3CPWP

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cpwP00
1YIJQ 3CCVQ 1S72Q 1Q81R 1VQ8Q 3CCMQ 3CC2Q 1VQNQ 3CPWP 3CC4Q 1JJ2P 3CCSQ 1VQ5Q 1K73R 1VQLQ 1VQ6Q 1K9MR 1VQPQ 3G6EQ 3CCRQ 1W2BP 1KC8R 1YJNQ 1QVFP 3CD6Q 1N8RR 3G71Q 3CCJQ 1Q86R 2QEXQ 3CMEQ 3CMAQ 1YI2Q 1KQSP 1YITQ 1VQ4Q 3CCUQ 2QA4Q 1VQMQ 3CC7Q 1VQ9Q 2OTJQ 3G4SQ 1VQ7Q 3CXCP 1M1KR 1Q82R 2OTLQ 3OW2P 3CCLQ 1Q7YR 3I56Q 1QVGP 1YJ9Q 1K8AR 1M90R 1VQOQ 1NJIR 3CCQQ 1KD1R 3I55Q 1VQKQ 3CCEQ 1YHQQ 1YJWQ
chains in the Genus database with same CATH superfamily
1YIJQ 1Q7YU 5HCKA 3CCVA 4PJMA 5DLOA 1D1BA 1HK9A 2AIRB 1C1AA 3GF5A 1Q81U 4E7ZA 4J9GA 2QDLA 2JOYA 2QEXQ 3CMAQ 1K0SA 4ATOA 1KC8C 1OU9A 2VV5A 1Q7YR 2LT4A 1X2QA 2DBMA 1DJ7B 1K1ZA 3FC3A 3RESA 2DL3A 2DNUA 3ASKA 4C8QC 1Q81R 4FSSA 4EMKA 1N5ZA 2RHIA 2CSIA 2XDPA 1WXTA 1JJ2S 2WSFE 1H641 2O01E 3EFOA 4FIBA 4DEXA 3SWNB 3RBBB 4XTYA 4PJOD 1GCQC 5IHKA 4E6RA 1ZUUA 4BE2A 2DVJA 2OX7A 3S3MA 1GFDA 1NLOC 1NYFA 8AT1B 2HBWA 2ZPGB 1HXDA 3CC2Q 2GTJA 3O5ZA 1VQLA 3G6EA 2DXBA 5DLQE 3C0CA 2JS2A 2V26A 1NYGA 1WFWA 1I1JA 1RAGB 3REBB 1OZ3A 3WVEB 1N9RA 3NTIA 2R5AA 3VUBA 1T0HA 1PHTA 3M59A 2E70A 2IVWA 2CUDA 4FW2A 2A3LA 1JEGA 1VQNQ 4L5GA 1Y96A 2AT1B 1BI1A 1YI2Q 1UUEA 4ZGJB 1U3OA 2L2PA 3OMGA 2PNIA 1UECA 3RKXA 3OYIA 1VQMA 2LNVA 1VQ9Q 1T3LA 1OULA 5LJ3j 2JNGA 1SRMA 2LX7A 2CREA 2KMTA 2RNAA 4NL3A 1Q95G 2K9GA 1NJIU 1D3BA 2RB6A 1OX9A 2QK0A 2L3RA 2K3YA 1ZLMA 3TCJA 1TOVA 2YLBA 1X69A 3FDRA 3J81E 3MO8A 4QKUA 4LDVA 4M78B 1UTIA 1NJIR 2X4YA 4ELYC 3BDLA 2DL5A 3EAEA 1M1KC 3KFVA 3RUXA 4C92D 1UGSB 3UATA 1Q82C 3CMET 3D7SB 3GPLA 3C4SA 1VQPA 1I0CA 3DB3A 1Y07A 1Q86R 2HZYA 4J83A 2DPPB 5CAIA 3RR6A 5GAOn 4C8QF 1IXDA 2CP6A 4J6YA 2KY9A 4M75G 3OW2S 4BE0A 1MHNA 2JTFA 3C95A 4EPCA 2ECZA 3CCST 4PLLA 1BI0A 2RF0A 1S72Q 1M4ZA 1U1SA 1RAFB 3CCJT 1OV3A 4F14A 3MPUB 4OMMA 1OU8A 3G4ST 3OBYA 2FPEA 4Z8AA 1YBYA 1FXXA 4A4KA 2KNBB 1G83A 1WNLA 2MWPA 1QCFA 1R77A 1VQ8T 4X9CA 2V1RA 2MPXC 4X1VA 3EG0A 4AG1C 3QBYA 5J3BA 4Y92A 1LPLA 3JRZA 2EQMA 2HQEA 2RPNA 5HY6A 1VQ5A 1IHVA 