3CPWE

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cpwE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cpwE01
1KC8G 4WF9E 3CMAE 4IOCE 4WFAE 3CCEE 1S72E 3DLLE 1M1KG 3CD6E 3G71E 1YJWE 1N8RG 1VQKE 4WCEE 1VQPE 1K9MG 1KD1G 1JJ2E 3CCME 3CCRE 5DM6E 1YJ9E 5HL7E 3G6EE 3I56E 5MLCH 5GAGG 3CC4E 1QVGE 3CCVE 3J7ZG 3CCSE 3CC2E 1YHQE 1VQOE 3OW2E 3CCUE 1W2BE 1VQ8E 3CPWE 2ZJQE 1VQNE 4WFBE 3CXCE 5AN9B 2OTJE 1Q82G 3CCLE 1YIJE 3PIPE 1RL6A 4WFNE 5DM7E 4U67E 5GAEG 1Q86G 1VQ7E 3G4SE 1K8AG 2QA4E 2ZJRE 1Q81G 5H1SI 1KQSE 2ZJPE 2OTLE 5JVGE 5JVHE 3CCQE 3I55E 1Q7YG 1M90G 4IOAE 1QVFE 5GADG 4IO9E 4UY8G 1NJIG 5GAHG 1YITE 1YI2E 1VQ6E 1YJNE 1VQLE 1VQME 1K73G 2CQLA 1VQ4E 3CMEE 3CF5E 1VQ9E 3CCJE 1VQ5E 3CC7E 3PIOE 2QEXE
chains in the Genus database with same CATH superfamily
1KC8G 4WF9E 2OY1O 3CMAE 4IOCE 5B2AO 3IG9A 3EC5A 2QEXE 4WFAE 3CCEE 1S72E 3DLLE 3IGEA 1M1KG 3CD6E 3G71E 1YJWE 1N8RG 2OY5O 2I5ZO 1VQKE 4WCEE 2HKDA 1VQPE 1K9MG 1KD1G 3CKGA 2I5VO 1JJ2E 3CCME 3CCRE 3CKFA 1YJ9E 5HL7E 3G6EE 3I56E 5MLCH 5GAGG 3CC4E 1QVGE 3CCVE 3J7ZG 3CCSE 3CC2E 1YHQE 1VQOE 3OW2E 3CCUE 1W2BE 1VQ8E 2OL7A 3CPWE 2ZJQE 1VQNE 4WFBE 3CXCE 5AN9B 2OTJE 1Q82G 3CCLE 1P4PA 5B11O 2OY8A 1YIJE 3PIPE 1RL6A 4WFNE 5DM7E 4U67E 5GAEG 1Q86G 1VQ7E 3G4SE 1K8AG 2QA4E 2ZJRE 1Q81G 5H1SI 1KQSE 2OY7A 1OSPO 2ZJPE 2OTLE 5JVGE 2OYBO 5JVHE 3CCQE 3I55E 1Q7YG 1M90G 4IOAE 5B10O 1QVFE 5GADG 4IO9E 4UY8G 1NJIG 1FJ1E 5GAHG 1YITE 1YI2E 1VQ6E 1YJNE 1VQLE 1VQME 1K73G 2CQLA 2FKGA 5B3MO 1VQ4E 3CMEE 3CF5E 2OL6O 1VQ9E 1RJLC 2OL8O 3CCJE 1VQ5E 3AUMO 3CC7E 2G8CO 2FKJA 2PI3O 3PIOE 5DM6E 2AF5A
chains in the Genus database with same CATH topology
1KC8G 4WF9E 3CMAE 4IOCE 4WFAE 3CCEE 1S72E 3DLLE 1M1KG 3CD6E 3G71E 1YJWE 1N8RG 1VQKE 4WCEE 1VQPE 1K9MG 1KD1G 1JJ2E 3CCME 3CCRE 5DM6E 1YJ9E 5HL7E 3G6EE 3I56E 5MLCH 5GAGG 3CC4E 1QVGE 3CCVE 3J7ZG 3CCSE 3CC2E 1YHQE 1VQOE 3OW2E 3CCUE 1W2BE 1VQ8E 3CPWE 2ZJQE 1VQNE 4WFBE 3CXCE 5AN9B 2OTJE 1Q82G 3CCLE 1YIJE 3PIPE 1RL6A 4WFNE 5DM7E 4U67E 5GAEG 1Q86G 1VQ7E 3G4SE 1K8AG 2QA4E 2ZJRE 1Q81G 5H1SI 1KQSE 2ZJPE 2OTLE 5JVGE 5JVHE 3CCQE 3I55E 1Q7YG 1M90G 4IOAE 1QVFE 5GADG 4IO9E 4UY8G 1NJIG 5GAHG 1YITE 1YI2E 1VQ6E 1YJNE 1VQLE 1VQME 1K73G 2CQLA 1VQ4E 3CMEE 3CF5E 1VQ9E 3CCJE 1VQ5E 3CC7E 3PIOE 2QEXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 G;  4WF9 E;  3CMA E;  4IOC E;  4WFA E;  3CCE E;  1S72 E;  3DLL E;  1M1K G;  3CD6 E;  3G71 E;  1YJW E;  1N8R G;  1VQK E;  4WCE E;  1VQP E;  1K9M G;  1KD1 G;  1JJ2 E;  3CCM E;  3CCR E;  5DM6 E;  1YJ9 E;  5HL7 E;  3G6E E;  3I56 E;  5MLC H;  5GAG G;  3CC4 E;  1QVG E;  3CCV E;  3J7Z G;  3CCS E;  3CC2 E;  1YHQ E;  1VQO E;  3OW2 E;  3CCU E;  1W2B E;  1VQ8 E;  3CPW E;  2ZJQ E;  1VQN E;  4WFB E;  3CXC E;  5AN9 B;  2OTJ E;  