB 2K1EA 4FMTA 1JX9A 4ASUG 5L3FA 3AEIA 1P4RA 3CC4V 3F7YC 5IYDO 3EHBB 4QE9A 2XAJA 5IYCO 2WLKA 5L3DA 4WFGA 1K8AW 1FXKC 3T2MA 3VOUA 2ZDIA 2X0LA 3OW2U 2WPDG 5CBHA 5J9PC 1H8HG 2Q69A 4I9WA 4RUFA 1COWG 2WLIA 4MVRA 2ZR2A 1AROP 1PNMA 1V54B 1Q86W 3ZRWB 1YJNV 4MS2A 2EIJC 4LP8A 2ZR3A 1JVMA 1GTOA 2EIMB 3ZRVA 3ZRXA 1UJWB 1XL6A 3E8HA 2Q68A 2XAFA 5BZBA 1Q81W 2HJFC 3SYOA 3IC7A 1CP9A 2IH1C 2ZDIC 1R3JC 2FTKA 4JYBA 4J9YB 4XDLA 3CC7V 2R9IA 5IDJA 2QM8A 1AI7A 2HG5C 3OMNB 2IW5A 2KB1A 5L3EA 5HFMA 1AJQA 2P7TC 3SYCA 5KA6A 1AR1B 3ML0A 3FYEB 3JCZA 4JF3A 1NJIW 5EBWC 1KD1W 2HVJC 4MVSA 3W7XA 2OTJV 2DW4A 4JASA 1H2GA 1QCEA 2WWWA 1KP2A 4PA7A 1VQNV 3KG2A 3I55V 3CC2V 4GT1A 2MK3A 4X8AA 3WG7C 2X6BA 5EC2C 1QVGU 4MW3A 1QLNA 1KQSU 2P90A 4J9ZB 2JEUA 3X2QB 2QKSA 1VQ7V 3OUFA 3NXSA 3CCRV 4QJFB 3ZMVA 3RVYA 1H38A 2EINC 1GM7A 3WG7B 1THZA 1K4CC 1S72V 3AG3B 2AHYA 4MVMA 3CCMV 2GSMB 4MT8A 1PL0A 3FB6C 4QE7A 1IXMA 4DXWA 2LFSA 3B77A 4UXNA 2OT5A 4GX1A 2M7WA 2WLLA 4WCEV 1S5HC 4H37A 1EBOA 5H6RA 4FIPC 1EZJA 1G8MA 1OCZC 3OMIB 2HKOA 2LP7A 4Z1MG 3QO8A 3FB5C 1NH2D 1NKDA 4WFFA 2YEVB 3CYOA 2IJIA 3GB7C 1FXKB 4OXSA 4MSWC 3STZC 3OAAG 3CCLV 1FXVA 2EILB 4PELA 3SYAA 4BIUA 3ZRSA 1K7DA 3ETGA 2EZOA 3T4DA 3CMEV 1FFTB 3JD3A 4FK5C 2XAHA 2JJ1G 1OCZB 4R50A 4Q20A 1ENVA 2UXXA 3P32A 2EILC 2JK5C 1YTFB 3ZIAG 2W0FC 1GMGA 1R6KA 2HLDG 2P6JA 2QM7A 4JAVA 1GM9A 1KC8W 1DTOA 2IU3A 4UVBA 1NQTA 1MSWD 1VQMV 1W0KG 5H6QA 3OEHG 2B1IA 5B3SC 1R3LC 3K79A 3ASNC 3ABMB 5HFLA 1OCOB 4F4LA 2ATKC 3G4SV 1QLEC 3RVZA 3K03A 2IJJA 3QO7A 4RQFA 3OR7C 3K0GA 1KP3A 2H8PC 2QEXV 3AG4B 1NVPD 1N8RW 3DGEA 2WSSG 5EBMC 4MTXA 3TETA 1NR7A 1F51A 1M1KW 4FJCC 3PJSK 4LBEC 2Z5UA 4JYCA 1QR8A 4X88A 2AHZA 4G28B 3LDDA 3OFNG 3STLC 3R65A 3I56V 3CCQV 1RPRA 4ZBMA 4RO2A 4YXWG 2BOBC 3AG1B 5LHIA 1YHQV 1VQ9V 4UUJC 2IJKA 3ZMSA 4UV8A 1M56B 1AJNA 2D3OW 2V7QG 1HWYA 1OHHG 4UV9A 1DF4A 5B3SB 1BHBA 2OTLV 3ETEA 2Q6AA 1QLEB 3K3WA 1DF5A 3SPCA 2DQ0A 4MW8A 1JOYA 3SYPA 3CCUV 2R9RB 2EIMC 4BIZA 4MTGA 4U7OA 2B5UA 3X2QC 3OE7G 2PI4A 1R73A 3OMAB 3E8GA 4PDVA 2X6CA 3BY6A 1R6NA 4GX0A 2Z3YA 5LHHA 3HPLC 1F4MA 1I5XA 3SYQA 2DQ3A 2NNUA 1S76D 3B8MA 3SPIA 2IU0A 3FB7C 1NH2B 2Y48A 2BOCC 3ZRWA 4X89A 3W7TA 4P9OA 1AI6A 4U7NA 3E2EA 1CPYA 2XOKG 4PA4A 2C2AA 3JYCA 3VBBA 3K9AA 2ITDC 3E83A 3K0DA 4MVUA 2X7RB 3ABLB 1W0JG 3ABMC 5EC1C 5B1BC 1K34A 2F43G 3QNEA 4R8CA 3F5WC 1YJ9V 4JGSA 1DLBA 3CD6V 5CA3A 2UXNA 2YSUB 4PDRA 2Y69B 5B1OA 3AG4C 5H9CA 1K4DC 1BHAA 1E1QG 1SESA 5KUMA 5CBFA 2EINB 1SZTA 1YIJV 1G4YB 1NBMG 1YITV 1S3JA 3RW0A 3ZCCA 3G71V 4TSFG 3FYIB 4PDLA 4KFMA 2DWEC 1MOFA 2W6JG 1V55B 5C93A 4JPRA 1K9MW 3UM7A 3LUTB 3RBZA 2ITCC 3AG2B 4MTFA 1BMFG 4JTAB 1PNKA 2EBOA 3JD2A 3T1CA 4QNHB 1ROPA 1AI5A 5E1AC 4XDKA 2OCCB 4G27B 2IH3C 4JTDB 1LNQA 2ZD9A 2QE7G 3CXCU 3IFXA 2ZXWB 2HVKC 2JEXA 5B1BB 5CBGA 4MVOA 4WFEA 4ZKIA 4KP4A 2EZPA 1QVFU 2A9HA 3TK1A 3CCVV 1Y66A 3D3IA 3W7SA 1VQOV 3OGCC 4P30A 1VQLV 3ETDA 1Q82W 3DTUB 1SRYA 3W7UA 4MVQA 1M56C 1OCRC 2ZXWC 1F4NA 1VQ6V 3FKSG 4N23A 2NLJC 1GKFA 3B8NA 1QR9A 2A0LA 5EK0A 3UKMA 1VQ8V 4I5SA 4MTOA 3ZN0A 1F23A 1P7BA 1OZ0A 1ZWIC 5GW7A 2YEVA 3OR6C 4L87A 1L1FA 2PI5A 1R3KC 1GK9A 1CEZA 3ZN1A 2DWDC 3QO5A 4TT3G 5LGNA 2OCCC 1OCCB 1TUEB 4HYOA 3MHSC 2P67A 1K3EA 4HAMA 4EKWA 3OEEG 2B1GA 2HFEC 1W2BU 1VQPV 1XL4A 3MHHC 2EIJB 2WLMA 3JD0A 1YI2V 5LBQA 4UVCA 1OCOC 4XDJA 4CZZA 1ORQC 4FPPA 5KA5A 3W7WA 5DM6V 1K5QA 3BEHA 2JDIG 2V1DA 2Y69C 3E8BA 2QTOA 5B1AC 2WLNA 3ABKB 3M99B 3ABLC 3HB3B 3P30A 1FXHA 1MG1A 3LSQA 2EJRA 3FB8C 3JD4A 4G2KA 4GX5A 1FXKA 1E1RG 2HR3A 4HZ3A 4PA3A 4WF9V 1PNLA 3D36A 3G6EV 1FS0G 3E86A 1VQKV 4BAYA 5IY5C 5L3GA 3TCUA 3ZMUA 1J95A 3CMAV 3AG1C 4H33A 1BL8A 3SPJA 2XAGA 3LDCA 5IYBO 3E89A 4PA9A 3ZMZA 2WLIB 5FL7G 1I5YA 