2JMAA 2NUZA 4M77D 4M7DF 2PU9B 1Z9QA 1SEMA 3VS0A 3RERA 1YITA 1UJYA 4OP0A 3A8GB 1X6GA 5LJ3h 1U1TA 3GNGA 5I21A 4RTXA 3CCMT 3M0QA 4HCKA 5CKFA 2JS0A 1WI7A 1UDLA 2JT4A 3CCRT 4PJOE 4LNPA 1K8AU 5KYUA 5GMKj 4C0GA 1XJWB 3I9QA 3RIRA 5FU7C 3UT1A 2KYMA 1RI0A 2DBKA 5LJ5f 5GAN7 4N4HA 4HVVA 2QEXA 3AT1B 1E6HA 2QXFA 4ZN3A 4M75A 4RTWA 2GQVA 2QG9B 4C5IA 2IIMA 1YHQT 1TUCA 1K8AR 1FYNA 2HL3A 2RQWA 2AKKA 1FX7A 4R55A 3CPWP 1EIFA 3GLXA 5ECAA 3OA6A 2VXEA 2K57A 1TSFA 2DZ9A 2Y4XA 2VKNA 2KRNA 1RAHB 1XTDA 2EYZA 2AHJB 2DYBA 1G3YA 1TTHB 4C8QD 1JQQA 2CP5A 5FU6B 4FCYA 4O6JA 4EMGA 3OYKA 3A1PA 4PJNA 3CCQA 1M2VB 1NM7A 5LJ3f 1V1CA 3VS2A 2F2XA 4M75C 4RTVA 3E1SA 2MF2A 3UA7A 4D8DA 4OB2B 4RTYA 3CEYA 1N8RC 3THKA 1YP5A 2LMJA 4FYVB 2DJZA 5A0DA 4DBRA 1Q82R 3FRNA 5LJ5e 2K2VA 1D1CA 1VQ6T 1YFNA 4J9EA 2JVVA 3MCAB 3CC7T 2FPFA 1XOVA 1K0XA 1M27C 5J39A 2JTMA 2E1HA 1YI2A 4C92E 2DXCA 2QA4Q 1ABQA 3CPWA 3VV0A 3PTAA 1VQ9A 3CBPA 1IHWA 4VUBA 4M7DB 4HCBA 4BUGA 3HRUA 1T0JA 3OS0A 1B07A 5GMKh 5KCOA 2CH4W 5LJ3e 2IG0A 2DX1A 4OMPA 3RMSA 3SFMA 2K3BA 1R8OB 4KULA 3QYGB 4J5YA 1LCKA 1HSQA 2YXYA 1QVGS 4JLIA 3EG9B 3OB9A 2EQKA 5GAOr 4XTXA 3JCMg 2CP0A 4M78G 4F7UE 1W2BS 1KD1C 5GAN3 3HFNA 2AKLA 1GBQA 2QASA 2KXDA 3GNFB 1C0MA 7AT1B 4M77E 5GAN5 3I55T 2QQSA 3T9NA 1X27A 4EDUA 1KG1A 4AT1B 2RHUA 4Z88A 4FSXA 1YJNT 1M90U 2FZGB 1S72A 5GMKm 2KQWA 2LDMA 5FLXE 2MCNA 4XQ3A 3IQLA 1D0XA 3F70A 4L6V5 1YJ9T 3PE0A 2DEUA 5GAMf 4PLIA 3CCET 2FPDA 2NUPB 2LJ1A 2YUNA 2RQVA 4C0DC 1MV3A 3OY9A 1M90R 1Z9ZA 3RNJA 2PUKB 4E7JA 5KYXB 2RJFA 2ROTA 1VYUA 1VQLQ 1WQWA 5LJ5d 3G6EQ 3EGDB 1WXBA 2KK4A 1QP2A 2CP3A 2JJ9A 1KHCA 1MMAA 4FL6A 3CXCS 1WIEA 2LC4A 2HKNA 3EGXB 1N8RR 4M78A 4C8QE 1M8VA 3EFSA 2XU8A 2CDTA 2LZ6B 2BTTA 4DBFA 1Y0MA 2KXCA 2HSEB 3V8KA 1WJQA 2QGFB 1PSFA 1KIKA 1VQMQ 4DQ2A 3CCVT 1M3BA 2JW4A 4PFOA 5LJ3d 5I2SA 4RUGA 5GAMe 3META 5HKCA 1IO6A 4J9BA 5FU7B 3X28B 3R6NA 2E6ZA 3LYIA 3I5RA 1KQSS 4E2FB 2OTLA 1M1FA 2M0OA 2YRVA 2CS7A 2ZGWA 2GF7A 1NZ9A 5HK3A 2XI9A 4PJOF 1J3TA 2K7AA 2A08A 5CKEA 1ZBXA 1VQ4Q 3PIOA 