1Q82 G;  3CCL E;  1YIJ E;  3PIP E;  1RL6 A;  4WFN E;  5DM7 E;  4U67 E;  5GAE G;  1Q86 G;  1VQ7 E;  3G4S E;  1K8A G;  2QA4 E;  2ZJR E;  1Q81 G;  5H1S I;  1KQS E;  2ZJP E;  2OTL E;  5JVG E;  5JVH E;  3CCQ E;  3I55 E;  1Q7Y G;  1M90 G;  4IOA E;  1QVF E;  5GAD G;  4IO9 E;  4UY8 G;  1NJI G;  5GAH G;  1YIT E;  1YI2 E;  1VQ6 E;  1YJN E;  1VQL E;  1VQM E;  1K73 G;  2CQL A;  1VQ4 E;  3CME E;  3CF5 E;  1VQ9 E;  3CCJ E;  1VQ5 E;  3CC7 E;  3PIO E;  2QEX E; 
#chains in the Genus database with same CATH topology
 1KC8 G;  4WF9 E;  2OY1 O;  3CMA E;  4IOC E;  5B2A O;  3IG9 A;  3EC5 A;  2QEX E;  4WFA E;  3CCE E;  1S72 E;  3DLL E;  3IGE A;  1M1K G;  3CD6 E;  3G71 E;  1YJW E;  1N8R G;  2OY5 O;  2I5Z O;  1VQK E;  4WCE E;  2HKD A;  1VQP E;  1K9M G;  1KD1 G;  3CKG A;  2I5V O;  1JJ2 E;  3CCM E;  3CCR E;  3CKF A;  1YJ9 E;  5HL7 E;  3G6E E;  3I56 E;  5MLC H;  5GAG G;  3CC4 E;  1QVG E;  3CCV E;  3J7Z G;  3CCS E;  3CC2 E;  1YHQ E;  1VQO E;  3OW2 E;  3CCU E;  1W2B E;  1VQ8 E;  2OL7 A;  3CPW E;  2ZJQ E;  1VQN E;  4WFB E;  3CXC E;  5AN9 B;  2OTJ E;  1Q82 G;  3CCL E;  1P4P A;  5B11 O;  2OY8 A;  1YIJ E;  3PIP E;  1RL6 A;  4WFN E;  5DM7 E;  4U67 E;  5GAE G;  1Q86 G;  1VQ7 E;  3G4S E;  1K8A G;  2QA4 E;  2ZJR E;  1Q81 G;  5H1S I;  1KQS E;  2OY7 A;  1OSP O;  2ZJP E;  2OTL E;  5JVG E;  2OYB O;  5JVH E;  3CCQ E;  3I55 E;  1Q7Y G;  1M90 G;  4IOA E;  5B10 O;  1QVF E;  5GAD G;  4IO9 E;  4UY8 G;  1NJI G;  1FJ1 E;  5GAH G;  1YIT E;  1YI2 E;  1VQ6 E;  1YJN E;  1VQL E;  1VQM E;  1K73 G;  2CQL A;  2FKG A;  5B3M O;  1VQ4 E;  3CME E;  3CF5 E;  2OL6 O;  1VQ9 E;  1RJL C;  2OL8 O;  3CCJ E;  1VQ5 E;  3AUM O;  3CC7 E;  2G8C O;  2FKJ A;  2PI3 O;  3PIO E;  5DM6 E;  2AF5 A; 
#chains in the Genus database with same CATH homology
 1KC8 G;  4WF9 E;  3CMA E;  4IOC E;  4WFA E;  3CCE E;  1S72 E;  3DLL E;  1M1K G;  3CD6 E;  3G71 E;  1YJW E;  1N8R G;  1VQK E;  4WCE E;  1VQP E;  1K9M G;  1KD1 G;  1JJ2 E;  3CCM E;  3CCR E;  5DM6 E;  1YJ9 E;  5HL7 E;  3G6E E;  3I56 E;  5MLC H;  5GAG G;  3CC4 E;  1QVG E;  3CCV E;  3J7Z G;  3CCS E;  3CC2 E;  1YHQ E;  1VQO E;  3OW2 E;  3CCU E;  1W2B E;  1VQ8 E;  3CPW E;  2ZJQ E;  1VQN E;  4WFB E;  3CXC E;  5AN9 B;  2OTJ E;  1Q82 G;  3CCL E;  1YIJ E;  3PIP E;  1RL6 A;  4WFN E;  5DM7 E;  4U67 E;  5GAE G;  1Q86 G;  1VQ7 E;  3G4S E;  1K8A G;  2QA4 E;  2ZJR E;  1Q81 G;  5H1S I;  1KQS E;  2ZJP E;  2OTL E;  5JVG E;  5JVH E;  3CCQ E;  3I55 E;  1Q7Y G;  1M90 G;  4IOA E;  1QVF E;  5GAD G;  4IO9 E;  4UY8 G;  1NJI G;  5GAH G;  1YIT E;  1YI2 E;  1VQ6 E;  1YJN E;  1VQL E;  1VQM E;  1K73 G;  2CQL A;  1VQ4 E;  3CME E;  3CF5 E;  1VQ9 E;  3CCJ E;  1VQ5 E;  3CC7 E;  3PIO E;  2QEX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...