3CP1A

Structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
73
Chain Sequence
TVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Transmembrane Protein
total genus 34
structure length 73
sequence length 83
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cp1A00
3CYOA 1DF4A 4N21A 1Y4MA 5CN0A 2EZOA 4JGSA 1QBZA 5HFMA 1K33A 3P30A 4N23A 1DF5A 1F23A 3B8NA 4FK5C 4JPRA 1I5XA 3K9AA 4E2LA 3M99B 3GWOA 1K34A 5KA6A 2X7RB 1QR8A 1I5YA 4JF3A 5H9CA 3B77A 3CP1A 3MHHC 2MK3A 2M7WA 1Y66A 5KA5A 1MG1A 1QR9A 1JPXA 1MOFA 2OT5A 4FJCC 4FIPC 2P6JA 2EBOA 3WFVA 5HFLA 1ENVA 5CMUA 1JQ0A 2EZPA 3MHSC 1EBOA 4G2KA 1SZTA 2LP7A 3H01A 1QCEA 1DLBA 3B8MA
chains in the Genus database with same CATH superfamily
3T1CA 4X20B 1R6KA 4MTFA 2FKXA 4KL1A 2ATKC 3CC4V 2N05A 1F4MA 4IIJA 1KKDA 3KZIZ 4WBNA 5KA5A 3P3NA 4HYOA 2OWOA 3UKMA 4H0LB 4W4LA 2ZDIA 2ZNIA 2P7TC 3U0ZA 1PKXA 3CE2A 3H1LH 1GMGA 3F5WC 3A0BZ 1TVKB 3T1YB 1AR5A 1E1RG 4ZHQB 3K0DA 4E4EA 3CCQV 1RFYA 3UT5B 3OUFA 4MT8A 3RBZA 1ZL8A 2DQ0A 5B5EZ 2ADQB 1IURA 5JJNB 2CK3G 3OMNB 3M7MX 5KAIZ 3ZCCA 4CC5A 3FB8C 4UVCA 3OR6C 1ZX3A 4GUNA 4PDRA 3T1HB 3LSUA 1OV9A 3SYPA 2PGGA 4CBCA 4OX9B 2WWWA 2XTAA 3S3XA 2P6JA 2BTQB 4B3RB 5B3SB 5LHGA 2C2AA 3EXAA 3N2GA 4LFAO 4FLYA 1VQ5V 3UQ8A 3W7WA 1UPGA 1SQGA 5IJ0A 2UUBB 1OCRC 2Q0AA 4DR3O 4BIUA 2VQFB 2MK3A 2L35A 1HW7A 2WLLA 1MA1A 4UVBA 1JJ2U 2BTOA 2ARHA 2GTAA 3TGUH 4J9YB 3OTFA 1OCRB 1Q6UA 2DN9A 1BS3A 1N32B 4DW1A 3OFNG 4LFAB 5BMVA 2OCHA 1PV0A 5LMNB 2P4VA 2AHYA 2KG7B 2Q5ZA 4I7ZB 2M6YA 1AP5A 3H1IH 3BPZA 3W7SA 1K34A 1COWG 4JI3B 1YJWV 5FPOA 1QVGU 1N34O 4QJFB 2LGWA 4IL6Z 5L3BA 3LDDA 4XDKA 5EBWC 1AILA 3TXQA 1NJIW 2GUZB 1BMFG 1FJGO 2HR3A 2Q73A 3CEIA 3BY6A 1WB7A 3IC9A 5IT9N 4FPPA 1RP3B 4OXSA 4EEQA 4EB6A 4DV1B 3QO8A 1FFXA 5LGUA 4FLUA 2ITCC 2H8PC 1QLEC 1W59A 3ZIAG 4Z2WA 4O4LB 4DV0O 1K92A 3VQVA 1IXMA 1YJ9V 1GO3F 1QR8A 3JSLA 3B77A 3CRAA 4TV8B 2XASA 4HZ3A 4X62O 1F7YA 3CPWU 4NB5A 3HKDA 1BZKA 2KQXA 3I56V 3BEHA 2XAJA 4JI5B 3F5TA 1P49A 1BE3H 2P90A 3DSQA 3UT5A 4DV5B 1D5NA 1FXKC 2CH7B 4MVMA 4IGGA 3E8GA 2IW5A 4ZHQA 1GM9A 2XNDG 5L3DA 4CH5A 5CB4B 3LNMB 2A7WA 3CXCU 2DYSC 1YVWA 3RW0A 2K1EA 3NXSA 1QVFU 3AG3B 5CN0A 4I4TA 1BHBA 1QLNA 1XILA 4UCTA 2XHBA 5LYJA 3QO7A 4UUJC 4AQYO 2LJ2A 2QEXV 2XAFA 3JD2A 3W7XA 5EC2C 4UB8Z 5B3SC 3HKCA 1K4DC 4P30A 3K5MA 3JASB 1HNZB 1EZJA 2Y48A 5KLVH 4KP4A 2QTSA 1NH2B 3AG2C 4UCVA 4LF4B 3P30A 4UFZA 3CD6V 3NR7A 2JRIA 3GWKC 4ZBMA 4MS2A 1VQ9V 1E79G 2CDYA 3ETGA 2BTQA 2DYRB 5A9GA 5H9CA 2EJ7A 3CP1A 1QR9A 2B9ZA 4RQEA 5L3FA 3T1HO 1NR7A 5KUMA 1YIJV 5J2UB 2JJ1G 2HHHB 2UUAO 2HKOA 4OPHA 1GM7A 1FPOA 3N27A 1XL6A 3E8BA 4I5SA 2Z5UA 3P32A 5BZBA 5LMUB 1XMOO 3ZMTA 4DR3B 2WLIA 3CCVV 1AROP 2UU9B 4PDLA 4TT3G 2F1MA 1ORQC 4DR5O 2HP8A 3ZBHA 2F43G 3HB3B 1DGSA 3C90A 2LFSA 5L3EA 3X2QC 1YTFD 4LF6O 4R6ZA 1BT8A 3OTOB 3ZS8C 1XMOB 1IBMO 3F7YC 4R50A 1SA0B 5KX5A 5LGNA 1T5EA 4I55A 3U10A 1ZLZA 2ZIOA 5E1AC 4DUYO 2IU0A 4JI1B 3RGBA 5IJ9B 1NS1A 1I94O 4DRXB 1QU7A 1XNQB 3CJHA 1RM1C 4GX5A 3Q4HA 4FFBA 3I55V 2QM8A 3SR2C 4YJ2A 1VQOV 1NI8A 2QKSA 1R3KC 4O4HA 4YIOA 1KD1W 3K9AA 3CYOA 2EIKB 4MVOA 3AEIA 1WLEA 2UXXA 5K1PA 2X6CA 2Q7EA 3LDCA 4MSWC 1Q7YW 1BGYH 1OCCB 1JFFA 1XL4A 5LA6B 4X64O 2PZSA 4DK1A 5GONA 4CH3A 2PI5A 4RUFA 4H37A 4I50A 4FVMA 1B06A 1EFRG 3CC7V 2FB5A 3N2GB 1AJNA 4R7CA 1K5QA 1YDXA 2B5UA 3ZHUA 3M99B 5KAFZ 3ZMZA 3K04A 3DGEA 2HLDG 1DK1A 3K03A 2PYJA 2EIKC 2X0LA 1NTKH 1Q86W 5KHIA 2OYQA 3UO2A 3AG2B 3C3SA 5JH7B 2D3OW 1L0NH 2UXDB 3T2MA 3JALA 4I0XA 1SERA 4JV5B 4BAYA 2NNUA 4AQYB 2EINC 3TXSA 1B04A 3SYQA 1IXBA 4LH7A 1KYOF 3P3PA 3E22B 1MSDA 3ZHRA 1ROPA 3CJHB 3F7VC 4FLXA 1OJHA 3B2EE 3FYIB 2A9HA 4O4JA 1H2LA 1Q8IA 4DUZB 2W6IG 4D7TA 4GX0A 2QSAA 4JI8B 1SA0A 4IIJB 1I7FA 2GTSA 2ITDC 4UCOA 2IJKA 1X59A 1WJZA 2UU9O 1EN6A 5LP6C 2HFEC 2EULA 4B08A 4IHJA 5CB4A 4JI8O 1P4RA 3BABA 2DYRC 1R3IC 1YCIA 3CB2A 3K5OA 3RYFB 4MW3A 1XDCA 1SETA 1S0VA 4JTCB 2VQFO 4X89A 4QNHB 4G27B 3OT7A 2EIJC 3DTUB 4X1KA 3SDLA 4DV4B 5CA0B 4WFBV 3BVOA 3ABLC 4FLWA 4DR7O 5DM6V 5J2UA 4OPAA 4TV8A 4MVZA 3CCUV 1TVKA 1VMGA 3WFVA 2IH1C 4IHJB 1Y6XA 1RPRA 1OCZB 1FXKB 2JGDA 4BWAA 3MD0A 1TUEB 1KC8W 4XBFA 3EVKA 5C8YA 1XEQA 3L73H 4WFFA 4J9ZB 3J81N 4NTXA 2NN4A 5LA6A 4NXMB 3D8CA 1QNMA 3H9VA 4LWSB 3JCZA 2HVKC 1JX9A 5JVDB 2Y69C 3J7AU 4DV1O 1Z5WA 2W6JG 4B3SB 2UXCB 3U11A 1Y4MA 4I4TB 1SS3A 5JJJB 4RAIA 4OX9O 2AGAA 4DW0A 3VQWA 1YJNV 4OGQB 3HPLC 4ICGA 2Y69B 3DC6A 1V54C 1R1BA 1XBLA 3BRCA 3IFXA 1BQ0A 3AG3C 5L3GA 4I9WA 1S5LZ 4P9OA 1GK9A 1M1KW 3RVZA 3RWRD 3K59A 4ZOLA 4ZKIA 1NU1H 3HKBB 3RN4A 3ABMB 4J10A 4CH4A 1SQQH 1GTOA 3RYIA 4A5UB 2P06A 1ZWIC 1YI2V 3GWOA 5BR8O 5C93A 1N32O 2UXDO 1FYJA 4MTOA 3CCLV 1AP6A 2KKWA 1AR4A 4U3JA 4MVSA 1PNKA 5DN6G 2ZDIC 5IYCO 1QCEA 1XQ8A 3AG1C 1KP3A 3HKEB 3RT3C 3LSQA 4O4IA 3ZHVA 2UXBO 2WLIB 2V4DA 3L70H 3OGIB 3OUSA 5JWPA 4NXNB 4FJCC 3KKYA 3IJ4A 3D3QA 1FJGB 5CA0A 1KUQA 4Q20A 5GTHZ 1K73W 1K97A 3K08A 2Q68A 4JYCA 4FK5C 1PP9H 4TV9B 5LOVB 3SPCA 4IT5A 1I08A 5B1AC 1K9MW 2A0LA 4GKKO 5FLXN 3CCJV 1QHTA 4D6TH 2QWNB 3CXHF 1ZTEA 4TWKA 1S76D 5EC1C 2GHYA 4MTGA 2N04A 3OMIB 1HR0B 1RSOB 5B1NA 1SRYA 2WLLB 5IYBO 1J5EO 4GKJB 2RJZA 2WLHA 5IJ0B 3QF7A 1DLBA 3AK2A 4DYLA 1SZXA 4X1YA 2AHZA 2LW1A 3SPGA 4CC6A 5EIBC 2O57A 4DV4O 1X4TA 4EFEA 4DO2A 3WB2A 2QJ1A 2XAHA 1SQVH 4O2BB 3G71V 1MABG 3A2FA 2X6AA 1M5IA 5LBQA 4PDMA 4TV9A 1HWYA 