4RQEA 1RM1C 4UVAA 2JIZG 1JQ0A 2X6AA 1YJWV 3ABKC 1M9NA 1RPOA 2IJHA 1K97A 2WLHA 3CP1A 3MD0A 4R6ZA 3F7VC 1KKDA 1JCHA 3ABTA 5CN0A 1R3IC 1AI4A 1GO3F 4TWKA 2JJ2G 4BW5A 4GCZA 2WLJA 3E8FA 2H94A 1SETA 2XASA 3E35A 3K06A 4WFHA 4KUMA 1YTFD 1E79G 1GM8A 1M57C 1V55C 5LGUA 3CPWU 2DYSB 5EBLC 3ASOC 1H8EG 1NR1A 1OCCC 5L3CA 4XBFA 4RAIA 4LCUC 1EFRG 4QIWF 1WPXA 3CCSV 1AJPA 2DYRC 2DYSC 1B6QA 4JTCB 5CMUA 1SERA 1Q7YW 2ZQMA 1NVPB 2A79B 1M57B 3SJQC 2EIKB 3WFVA 3CCEV 3LNMB 3AG3C 3ASOB 4PDMA 4MVZA 1WLEA 4P9PA 2GHYA 4RUEA 3LSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZP A;  3B8M A;  1MG1 A;  3CP1 A;  3CYO A;  1Y66 A;  5HFM A;  1SZT A;  5KA6 A;  2P6J A;  3MHS C;  4G2K A;  4FJC C;  1JPX A;  1DF5 A;  4E2L A;  1QBZ A;  1MOF A;  1QR8 A;  5CN0 A;  4JPR A;  3K9A A;  4JF3 A;  3H01 A;  3MHH C;  3GWO A;  4N23 A;  2X7R B;  1K33 A;  2EBO A;  5CMU A;  1QCE A;  1K34 A;  3B77 A;  2EZO A;  1QR9 A;  2OT5 A;  3B8N A;  5HFL A;  2M7W A;  5KA5 A;  4JGS A;  1EBO A;  1I5Y A;  4FK5 C;  1F23 A;  4FIP C;  1DLB A;  2MK3 A;  3WFV A;  1Y4M A;  1I5X A;  2LP7 A;  1JQ0 A;  1ENV A;  3M99 B;  4N21 A;  5H9C A;  1DF4 A;  3P30 A; 
#chains in the Genus database with same CATH topology
 4PA6 A;  2CK3 G;  4TUY A;  5KHJ A;  2W6I G;  3VQV A;  4CS4 A;  2LFR A;  1M90 W;  1QBZ A;  2AGA A;  4TV8 B;  3SPG A;  1KEC A;  2B9Z A;  1XMO O;  1PD3 A;  4P2Z A;  3H01 A;  3ASN B;  1RM1 B;  1SQP H;  2F4V O;  3K08 A;  3ABU A;  2EIK C;  3K04 A;  2CE4 A;  1HNW O;  5B1N A;  1VIB A;  2ZNJ A;  3EFF K;  2XND G;  4LF8 O;  1O9H A;  1AP6 A;  4JI5 B;  1YEW A;  3KZI Z;  1OCR B;  1HP8 A;  2HP8 A;  1IUR A;  2RJZ A;  1SQG A;  3FAV B;  1P4R A;  3G67 A;  4WBN B;  4J7K A;  5IYD O;  5JJE B;  3EHB B;  1D5A A;  4X64 O;  3RYH B;  1KBH A;  2OIG A;  4LFB B;  2WPD G;  2GUZ B;  5FNV B;  5J9P C;  4I9W A;  3BRC A;  2RDC A;  3ZRW B;  5JWP A;  2EIM B;  1QHT A;  3CB2 A;  3JSL A;  3ZRX A;  5IJ0 A;  4NXN B;  4JAA A;  4DV0 B;  1XL6 A;  3E8H A;  2HJF C;  3SYO A;  1WAZ A;  2ZDI C;  1R3J C;  4JYB A;  2QM8 A;  5L3E A;  2KB1 A;  4FLV A;  4ZHQ B;  3TGU H;  3D8C A;  2OYQ A;  1VEW A;  2UU9 O;  1BZK A;  1BT8 A;  1SF9 A;  2HVJ C;  1KD1 W;  3W7X A;  4JAS A;  3K58 A;  2CH7 A;  3WG7 C;  5EC2 C;  1QVG U;  2Q7E A;  1QLN A;  1KQS U;  5EYP A;  2Y4U A;  5LMU B;  1WB7 A;  4HNA B;  3OUF A;  1VF5 B;  3JAL B;  1H38 A;  2EIN C;  3L70 H;  4F6E A;  3WG7 B;  4TQD A;  1PL0 A;  4B3S O;  2OWO A;  4UXN A;  5EZY B;  1Z5V A;  5IYZ A;  1NH2 D;  1NKD A;  4JI8 B;  2P4V A;  3CYO A;  2HEP A;  3ETQ A;  1FXK B;  3T1Y O;  4MSW C;  4PI0 A;  3OAA G;  1FXV A;  3BHP A;  2EIL B;  4BIU A;  1YXB A;  3T4D A;  2YIB A;  3CME V;  3CJH A;  2YDE A;  3LSU A;  4GUN A;  4FK5 C;  3CXH F;  1OCZ B;  4R50 A;  3ZHQ A;  4EB6 B;  5J2U A;  2ADP A;  2CGO A;  2W0F C;  2HLD G;  1CXZ B;  2IU3 A;  1SQQ H;  5H6Q A;  3ZHS A;  1JMK C;  5B3S C;  5C8Y A;  4H0L B;  5E79 Z;  1QLE C;  4O2A B;  3K03 A;  2DJV A;  4FM2 A;  4RQF A;  4ZIB A;  1TVK B;  3HR0 A;  1KP3 A;  4JI7 B;  3AG4 B;  2BSK A;  2K9P A;  3DGE A;  1M1K W;  5KAF Z;  3PJS K;  1JR9 A;  4NTY A;  2Z5U A;  3Q4H B;  3UQ8 A;  1Y67 A;  2QWQ B;  3QF7 A;  4X88 A;  4B3R O;  3HKD B;  3I56 V;  1Q8I A;  4D7T A;  1RPR A;  1S5L Z;  4ZBM A;  5LHI A;  2FB5 A;  2Q7G A;  5KMG B;  3ZMS A;  4FLY A;  4LNU A;  4DR5 B;  4UV9 A;  2QJ1 A;  4DV3 B;  3T1Y B;  1BHB A;  1QLE B;  3K3W A;  2A7W A;  2DQ0 A;  3BAB A;  2R9R B;  4BIZ A;  3X2Q C;  2NR5 A;  1XOU A;  4YHH O;  4O4H B;  1A32 A;  2PI4 A;  4J7J A;  5FPO A;  2X6C A;  5LHH A;  1IX9 A;  2NNU A;  3CX5 F;  3FD9 A;  4DUY O;  4YJ3 B;  2IU0 A;  2BOC C;  3ZRW A;  4X89 A;  3W7T A;  5JH7 A;  1AI6 A;  3E2E A;  2C2A A;  4ABM A;  3K57 A;  4BR6 