4BY6C 1WJRA 5I22A 3OYEA 3OQ5A 3H8ZA 2V8IA 2RHXA 1AVZC 4MZPA 4M75D 1YJWQ 3VS6A 3A8LB 2D6FA 4QQ6A 4FU6A 2A28A 3WVDB 2F5TX 3URGA 2YHTA 1K9MU 2VGNA 1I8FA 1PM3A 4M77C 2QA4A 4FT4A 2KEAA 2RHZA 2DJQA 4GLMA 2EFIA 4AG2C 3LWHA 2KT8A 3PVLA 3CD6T 3MEWA 1K9MR 2DK3A 4HVUA 3JCMJ 3PVQA 2EW3A 2RJCA 2VGMA 4BI4A 4IUVA 4MMLA 1XNIA 2HL5C 2MMPA 1YITQ 2A0FB 4ANJA 4C5GA 5GANg 3REAB 1M3CA 1NPRA 2QTXA 2QQAA 2YLCA 2CZ1B 3BY7A 2OAUA 2E10A 2VVKA 3UDCA 3M57A 3CC4A 4LD6A 1D0ZA 4XTZA 1UEBA 4IKFA 4FM4B 1SHGA 5GAMd 2JM8A 3GOXA 3ER0A 2GNCA 1ZBJA 1K73C 2OTJQ 1VQ7A 5CVIA 4OMFB 1RUWA 2GFAA 3MP6A 2W0ZA 3G7ZA 2D8HA 3A98A 2EGAA 2HQHA 1VQPT 4C92F 3M5AA 1I5LA 2LQ8A 2EKHA 3A8HB 4QVDA 2BUDA 4LD9K 4A4GA 1ZHIA 5HK0A 3LH5A 3PGGA 2EAYA 1TXQA 1M1GA 2DTHA 2E6NA 2A7YA 2BZYA 5GAOm 2E12A 2YDLA 2HNIA 1TWBA 1MMGA 3PNWC 3JB9G 1B7TA 2RMOA 3CCQQ 4PJOB 1PRMC 4X9DA 4M7DA 3JCMh 3P8HA 4M7AG 2MYSA 2ZPFB 1UJ0A 1AWXA 3G71A 4J7FA 4HT9A 2FZCB 1U8RA 1ZSZB 3CCLT 2QQ9A 1KK7A 1VQOT 4PKCC 4EMKC 3JSCA 4F7UF 4IUPA 1VUBA 1H3HA 3OYGA 1KQ1A 1VQ5T 3V7SA 2J6KA 2DTOA 1RLPC 2P4RA 2BE9B 3E9FA 2P0QA 3CCSQ 4M77F 1P92A 4HA8A 5IHIA 2X3XD 4HCCA 2DIGA 2L8DA 3HRTA 3OYDA 4PL6A 4QQGA 1BU1A 2J05A 4XK8E 2X4WA 4CC3A 2F2WA 3L2RA 1MNEA 1B34B 1YIJT 2DVEA 4ZN1A 1YCYA 3PIPA 1QKXA 2RQRA 4ESRA 2KR3A 2EYXA 3M9QA 4QW2A 3UWNA 2QEXT 1IREB 3CMAT 3A8MB 4M75E 3SHWA 2B86A 5FWBA 2JZ2A 3M0SA 1NLPC 2JUFA 3KUFA 4A54A 2CSQA 2RHYA 1SHFA 1WLPB 2GTOA 4NOYA 2P4TA 4OGEA 1Q86U 4AMCA 1MNDA 1O9SA 1E7OA 2L3PA 1ZUYA 4M7AA 4MDXA 1VQKQ 2NUPA 5KYWB 1I07A 5GAN6 1QLYA 4GY5A 2IPOB 5L23A 4IUQA 1H92A 4E7KA 1WHJA 4C92B 3JCMb 3LH0A 1KC8U 1RACB 1K76A 1JJ2A 1RAEB 1VQ4A 3N5BB 4ME7A 4ZNXA 3H9NA 3CC2T 1QW1A 1AD5A 2HAXA 5KYYA 2K2MA 2QQBA 2VXFA 1JRIA 2PQWA 2KYBA 2YRDA 4LE9A 1YJWA 3EGXA 1BIBA 1K73R 1KC8R 4BI3A 4IIOA 2YUOA 4GBQA 2FB7A 2O9SA 3M56A 4BY6B 2JN0A 1ZA1B 2MK5A 1O75A 4KUIA 1H8KA 9ATCB 1VQNT 2H8HA 3QZ5B 1MMNA 2CKKA 1TUDA 5CKBA 1VA7A 2O4XB 1EX4A 1X75C 1YI2T 4N4IA 4F7UB 3LLRA 2ZPIB 1GCPA 2KVQG 5CQXA 2KBTA 3CPFA 3UA6A 