4X8AA 5DEDA 3UO3A 1TUBB 2AZ0A 1MZEA 1A32A 2XOKG 2YXYA 4PA6A 4TSFG 5FNVA 4Z1MG 1QLEB 3QTCA 4L87A 1V9PA 3B8NA 1ZL8B 1TUBA 3ZRXA 4Z1VA 4ZI7B 5D5PA 1WP8A 2ZE5A 1PD3A 4W4KA 3R66A 1MSWD 1MMMA 2F95B 3FAVB 1OZ0A 3HKEA 2ZE7A 1HNXB 1Y76B 4FZ0A 4NTWA 4WF9V 4X1IB 3LUTB 4YIPA 2PI4A 3T1YO 2P67A 3TCUA 4H44B 3FFQA 3RFRA 3SYAA 2H94A 1U97A 3ZHQA 5IWAB 4LFBB 2KSDA 4B3MO 3RYHA 5LHIA 5LHHA 3KCYA 2ZE6A 1URFA 1FD9A 2Q9LA 4O4JB 1FAFA 3AK3A 2DYSB 3CRQA 1K4CC 2FYUH 2HJFC 4GX1A 1NTMH 4ZIBA 5IWAO 3FYEB 2RDCA 1JR9A 2YEVB 2E74B 3FKSG 2EJRA 3OM3B 1V54B 2UUCB 4KHPB 4JAUA 1NZ6A 4U7OA 4J80A 3STZC 1M93A 1XOUA 2H3OA 1H8EG 3OTOO 5LOVA 1PPJH 1VQMV 3EFFK 4B3TO 3ML0A 1QBZA 1NVPD 1LNQA 2A3QA 4FM2A 4J7JA 1P84F 1I5XA 4I55B 4GLXA 2YI8A 4DR1O 4UV9A 5KX5B 2QM4A 2ETNA 4UB6Z 5LP6B 1I94B 2ZM6O 3MHSC 4DXWA 2HG5C 4DV3O 1VIBA 4NVPA 5KMGA 4DR4B 2WLMA 1Q81W 1Y76A 3A0RA 5CBFA 1G6UA 2ILMA 4I50B 2QWOB 2B1IA 1GN2A 2QKAA 1O9HA 4QPJA 1JOYA 4DV3B 1NVPB 4MTXA 4DV7B 2WAMA 1EN4A 1HR0O 4EKWA 2QWPB 4GKKB 1MZFA 3ZRSA 2Z3YA 5FNVB 3L72H 3BAAA 4LP8A 4U7NA 1Q82W 1L0LH 3ETEA 2ZXWB 3G4SV 3OW2U 1YF2A 1VQ7V 1NKDA 2Q8VA 2RCVA 4RUEA 4UCSA 4FMTA 1LR1A 1JQ0A 2QDOA 4GKJO 3H1HH 2CE4A 3FB5C 3ABLB 1JJOA 5IJ9A 2QM7A 1WA8A 3JD0A 5BMVB 1K5SA 2Z0AA 1VQ8V 3SJCC 4PELA 1Y67A 3CRMA 4LWSA 3E86A 2BSKB 2Q67A 2ZINA 4LF8O 5LYJB 5EZYB 4DR7B 2JK5C 1AB3A 4B7EA 1G8MA 1N8RW 4LF5B 5GTIZ 3WB0A 3ZRVA 4PI0A 4JI2B 3ZRWB 1K7DA 3B09A 3IC7A 5A2QN 2E76B 5KUKA 1JPXA 2JJ2G 4LFBO 4YY3B 4B3RO 1AVMA 4TQFA 4K0KO 4DV6B 1H2KA 4JI2O 4AILC 2YICA 2YXHA 3JD3A 3ZMUA 4FM0A 2XT9A 4JI6O 5EK0A 2R9RB 2Y0PA 4P2ZA 4B3SO 1IZ3A 4YJ3B 5GW7A 4F4LA 3LDEA 1R3JC 3DXRB 3K9SA 2NR5A 3QNEA 5CA1B 1FXHA 2QR4A 3ZHSA 4QIWF 3TJTA 1VQ4V 3W7TA 3JCUZ 3ZRWA 4N21A 2OTJV 1CPYA 3JASA 3LSSA 3BHPA 2XAGA 1GN3A 5LP6A 2P4KA 4K3AA 4PDVA 2Y4UA 1VF7A 2ZR2A 4LF7B 1RM1B 4RQFA 5JJEB 5BY1A 2OTLV 2GUZA 2OCCC 1YITV 3R65A 2EZOA 5B1AB 5IYZB 4F6RB 2Q4PA 3BA8A 3D36A 1S3JA 1VQLV 2AXTZ 3JAMN 3QVNA 3JATB 2L6LA 5CA3A 3K5NA 1M9NA 2CTWA 1ENVA 2CH7A 1VF5B 2ZM6B 2A06H 2VWJA 5J2TA 2HJDA 2RMKB 1Y74B 2ADPA 4NXNO 3CCMV 3E8HA 3CWBH 1K33A 5JH7A 4NXMO 3G67A 1LUVA 3VBBA 4DR6B 2OIEA 4JTDB 4JI0B 1JVMA 1LUWA 2CGNA 2CTPA 2UXCO 2OCCB 3CCRV 4AHCA 5HFLA 4CS4A 1BCCH 3CC2V 4PA4A 2F4VB 2G38A 1IBKB 3QG5A 5EYPB 5EYPA 3UM7A 5B1BC 1XUQA 4JAVA 1W0KG 4JYBA 4LF9B 2PF4E 2GSMB 4K8XA 4H13B 3RYCB 4DV5O 1UJWB 3C3TA 4EFBA 1JFFB 4PA3A 4LCUC 4G2KA 3ABMC 1G4YB 3H01A 2CTQA 3ETQA 1J5EB 4DV0B 3FX7A 3IGAC 1B3QA 1W2BU 1Q6IA 4N23A 1Y74A 1M57C 3N2KA 5B66Z 3HKBA 3RYFA 1VF6C 4O2BA 4X62B 3ICXA 4FFKA 2PY5A 2YS8A 4J7ZA 3MDSA 2YXLA 2E5LO 1R6TA 1F51A 5LL6Y 1V55B 4WCEV 2KG7A 5IYZA 2WA3A 1HNZO 2OIGA 4PI2A 4J11A 4XDJA 1DF5A 2YIBD 2BOCC 3VQYA 2R72A 5EZYA 3HKCB 3EHBB 3JD4A 1Y66A 1GH6A 3APOA 3SJAC 1RSOA 2Q6AA 2ZD9A 1NT2B 3H1KH 3K06A 4KFMA 4BW9A 3QO5A 5FPRA 1WP7A 4K0KB 1GKFA 1L8DA 2AW9A 2JVDA 2GDSA 2VS0A 1N33O 4JI6B 4PD4F 5JQGB 5E79Z 3G80A 3MHHC 5CA1A 4I0XB 1VQPV 1H2GA 5IE9A 1EM1A 2EIMB 1VP7A 2IM9A 4ZI7A 2JEXA 3N2KB 4O2AA 3CMEV 2XUMA 1R6NA 1AI5A 3K79A 3OE7G 2QE7G 2JDIG 3WG7C 1Q90D 5J9PC 4O2AB 3OD4A 2ZCEA 4YHHO 5KHJA 2UUBO 5LXTB 2F93B 3RYCA 1WPXA 1S77D 3CHXA 4PA9A 5JQGA 3VQXA 3HR0A 1P7GA 2ZXWC 1SKVA 2YIDA 3B40A 2LP7A 3L71H 2CGOA 3RVYA 4GZRB 2UUCO 1M57B 5KMGB 1M56B 2Q0OC 4BIZA 4YHHB 2FL4A 5LMUO 3THOA 3ABUA 1CXZB 4U3JB 1AJPA 1HDJA 3SYCA 2BSKA 2DE0X 2DMXA 5JCOC 4FLZA 2JS3A 5KHKA 2DW4A 3I5DA 4C7UA 3ASNC 1S72V 4KUMA 2JS5A 1WA8B 4LF6B 2YDEA 3JAKB 3ASOC 5L3CA 2VWKA 3JD1A 3TETA 5IY5C 1AJQA 3CCEV 4TUYA 2IH3C 1MG1A 1SQBH 2YIAA 4JI0O 2XAQA 1KKCA 5H6RA 4GCZA 2JIZG 3AG7A 4WFAV 3WU2Z 2IJJA 1E1QG 2WSSG 1N36B 3UCSC 2ZQMA 1UFIA 2QWRB 5H2FZ 1F4NA 2LGQA 3CCSV 1I5YA 1Q6HA 3S3WA 2EIMC 2EINB 5EBLC 3ZMVA 1VQ6V 1SQPH 1EZVH 2Q69A 1R73A 4JAAA 1KU9A 1V55C 4RWUA 3WG7B 1SQFA 3ABTA 4JI5O 2RN9A 2JGDB 1S5HC 3ZJZA 1FXKA 4X9QA 4E2LA 1KBHA 4CS3A 5IDJA 3DXRA 3O9OA 4IYHA 2E3CA 2WLKA 1AI4A 2LFRA 4DV2O 4JI4O 1R3LC 2DWEC 1SC5B 3SPIA 2N74A 3CRRA 1KB9F 4P9PA 3T4DA 2EX3A 4FM1A 3D36C 5BR8B 1M56C 3ZX6A 2YUAA 3KG2A 4JGSA 4D7SA 1GN4A 2NLJC 3RYIB 1H2NA 2BCCH 2UXBB 4WFGA 1D5AA 1N4CA 4ZOLB 2V7QG 3JSNA 1IDSA 2AZ2A 3GVMA 4LF4O 4X88A 3JATA 4YJ2B 4DR4O 3E2EA 1MOFA 2GBOA 2D2CB 4K8ZA 1HNWO 1M90W 4JPRA 4LH6A 4QPKA 4PV1B 4X1YB 3PJSK 1SQXH 4YY3O 3E89A 3FB6C 4DV7O 5JVDA 4X65B 5B1BB 1VARA 3PN1A 5IYDO 2Q7HA 3CS5A 2OT5A 3SJBC 4I9QA 1YTFB 3VOUA 2ZIMA 1TAEA 3J80N 3L74H 1Q3EA 3ZN0A 4MVRA 5ITZB 3K0GA 3IAYA 1WB8A 2A79B 1NR1A 1KP2A 1ZAUA 1WAZA 2PUSA 3FAVA 2BE3A 2DWDC 2ZR3A 3BCCH 1O9GA 1TGOA 2DQ3A 3WB1A 3CSXA 4G28B 4DR5B 3JYCA 4X1KB 4UCUA 3ZEDA 3E35A 5DECA 4BR6A 2YIBA 1EN5A 1M4UA 4JI1O 1NBMG 4LR3A 4LF5O 3OMAB 2QA4V 3K3WA 1XNRB 3CX5F 2HVJC 2QGNA 2RQ6A 3CRCA 2PYLA 1N34B 1QQCA 2KB1A 4LFCO 4XDLA 2IBZH 2B1GA 4DV6O 1CEZA 1H38A 5K1XA 1XREA 4DR6O 2IJIA 5BXZA 2Q7GA 3E8FA 3K5LA 3OGCC 3B4SA 1I0HA 1MNGA 1IBKO 2YC0A 3AG4C 1SF9A 4MW8A 1VEWA 3DC5A 2CTRA 2Y0IA 1HNXO 2YI9A 3G6BA 1S5JA 2YEVA 3ZHTA 5H5NA 1WNSA 3Q4HB 4FFBB 4CS2A 3X2QB 3APQA 3B8MA 4HNAB 4DRXA 3JAKA 4DV2B 3JARB 4B3MB 5FL7G 4LF7O 2ZKOA 1FXVA 4LNUB 2VQEO 3ABKC 4KHPO 2QTOA 2X6BA 3HKDB 1VF6A 1WPBA 5LMNO 5CBGA 1PL0A 3H1JH 3AG1B 5C8YB 4DK0A 1AI6A 2P22C 3ABKB 3ZMSA 4BIOA 4JV5O 4X1IA 3SPJA 1B6QA 1HNWB 1L1FA 3L75H 4DR2B 4QE7A 3E83A 3OEEG 4DR1B 2VQEB 1IVSA 1Q43A 2VRZA 1VQKV 5KA6A 1XI1A 3CMAV 