A;  4MVU A;  3ABL B;  4X65 O;  1W0J G;  2Q9L A;  3ABM C;  3UT5 B;  5BY1 A;  1ZLZ A;  3TXS A;  3F5W C;  1NTZ H;  5B1O A;  4X1K A;  1Y74 B;  1K4D C;  4RWU A;  5KUM A;  1AP5 A;  3SJA C;  1SZT A;  1YIJ V;  1S3J A;  3FYI B;  4KFM A;  4IIJ A;  1MOF A;  4DV1 O;  4B3R B;  3LUT B;  3AG2 B;  1BMF G;  1PNK A;  2EUL A;  3JD2 A;  4IYI A;  4LF9 B;  1ROP A;  1BSM A;  1I0H A;  1IBM O;  4G27 B;  4FFB A;  3OTO B;  2QE7 G;  2JEX A;  5B1B B;  5CBG A;  4KP4 A;  4FLU A;  3D3I A;  1VQO V;  3OGC C;  4P30 A;  1OCR C;  3FFQ A;  3FKS G;  2NLJ C;  1QR9 A;  4UCR A;  1ZWI C;  2ZM6 O;  4AQY O;  2ZIO A;  2PI5 A;  3N27 A;  3SR2 C;  2GTA A;  3ZN1 A;  2DWD C;  4JI4 B;  1TUE B;  2ZE5 A;  4PI2 A;  1AVM A;  1YF2 A;  1XNR B;  4HAM A;  1XI1 A;  4K8X A;  1X59 A;  4UB8 Z;  4B3T B;  5IWA B;  1F7Y A;  4UVC A;  2BSK B;  4J42 A;  4XDJ A;  1OJH A;  4FPP A;  5KA5 A;  3W7W A;  1N34 B;  5DM6 V;  1K5Q A;  2JDI G;  4DR6 O;  1SC5 B;  3CEI A;  2QTO A;  2WLN A;  2E3C A;  3ABL C;  4K35 A;  1SS3 A;  2L6L A;  4CS3 A;  3BPZ A;  4DR1 O;  4UCS A;  2EJR A;  4HZ3 A;  4WF9 V;  3AK1 A;  1PNL A;  1FS0 G;  4B3M O;  3E86 A;  4BAY A;  3CMA V;  3AG1 C;  4DV2 O;  5KX5 A;  2QGN A;  2ILM A;  1BQZ A;  5KHG A;  2YS8 A;  5FL7 G;  3JAS B;  5JQG B;  2JIZ G;  3OTO O;  1M9N A;  1RPO A;  4DV6 O;  1XUQ A;  3MD0 A;  4QGP A;  3CSX A;  1N36 O;  3DXR B;  4YHH B;  1G6U A;  3ABT A;  4DV2 B;  1WJZ A;  4DYL A;  5BR8 B;  2HJD A;  5BMV A;  1SET A;  1KKC A;  2VWK A;  3CRM A;  1YTF D;  4IIJ B;  5GON A;  1TVK A;  5EBL C;  3CRA A;  1TUB B;  4XBF A;  4LCU C;  3BA9 A;  3Q4H A;  1AJP A;  1LR1 A;  4FVM A;  1B6Q A;  5CMU A;  1SER A;  4NTX A;  2ZQM A;  2UXD O;  1KYO F;  4DV0 O;  4IYH A;  2A79 B;  2PYJ A;  1M57 B;  3ZHV A;  3CCE V;  3AG3 C;  2GHY A;  3LSS A;  3OUS A;  4LC1 A;  5DN6 G;  1K5S A;  3JD1 A;  1S77 D;  3U11 A;  2WLL B;  2ZE8 A;  1XIL A;  3UT5 A;  1N32 B;  5J2U B;  4EB6 A;  5LHG A;  5L3B A;  1S0V A;  3B4S A;  4JI2 O;  2P4K A;  4DV6 B;  3IGA C;  5FPR A;  3OM3 B;  2XAQ A;  1Y4M A;  3ZMT A;  4QPK A;  4CBC A;  4R7C A;  4LNU B;  4LF6 O;  4E2L A;  2Q67 A;  3SPH A;  4GKJ O;  4FMT A;  4LF9 O;  2QTS A;  3MDS A;  5L3F A;  1V9P A;  3CC4 V;  3F7Y C;  4LF4 O;  2XAJ A;  5IYC O;  2BTO A;  5IYZ B;  1G1X B;  4WFG A;  2QKC A;  3T2M A;  4DR7 B;  2R9A A;  3B09 A;  1FKA O;  1H8H G;  2Q69 A;  1P84 F;  2WLI A;  4MVR A;  1PNM A;  1ARO P;  1V54 B;  4ICG A;  4IGG A;  1SQV H;  2KG7 B;  5CB4 B;  2ZR3 A;  4UCV A;  3ZRV A;  2YIC A;  1XDC A;  4O4J A;  1ZTE A;  1CP9 A;  2IH1 C;  5IE9 A;  4J9Y B;  3RT3 C;  4NTW A;  1AI7 A;  3OMN B;  2IW5 A;  5FLX N;  3AK3 A;  2KSD A;  2P7T C;  3SYC A;  5KA6 A;  2BTQ A;  5AG2 A;  3ML0 A;  1ZX3 A;  2YXY A;  3L9D A;  3EXA A;  2QR4 A;  1N34 O;  2DW4 A;  1H2G A;  4PA7 A;  3WB0 A;  1NU1 H;  4GT1 A;  4MW3 A;  2P90 A;  2CAZ C;  2JEU A;  3L74 H;  2QKS A;  5A9G A;  3NXS A;  4LFA O;  4QJF B;  2E5L B;  3RVY A;  2ZKO A;  5H2F Z;  1S72 V;  1I08 A;  4GKK B;  2AHY A;  4MVM A;  3J81 N;  1IBK O;  2GSM B;  3SJB C;  4MT8 A;  4QE7 A;  2Q73 A;  4O4L B;  3BVO A;  4JYY A;  2LFS A;  4DW1 A;  2M7W A;  2WLL A;  2RN9 A;  4FIP C;  1MSD A;  1M93 A;  1TA8 A;  4BW9 A;  3QO8 A;  3FB5 C;  2QWO B;  1GN6 A;  2YEV B;  2IJI A;  4B7K A;  3HKC B;  4CC5 A;  4PEL A;  3ZRS A;  1Q90 D;  3QVN A;  5F2V O;  2OCH A;  1FFT B;  5D5P A;  4I0X A;  2IBZ H;  2P5O A;  1ENV A;  1EN5 A;  1TUB A;  2UXX A;  3JCU Z;  3P32 A;  1HDJ A;  2CGN A;  3S3W A;  4JAV A;  3IAY A;  2QM7 A;  1DTO A;  2F1M A;  1NQT A;  1VQM V;  5IJ9 A;  2AZ0 A;  1IDS A;  3OEH G;  2B1I A;  1JFF B;  5BMV B;  4EFE A;  3ASN C;  5HFL A;  2ATK C;  1OV9 A;  3RVZ A;  4A5U B;  3K0G A;  2EX3 A;  2QEX V;  1YVW A;  4GKJ B;  