1YWOA 1FMKA 1XQHA 2LP5A 2EJ9A 2HDAA 2DERA 4M77B 3ME9A 3TREA 3L42A 3UF4A 2QI2A 1BI3A 3OS2A 2AZSA 2DXUA 1WJSA 1SF9A 2ENMA 3EHQA 2DMOA 3AHUA 1X6BA 1UB4A 4E7HA 1ACMB 2Y4YA 4DOWA 4F17A 2I2LA 2ZPHB 2QDYB 2PVDB 4M4ZA 4IURA 2OTJA 1QP3A 2YSQA 1PCXA 4KGVB 1KHIA 5IT9E 5C6SA 2KROA 2EKOA 1AWJA 4JRKA 5EG2A 4ELZC 5GJVB 4A4HA 1NBEB 2R57A 5GANh 3V7CA 2OTLQ 1PSEA 1BBZA 1S72T 1JXMA 1Y71A 2X9HA 1Q82U 2RM4A 4C8QB 5KCHA 3MJXA 2DLPA 2YWWA 2KI7A 2EPDA 3ZEHA 4AFZC 2RK2A 5KE3A 2FHDA 4PJOG 1W6XA 3QXEB 3CMEA 3OSSC 1ZSGA 2DL7A 1M1KR 2C0TA 3PMIA 2MWOA 3SB2A 3NPFA 1D0YA 3FJPA 1F1BB 4LDXA 4E7LA 2PZ1A 3CCSA 4RTTA 1N27A 4J9CA 3JCMd 3E9GA 2LX9A 3CCUT 3M53A 3CCJA 2G6FX 2OAWA 2XKOC 2ZPEB 2M16A 1PRLC 1OPKA 3EHRA 3JCMW 3VJPA 4RMOA 4EMKB 3GBQA 4M78E 1YJ9Q 2KSSA 4NL2A 1Y57A 1NE8A 2DFUA 3HSBA 1OEBA 3EFOB 4OMLA 4XU2A 1ARKA 1VQ8A 1VIEA 4FT2A 3NTHA 2ROLA 3L1AA 2CP2A 1QQJA 2MI6A 2XMFA 3JB9I 3MEUA 1AHJB 4CC7A 4HVWA 1UGVA 2EYYA 1UHCA 3SWNA 5GAOq 1YNZA 4QT7A 2BZXA 4FYYB 1PD1A 2GBQA 2JTEA 3VRYA 1VQKA 2WACA 3CCMA 2DD4A 2HSPA 1TS9A 3CC4Q 4HT8A 4PJOA 2FL7A 3BDUA 1QVFP 5IH2A 3CCRA 1QCNA 2DIQA 2MIOA 4O5VA 4KGXB 1S1NA 1X01A 6AT1B 1VQ7Q 1FMVA 4N4GA 1MGQA 2W10A 2ED1A 3OYYA 4PFPA 1ZSZA 4AFQC 3JCMc 4XTUA 4YTLA 4NS5A 2E64A 5D6WA 1YHQA 1ZUKA 2FZKB 1Y96B 3OSVA 3Q1JA 4RG8A 2E5KA 3QIIA 1U5SA 2NLUA 4J6WA 3X25B 4OB0B 3QDFA 3LWIA 3SWNC 2JXBA 1SG5A 4FW1A 2XD0A 3X26B 3VS5A 3ULRB 4CC4B 4IIMA 3G1JA 2HD0A 4M75F 1BB9A 2FEIA 2A37A 1D3BB 2NWMA 2H3EB 1EFNA 5GAOp 2F1LA 3JB9D 1B34A 2NYSA 4CI0C 2KGTA 1BI2A 3VS4A 4J6XA 5CK9A 4WTOB 4JJNK 2XG8D 1N8RU 4M7AD 3QUIA 3G71Q 2QA4T 4LDYA 4BB7A 4PK4A 2M51A 4DBQA 4WF2A 2D8JA 3I5SA 1AZGB 4IUTA 2EIFA 1OPLA 2DETA 1QVFA 3I56Q 2FVUA 3FIFA 4OGCA 5CQYA 2DL8A 2YRCA 2O9VA 5KE2A 2JMCA 1IB8A 3V8LA 2GQIA 3DLLA 1X6OA 3RKWA 8ATCB 1QWEA 2LVMA 2XDBA 2RJDA 5M9OA 3CC7A 3SEMA 2YUPA 2DRKA 1HJDA 4J9IA 4Z89A 5GMKe 3OYHA 1WHGA 3EFRA 4OMQA 1NG2A 3E2UA 4BD3A 2KAFA 3FLGA 1K9AA 2R58A 2EVRA 1Q7YC 3FEOA 3OMCA 4KGZB 1UG1A 1Q81C 1TU0B 1WHHA 1V29B 1MV0B 4HKEA 