1GAXA 4NYKA 4HAMA 4JI7B 4JASA 4EB6B 4FIPC 1GN6A 1IBLB 1EBOA 2EILC 1CP9A 2WLJA 1Z2GA 1DF4A 1D2DA 3TK1A 2Y4TA 3JARA 5KHGA 1RPOA 4O4HB 4R8CA 3OR7C 3MAQA 1JA8A 4Q6GA 4JI7O 3W7UA 2F4VO 4DUZO 1KQSU 4B7KA 1IBLO 4TUYB 1XHXA 5LGTA 3BFRA 5CMUA 1XMQO 1YZBA 4LF9O 1N33B 5IY5B 4U3FH 4GYCB 2P5OA 4JYAB 1Z5VA 2LO1A 5ITZA 1YSCA 1YEWA 2V1DA 4LBEC 2IJHA 4MVQA 3FB7C 4J42A 2FTKA 3JAWA 1H8HG 2ZT9B 3KCXA 3SYOA 3L9DA 2X7RB 2UUAB 4WBNB 5H6QA 1AR1B 4X66O 2BOBC 1NH2D 4NTYA 4PJ0Z 4GX2A 4GT1A 1GRJA 1PL4A 4FZ1A 1KECA 1XNRO 2MW2B 1OCCC 5D5QA 1H2SB 2F23A 2YSUB 2QWQB 4F6EA 2E5LB 1HP8A 4LF8B 4UCRA 3OEHG 1JCHA 3BA9A 4PA7A 3A8TA 4UXNA 3JALB 1IBMB 4NKGB 3ETDA 4LFCB 5KHHA 3K57A 4QGPA 1OCOB 4K35A 4J7KA 2R9IA 1U96A 1N0NA 1YHQV 2JEUA 4DUYB 2LQTA 2QKCA 1XNQO 1ZSPA 3FD9A 2EILB 2EBOA 4L8JA 1AI7A 4O4IB 1WN7A 2WA4A 4NR1A 4WFEA 1BL8A 1NTZH 3M8AA 4J41A 3K58A 2DOSA 2R9AA 4JYYA 4JZGA 4TOIA 4QE9A 4TQDA 1GM8A 1BHAA 1SESA 2UXNA 1H2MA 3SPHA 1THZA 3O65A 1K3EA 5GONB 1FFXB 2FMLA 5AG2A 2HHHO 3D3IA 2RNBA 1IX9A 1J95A 4KXRA 2DJVA 3LNNA 4ABMA 1BSMA 3JAWB 2K9PA 3OAAG 4X64B 5B1OA 5TISZ 3SJQC 4JZ2A 1FS0G 4X20A 5HFMA 4MVUA 1F23A 2WLNA 3T4ZA 3E22A 1DTOA 1YXBA 2ZE8A 3AG4B 2R70A 1OCZC 4JF3A 2WPDG 1P7BA 1FKAO 2ZNJA 1N0JA 5EBMC 5EIBD 4UVAA 1TA8A 4F6RA 4JI4B 4ASUG 4FLTA 1KMIZ 2CAZC 4DR2O 4IYIA 2M7WA 4PHZA 4JI3O 3RYHB 1ZUQA 1JMKC 1PM9A 3ASNB 4YXWG 2W0FC 4B3TB 4UV8A 2EIJB 4FLVA 1OHHG 5JCOA 2W0XA 4O4LA 3ASOB 4LC1A 1XMQB 1Q5OA 4RO2A 4JYAO 1G1XB 2CUGA 2IU3A 2ODMA 3AK1A 3SGIA 4CZZA 5LXTA 4H33A 1XHZA 4YJ3A 4LNUA 3STLC 3ZN1A 4X65O 1BQZA 1N36O 2PTMA 5CBHA 3G6EV 1K8AW 1FFTB 4X66B 4BW5A 4HNAA 1PNLA 5J2TB 1W0JG 2JGUA 4CH6A 3A0HZ 2E75B 2HEPA 1US6A 1NQTA 3GB7C 1PNMA 1VQNV 4HBNA 2F66C 4JTAB 2EZPA 4WFHA 4AI8A 2GV9A 1SZTA 1OCOC 5F2VO 2LW7A
chains in the Genus database with same CATH topology
3FB5C 4QPKA 1ROPA 3ABLB 3T1CA 1R6KA 3PJSK 3F7VC 2QM7A 3JD0A 4MTFA 1K5SA 3FYIB 1VQ8V 2A9HA 2ATKC 3E89A 3CC4V 3FB6C 4PELA 1F4MA 5B1BB 5IYDO 1KKDA 3E86A 2W6IG 5KA5A 2OT5A 4GX0A 2Q67A 1YTFB 3VOUA 4HYOA 2ITDC 2JK5C 1G8MA 3UKMA 2IJKA 2ZDIA 1N8RW 3ZN0A 2P7TC 4MVRA 3K0GA 3ZRVA 2A79B 2HFEC 3ZRWB 1K7DA 1NR1A 1KP2A 1PKXA 1GMGA 3F5WC 3IC7A 2DWDC 1P4RA 2DYRC 1E1RG 1JPXA 1R3IC 2ZR3A 5KUKA 2JJ2G 3K0DA 3CCQV 4MW3A 2DQ3A 3OUFA 1SETA 4MT8A 1S0VA 4JTCB 3RBZA 2DQ0A 4X89A 4QNHB 4G27B 4G28B 2EIJC 3DTUB 3JYCA 2CK3G 3OMNB 3JD3A 3ZMUA 3ZCCA 4WFBV 3FB8C 3E35A 5EK0A 2R9RB 3ABLC 4UVCA 4P2ZA 3OR6C 5DM6V 5GW7A 1NBMG 4F4LA 4PDRA 3LDEA 1R3JC 3CCUV 4MVZA 3SYPA 4CBCA 3OMAB 2QA4V 2WWWA 3QNEA 2P6JA 3WFVA 1FXHA 2IH1C 3K3WA 5B3SB 1RPRA 2HVJC 1OCZB 5LHGA 2C2AA 1FXKB 4QIWF 1VQ4V 3W7TA 3MD0A 3ZRWA 4N21A 1TUEB 1KC8W 2OTJV 1VQ5V 1CPYA 4XBFA 3W7WA 3LSSA 4WFFA 2KB1A 1OCRC 2XAGA 4J9ZB 4XDLA 4BIUA 2B1GA 2MK3A 1CEZA 4PDVA 2WLLA 1H38A 2ZR2A 4UVBA 1JJ2U 3JCZA 1RM1B 4RQFA 2HVKC 1JX9A 4J9YB 2IJIA 1OCRB 2OTLV 2Y69C 2OCCC 3OFNG 1YITV 3E8FA 2W6JG 1Y4MA 3R65A 3OGCC 2EZOA 5B1AB 2AHYA 4RAIA 1YJNV 3AG4C 3HPLC 4MW8A 3W7SA 1K34A 3D36A 1S3JA 2Y69B 1VQLV 1V54C 3IFXA 3AG3C 5L3GA 4I9WA 4P9OA 5CA3A 1COWG 1GK9A 1M1KW 1M9NA 2YEVA 1ENVA 3RVZA 1YJWV 3X2QB 4ZKIA 1QVGU 4QJFB 3ABMB 3B8MA 5L3BA 1GTOA 3CCMV 3LDDA 3E8HA 4XDKA 5EBWC 1K33A 1NJIW 1ZWIC 1BMFG 5FL7G 3VBBA 1YI2V 2HR3A 4JTDB 3GWOA 1FXVA 3BY6A 5C93A 3ABKC 1JVMA 2QTOA 2X6BA 4FPPA 4OXSA 4MTOA 3CCLV 2OCCB 3QO8A 3CCRV 4MVSA 5HFLA 5LGUA 5CBGA 1PNKA 1PL0A 3AG1B 5DN6G 2ZDIC 5IYCO 2ITCC 3CC2V 2H8PC 1QLEC 3AG1C 1QCEA 1AI6A 4PA4A 3ZIAG 3ZMSA 3ABKB 1KP3A 3SPJA 1B6QA 3UM7A 5B1BC 4JAVA 1W0KG 4JYBA 1L1FA 4QE7A 3E83A 3OEEG 1K92A 3LSQA 2GSMB 1VQKV 5KA6A 3CMAV 1IXMA 1YJ9V 1GO3F 2WLIB 1QR8A 1UJWB 3B77A 2XASA 4HAMA 3OUSA 4HZ3A 4JASA 3CPWU 4FJCC 4FIPC 4PA3A 4LCUC 1EBOA 2EILC 1CP9A 4G2KA 3ABMC 3I56V 3BEHA 1G4YB 2XAJA 3H01A 2WLJA 4Q20A 1K73W 1DF4A 1K97A 3TK1A 3IGAC 3K08A 2Q68A 1W2BU 1RPOA 4JYCA 4N23A 4FK5C 1M57C 2P90A 4R8CA 3OR7C 1FXKC 4MVMA 3E8GA 3SPCA 2IW5A 3W7UA 1GM9A 2XNDG 5L3DA 5B1AC 1K9MW 1KQSU 2A0LA 5LGTA 3LNMB 5CMUA 3CXCU 3CCJV 2DYSC 5IY5B 3RW0A 1F51A 2K1EA 3NXSA 1QVFU 1V55B 1YSCA 3AG3B 4WCEV 5CN0A 2V1DA 4LBEC 4TWKA 2IJHA 1S76D 4MVQA 4XDJA 1BHBA 1QLNA 1DF5A 5EC1C 2GHYA 3FB7C 4MTGA 2BOCC 3OMIB 2FTKA 1H8HG 3EHBB 3QO7A 3SYOA 4UUJC 5B1NA 2X7RB 1SRYA 3JD4A 2QEXV 5H6QA 2WLLB 2XAFA 5IYBO 1Y66A 1AR1B 3JD2A 3W7XA 2BOBC 2Q6AA 5EC2C 5B3SC 1K4DC 2ZD9A 1NH2D 4P30A 2WLHA 1DLBA 3K06A 4GT1A 1EZJA 2Y48A 4GX2A 4KP4A 4KFMA 3QO5A 1NH2B 3AG2C 2AHZA 1GKFA 1KECA 3P30A 3SPGA 3CD6V 1OCCC 4ZBMA 4MS2A 1VQ9V 1E79G 2YSUB 3ETGA 2DYRB 4DO2A 5H9CA 3CP1A 3MHHC 2XAHA 3OEHG 1JCHA 1QR9A 1VQPV 1H2GA 4PA7A 5L3FA 4RQEA 2EIMB 4UXNA 3G71V 1MABG 1NR7A 2X6AA 5KUMA 1YIJV 5LBQA 4PDMA 1HWYA 3ETDA 4X8AA 2JEXA 3CMEV 2JJ1G 1OCOB 1R6NA 4PA6A 2XOKG 4TSFG 4Z1MG 1AI5A 1QLEB 3K79A 2QE7G 3OE7G 2R9IA 2JDIG 3WG7C 2HKOA 4L87A 1GM7A 1YHQV 3B8NA 2JEUA 5J9PC 3ZRXA 1XL6A 3E8BA 4I5SA 2Z5UA 3P32A 5BZBA 3ZMTA 1PD3A 2WLIA 3CCVV 1AROP 2EILB 2EBOA 1MSWD 1WPXA 1AI7A 1S77D 4PA9A 4PDLA 4WFEA 1BL8A 4TT3G 2ZXWC 1ORQC 1OZ0A 2LP7A 4QE9A 3RVYA 2F43G 3HB3B 4WF9V 2LFSA 1GM8A 5L3EA 1M57B 3LUTB 1SESA 1BHAA 3X2QC 2PI4A 1YTFD 1M56B 2P67A 3TCUA 4R6ZA 2UXNA 3SYAA 4BIZA 2H94A 3SPHA 1THZA 3ABUA 1K3EA 3F7YC 1AJPA 4R50A 5LHIA 3SYCA 5LHHA 3D3IA 5LGNA 1J95A 2DW4A 3ASNC 5E1AC 3OAAG 1S72V 2DYSB 4KUMA 5B1OA 2IU0A 3SJQC 1FS0G 1K4CC 2HJFC 3ASOC 5HFMA 