5KHH A;  4NXN O;  4MTX A;  1AIL A;  3CWB H;  4FJC C;  1H2M A;  4LBE C;  3JAW B;  3K5M A;  2AHZ A;  4U3J A;  3STL C;  3CRQ A;  4IT5 A;  2BOB C;  2XHB A;  4GZR B;  4TV9 B;  1M56 B;  2V7Q G;  1DF4 A;  4JI3 B;  3MAQ A;  1Z5W A;  3H1K H;  3T1H O;  1WP7 A;  5IJ0 B;  2DN9 A;  3E22 A;  4TV8 A;  2RMK B;  2EIM C;  4O4I A;  4MTG A;  2B5U A;  4I4T B;  5H5N A;  2F66 C;  2HHH B;  1KB9 F;  4PDV A;  4NXM O;  3BY6 A;  1R6N A;  1D5N A;  3E22 B;  5BXZ A;  1YDX A;  3HPL C;  3SYQ A;  4O4I B;  4J10 A;  5JCO C;  1XEQ A;  2QKA A;  3SPI A;  4LFC O;  3FB7 C;  2N74 A;  4P9O A;  1ZUQ A;  1XQ8 A;  3GVM A;  1CPY A;  2XOK G;  4X66 O;  2QWP B;  1XMO B;  4IL6 Z;  2ITD C;  3E83 A;  5LP6 B;  2Q5Z A;  1XHZ A;  3QNE A;  4HBN A;  4R8C A;  4JGS A;  2YSU B;  2Y69 B;  3AG4 C;  1P49 A;  5H9C A;  1BQ0 A;  1SES A;  5CBF A;  1N0J A;  4JV5 B;  1LUW A;  3G71 V;  4FLX A;  1PL4 A;  5ITZ B;  5C93 A;  2Q4P A;  1UPG A;  1Q43 A;  3RBZ A;  2ITC C;  2EJ7 A;  4I7Z B;  4X1I A;  3ZHU A;  1YCI A;  4QNH B;  2UUA B;  4TUY B;  4XDK A;  4JI5 O;  2OCC B;  2UUC B;  2GV9 A;  4NB5 A;  3C90 A;  2ZD9 A;  2ZXW B;  4O2B B;  3KCX A;  4MVO A;  4WFE A;  2EZP A;  3TK1 A;  4ZOL A;  1GH6 A;  2Q0A A;  3ETD A;  3IJ4 A;  1SRY A;  1Y76 A;  4KL1 A;  3W7U A;  2RNB A;  1W59 A;  2ZXW C;  2ZIM A;  4ZI7 B;  2GDS A;  2QM4 A;  1GKF A;  3SGI A;  4PV1 B;  4LR3 A;  2A0L A;  4I5S A;  4MTO A;  3ZN0 A;  5GW7 A;  3LNN A;  4W4L A;  4DUZ O;  4PHZ A;  2YEV A;  1XNR O;  1R3K C;  1GK9 A;  1CEZ A;  4CS2 A;  3OT7 A;  4TT3 G;  2OCC C;  1OCC B;  4HYO A;  4K8Z A;  3MHS C;  2LQT A;  3OEE G;  2O57 A;  4FM0 A;  1W2B U;  3JAT B;  1XL4 A;  3MHH C;  2EIJ B;  1YI2 V;  4O4L A;  5LYJ A;  1ORQ C;  3H1J H;  5JCO A;  3E8B A;  2PZS A;  2BE3 A;  1Y6X A;  3HB3 B;  1U96 A;  2XT9 A;  2PY5 A;  1ZSP A;  1MG1 A;  1WPB A;  3LSQ A;  5IJ9 B;  1FXK A;  4PA3 A;  3D36 A;  4IHJ A;  1IBK B;  5IY5 C;  2FYU H;  1XBL A;  1BL8 A;  2CDY A;  2XAG A;  4PA9 A;  1L0L H;  4X62 B;  4DV5 O;  4I0X B;  4RQE A;  1HR0 B;  2X6A A;  2IJH A;  3HKE A;  2UUC O;  2WLH A;  1MZF A;  3ZX6 A;  1KKD A;  3KKY A;  3R66 A;  3B40 A;  1AI4 A;  4CC6 A;  4BW5 A;  1FYJ A;  4KUM A;  5LXT A;  2W0X A;  1M57 C;  3C3T A;  5LMN B;  2DYS B;  1SA0 B;  4I9Q A;  4YIO A;  1L8D A;  3JAR A;  5L3C A;  4JI4 O;  2G38 A;  3CCS V;  2DYR C;  1EM1 A;  5IT9 N;  1H2S B;  3K5N A;  4JZ2 A;  1MNG A;  5TIS Z;  3U10 A;  4DV4 O;  4BIO A;  2VS0 A;  5KMG A;  3G6B A;  3ZS8 C;  3ASO B;  2DMX A;  4PDM A;  3CPW U;  4RUE A;  4GLX A;  4DO2 A;  5LGT A;  5B1A B;  3AG2 C;  1K92 A;  3GWO A;  4WFA V;  1B04 A;  3RN4 A;  1K33 A;  1NZ6 A;  4QPJ A;  4DR2 B;  3DC6 A;  2QA4 V;  1VQ4 V;  1VQ5 V;  4JYA B;  3RYI A;  3JAT A;  5IY5 B;  3VQX A;  4B3T O;  4N21 A;  5C8Y B;  4X20 B;  2KKW A;  3FAV A;  1L0N H;  4WBN A;  5LL6 Y;  4K0K B;  2Z0A A;  2QWN B;  4Q6G A;  1VMG A;  3LDE A;  1K73 W;  2K1E A;  2ZM6 B;  1IBL B;  4AQY B;  5KLV H;  4UFZ A;  4QE9 A;  2NN4 A;  2WLK A;  3THO A;  5L3D A;  1K8A W;  1FXK C;  5GON B;  2ZDI A;  1WA8 A;  2X0L A;  4UB6 Z;  5CBH A;  4FLW A;  2D2C B;  1COW G;  4DR4 B;  2GBO A;  1AB3 A;  2PF4 E;  1JVM A;  1GTO A;  1H2K A;  4X1I B;  4JI1 B;  4CH6 A;  3GWK C;  2PYL A;  1RSO B;  2VQF O;  1SQX H;  2Q68 A;  2UXD B;  3H1H H;  5BZB A;  1Q81 W;  4LF8 B;  3IC7 A;  2ADQ B;  3CC7 V;  2R9I A;  1SZX A;  4W4K A;  5IDJ A;  4TOI A;  2HG5 C;  3RWR D;  2Y0P A;  5HFM A;  5EIB C;  1AJQ A;  4CH3 A;  4FM1 A;  2A06 H;  4LH7 A;  1WP8 A;  3JCZ A;  2YXL A;  2UUB B;  2WWW A;  1MA1 A;  3I55 V;  3CC2 V;  2MK3 A;  2X6B A;  4CH4 A;  4F6R A;  3X2Q B;  2R72 A;  2UUA O;  1WB8 A;  3CCR V;  4LF6 B;  1Q6U A;  3M7M X;  1PPJ H;  5B66 Z;  3CCM V;  1ZL8 B;  3FB6 C;  