3VKIA 3M58A 1K4US 3MEAA 3L2ZA 3SD4A 4M78C 4IUUA 1I5OB 4RCBA 5AT1B 2COYA 1NEGA 1JU5C 5LJ5g 4J9HA 4Z02A 2L3QA 2P84A 2DD5A 1KD1U 1CKBA 1W1FA 4V2SA 2C0OA 2LTOA 3M4GA 3QDRB 4C8QG 5IAYA 4C5EA 5KYUB 1TH7A 1C6VX 4A63B 1VQLT 1KD1R 2CZ6B 2J7IA 3I55A 3G6ET 2QGGA 1SPKA 3VU3C 4CC2A 3LGLA 2CP7A 2EGEA 1ZA2B 3QJYA 2EQUA 1YJNA 4M75B 4DA4A 1SKUB 4RG2A 1KQSP 1G3SA 4MZMA 3TEEA 5FWCA 4BACA 5LJ3g 4KBMB 2FRWA 2RQTA 4XTWA 1YJ9A 3CCEA 2HCKA 4LUEA 1LNXA 3HPWA 4TVRA 4M7DG 1VQMT 1OQKA 5CR2A 3NFCA 4JZ4A 2DXTA 5FROA 5KYNA 2MOXA 1GFCA 2E3IA 1W4SA 3CBOA 5GMKl 4ORZA 2KRMA 1A0NB 2E3HA 5EC7A 4UC4A 4JRQA 2FO0A 3H0HA 1WA7A 4J7IA 1M2VA 2RA2A 1NJIC 2HKQB 4C8QA 1RL2A 4ZTJA 1QKWA 1OZ2A 4F16A 1KFZA 2C06A 2E5QA 3EH2A 3P8BB 2L0AA 3JCMX 4M7AE 2D1XA 1IRXA 1PWTA 1GCQA 1KQSA 4B9XA 1AT1B 4BI8B 2DA9A 2LCCA 2OI3A 2LCLA 2VB6A 2GGRA 4M78F 3L2QA 1VQ4T 5IHNA 2BZ8A 5CCAA 5AYFA 4HXJA 4OMOA 1BK2A 2LQWA 2CH4A 1SSHA 1LOJA 1RLQC 4KH1B 1M3AA 1BCMA 5FU6C 1YJWT 3J80E 2F69A 1BCOA 4LDUA 1QVPA 1M8MA 2Z0WA 4K11A 5IXBA 2P0PA 2EQJA 2BKDN 2DL4A 2LNHB 3CMEQ 4JRIA 2DILA 5IN1A 4FYXB 1NEBA 2VASA 1X43A 3NMZC 1PNJA 2P0KA 4PFZA 4C0DB 4D6WA 3EG3A 3I56A 1Y7XA 1D1AA 3O8VA 5LJ5j 2DM1A 1UGPB 1JJ2P 1B3QA 2GFUA 1OX8A 2LT1A 1QCOA 2K79A 4Y28E 1YITT 3EG9A 5GAMg 2X35A 3CCJQ 1G3WA 3LX7A 2EJFA 4X34A 4CRIA 3G4SQ 4M7DC 3QZ9B 3KXTA 2DYIA 4LN2A 4AFSC 2X51A 3NHNA 4XU3A 1M30A 3JB9J 1VQ8Q 1N6AA 1T3SA 3A5ZB 1K8AC 4PJLA 4JJDA 3CD6A 1KJWA 3QSUA 2JM9A 2OTJT 2HMAA 3GIBA 3JCMf 3OYJA 5DM7R 1V76A 3QPHA 2CT3A 3VS1A 2E65A 2RH2A 1KQ2A 1H3ZA 2A36A 3CCMQ 2FRYA 3U23A 4Y91A 3CCRQ 2I0NA 1JXOA 5KYXA 4ZGDB 4M78D 1K73U 4E47A 4JZ3A 3EGDA 3JV3A 1WDXA 1M5Q1 3PT9A 5GANj 4OF1A 3CCQT 2AZVA 3TQ7P 3OYAA 5CKDA 3OYNA 3FB9A 5I2MA 3V7RA 1YHQQ 5A2QE 1QMCA 2LJ3A 2DF6A 1U06A 4MMKA 4J9DA 4Q5WA 2J6FA 1MMDA 4PJJA 1ABOA 4M7AC 2DTIA 4BDZA 3JCMe 5CIUA 3A8OB 5LJ5h 2WSEE 4R0KA 3HRSA 1GRIA 2NUTB 5GAN2 1VQ9T 1D09B 3RKYA 3OYLA 1WXUA 4XU0A 2M0YA 2LJ0A 5FW9A 2CYZB 5IXFA 3OW2P 3CCLA 2QYZA 3OS1A 1JB0E 2M02A 3V8JA 1IZ6A 1VQOA 1JBMA 