4GX1A 4MVUA 5L3CA 1F23A 2WLNA 3JD1A 1RM1C 4GX5A 3T4ZA 3FYEB 3I55V 3TETA 2QM8A 1DTOA 5IY5C 2YEVB 1AJQA 3AG4B 3FKSG 1OCZC 4JF3A 3CCEV 2EJRA 2WPDG 1P7BA 3OM3B 2IH3C 1V54B 1MG1A 1VQOV 4JAUA 4U7OA 5EBMC 2XAQA 2QKSA 3STZC 4UVAA 1R3KC 5H6RA 1H8EG 4GCZA 2JIZG 1KD1W 3K9AA 3CYOA 1VQMV 3EFFK 4WFAV 2EIKB 4MVOA 3ML0A 4ASUG 1QBZA 2IJJA 3AEIA 1NVPD 1LNQA 1WLEA 1E1QG 2UXXA 2WSSG 2X6CA 3LDCA 2ZQMA 1I5XA 4MSWC 1F4NA 4UV9A 1Q7YW 3CCSV 1OCCB 1I5YA 1XL4A 2EIMC 2EINB 2M7WA 5EBLC 3ZMVA 1VQ6V 2PI5A 4RUFA 3ASNB 4H37A 3MHSC 2Q69A 4YXWG 4DXWA 1R73A 2HG5C 2W0FC 4UV8A 2EIJB 1OHHG 1V55C 3WG7B 2WLMA 1EFRG 3CC7V 1Q81W 3ASOB 3ABTA 3A0RA 4LC1A 1AJNA 4R7CA 1S5HC 1K5QA 1FXKA 3ZJZA 5CBFA 2B5UA 4RO2A 4E2LA 3M99B 2B1IA 3K04A 3ZMZA 5IDJA 3DGEA 2HLDG 2IU3A 4CZZA 2WLKA 3K03A 1AI4A 2LFRA 4H33A 1R3LC 4QPJA 1JOYA 2DWEC 2EIKC 1NVPB 2X0LA 4MTXA 3SPIA 2WAMA 3STLC 3ZN1A 1Q86W 4EKWA 5CBHA 3G6EV 3ZRSA 1K8AW 4P9PA 3T4DA 3AG2B 1FFTB 1M56C 2Z3YA 4JGSA 3KG2A 2D3OW 4BW5A 2NLJC 3T2MA 4LP8A 1PNLA 4U7NA 1W0JG 4WFGA 1Q82W 3ETEA 2ZXWB 3G4SV 2V7QG 3OW2U 1VQ7V 1NKDA 1SERA 3GB7C 1NQTA 4X88A 4RUEA 2NNUA 4BAYA 3E2EA 1MOFA 2EINC 1PNMA 1VQNV 4FMTA 4JTAB 3SYQA 1JQ0A 2EZPA 4WFHA 1SZTA 1M90W 1OCOC 4JPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYO A;  1DF4 A;  4N21 A;  1Y4M A;  5CN0 A;  2EZO A;  4JGS A;  1QBZ A;  5HFM A;  1K33 A;  3P30 A;  4N23 A;  1DF5 A;  1F23 A;  3B8N A;  4FK5 C;  4JPR A;  1I5X A;  3K9A A;  4E2L A;  3M99 B;  3GWO A;  1K34 A;  5KA6 A;  2X7R B;  1QR8 A;  1I5Y A;  4JF3 A;  5H9C A;  3B77 A;  3CP1 A;  3MHH C;  2MK3 A;  2M7W A;  1Y66 A;  5KA5 A;  1MG1 A;  1QR9 A;  1JPX A;  1MOF A;  2OT5 A;  4FJC C;  4FIP C;  2P6J A;  2EBO A;  3WFV A;  5HFL A;  1ENV A;  5CMU A;  1JQ0 A;  2EZP A;  3MHS C;  1EBO A;  4G2K A;  1SZT A;  2LP7 A;  3H01 A;  1QCE A;  1DLB A;  3B8M A; 
#chains in the Genus database with same CATH topology
 3T1C A;  4X20 B;  1R6K A;  4MTF A;  2FKX A;  4KL1 A;  2ATK C;  3CC4 V;  2N05 A;  1F4M A;  4IIJ A;  1KKD A;  3KZI Z;  4WBN A;  5KA5 A;  3P3N A;  4HYO A;  2OWO A;  3UKM A;  4H0L B;  4W4L A;  2ZDI A;  2ZNI A;  2P7T C;  3U0Z A;  1PKX A;  3CE2 A;  3H1L H;  1GMG A;  3F5W C;  3A0B Z;  1TVK B;  3T1Y B;  1AR5 A;  1E1R G;  4ZHQ B;  3K0D A;  4E4E A;  3CCQ V;  1RFY A;  3UT5 B;  3OUF A;  4MT8 A;  3RBZ A;  1ZL8 A;  2DQ0 A;  5B5E Z;  2ADQ B;  1IUR A;  5JJN B;  2CK3 G;  3OMN B;  3M7M X;  5KAI Z;  3ZCC A;  4CC5 A;  3FB8 C;  4UVC A;  3OR6 C;  1ZX3 A;  4GUN A;  4PDR A;  3T1H B;  3LSU A;  1OV9 A;  3SYP A;  2PGG A;  4CBC A;  4OX9 B;  2WWW A;  2XTA A;  3S3X A;  2P6J A;  2BTQ B;  4B3R B;  5B3S B;  5LHG A;  2C2A A;  3EXA A;  3N2G A;  4LFA O;  4FLY A;  1VQ5 V;  3UQ8 A;  3W7W A;  1UPG A;  1SQG A;  5IJ0 A;  2UUB B;  1OCR C;  2Q0A A;  4DR3 O;  4BIU A;  2VQF B;  2MK3 A;  2L35 A;  1HW7 A;  2WLL A;  1MA1 A;  4UVB A;  1JJ2 U;  2BTO A;  2ARH A;  2GTA A;  3TGU H;  4J9Y B;  3OTF A;  1OCR B;  1Q6U A;  2DN9 A;  1BS3 A;  1N32 B;  4DW1 A;  3OFN G;  4LFA B;  5BMV A;  2OCH A;  1PV0 A;  5LMN B;  2P4V A;  2AHY A;  2KG7 B;  2Q5Z A;  4I7Z B;  2M6Y A;  1AP5 A;  3H1I H;  3BPZ A;  3W7S A;  1K34 A;  1COW G;  4JI3 B;  1YJW V;  5FPO A;  1QVG U;  1N34 O;  4QJF B;  2LGW A;  4IL6 Z;  5L3B A;  3LDD A;  4XDK A;  5EBW C;  1AIL A;  3TXQ A;  1NJI W;  2GUZ B;  1BMF G;  1FJG O;  2HR3 A;  2Q73 A;  3CEI A;  3BY6 A;  1WB7 A;  3IC9 A;  5IT9 N;  4FPP A;  1RP3 B;  4OXS A;  4EEQ A;  4EB6 A;  4DV1 B;  3QO8 A;  1FFX A;  5LGU A;  4FLU A;  2ITC C;  2H8P C;  1QLE C;  1W59 A;  3ZIA G;  4Z2W A;  4O4L B;  4DV0 O;  1K92 A;  3VQV A;  1IXM A;  1YJ9 V;  1GO3 F;  1QR8 A;  3JSL A;  3B77 A;  3CRA A;  4TV8 B;  2XAS A;  4HZ3 A;  4X62 O;  1F7Y A;  3CPW U;  4NB5 A;  3HKD A;  1BZK A;  2KQX A;  3I56 V;  3BEH A;  2XAJ A;  4JI5 B;  3F5T A;  1P49 A;  1BE3 H;  2P90 A;  3DSQ A;  3UT5 A;  4DV5 B;  1D5N A;  1FXK C;  2CH7 B;  4MVM A;  4IGG A;  3E8G A;  2IW5 A;  4ZHQ A;  1GM9 A;  2XND G;  5L3D A;  4CH5 A;  5CB4 B;  3LNM B;  2A7W A;  3CXC U;  2DYS C;  1YVW A;  3RW0 A;  2K1E A;  3NXS A;  1QVF U;  3AG3 B;  5CN0 A;  4I4T A;  1BHB A;  1QLN A;  1XIL A;  4UCT A;  2XHB A;  5LYJ A;  3QO7 A;  4UUJ C;  4AQY O;  2LJ2 A;  2QEX V;  2XAF A;  3JD2 A;  3W7X A;  5EC2 C;  4UB8 Z;  5B3S C;  3HKC A;  1K4D C;  4P30 A;  3K5M A;  3JAS B;  1HNZ B;  1EZJ A;  2Y48 A;  5KLV H;  4KP4 A;  2QTS A;  1NH2 B;  3AG2 C;  4UCV A;  4LF4 B;  3P30 A;  4UFZ A;  3CD6 V;  3NR7 A;  2JRI A;  3GWK C;  4ZBM A;  4MS2 A;  1VQ9 V;  1E79 G;  2CDY A;  3ETG A;  2BTQ A;  2DYR B;  5A9G A;  5H9C A;  2EJ7 A;  3CP1 A;  1QR9 A;  2B9Z A;  4RQE A;  5L3F A;  3T1H O;  1NR7 A;  5KUM A;  1YIJ V;  5J2U B;  2JJ1 G;  2HHH B;  2UUA O;  2HKO A;  4OPH A;  1GM7 A;  1FPO A;  3N27 A;  1XL6 A;  3E8B A;  4I5S A;  2Z5U A;  3P32 A;  5BZB A;  5LMU B;  1XMO O;  3ZMT A;  4DR3 B;  2WLI A;  3CCV V;  1ARO P;  2UU9 B;  4PDL A;  4TT3 G;  2F1M A;  1ORQ C;  4DR5 O;  2HP8 A;  3ZBH A;  2F43 G;  3HB3 B;  1DGS A;  3C90 A;  2LFS A;  5L3E A;  3X2Q C;  1YTF D;  4LF6 O;  4R6Z A;  1BT8 A;  3OTO B;  3ZS8 C;  1XMO B;  1IBM O;  3F7Y C;  4R50 A;  1SA0 B;  5KX5 A;  5LGN A;  1T5E A;  4I55 A;  3U10 A;  1ZLZ A;  2ZIO A;  5E1A C;  4DUY O;  2IU0 A;  4JI1 B;  3RGB A;  5IJ9 B;  1NS1 A;  1I94 O;  4DRX B;  1QU7 A;  1XNQ B;  3CJH A;  1RM1 C;  4GX5 A;  3Q4H A;  4FFB A;  3I55 