4DUY B;  1Y76 B;  4DXW A;  5EIB D;  2E76 B;  3JSN A;  4X1Y B;  2YC0 A;  3B77 A;  2OT5 A;  4GX1 A;  4WCE V;  1Q3E A;  1S5H C;  5H6R A;  1G8M A;  5JH7 B;  2HKO A;  1FD9 A;  2LP7 A;  4Z1M G;  3RYH A;  1H2L A;  1ZAU A;  5J2T B;  2ZCE A;  4B08 A;  3GB7 C;  4OXS A;  2ARH A;  3STZ C;  3CCL V;  2AZ2 A;  1MZE A;  3UO2 A;  3N2K B;  2EZO A;  1VF6 A;  4JI1 O;  3JD3 A;  3M8A A;  1M4U A;  2XAH A;  2JJ1 G;  2EIL C;  4H44 B;  4DV1 B;  1YTF B;  1BGY H;  1US6 A;  1R6K A;  3RYF B;  4UVB A;  1MSW D;  1W0K G;  1XMQ B;  4JI6 B;  3K79 A;  5LP6 C;  3JAK A;  1OCO B;  2IJJ A;  3QO7 A;  2QSA A;  2VRZ A;  4JI6 O;  2RCV A;  4JI0 B;  3TJT A;  3OR7 C;  2PTM A;  1JFF A;  2H8P C;  2CUG A;  2LW7 A;  3WB1 A;  1HNZ O;  1N8R W;  2WSS G;  3TET A;  1NR7 A;  1F51 A;  3HKC A;  4JYC A;  4G28 B;  4JZG A;  5DEC A;  3R65 A;  3CCQ V;  1N33 O;  4J7Z A;  2CTR A;  1XRE A;  3K5O A;  4RO2 A;  4NYK A;  1KUQ A;  2BTQ B;  4DR1 B;  3BFR A;  1R1B A;  3I5D A;  4FZ0 A;  4UV8 A;  3RYC A;  3C3S A;  1D2D A;  2UU9 B;  1AJN A;  1OHH G;  1DGS A;  5B3S B;  5DED A;  2OTL V;  2AXT Z;  2Q6A A;  4FFK A;  1DF5 A;  3JAS A;  5JQG A;  2HHH O;  3WU2 Z;  3SPC A;  4F6R B;  4MW8 A;  5EYP B;  3SYP A;  4DR5 O;  3OE7 G;  1R73 A;  3OMA B;  2YXH A;  1JA8 A;  4LFC B;  4DV4 B;  3ZED A;  4LFA B;  2KQX A;  2VWJ A;  3HKB A;  2DQ3 A;  1EN4 A;  2Y48 A;  1FJG O;  1NTM H;  4PA4 A;  3JYC A;  1GN2 A;  3K9A A;  4J41 A;  3L72 H;  2X7R B;  5K1X A;  5EC1 C;  5B1B C;  2F43 G;  4JI3 O;  1XMQ O;  4L8J A;  4OGQ B;  2ODM A;  3CD6 V;  4PDR A;  1BHA A;  2LW1 A;  1WN7 A;  4K0K O;  1IBM B;  1G4Y B;  1NBM G;  3RW0 A;  3ZCC A;  4IHJ B;  4TSF G;  4PDL A;  3RGB A;  2W6J G;  4JPR A;  3BA8 A;  4FFB B;  2LJ2 A;  4X62 O;  4MTF A;  4JTA B;  3T1C A;  2EBO A;  1HR0 O;  4O4J B;  3D3Q A;  2OIE A;  3N2G A;  3PN1 A;  1H2N A;  2IH3 C;  3NR7 A;  4JTD B;  1LNQ A;  1J5E O;  3IFX A;  1AR5 A;  2JGD A;  1SQB H;  4OX9 B;  2A9H A;  2DOS A;  1Y66 A;  3EVK A;  1VF6 C;  2QWR B;  3W7S A;  1VQL V;  4D7S A;  2GTS A;  1B3Q A;  1SKV A;  1Q82 W;  4MVQ A;  3IC9 A;  1F4N A;  3SJC C;  4AI8 A;  1I94 O;  1VQ8 V;  5EK0 A;  1F23 A;  1P7B A;  1OZ0 A;  3OR6 C;  4L87 A;  1L1F A;  3JAR B;  3CRC A;  4X66 B;  3APO A;  5LGN A;  4JI2 B;  2WA4 A;  4O2A A;  3D36 C;  2Y0I A;  1Q6I A;  2HFE C;  2Q8V A;  1VQP V;  4JYA O;  1TAE A;  4LWS B;  5KAI Z;  4J80 A;  3BEH A;  2Y69 C;  2V1D A;  3ABK B;  3P30 A;  2CTQ A;  3J80 N;  2F23 A;  1FXH A;  3O9O A;  3FB8 C;  3JD4 A;  4GX5 A;  1E1R G;  4UCU A;  2UXC B;  3UO3 A;  3G6E V;  1GAX A;  5JVD B;  3ZMU A;  4H33 A;  3HKE B;  3SPJ A;  3LDC A;  4DRX B;  2WLI B;  2M6Y A;  4NR1 A;  1RM1 C;  4LF7 O;  4JI7 O;  1K97 A;  2L35 A;  4U3F H;  2JGD B;  3CP1 A;  4R6Z A;  3RYF A;  2H3O A;  1QNM A;  1JCH A;  1GO3 F;  2JJ2 G;  5LMN O;  4LF5 O;  2XAS A;  3E35 A;  3K06 A;  3RYC B;  1GM8 A;  1FFX A;  3VQW A;  2FML A;  3CE2 A;  3ASO C;  1NR1 A;  2P06 A;  3H1L H;  1NI8 A;  1OCC C;  1EFR G;  1WPX A;  3N2G B;  2YI8 A;  1HNW B;  4DR4 O;  1MMM A;  4DW0 A;  2E5L O;  4YY3 B;  4FZ1 A;  3G80 A;  2EIK B;  5ITZ A;  4EEQ A;  2FKX A;  4ZI7 A;  3A8T A;  4MVZ A;  1WLE A;  4P9P A;  1N0N A;  4AIL C;  4I55 B;  3AG7 A;  2JVD A;  2RQ6 A;  3ZJZ A;  1JPX A;  1JJ2 U;  4YIP A;  1PM9 A;  1PKX A;  3A0R A;  3APQ A;  3VQY A;  3OTF A;  5LA6 B;  3ZHR A;  1WNS A;  3QG5 A;  1XNQ B;  3TXQ A;  1M5I A;  2BCC H;  3K59 A;  4WFB V;  3T4Z A;  3BCC H;  2MW2 B;  2V4D A;  1V54 C;  5CA1 A;  1FFX B;  2N05 A;  3WB2 A;  3A0H Z;  1IBL O;  4NVP A;  5B5E Z;  2WAM A;  3CCJ V;  2Y4T A;  1DK1 A;  1MAB G;  5KUK A;  3U0Z A;  4JAU A;  3DSQ A;  1YSC A;  2DYR B;  1I94 B;  1RFY A;  4GX2 A;  1ZL8 A;  3ZHT A;  2F93 B;  1JX9 A;  