4HCZA 2C0IA 5GJWB 5GAOl 1VOMA 1VQ6Q 1YWPA 4JLGA 5DY9A 1PKSA 3CPWS 4RTZA 2D9TA 4RCCA 4II1A 1X2KA 2LQKA 3CCUQ 2D0NA 3S3NA 3CC7Q 2EYQA 2D0QB 5D6XA 3UPUA 1VQKT 1RAAB 2ZAEA 2RD1A 2YUQA 1SSFA 1IGQA 2YT6A 3EG1A 2DEQA 4C0FA 1BYMA 1YIJA 1G2BA 1N9SA 1UGRB 3DLMA 3NTKA 3HTRA 3JCMV 3EGUA 1HD3A 3M0RA 3ZL7C 5GAMj 1AEYA 1CSKA 1EZZB 3MP1A 4DOVA 4B6MA 2CUBA 3CMAA 4QVZA 3OYBA 4KT0E 2ESWA 3OBWA 2EWNA 2X4JA 3QWYA 2XIDA 3CBMA 3SDZA 2ZCFB 1WPYA 3KBGA 1M1KU 2FG0A 2ABLA 2WSCE 2XHCA 3VUZA 1M90C 3OW2A 2H3JA 2EBPA 1AWWA 3L2VA 1G3TA 1WHLA 4RTUA 3QHSA 2MAMA 3QYHB 4C0ZA 1RABB 2E4HA 5L8RE 2XDDA 2DAQA 3HL8A 2QQRA 1QWFA 3JB9F 3P8DA 3RDVA 5LL6S 3I55Q 3C94A 5I11A 1JO8A 3CC2A 4M7AF 1NPPA 2VYTA 1AWOA 1YJNQ 2COWA 4FYWB 3INZA 2QAZA 2Y90A 2RI2A 3G4SA 1AOJA 5D7UA 4N0AA 1ZQ1A 1PKTA 2PVOB 3CCEQ 5GANf 4OVAA 2RO0A 2CZ7B 3MKDA 1UFFA 2VUBA 2L3SA 3ZBDA 2HEQA 1UHFA 1VQNA 5FRMA 2K5IA 4BE1A 2HQXA 2OJ2A 4EIKA 3EG2A 1QVFS 5FRNA 4M7DD 2E41A 2KE9A 2G3RA 1WHMA 2EQIA 2K5FA 3QJ6A 3HKSA 2CGHA 2RQUA 1PD0A 3VYGA 2DO3A 2V8JA 1G8XA 2M1HA 2LRQA 2L89A 2F2VA 2CT4A 4JUVA 5GAMh 1WHKA 3GP8A 4N0AC 2OTLT 3LW5E 4JDSA 1BKBA 4LUDA 4PNOA 4AFUC 3JCMQ 4MZTA 3QWXX 4JRPA 3H0FA 1LJOA 4C92G 3CCVQ 1R0CB 1SRLA 3H41A 4J8OA 5D6YA 3FJ5A 5GANe 2DKGA 1W70A 3OYMA 1FWZA 4A4EA 4LXCA 1VYTA 1VIFA 3C12A 1G5VA 1RAIB 1QVGP 1HYOA 4PJOC 2HBPA 4C5HA 4E7SA 2FYKA 1LVKA 5CO7A 3PMTA 1UGQB 1W2BP 1WYXA 2V8KA 1FMWA 2ZPBB 1ZSZC 2COZA 3M0UA 4LDWA 4JPBW 1IGUA 1K9MC 1ZX6A 4M7AB 5GMKi 1KSWA 4JS5A 4F7UG 2O2OA 3H0IA 3ZFJA 5C0MA 1WX6A 1I81A 5A0LA 3VYHB 2BIVA 4A53A 1AZEA 1TG0A 2DZCA 4DEYA 3M4YA 4M77G 3L2WA 3TSZA 1VQ6A 5KYWA 5KH6A 1E6GA 4XAXB 2QTVA 2ZZDA 2ATCB 4EMHA 5KYYB 3CCUA 3OYFA 4OB1B 4C92A 1R0BG 2EJGA 4E7IA 2XICA 2J6OA 3CC4T 5J26A 3JB9H 2B8AA 3TSWA 2VWFA 3J7AF 3HFOA 2LQNA 3QO3A 4XTVA 4R56A 1OI1A 3MHXA 3CD6Q 3OYCA 1QVGA 1PC0A 5GAN8 1VQ7T 3R6OA 3M0PA 1PG5B 3M0TA 4ZTFA 4QQDA 1WQ7A 3CXCP 3HP9A 2PUOB 2L5QA 1W2BA 4DBHA 5GAN4 2EYWA 3PFSA 3MEVA 1BIAA 2X3WD 3HHTB 2CZ0B 1YN8A 3TU4K 2RK1A 2F5KA 4C92C 