V;  2QM8 A;  3SR2 C;  4YJ2 A;  1VQO V;  1NI8 A;  2QKS A;  1R3K C;  4O4H A;  4YIO A;  1KD1 W;  3K9A A;  3CYO A;  2EIK B;  4MVO A;  3AEI A;  1WLE A;  2UXX A;  5K1P A;  2X6C A;  2Q7E A;  3LDC A;  4MSW C;  1Q7Y W;  1BGY H;  1OCC B;  1JFF A;  1XL4 A;  5LA6 B;  4X64 O;  2PZS A;  4DK1 A;  5GON A;  4CH3 A;  2PI5 A;  4RUF A;  4H37 A;  4I50 A;  4FVM A;  1B06 A;  1EFR G;  3CC7 V;  2FB5 A;  3N2G B;  1AJN A;  4R7C A;  1K5Q A;  1YDX A;  2B5U A;  3ZHU A;  3M99 B;  5KAF Z;  3ZMZ A;  3K04 A;  3DGE A;  2HLD G;  1DK1 A;  3K03 A;  2PYJ A;  2EIK C;  2X0L A;  1NTK H;  1Q86 W;  5KHI A;  2OYQ A;  3UO2 A;  3AG2 B;  3C3S A;  5JH7 B;  2D3O W;  1L0N H;  2UXD B;  3T2M A;  3JAL A;  4I0X A;  1SER A;  4JV5 B;  4BAY A;  2NNU A;  4AQY B;  2EIN C;  3TXS A;  1B04 A;  3SYQ A;  1IXB A;  4LH7 A;  1KYO F;  3P3P A;  3E22 B;  1MSD A;  3ZHR A;  1ROP A;  3CJH B;  3F7V C;  4FLX A;  1OJH A;  3B2E E;  3FYI B;  2A9H A;  4O4J A;  1H2L A;  1Q8I A;  4DUZ B;  2W6I G;  4D7T A;  4GX0 A;  2QSA A;  4JI8 B;  1SA0 A;  4IIJ B;  1I7F A;  2GTS A;  2ITD C;  4UCO A;  2IJK A;  1X59 A;  1WJZ A;  2UU9 O;  1EN6 A;  5LP6 C;  2HFE C;  2EUL A;  4B08 A;  4IHJ A;  5CB4 A;  4JI8 O;  1P4R A;  3BAB A;  2DYR C;  1R3I C;  1YCI A;  3CB2 A;  3K5O A;  3RYF B;  4MW3 A;  1XDC A;  1SET A;  1S0V A;  4JTC B;  2VQF O;  4X89 A;  4QNH B;  4G27 B;  3OT7 A;  2EIJ C;  3DTU B;  4X1K A;  3SDL A;  4DV4 B;  5CA0 B;  4WFB V;  3BVO A;  3ABL C;  4FLW A;  4DR7 O;  5DM6 V;  5J2U A;  4OPA A;  4TV8 A;  4MVZ A;  3CCU V;  1TVK A;  1VMG A;  3WFV A;  2IH1 C;  4IHJ B;  1Y6X A;  1RPR A;  1OCZ B;  1FXK B;  2JGD A;  4BWA A;  3MD0 A;  1TUE B;  1KC8 W;  4XBF A;  3EVK A;  5C8Y A;  1XEQ A;  3L73 H;  4WFF A;  4J9Z B;  3J81 N;  4NTX A;  2NN4 A;  5LA6 A;  4NXM B;  3D8C A;  1QNM A;  3H9V A;  4LWS B;  3JCZ A;  2HVK C;  1JX9 A;  5JVD B;  2Y69 C;  3J7A U;  4DV1 O;  1Z5W A;  2W6J G;  4B3S B;  2UXC B;  3U11 A;  1Y4M A;  4I4T B;  1SS3 A;  5JJJ B;  4RAI A;  4OX9 O;  2AGA A;  4DW0 A;  3VQW A;  1YJN V;  4OGQ B;  3HPL C;  4ICG A;  2Y69 B;  3DC6 A;  1V54 C;  1R1B A;  1XBL A;  3BRC A;  3IFX A;  1BQ0 A;  3AG3 C;  5L3G A;  4I9W A;  1S5L Z;  4P9O A;  1GK9 A;  1M1K W;  3RVZ A;  3RWR D;  3K59 A;  4ZOL A;  4ZKI A;  1NU1 H;  3HKB B;  3RN4 A;  3ABM B;  4J10 A;  4CH4 A;  1SQQ H;  1GTO A;  3RYI A;  4A5U B;  2P06 A;  1ZWI C;  1YI2 V;  3GWO A;  5BR8 O;  5C93 A;  1N32 O;  2UXD O;  1FYJ A;  4MTO A;  3CCL V;  1AP6 A;  2KKW A;  1AR4 A;  4U3J A;  4MVS A;  1PNK A;  5DN6 G;  2ZDI C;  5IYC O;  1QCE A;  1XQ8 A;  3AG1 C;  1KP3 A;  3HKE B;  3RT3 C;  3LSQ A;  4O4I A;  3ZHV A;  2UXB O;  2WLI B;  2V4D A;  3L70 H;  3OGI B;  3OUS A;  5JWP A;  4NXN B;  4FJC C;  3KKY A;  3IJ4 A;  3D3Q A;  1FJG B;  5CA0 A;  1KUQ A;  4Q20 A;  5GTH Z;  1K73 W;  1K97 A;  3K08 A;  2Q68 A;  4JYC A;  4FK5 C;  1PP9 H;  4TV9 B;  5LOV B;  3SPC A;  4IT5 A;  1I08 A;  5B1A C;  1K9M W;  2A0L A;  4GKK O;  5FLX N;  3CCJ V;  1QHT A;  4D6T H;  2QWN B;  3CXH F;  1ZTE A;  4TWK A;  1S76 D;  5EC1 C;  2GHY A;  4MTG A;  2N04 A;  3OMI B;  1HR0 B;  1RSO B;  5B1N A;  1SRY A;  2WLL B;  5IYB O;  1J5E O;  4GKJ B;  2RJZ A;  2WLH A;  5IJ0 B;  3QF7 A;  1DLB A;  3AK2 A;  4DYL A;  1SZX A;  4X1Y A;  2AHZ A;  2LW1 A;  3SPG A;  4CC6 A;  5EIB C;  2O57 A;  4DV4 O;  1X4T A;  4EFE A;  4DO2 A;  3WB2 A;  2QJ1 A;  2XAH A;  1SQV H;  4O2B B;  3G71 V;  1MAB G;  3A2F A;  2X6A A;  1M5I A;  5LBQ A;  4PDM A;  4TV9 A;  1HWY A;  4X8A A;  5DED A;  3UO3 A;  1TUB B;  2AZ0 A;  1MZE A;  1A32 A;  2XOK G;  2YXY A;  4PA6 A;  4TSF G;  5FNV A;  4Z1M G;  1QLE B;  3QTC A;  4L87 A;  1V9P A;  3B8N A;  1ZL8 B;  1TUB A;  3ZRX A;  4Z1V A;  4ZI7 B;  5D5P A;  1WP8 A;  2ZE5 A;  1PD3 A;  4W4K A;  3R66 A;  1MSW D;  1MMM A;  2F95 B;  3FAV B;  1OZ0 A;  3HKE A;  2ZE7 A;  1HNX B;  1Y76 B;  4FZ0 A;  4NTW A;  4WF9 V;  4X1I B;  3LUT B;  4YIP A;  2PI4 A;  3T1Y O;  2P67 A;  3TCU A;  4H44 B;  3FFQ A;  3RFR A;  3SYA A;  2H94 A;  1U97 A;  3ZHQ A;  5IWA B;  4LFB B;  2KSD A;  4B3M O;  3RYH A;  5LHI A;  5LHH A;  3KCY A;  2ZE6 A;  1URF A;  1FD9 A;  2Q9L A;  4O4J B;  1FAF A;  3AK3 A;  2DYS B;  3CRQ A;  1K4C C;  2FYU H;  2HJF C;  4GX1 A;  1NTM H;  4ZIB A;  5IWA O;  3FYE B;  2RDC A;  1JR9 A;  2YEV B;  2E74 B;  3FKS G;  2EJR A;  3OM3 B;  1V54 B;  2UUC B;  4KHP B;  4JAU A;  1NZ6 A;  4U7O A;  4J80 A;  3STZ C;  1M93 A;  1XOU A;  2H3O A;  1H8E G;  3OTO O;  5LOV A;  1PPJ H;  1VQM V;  3EFF K;  4B3T O;  3ML0 A;  1QBZ A;  1NVP D;  1LNQ A;  2A3Q A;  4FM2 A;  4J7J A;  1P84 F;  1I5X A;  4I55 B;  4GLX A;  2YI8 A;  4DR1 O;  4UV9 A;  5KX5 B;  2QM4 A;  2ETN A;  4UB6 Z;  5LP6 B;  1I94 B;  2ZM6 O;  3MHS C;  4DXW A;  2HG5 C;  4DV3 O;  1VIB A;  4NVP A;  5KMG A;  4DR4 B;  2WLM A;  1Q81 W;  1Y76 A;  3A0R A;  5CBF A;  1G6U A;  2ILM A;  4I50 B;  2QWO B;  2B1I A;  1GN2 A;  2QKA A;  1O9H A;  4QPJ A;  1JOY A;  4DV3 B;  1NVP B;  4MTX A;  4DV7 B;  2WAM A;  1EN4 A;  1HR0 O;  4EKW A;  2QWP B;  4GKK B;  1MZF A;  3ZRS A;  2Z3Y A;  5FNV B;  3L72 H;  3BAA A;  4LP8 A;  4U7N A;  1Q82 W;  1L0L H;  3ETE A;  2ZXW B;  3G4S V;  3OW2 U;  1YF2 A;  1VQ7 V;  1NKD A;  2Q8V A;  2RCV A;  4RUE A;  4UCS A;  4FMT A;  1LR1 A;  1JQ0 A;  2QDO A;  4GKJ O;  3H1H H;  2CE4 A;  3FB5 C;  3ABL B;  1JJO A;  5IJ9 A;  2QM7 A;  1WA8 A;  3JD0 A;  5BMV B;  