2ZIN A;  4ASU G;  4DUZ B;  4OPA A;  4X1Y A;  3AEI A;  4I4T A;  4LF5 B;  2LGW A;  3VOU A;  1J5E B;  3OW2 U;  5KX5 B;  2E75 B;  4DRX A;  4RUF A;  1Q6H A;  4TV9 A;  2ZR2 A;  1FAF A;  1QQC A;  1Q86 W;  1X4T A;  1YJN V;  4MS2 A;  1NS1 A;  5LA6 A;  1WA8 B;  2EIJ C;  4LP8 A;  3K5L A;  2ZT9 B;  1HNX B;  2UXB B;  1UJW B;  1N36 B;  1HNZ B;  2LGQ A;  2XAF A;  4DR3 B;  3K9S A;  3L73 H;  1S5J A;  2FTK A;  4C7U A;  4XDL A;  4O4H A;  1O9G A;  3OGI B;  2XUM A;  5K1P A;  5GTH Z;  1VF7 A;  1AR1 B;  1NT2 B;  4I50 A;  1XNQ O;  1AR4 A;  1HW7 A;  3FYE B;  2YI9 A;  4JF3 A;  1NJI W;  5EBW C;  2VQE B;  4J11 A;  2R70 A;  1IXB A;  3H9V A;  4MVS A;  4X9Q A;  4DR7 O;  1RP3 B;  2OTJ V;  1QCE A;  1KP2 A;  1I7F A;  1VQN V;  3KG2 A;  4X8A A;  1JJO A;  1BS3 A;  4OX9 O;  4J9Z B;  1VQ7 V;  3ZMV A;  4FLT A;  1GM7 A;  1EN6 A;  1THZ A;  1K4C C;  3AG3 B;  2KG7 A;  5CB4 A;  1IXM A;  1FPO A;  1BCC H;  4H37 A;  1EBO A;  5LMU O;  1EZJ A;  1PP9 H;  1OCZ C;  3OMI B;  4X64 B;  4WFF A;  4Z2W A;  4H13 B;  4CH5 A;  3N2K A;  3CRR A;  4ZHQ A;  2PGG A;  3L75 H;  4LH6 A;  3RYI B;  4B3S B;  3ZBH A;  4KHP B;  5JVD A;  3QTC A;  4OPH A;  5KHK A;  3SYA A;  1U97 A;  1URF A;  1VP7 A;  1Y74 A;  1K7D A;  3ETG A;  4DR3 O;  1RSO A;  5D5Q A;  4YJ2 A;  4Q20 A;  2YIB D;  2JK5 C;  1T5E A;  3ZIA G;  1GMG A;  2P6J A;  1KMI Z;  1KC8 W;  1GM9 A;  2P22 C;  5CA1 B;  3B2E E;  4UCO A;  1GN4 A;  2UXC O;  1R3L C;  3ABM B;  4F4L A;  3G4S V;  4FLZ A;  3JAW A;  5IWA O;  2E74 B;  3DC5 A;  1SA0 A;  2N04 A;  2FL4 A;  4DV7 O;  4I55 A;  2Q7H A;  1NVP D;  4B7E A;  5EBM C;  3J7A U;  3ICX A;  1QR8 A;  3LDD A;  3OFN G;  1VQ9 V;  4YXW G;  1YZB A;  3AG1 B;  1TGO A;  1YHQ V;  4UUJ C;  1LUV A;  2IJK A;  4DK1 A;  3UCS C;  4B3M B;  2D3O W;  3RFR A;  1HWY A;  2JRI A;  3ETE A;  4KXR A;  3L71 H;  2XTA A;  1VAR A;  4DR6 B;  1JOY A;  3CCU V;  4U7O A;  1KU9 A;  4HNA A;  3A2F A;  3E8G A;  1IZ3 A;  3DXR A;  4GX0 A;  4YY3 O;  2Z3Y A;  4DV3 O;  5GTI Z;  4GKK O;  1NTK H;  5FNV A;  1F4M A;  1I5X A;  4NKG B;  1S76 D;  4YJ2 B;  4X20 A;  3B8M A;  5LXT B;  1NH2 B;  4NXM B;  4ZOL B;  1P7G A;  4U7N A;  3HKB B;  2CH7 B;  3FX7 A;  3VBB A;  5CA0 A;  5LYJ B;  3K0D A;  3KCY A;  1K34 A;  3JAL A;  5LOV A;  1YJ9 V;  4K3A A;  4PJ0 Z;  3AK2 A;  1DLB A;  5CA3 A;  2UXN A;  4JI0 O;  1Q5O A;  1E1Q G;  3CJH B;  2EIN B;  1YIT V;  2F95 B;  1N33 B;  2DWE C;  4X65 B;  1K9M W;  2YID A;  1V55 B;  5EZY A;  3A0B Z;  3UM7 A;  2ZE6 A;  3CS5 A;  1AI5 A;  1SQF A;  1B06 A;  3H1I H;  5E1A C;  1Z2G A;  1N32 O;  4LFB O;  3CXC U;  2HVK C;  4ZKI A;  1QVF U;  3CCV V;  1PV0 A;  4DR2 O;  5JJN B;  1GRJ A;  3DTU B;  1M56 C;  2A3Q A;  2ZE7 A;  1BE3 H;  1GN3 A;  1VQ6 V;  4N23 A;  5LOV B;  3B8N A;  3OD4 A;  4GYC B;  3UKM A;  4JI8 O;  2ETN A;  2CTW A;  5A2Q N;  2WA3 A;  3P3N A;  3QO5 A;  2VQF B;  3JAK B;  2P67 A;  1K3E A;  4EKW A;  2YUA A;  2B1G A;  2IM9 A;  4EFB A;  2WLM A;  3JD0 A;  5LBQ A;  1OCO C;  4CZZ A;  2UUB O;  4Z1V A;  4O2B A;  5B1A C;  4U3J B;  3M99 B;  2VQE O;  5J2T A;  4DK0 A;  2AW9 A;  4BWA A;  4G2K A;  2JGU A;  2HR3 A;  1IVS A;  1VQK V;  5KHI A;  5L3G A;  3TCU A;  1J95 A;  2GUZ A;  5IYB O;  3E89 A;  3ZMZ A;  2CTP A;  4AHC A;  4I50 B;  1I5Y A;  4UVA A;  2QDO A;  1JQ0 A;  1UFI A;  1YJW V;  1N4C A;  3ABK C;  3F7V C;  4DV5 B;  2LO1 A;  2JS3 A;  2YIA A;  5CN0 A;  1R3I C;  2JS5 A;  4TWK A;  4GCZ A;  2WLJ A;  4YJ3 A;  3S3X A;  3JAM N;  3BAA A;  4LF4 B;  4KHP O;  3T1H B;  3E8F A;  2H94 A;  4UCT A;  2DE0 X;  4WFH A;  1E79 G;  1V55 C;  5LGU A;  1XHX A;  4D6T H;  3F5T A;  4E4E A;  1R6T A;  5BR8 O;  1FJG B;  5CA0 B;  1H8E G;  2ZNI A;  5LP6 A;  3SDL A;  3P3P A;  4PD4 F;  4RAI A;  4QIW F;  1QU7 A;  1HNX O;  2UXB O;  1EZV H;  2DYS C;  3HKD A;  4X1K B;  4TQF A;  5JJJ B;  4LF7 B;  4JTC B;  1Q7Y W;  4JV5 O;  1NVP B;  2PUS A;  4LWS A;  3SJQ C;  3WFV A;  3LNM B;  4DV7 B;  3CHX A;  2Q0O C;  2F4V B;  3O65 A; 