2O4XA 4KRTA 2RJEA 2NUTA 4KUDK 4F7UA 3VRZA 4J9FA 2GCXA 1OYXA 4JJCA 5GANd 4M7DE 3MP8A 4M77A 3NGPA 3X20B 2BE7D 3G71T 1VQPQ 1GBRA 3OS5A 2XK0A 4ZGEB 3JCMP 4JJBA 2PVGB 4D8KA 3S6WA 3I35A 4A4FA 1YCSB 3I56T 3BW1A 4MDWA 2K4YA 3RMQA 2RI3A 2O31A 3CQTA 4RKUE 4P5NA 1WGSA 5A0GA 3WXMB 2DRMA 1OOTA 2KRSA 4L59A 2K6DA 4OB3B 3E19A 3CXCA 2K3XA 4XU1A 1M9SA 2R5MA 1RI9A 2AK5A 3QKJA 4QVCA 3JAME 3L2UA 1TUGB 2RI5A 2VC8A 2M9UA 2KT1A 3CCLQ 2O88A 2PTKA 4BDYA 1CKAA 2J06A 1UE9A 4B9WA 2V1QA 1WZOA 3DKMA 1VQOQ 3LGFA 2DE0X 3BFMA 3TVTA 2KDSA 2LCSA 3S3OA 1GXIE 2ED0A 1VQ5Q 3M55A 2K5LA 3VS7A 3DB4A 3H6ZA 4WCIA 3BE3A 1M2OA 4KH0B 4JS4A 2EGCA 2SRCA 3EH1A 4F04B 3X24B 1GL5A 5CKHA 1MUZA 2RN8A 2X4XA 4GLKA 1RADB 3QG1A 4OMNA 1Q86C 2SEMA 3M54A 1I4K1 1VYVA 3VS3A
chains in the Genus database with same CATH topology
1YIJQ 3CCVQ 1S72Q 1Q81R 1VQ8Q 3CCMQ 3CC2Q 1VQNQ 3CPWP 3CC4Q 1JJ2P 3CCSQ 1VQ5Q 1K73R 1VQLQ 1VQ6Q 1K9MR 1VQPQ 3G6EQ 3CCRQ 1W2BP 1KC8R 1YJNQ 1QVFP 3CD6Q 1N8RR 3G71Q 3CCJQ 1Q86R 2QEXQ 3CMEQ 3CMAQ 1YI2Q 1KQSP 1YITQ 1VQ4Q 3CCUQ 2QA4Q 1VQMQ 3CC7Q 1VQ9Q 2OTJQ 3G4SQ 1VQ7Q 3CXCP 1M1KR 1Q82R 2OTLQ 3OW2P 3CCLQ 1Q7YR 3I56Q 1QVGP 1YJ9Q 1K8AR 1M90R 1VQOQ 1NJIR 3CCQQ 1KD1R 3I55Q 1VQKQ 3CCEQ 1YHQQ 1YJWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ Q;  3CCV Q;  1S72 Q;  1Q81 R;  1VQ8 Q;  3CCM Q;  3CC2 Q;  1VQN Q;  3CPW P;  3CC4 Q;  1JJ2 P;  3CCS Q;  1VQ5 Q;  1K73 R;  1VQL Q;  1VQ6 Q;  1K9M R;  1VQP Q;  3G6E Q;  3CCR Q;  1W2B P;  1KC8 R;  1YJN Q;  1QVF P;  3CD6 Q;  1N8R R;  3G71 Q;  3CCJ Q;  1Q86 R;  2QEX Q;  3CME Q;  3CMA Q;  1YI2 Q;  1KQS P;  1YIT Q;  1VQ4 Q;  3CCU Q;  2QA4 Q;  1VQM Q;  3CC7 Q;  1VQ9 Q;  2OTJ Q;  3G4S Q;  1VQ7 Q;  3CXC P;  1M1K R;  1Q82 R;  2OTL Q;  3OW2 P;  3CCL Q;  1Q7Y R;  3I56 Q;  1QVG P;  1YJ9 Q;  1K8A R;  1M90 R;  1VQO Q;  1NJI R;  3CCQ Q;  1KD1 R;  3I55 Q;  1VQK Q;  3CCE Q;  1YHQ Q;  1YJW Q; 
#chains in the Genus database with same CATH topology