1K5S A;  2Z0A A;  1VQ8 V;  3SJC C;  4PEL A;  1Y67 A;  3CRM A;  4LWS A;  3E86 A;  2BSK B;  2Q67 A;  2ZIN A;  4LF8 O;  5LYJ B;  5EZY B;  4DR7 B;  2JK5 C;  1AB3 A;  4B7E A;  1G8M A;  1N8R W;  4LF5 B;  5GTI Z;  3WB0 A;  3ZRV A;  4PI0 A;  4JI2 B;  3ZRW B;  1K7D A;  3B09 A;  3IC7 A;  5A2Q N;  2E76 B;  5KUK A;  1JPX A;  2JJ2 G;  4LFB O;  4YY3 B;  4B3R O;  1AVM A;  4TQF A;  4K0K O;  4DV6 B;  1H2K A;  4JI2 O;  4AIL C;  2YIC A;  2YXH A;  3JD3 A;  3ZMU A;  4FM0 A;  2XT9 A;  4JI6 O;  5EK0 A;  2R9R B;  2Y0P A;  4P2Z A;  4B3S O;  1IZ3 A;  4YJ3 B;  5GW7 A;  4F4L A;  3LDE A;  1R3J C;  3DXR B;  3K9S A;  2NR5 A;  3QNE A;  5CA1 B;  1FXH A;  2QR4 A;  3ZHS A;  4QIW F;  3TJT A;  1VQ4 V;  3W7T A;  3JCU Z;  3ZRW A;  4N21 A;  2OTJ V;  1CPY A;  3JAS A;  3LSS A;  3BHP A;  2XAG A;  1GN3 A;  5LP6 A;  2P4K A;  4K3A A;  4PDV A;  2Y4U A;  1VF7 A;  2ZR2 A;  4LF7 B;  1RM1 B;  4RQF A;  5JJE B;  5BY1 A;  2OTL V;  2GUZ A;  2OCC C;  1YIT V;  3R65 A;  2EZO A;  5B1A B;  5IYZ B;  4F6R B;  2Q4P A;  3BA8 A;  3D36 A;  1S3J A;  1VQL V;  2AXT Z;  3JAM N;  3QVN A;  3JAT B;  2L6L A;  5CA3 A;  3K5N A;  1M9N A;  2CTW A;  1ENV A;  2CH7 A;  1VF5 B;  2ZM6 B;  2A06 H;  2VWJ A;  5J2T A;  2HJD A;  2RMK B;  1Y74 B;  2ADP A;  4NXN O;  3CCM V;  3E8H A;  3CWB H;  1K33 A;  5JH7 A;  4NXM O;  3G67 A;  1LUV A;  3VBB A;  4DR6 B;  2OIE A;  4JTD B;  4JI0 B;  1JVM A;  1LUW A;  2CGN A;  2CTP A;  2UXC O;  2OCC B;  3CCR V;  4AHC A;  5HFL A;  4CS4 A;  1BCC H;  3CC2 V;  4PA4 A;  2F4V B;  2G38 A;  1IBK B;  3QG5 A;  5EYP B;  5EYP A;  3UM7 A;  5B1B C;  1XUQ A;  4JAV A;  1W0K G;  4JYB A;  4LF9 B;  2PF4 E;  2GSM B;  4K8X A;  4H13 B;  3RYC B;  4DV5 O;  1UJW B;  3C3T A;  4EFB A;  1JFF B;  4PA3 A;  4LCU C;  4G2K A;  3ABM C;  1G4Y B;  3H01 A;  2CTQ A;  3ETQ A;  1J5E B;  4DV0 B;  3FX7 A;  3IGA C;  1B3Q A;  1W2B U;  1Q6I A;  4N23 A;  1Y74 A;  1M57 C;  3N2K A;  5B66 Z;  3HKB A;  3RYF A;  1VF6 C;  4O2B A;  4X62 B;  3ICX A;  4FFK A;  2PY5 A;  2YS8 A;  4J7Z A;  3MDS A;  2YXL A;  2E5L O;  1R6T A;  1F51 A;  5LL6 Y;  1V55 B;  4WCE V;  2KG7 A;  5IYZ A;  2WA3 A;  1HNZ O;  2OIG A;  4PI2 A;  4J11 A;  4XDJ A;  1DF5 A;  2YIB D;  2BOC C;  3VQY A;  2R72 A;  5EZY A;  3HKC B;  3EHB B;  3JD4 A;  1Y66 A;  1GH6 A;  3APO A;  3SJA C;  1RSO A;  2Q6A A;  2ZD9 A;  1NT2 B;  3H1K H;  3K06 A;  4KFM A;  4BW9 A;  3QO5 A;  5FPR A;  1WP7 A;  4K0K B;  1GKF A;  1L8D A;  2AW9 A;  2JVD A;  2GDS A;  2VS0 A;  1N33 O;  4JI6 B;  4PD4 F;  5JQG B;  5E79 Z;  3G80 A;  3MHH C;  5CA1 A;  4I0X B;  1VQP V;  1H2G A;  5IE9 A;  1EM1 A;  2EIM B;  1VP7 A;  2IM9 A;  4ZI7 A;  2JEX A;  3N2K B;  4O2A A;  3CME V;  2XUM A;  1R6N A;  1AI5 A;  3K79 A;  3OE7 G;  2QE7 G;  2JDI G;  3WG7 C;  1Q90 D;  5J9P C;  4O2A B;  3OD4 A;  2ZCE A;  4YHH O;  5KHJ A;  2UUB O;  5LXT B;  2F93 B;  3RYC A;  1WPX A;  1S77 D;  3CHX A;  4PA9 A;  5JQG A;  3VQX A;  3HR0 A;  1P7G A;  2ZXW C;  1SKV A;  2YID A;  3B40 A;  2LP7 A;  3L71 H;  2CGO A;  3RVY A;  4GZR B;  2UUC O;  1M57 B;  5KMG B;  1M56 B;  2Q0O C;  4BIZ A;  4YHH B;  2FL4 A;  5LMU O;  3THO A;  3ABU A;  1CXZ B;  4U3J B;  1AJP A;  1HDJ A;  3SYC A;  2BSK A;  2DE0 X;  2DMX A;  5JCO C;  4FLZ A;  2JS3 A;  5KHK A;  2DW4 A;  3I5D A;  4C7U A;  3ASN C;  1S72 V;  4KUM A;  2JS5 A;  1WA8 B;  4LF6 B;  2YDE A;  3JAK B;  3ASO C;  5L3C A;  2VWK A;  3JD1 A;  3TET A;  5IY5 C;  1AJQ A;  3CCE V;  4TUY A;  2IH3 C;  1MG1 A;  1SQB H;  2YIA A;  4JI0 O;  2XAQ A;  1KKC A;  5H6R A;  4GCZ A;  2JIZ G;  3AG7 A;  4WFA V;  3WU2 Z;  2IJJ A;  1E1Q G;  2WSS G;  1N36 B;  3UCS C;  2ZQM A;  1UFI A;  2QWR B;  5H2F Z;  1F4N A;  2LGQ A;  3CCS V;  1I5Y A;  1Q6H A;  3S3W A;  2EIM C;  2EIN B;  5EBL C;  3ZMV A;  1VQ6 V;  1SQP H;  1EZV H;  2Q69 A;  1R73 A;  4JAA A;  1KU9 A;  1V55 C;  4RWU A;  3WG7 B;  1SQF A;  3ABT A;  4JI5 O;  2RN9 A;  2JGD B;  1S5H C;  3ZJZ A;  1FXK A;  4X9Q A;  4E2L A;  1KBH A;  4CS3 A;  5IDJ A;  3DXR A;  3O9O A;  4IYH A;  2E3C A;  2WLK A;  1AI4 A;  2LFR A;  4DV2 O;  4JI4 O;  1R3L C;  2DWE C;  1SC5 B;  3SPI A;  2N74 A;  3CRR A;  1KB9 F;  4P9P A;  3T4D A;  2EX3 A;  4FM1 A;  3D36 C;  5BR8 B;  1M56 C;  3ZX6 A;  2YUA A;  3KG2 A;  4JGS A;  4D7S A;  1GN4 A;  2NLJ C;  3RYI B;  1H2N A;  2BCC H;  2UXB B;  4WFG A;  1D5A A;  1N4C A;  4ZOL B;  2V7Q G;  3JSN A;  1IDS A;  2AZ2 A;  3GVM A;  4LF4 O;  4X88 A;  3JAT A;  4YJ2 B;  4DR4 O;  3E2E A;  1MOF A;  2GBO A;  2D2C B;  4K8Z A;  1HNW O;  1M90 W;  4JPR A;  4LH6 A;  4QPK A;  4PV1 B;  4X1Y B;  3PJS K;  1SQX H;  4YY3 O;  3E89 A;  3FB6 C;  4DV7 O;  5JVD A;  4X65 B;  5B1B B;  1VAR A;  3PN1 A;  5IYD O;  2Q7H A;  3CS5 A;  2OT5 A;  3SJB C;  4I9Q A;  1YTF B;  3VOU A;  2ZIM A;  1TAE A;  3J80 N;  3L74 H;  1Q3E A;  3ZN0 A;  4MVR A;  5ITZ B;  3K0G A;  3IAY A;  1WB8 A;  2A79 B;  1NR1 A;  1KP2 A;  1ZAU A;  1WAZ A;  2PUS A;  3FAV A;  2BE3 A;  2DWD C;  2ZR3 A;  3BCC H;  1O9G A;  1TGO A;  2DQ3 A;  3WB1 A;  3CSX A;  4G28 B;  4DR5 B;  3JYC A;  4X1K B;  4UCU A;  3ZED A;  3E35 A;  5DEC A;  4BR6 A;  2YIB A;  1EN5 A;  1M4U A;  4JI1 O;  1NBM G;  4LR3 A;  4LF5 O;  3OMA B;  2QA4 V;  3K3W A;  1XNR B;  3CX5 F;  2HVJ C;  2QGN A;  2RQ6 A;  3CRC A;  2PYL A;  1N34 B;  1QQC A;  2KB1 A;  4LFC O;  4XDL A;  2IBZ H;  2B1G A;  4DV6 O;  1CEZ A;  1H38 A;  5K1X A;  1XRE A;  