#chains in the Genus database with same CATH homology
 3OUS A;  4LC1 A;  4PA6 A;  5DN6 G;  1K5S A;  2CK3 G;  3JD1 A;  1S77 D;  3ZJZ A;  2W6I G;  1JPX A;  2LFR A;  4DO2 A;  1M90 W;  1JJ2 U;  1QBZ A;  3SPG A;  2WLL B;  5LGT A;  1PKX A;  3A0R A;  1KEC A;  5B1A B;  1PD3 A;  3AG2 C;  4P2Z A;  1K92 A;  3H01 A;  3GWO A;  4WFA V;  5LHG A;  1K33 A;  5L3B A;  1S0V A;  4WFB V;  3ASN B;  3T4Z A;  4QPJ A;  1RM1 B;  1V54 C;  3IGA C;  1VQ4 V;  2QA4 V;  1VQ5 V;  3K08 A;  3OM3 B;  2XAQ A;  1Y4M A;  2EIK C;  3ABU A;  3K04 A;  4QPK A;  3ZMT A;  5IY5 B;  5B1N A;  4CBC A;  4N21 A;  2WAM A;  3CCJ V;  4R7C A;  3EFF K;  2XND G;  1MAB G;  5KUK A;  4JAU A;  4E2L A;  2Q67 A;  1YSC A;  2DYR B;  3SPH A;  3LDE A;  4GX2 A;  1K73 W;  1OCR B;  2K1E A;  4FMT A;  1JX9 A;  4ASU G;  5L3F A;  3AEI A;  1P4R A;  3CC4 V;  3F7Y C;  5IYD O;  3EHB B;  4QE9 A;  2XAJ A;  5IYC O;  2WLK A;  5L3D A;  4WFG A;  1K8A W;  1FXK C;  3T2M A;  3VOU A;  2ZDI A;  2X0L A;  3OW2 U;  2WPD G;  5CBH A;  5J9P C;  1H8H G;  2Q69 A;  4I9W A;  4RUF A;  1COW G;  2WLI A;  4MVR A;  2ZR2 A;  1ARO P;  1PNM A;  1V54 B;  1Q86 W;  3ZRW B;  1YJN V;  4MS2 A;  2EIJ C;  4LP8 A;  2ZR3 A;  1JVM A;  1GTO A;  2EIM B;  3ZRV A;  3ZRX A;  1UJW B;  1XL6 A;  3E8H A;  2Q68 A;  2XAF A;  5BZB A;  1Q81 W;  2HJF C;  3SYO A;  3IC7 A;  1CP9 A;  2IH1 C;  2ZDI C;  1R3J C;  2FTK A;  4JYB A;  4J9Y B;  4XDL A;  3CC7 V;  2R9I A;  5IDJ A;  2QM8 A;  1AI7 A;  2HG5 C;  3OMN B;  2IW5 A;  2KB1 A;  5L3E A;  5HFM A;  1AJQ A;  2P7T C;  3SYC A;  5KA6 A;  1AR1 B;  3ML0 A;  3FYE B;  3JCZ A;  4JF3 A;  1NJI W;  5EBW C;  1KD1 W;  2HVJ C;  4MVS A;  3W7X A;  2OTJ V;  2DW4 A;  4JAS A;  1H2G A;  1QCE A;  2WWW A;  1KP2 A;  4PA7 A;  1VQN V;  3KG2 A;  3I55 V;  3CC2 V;  4GT1 A;  2MK3 A;  4X8A A;  3WG7 C;  2X6B A;  5EC2 C;  1QVG U;  4MW3 A;  1QLN A;  1KQS U;  2P90 A;  4J9Z B;  2JEU A;  3X2Q B;  2QKS A;  1VQ7 V;  3OUF A;  3NXS A;  3CCR V;  4QJF B;  3ZMV A;  3RVY A;  1H38 A;  2EIN C;  1GM7 A;  3WG7 B;  1THZ A;  1K4C C;  1S72 V;  3AG3 B;  2AHY A;  4MVM A;  3CCM V;  2GSM B;  4MT8 A;  1PL0 A;  3FB6 C;  4QE7 A;  1IXM A;  4DXW A;  2LFS A;  3B77 A;  4UXN A;  2OT5 A;  4GX1 A;  2M7W A;  2WLL A;  4WCE V;  1S5H C;  4H37 A;  1EBO A;  5H6R A;  4FIP C;  1EZJ A;  1G8M A;  1OCZ C;  3OMI B;  2HKO A;  2LP7 A;  4Z1M G;  3QO8 A;  3FB5 C;  1NH2 D;  1NKD A;  4WFF A;  2YEV B;  3CYO A;  2IJI A;  3GB7 C;  1FXK B;  4OXS A;  4MSW C;  3STZ C;  3OAA G;  3CCL V;  1FXV A;  2EIL B;  4PEL A;  3SYA A;  4BIU A;  3ZRS A;  1K7D A;  3ETG A;  2EZO A;  3T4D A;  3CME V;  1FFT B;  3JD3 A;  4FK5 C;  2XAH A;  2JJ1 G;  1OCZ B;  4R50 A;  4Q20 A;  1ENV A;  2UXX A;  3P32 A;  2EIL C;  2JK5 C;  1YTF B;  3ZIA G;  2W0F C;  1GMG A;  1R6K A;  2HLD G;  2P6J A;  2QM7 A;  4JAV A;  1GM9 A;  1KC8 W;  1DTO A;  2IU3 A;  4UVB A;  1NQT A;  1MSW D;  1VQM V;  1W0K G;  5H6Q A;  3OEH G;  2B1I A;  5B3S C;  1R3L C;  3K79 A;  3ASN C;  3ABM B;  5HFL A;  1OCO B;  4F4L A;  2ATK C;  3G4S V;  1QLE C;  3RVZ A;  3K03 A;  2IJJ A;  3QO7 A;  4RQF A;  3OR7 C;  3K0G A;  1KP3 A;  2H8P C;  2QEX V;  3AG4 B;  1NVP D;  1N8R W;  3DGE A;  2WSS G;  5EBM C;  4MTX A;  3TET A;  1NR7 A;  1F51 A;  1M1K W;  4FJC C;  3PJS K;  4LBE C;  2Z5U A;  4JYC A;  1QR8 A;  4X88 A;  2AHZ A;  4G28 B;  3LDD A;  3OFN G;  3STL C;  3R65 A;  3I56 V;  3CCQ V;  1RPR A;  4ZBM A;  4RO2 A;  4YXW G;  2BOB C;  3AG1 B;  5LHI A;  1YHQ V;  1VQ9 V;  4UUJ C;  2IJK