4DR6 O;  2IJI A;  5BXZ A;  2Q7G A;  3E8F A;  3K5L A;  3OGC C;  3B4S A;  1I0H A;  1MNG A;  1IBK O;  2YC0 A;  3AG4 C;  1SF9 A;  4MW8 A;  1VEW A;  3DC5 A;  2CTR A;  2Y0I A;  1HNX O;  2YI9 A;  3G6B A;  1S5J A;  2YEV A;  3ZHT A;  5H5N A;  1WNS A;  3Q4H B;  4FFB B;  4CS2 A;  3X2Q B;  3APQ A;  3B8M A;  4HNA B;  4DRX A;  3JAK A;  4DV2 B;  3JAR B;  4B3M B;  5FL7 G;  4LF7 O;  2ZKO A;  1FXV A;  4LNU B;  2VQE O;  3ABK C;  4KHP O;  2QTO A;  2X6B A;  3HKD B;  1VF6 A;  1WPB A;  5LMN O;  5CBG A;  1PL0 A;  3H1J H;  3AG1 B;  5C8Y B;  4DK0 A;  1AI6 A;  2P22 C;  3ABK B;  3ZMS A;  4BIO A;  4JV5 O;  4X1I A;  3SPJ A;  1B6Q A;  1HNW B;  1L1F A;  3L75 H;  4DR2 B;  4QE7 A;  3E83 A;  3OEE G;  4DR1 B;  2VQE B;  1IVS A;  1Q43 A;  2VRZ A;  1VQK V;  5KA6 A;  1XI1 A;  3CMA V;  1GAX A;  4NYK A;  4HAM A;  4JI7 B;  4JAS A;  4EB6 B;  4FIP C;  1GN6 A;  1IBL B;  1EBO A;  2EIL C;  1CP9 A;  2WLJ A;  1Z2G A;  1DF4 A;  1D2D A;  3TK1 A;  2Y4T A;  3JAR A;  5KHG A;  1RPO A;  4O4H B;  4R8C A;  3OR7 C;  3MAQ A;  1JA8 A;  4Q6G A;  4JI7 O;  3W7U A;  2F4V O;  4DUZ O;  1KQS U;  4B7K A;  1IBL O;  4TUY B;  1XHX A;  5LGT A;  3BFR A;  5CMU A;  1XMQ O;  1YZB A;  4LF9 O;  1N33 B;  5IY5 B;  4U3F H;  4GYC B;  2P5O A;  4JYA B;  1Z5V A;  2LO1 A;  5ITZ A;  1YSC A;  1YEW A;  2V1D A;  4LBE C;  2IJH A;  4MVQ A;  3FB7 C;  4J42 A;  2FTK A;  3JAW A;  1H8H G;  2ZT9 B;  3KCX A;  3SYO A;  3L9D A;  2X7R B;  2UUA B;  4WBN B;  5H6Q A;  1AR1 B;  4X66 O;  2BOB C;  1NH2 D;  4NTY A;  4PJ0 Z;  4GX2 A;  4GT1 A;  1GRJ A;  1PL4 A;  4FZ1 A;  1KEC A;  1XNR O;  2MW2 B;  1OCC C;  5D5Q A;  1H2S B;  2F23 A;  2YSU B;  2QWQ B;  4F6E A;  2E5L B;  1HP8 A;  4LF8 B;  4UCR A;  3OEH G;  1JCH A;  3BA9 A;  4PA7 A;  3A8T A;  4UXN A;  3JAL B;  1IBM B;  4NKG B;  3ETD A;  4LFC B;  5KHH A;  3K57 A;  4QGP A;  1OCO B;  4K35 A;  4J7K A;  2R9I A;  1U96 A;  1N0N A;  1YHQ V;  2JEU A;  4DUY B;  2LQT A;  2QKC A;  1XNQ O;  1ZSP A;  3FD9 A;  2EIL B;  2EBO A;  4L8J A;  1AI7 A;  4O4I B;  1WN7 A;  2WA4 A;  4NR1 A;  4WFE A;  1BL8 A;  1NTZ H;  3M8A A;  4J41 A;  3K58 A;  2DOS A;  2R9A A;  4JYY A;  4JZG A;  4TOI A;  4QE9 A;  4TQD A;  1GM8 A;  1BHA A;  1SES A;  2UXN A;  1H2M A;  3SPH A;  1THZ A;  3O65 A;  1K3E A;  5GON B;  1FFX B;  2FML A;  5AG2 A;  2HHH O;  3D3I A;  2RNB A;  1IX9 A;  1J95 A;  4KXR A;  2DJV A;  3LNN A;  4ABM A;  1BSM A;  3JAW B;  2K9P A;  3OAA G;  4X64 B;  5B1O A;  5TIS Z;  3SJQ C;  4JZ2 A;  1FS0 G;  4X20 A;  5HFM A;  4MVU A;  1F23 A;  2WLN A;  3T4Z A;  3E22 A;  1DTO A;  1YXB A;  2ZE8 A;  3AG4 B;  2R70 A;  1OCZ C;  4JF3 A;  2WPD G;  1P7B A;  1FKA O;  2ZNJ A;  1N0J A;  5EBM C;  5EIB D;  4UVA A;  1TA8 A;  4F6R A;  4JI4 B;  4ASU G;  4FLT A;  1KMI Z;  2CAZ C;  4DR2 O;  4IYI A;  2M7W A;  4PHZ A;  4JI3 O;  3RYH B;  1ZUQ A;  1JMK C;  1PM9 A;  3ASN B;  4YXW G;  2W0F C;  4B3T B;  4UV8 A;  2EIJ B;  4FLV A;  1OHH G;  5JCO A;  2W0X A;  4O4L A;  3ASO B;  4LC1 A;  1XMQ B;  1Q5O A;  4RO2 A;  4JYA O;  1G1X B;  2CUG A;  2IU3 A;  2ODM A;  3AK1 A;  3SGI A;  4CZZ A;  5LXT A;  4H33 A;  1XHZ A;  4YJ3 A;  4LNU A;  3STL C;  3ZN1 A;  4X65 O;  1BQZ A;  1N36 O;  2PTM A;  5CBH A;  3G6E V;  1K8A W;  1FFT B;  4X66 B;  4BW5 A;  4HNA A;  1PNL A;  5J2T B;  1W0J G;  2JGU A;  4CH6 A;  3A0H Z;  2E75 B;  2HEP A;  1US6 A;  1NQT A;  3GB7 C;  1PNM A;  1VQN V;  4HBN A;  2F66 C;  4JTA B;  2EZP A;  4WFH A;  4AI8 A;  2GV9 A;  1SZT A;  1OCO C;  5F2V O;  2LW7 A; 
#chains in the Genus database with same CATH homology
 3FB5 C;  4QPK A;  1ROP A;  3ABL B;  3T1C A;  1R6K A;  3PJS K;  3F7V C;  2QM7 A;  3JD0 A;  4MTF A;  1K5S A;  3FYI B;  1VQ8 V;  2A9H A;  2ATK C;  3E89 A;  3CC4 V;  3FB6 C;  4PEL A;  1F4M A;  5B1B B;  5IYD O;  1KKD A;  3E86 A;  2W6I G;  5KA5 A;  2OT5 A;  4GX0 A;  2Q67 A;  1YTF B;  3VOU A;  4HYO A;  2ITD C;  2JK5 C;  1G8M A;  3UKM A;  2IJK A;  2ZDI A;  1N8R W;  3ZN0 A;  2P7T C;  4MVR A;  3K0G A;  3ZRV A;  2A79 B;  2HFE C;  3ZRW B;  1K7D A;  1NR1 A;  1KP2 A;  1PKX A;  1GMG A;  3F5W C;  3IC7 A;  2DWD C;  1P4R A;  2DYR C;  1E1R G;  1JPX A;  1R3I C;  2ZR3 A;  5KUK A;  2JJ2 G;  3K0D A;  3CCQ V;  4MW3 A;  2DQ3 A;  3OUF A;  1SET A;  4MT8 A;  1S0V A;  4JTC B;  3RBZ A;  2DQ0 A;  4X89 A;  4QNH B;  4G27 B;  4G28 B;  2EIJ C;  3DTU B;  3JYC A;  2CK3 G;  3OMN B;  3JD3 A;  3ZMU A;  3ZCC A;  4WFB V;  3FB8 C;  3E35 A;  5EK0 A;  2R9R B;  3ABL C;  4UVC A;  4P2Z A;  3OR6 C;  5DM6 V;  5GW7 A;  1NBM G;  4F4L A;  4PDR A;  3LDE A;  1R3J C;  3CCU V;  4MVZ A;  3SYP A;  4CBC A;  3OMA B;  2QA4 V;  2WWW A;  3QNE A;  2P6J A;  3WFV A;  1FXH A;  2IH1 C;  3K3W A;  5B3S B;  1RPR A;  2HVJ C;  1OCZ B;  5LHG A;  2C2A A;  1FXK B;  4QIW F;  1VQ4 V;  3W7T A;  3MD0 A;  3ZRW A;  4N21 A;  1TUE B;  1KC8 W;  2OTJ V;  1VQ5 V;  1CPY A;  4XBF A;  3W7W A;  3LSS A;  4WFF A;  2KB1 A;  1OCR C;  2XAG A;  4J9Z B;  4XDL A;  4BIU A;  2B1G A;  2MK3 A;  1CEZ A;  4PDV A;  2WLL A;  1H38 A;  2ZR2 A;  4UVB A;  1JJ2 U;  3JCZ A;  1RM1 B;  4RQF A;  2HVK C;  1JX9 A;  4J9Y B;  2IJI A;  1OCR B;  2OTL V;  2Y69 C;  2OCC C;  3OFN G;  1YIT V;  3E8F A;  2W6J G;  1Y4M A;  3R65 A;  3OGC C;  2EZO A;  5B1A B;  2AHY A;  4RAI A;  1YJN V;  3AG4 C;  3HPL C;  4MW8 A;  3W7S A;  1K34 A;  3D36 A;  1S3J A;  2Y69 B;  1VQL V;  1V54 C;  3IFX A;  3AG3 