A;  3ZMS A;  4UV8 A;  1M56 B;  1AJN A;  2D3O W;  2V7Q G;  1HWY A;  1OHH G;  4UV9 A;  1DF4 A;  5B3S B;  1BHB A;  2OTL V;  3ETE A;  2Q6A A;  1QLE B;  3K3W A;  1DF5 A;  3SPC A;  2DQ0 A;  4MW8 A;  1JOY A;  3SYP A;  3CCU V;  2R9R B;  2EIM C;  4BIZ A;  4MTG A;  4U7O A;  2B5U A;  3X2Q C;  3OE7 G;  2PI4 A;  1R73 A;  3OMA B;  3E8G A;  4PDV A;  2X6C A;  3BY6 A;  1R6N A;  4GX0 A;  2Z3Y A;  5LHH A;  3HPL C;  1F4M A;  1I5X A;  3SYQ A;  2DQ3 A;  2NNU A;  1S76 D;  3B8M A;  3SPI A;  2IU0 A;  3FB7 C;  1NH2 B;  2Y48 A;  2BOC C;  3ZRW A;  4X89 A;  3W7T A;  4P9O A;  1AI6 A;  4U7N A;  3E2E A;  1CPY A;  2XOK G;  4PA4 A;  2C2A A;  3JYC A;  3VBB A;  3K9A A;  2ITD C;  3E83 A;  3K0D A;  4MVU A;  2X7R B;  3ABL B;  1W0J G;  3ABM C;  5EC1 C;  5B1B C;  1K34 A;  2F43 G;  3QNE A;  4R8C A;  3F5W C;  1YJ9 V;  4JGS A;  1DLB A;  3CD6 V;  5CA3 A;  2UXN A;  2YSU B;  4PDR A;  2Y69 B;  5B1O A;  3AG4 C;  5H9C A;  1K4D C;  1BHA A;  1E1Q G;  1SES A;  5KUM A;  5CBF A;  2EIN B;  1SZT A;  1YIJ V;  1G4Y B;  1NBM G;  1YIT V;  1S3J A;  3RW0 A;  3ZCC A;  3G71 V;  4TSF G;  3FYI B;  4PDL A;  4KFM A;  2DWE C;  1MOF A;  2W6J G;  1V55 B;  5C93 A;  4JPR A;  1K9M W;  3UM7 A;  3LUT B;  3RBZ A;  2ITC C;  3AG2 B;  4MTF A;  1BMF G;  4JTA B;  1PNK A;  2EBO A;  3JD2 A;  3T1C A;  4QNH B;  1ROP A;  1AI5 A;  5E1A C;  4XDK A;  2OCC B;  4G27 B;  2IH3 C;  4JTD B;  1LNQ A;  2ZD9 A;  2QE7 G;  3CXC U;  3IFX A;  2ZXW B;  2HVK C;  2JEX A;  5B1B B;  5CBG A;  4MVO A;  4WFE A;  4ZKI A;  4KP4 A;  2EZP A;  1QVF U;  2A9H A;  3TK1 A;  3CCV V;  1Y66 A;  3D3I A;  3W7S A;  1VQO V;  3OGC C;  4P30 A;  1VQL V;  3ETD A;  1Q82 W;  3DTU B;  1SRY A;  3W7U A;  4MVQ A;  1M56 C;  1OCR C;  2ZXW C;  1F4N A;  1VQ6 V;  3FKS G;  4N23 A;  2NLJ C;  1GKF A;  3B8N A;  1QR9 A;  2A0L A;  5EK0 A;  3UKM A;  1VQ8 V;  4I5S A;  4MTO A;  3ZN0 A;  1F23 A;  1P7B A;  1OZ0 A;  1ZWI C;  5GW7 A;  2YEV A;  3OR6 C;  4L87 A;  1L1F A;  2PI5 A;  1R3K C;  1GK9 A;  1CEZ A;  3ZN1 A;  2DWD C;  3QO5 A;  4TT3 G;  5LGN A;  2OCC C;  1OCC B;  1TUE B;  4HYO A;  3MHS C;  2P67 A;  1K3E A;  4HAM A;  4EKW A;  3OEE G;  2B1G A;  2HFE C;  1W2B U;  1VQP V;  1XL4 A;  3MHH C;  2EIJ B;  2WLM A;  3JD0 A;  1YI2 V;  5LBQ A;  4UVC A;  1OCO C;  4XDJ A;  4CZZ A;  1ORQ C;  4FPP A;  5KA5 A;  3W7W A;  5DM6 V;  1K5Q A;  3BEH A;  2JDI G;  2V1D A;  2Y69 C;  3E8B A;  2QTO A;  5B1A C;  2WLN A;  3ABK B;  3M99 B;  3ABL C;  3HB3 B;  3P30 A;  1FXH A;  1MG1 A;  3LSQ A;  2EJR A;  3FB8 C;  3JD4 A;  4G2K A;  4GX5 A;  1FXK A;  1E1R G;  2HR3 A;  4HZ3 A;  4PA3 A;  4WF9 V;  1PNL A;  3D36 A;  3G6E V;  1FS0 G;  3E86 A;  1VQK V;  4BAY A;  5IY5 C;  5L3G A;  3TCU A;  3ZMU A;  1J95 A;  3CMA V;  3AG1 C;  4H33 A;  1BL8 A;  3SPJ A;  2XAG A;  3LDC A;  5IYB O;  3E89 A;  4PA9 A;  3ZMZ A;  2WLI B;  5FL7 G;  1I5Y A;  4RQE A;  1RM1 C;  4UVA A;  2JIZ G;  1JQ0 A;  2X6A A;  1YJW V;  3ABK C;  1M9N A;  1RPO A;  2IJH A;  1K97 A;  2WLH A;  3CP1 A;  3MD0 A;  4R6Z A;  3F7V C;  1KKD A;  1JCH A;  3ABT A;  5CN0 A;  1R3I C;  1AI4 A;  1GO3 F;  4TWK A;  2JJ2 G;  4BW5 A;  4GCZ A;  2WLJ A;  3E8F A;  2H94 A;  1SET A;  2XAS A;  3E35 A;  3K06 A;  4WFH A;  4KUM A;  1YTF D;  1E79 G;  1GM8 A;  1M57 C;  1V55 C;  5LGU A;  3CPW U;  2DYS B;  5EBL C;  3ASO C;  1H8E G;  1NR1 A;  1OCC C;  5L3C A;  4XBF A;  4RAI A;  4LCU C;  1EFR G;  4QIW F;  1WPX A;  3CCS V;  1AJP A;  2DYR C;  2DYS C;  1B6Q A;  4JTC B;  5CMU A;  1SER A;  1Q7Y W;  2ZQM A;  1NVP B;  2A79 B;  1M57 B;  3SJQ C;  2EIK B;  3WFV A;  3CCE V;  3LNM B;  3AG3 C;  3ASO B;  4PDM A;  4MVZ A;  1WLE A;  4P9P A;  2GHY A;  4RUE A;  3LSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...