C;  5L3G A;  4I9W A;  4P9O A;  5CA3 A;  1COW G;  1GK9 A;  1M1K W;  1M9N A;  2YEV A;  1ENV A;  3RVZ A;  1YJW V;  3X2Q B;  4ZKI A;  1QVG U;  4QJF B;  3ABM B;  3B8M A;  5L3B A;  1GTO A;  3CCM V;  3LDD A;  3E8H A;  4XDK A;  5EBW C;  1K33 A;  1NJI W;  1ZWI C;  1BMF G;  5FL7 G;  3VBB A;  1YI2 V;  2HR3 A;  4JTD B;  3GWO A;  1FXV A;  3BY6 A;  5C93 A;  3ABK C;  1JVM A;  2QTO A;  2X6B A;  4FPP A;  4OXS A;  4MTO A;  3CCL V;  2OCC B;  3QO8 A;  3CCR V;  4MVS A;  5HFL A;  5LGU A;  5CBG A;  1PNK A;  1PL0 A;  3AG1 B;  5DN6 G;  2ZDI C;  5IYC O;  2ITC C;  3CC2 V;  2H8P C;  1QLE C;  3AG1 C;  1QCE A;  1AI6 A;  4PA4 A;  3ZIA G;  3ZMS A;  3ABK B;  1KP3 A;  3SPJ A;  1B6Q A;  3UM7 A;  5B1B C;  4JAV A;  1W0K G;  4JYB A;  1L1F A;  4QE7 A;  3E83 A;  3OEE G;  1K92 A;  3LSQ A;  2GSM B;  1VQK V;  5KA6 A;  3CMA V;  1IXM A;  1YJ9 V;  1GO3 F;  2WLI B;  1QR8 A;  1UJW B;  3B77 A;  2XAS A;  4HAM A;  3OUS A;  4HZ3 A;  4JAS A;  3CPW U;  4FJC C;  4FIP C;  4PA3 A;  4LCU C;  1EBO A;  2EIL C;  1CP9 A;  4G2K A;  3ABM C;  3I56 V;  3BEH A;  1G4Y B;  2XAJ A;  3H01 A;  2WLJ A;  4Q20 A;  1K73 W;  1DF4 A;  1K97 A;  3TK1 A;  3IGA C;  3K08 A;  2Q68 A;  1W2B U;  1RPO A;  4JYC A;  4N23 A;  4FK5 C;  1M57 C;  2P90 A;  4R8C A;  3OR7 C;  1FXK C;  4MVM A;  3E8G A;  3SPC A;  2IW5 A;  3W7U A;  1GM9 A;  2XND G;  5L3D A;  5B1A C;  1K9M W;  1KQS U;  2A0L A;  5LGT A;  3LNM B;  5CMU A;  3CXC U;  3CCJ V;  2DYS C;  5IY5 B;  3RW0 A;  1F51 A;  2K1E A;  3NXS A;  1QVF U;  1V55 B;  1YSC A;  3AG3 B;  4WCE V;  5CN0 A;  2V1D A;  4LBE C;  4TWK A;  2IJH A;  1S76 D;  4MVQ A;  4XDJ A;  1BHB A;  1QLN A;  1DF5 A;  5EC1 C;  2GHY A;  3FB7 C;  4MTG A;  2BOC C;  3OMI B;  2FTK A;  1H8H G;  3EHB B;  3QO7 A;  3SYO A;  4UUJ C;  5B1N A;  2X7R B;  1SRY A;  3JD4 A;  2QEX V;  5H6Q A;  2WLL B;  2XAF A;  5IYB O;  1Y66 A;  1AR1 B;  3JD2 A;  3W7X A;  2BOB C;  2Q6A A;  5EC2 C;  5B3S C;  1K4D C;  2ZD9 A;  1NH2 D;  4P30 A;  2WLH A;  1DLB A;  3K06 A;  4GT1 A;  1EZJ A;  2Y48 A;  4GX2 A;  4KP4 A;  4KFM A;  3QO5 A;  1NH2 B;  3AG2 C;  2AHZ A;  1GKF A;  1KEC A;  3P30 A;  3SPG A;  3CD6 V;  1OCC C;  4ZBM A;  4MS2 A;  1VQ9 V;  1E79 G;  2YSU B;  3ETG A;  2DYR B;  4DO2 A;  5H9C A;  3CP1 A;  3MHH C;  2XAH A;  3OEH G;  1JCH A;  1QR9 A;  1VQP V;  1H2G A;  4PA7 A;  5L3F A;  4RQE A;  2EIM B;  4UXN A;  3G71 V;  1MAB G;  1NR7 A;  2X6A A;  5KUM A;  1YIJ V;  5LBQ A;  4PDM A;  1HWY A;  3ETD A;  4X8A A;  2JEX A;  3CME V;  2JJ1 G;  1OCO B;  1R6N A;  4PA6 A;  2XOK G;  4TSF G;  4Z1M G;  1AI5 A;  1QLE B;  3K79 A;  2QE7 G;  3OE7 G;  2R9I A;  2JDI G;  3WG7 C;  2HKO A;  4L87 A;  1GM7 A;  1YHQ V;  3B8N A;  2JEU A;  5J9P C;  3ZRX A;  1XL6 A;  3E8B A;  4I5S A;  2Z5U A;  3P32 A;  5BZB A;  3ZMT A;  1PD3 A;  2WLI A;  3CCV V;  1ARO P;  2EIL B;  2EBO A;  1MSW D;  1WPX A;  1AI7 A;  1S77 D;  4PA9 A;  4PDL A;  4WFE A;  1BL8 A;  4TT3 G;  2ZXW C;  1ORQ C;  1OZ0 A;  2LP7 A;  4QE9 A;  3RVY A;  2F43 G;  3HB3 B;  4WF9 V;  2LFS A;  1GM8 A;  5L3E A;  1M57 B;  3LUT B;  1SES A;  1BHA A;  3X2Q C;  2PI4 A;  1YTF D;  1M56 B;  2P67 A;  3TCU A;  4R6Z A;  2UXN A;  3SYA A;  4BIZ A;  2H94 A;  3SPH A;  1THZ A;  3ABU A;  1K3E A;  3F7Y C;  1AJP A;  4R50 A;  5LHI A;  3SYC A;  5LHH A;  3D3I A;  5LGN A;  1J95 A;  2DW4 A;  3ASN C;  5E1A C;  3OAA G;  1S72 V;  2DYS B;  4KUM A;  5B1O A;  2IU0 A;  3SJQ C;  1FS0 G;  1K4C C;  2HJF C;  3ASO C;  5HFM A;  4GX1 A;  4MVU A;  5L3C A;  1F23 A;  2WLN A;  3JD1 A;  1RM1 C;  4GX5 A;  3T4Z A;  3FYE B;  3I55 V;  3TET A;  2QM8 A;  1DTO A;  5IY5 C;  2YEV B;  1AJQ A;  3AG4 B;  3FKS G;  1OCZ C;  4JF3 A;  3CCE V;  2EJR A;  2WPD G;  1P7B A;  3OM3 B;  2IH3 C;  1V54 B;  1MG1 A;  1VQO V;  4JAU A;  4U7O A;  5EBM C;  2XAQ A;  2QKS A;  3STZ C;  4UVA A;  1R3K C;  5H6R A;  1H8E G;  4GCZ A;  2JIZ G;  1KD1 W;  3K9A A;  3CYO A;  1VQM V;  3EFF K;  4WFA V;  2EIK B;  4MVO A;  3ML0 A;  4ASU G;  1QBZ A;  2IJJ A;  3AEI A;  1NVP D;  1LNQ A;  1WLE A;  1E1Q G;  2UXX A;  2WSS G;  2X6C A;  3LDC A;  2ZQM A;  1I5X A;  4MSW C;  1F4N A;  4UV9 A;  1Q7Y W;  3CCS V;  1OCC B;  1I5Y A;  1XL4 A;  2EIM C;  2EIN B;  2M7W A;  5EBL C;  3ZMV A;  1VQ6 V;  2PI5 A;  4RUF A;  3ASN B;  4H37 A;  3MHS C;  2Q69 A;  4YXW G;  4DXW A;  1R73 A;  2HG5 C;  2W0F C;  4UV8 A;  2EIJ B;  1OHH G;  1V55 C;  3WG7 B;  2WLM A;  1EFR G;  3CC7 V;  1Q81 W;  3ASO B;  3ABT A;  3A0R A;  4LC1 A;  1AJN A;  4R7C A;  1S5H C;  1K5Q A;  1FXK A;  3ZJZ A;  5CBF A;  2B5U A;  4RO2 A;  4E2L A;  3M99 B;  2B1I A;  3K04 A;  3ZMZ A;  5IDJ A;  3DGE A;  2HLD G;  2IU3 A;  4CZZ A;  2WLK A;  3K03 A;  1AI4 A;  2LFR A;  4H33 A;  1R3L C;  4QPJ A;  1JOY A;  2DWE C;  2EIK C;  1NVP B;  2X0L A;  4MTX A;  3SPI A;  2WAM A;  3STL C;  3ZN1 A;  1Q86 W;  4EKW A;  5CBH A;  3G6E V;  3ZRS A;  1K8A W;  4P9P A;  3T4D A;  3AG2 B;  1FFT B;  1M56 C;  2Z3Y A;  4JGS A;  3KG2 A;  2D3O W;  4BW5 A;  2NLJ C;  3T2M A;  4LP8 A;  1PNL A;  4U7N A;  1W0J G;  4WFG A;  1Q82 W;  3ETE A;  2ZXW B;  3G4S V;  2V7Q G;  3OW2 U;  1VQ7 V;  1NKD A;  1SER A;  3GB7 C;  1NQT A;  4X88 A;  4RUE A;  2NNU A;  4BAY A;  3E2E A;  1MOF A;  2EIN C;  1PNM A;  1VQN V;  4FMT A;  4JTA B;  3SYQ A;  1JQ0 A;  2EZP A;  4WFH A;  1SZT A;  1M90 W;  1OCO C;  4JPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...