 1YIJ Q;  1Q7Y U;  5HCK A;  3CCV A;  4PJM A;  5DLO A;  1D1B A;  1HK9 A;  2AIR B;  1C1A A;  3GF5 A;  1Q81 U;  4E7Z A;  4J9G A;  2QDL A;  2JOY A;  2QEX Q;  3CMA Q;  1K0S A;  4ATO A;  1KC8 C;  1OU9 A;  2VV5 A;  1Q7Y R;  2LT4 A;  1X2Q A;  2DBM A;  1DJ7 B;  1K1Z A;  3FC3 A;  3RES A;  2DL3 A;  2DNU A;  3ASK A;  4C8Q C;  1Q81 R;  4FSS A;  4EMK A;  1N5Z A;  2RHI A;  2CSI A;  2XDP A;  1WXT A;  1JJ2 S;  2WSF E;  1H64 1;  2O01 E;  3EFO A;  4FIB A;  4DEX A;  3SWN B;  3RBB B;  4XTY A;  4PJO D;  1GCQ C;  5IHK A;  4E6R A;  1ZUU A;  4BE2 A;  2DVJ A;  2OX7 A;  3S3M A;  1GFD A;  1NLO C;  1NYF A;  8AT1 B;  2HBW A;  2ZPG B;  1HXD A;  3CC2 Q;  2GTJ A;  3O5Z A;  1VQL A;  3G6E A;  2DXB A;  5DLQ E;  3C0C A;  2JS2 A;  2V26 A;  1NYG A;  1WFW A;  1I1J A;  1RAG B;  3REB B;  1OZ3 A;  3WVE B;  1N9R A;  3NTI A;  2R5A A;  3VUB A;  1T0H A;  1PHT A;  3M59 A;  2E70 A;  2IVW A;  2CUD A;  4FW2 A;  2A3L A;  1JEG A;  1VQN Q;  4L5G A;  1Y96 A;  2AT1 B;  1BI1 A;  1YI2 Q;  1UUE A;  4ZGJ B;  1U3O A;  2L2P A;  3OMG A;  2PNI A;  1UEC A;  3RKX A;  3OYI A;  1VQM A;  2LNV A;  1VQ9 Q;  1T3L A;  1OUL A;  5LJ3 j;  2JNG A;  1SRM A;  2LX7 A;  2CRE A;  2KMT A;  2RNA A;  4NL3 A;  1Q95 G;  2K9G A;  1NJI U;  1D3B A;  2RB6 A;  1OX9 A;  2QK0 A;  2L3R A;  2K3Y A;  1ZLM A;  3TCJ A;  1TOV A;  2YLB A;  1X69 A;  3FDR A;  3J81 E;  3MO8 A;  4QKU A;  4LDV A;  4M78 B;  1UTI A;  1NJI R;  2X4Y A;  4ELY C;  3BDL A;  2DL5 A;  3EAE A;  1M1K C;  3KFV A;  3RUX A;  4C92 D;  1UGS B;  3UAT A;  1Q82 C;  3CME T;  3D7S B;  3GPL A;  3C4S A;  1VQP A;  1I0C A;  3DB3 A;  1Y07 A;  1Q86 R;  2HZY A;  4J83 A;  2DPP B;  5CAI A;  3RR6 A;  5GAO n;  4C8Q F;  1IXD A;  2CP6 A;  4J6Y A;  2KY9 A;  4M75 G;  3OW2 S;  4BE0 A;  1MHN A;  2JTF A;  3C95 A;  4EPC A;  2ECZ A;  3CCS T;  4PLL A;  1BI0 A;  2RF0 A;  1S72 Q;  1M4Z A;  1U1S A;  1RAF B;  3CCJ T;  1OV3 A;  4F14 A;  3MPU B;  4OMM A;  1OU8 A;  3G4S T;  3OBY A;  2FPE A;  4Z8A A;  1YBY A;  1FXX A;  4A4K A;  2KNB B;  1G83 A;  1WNL A;  2MWP A;  1QCF A;  1R77 A;  1VQ8 T;  4X9C A;  2V1R A;  2MPX C;  4X1V A;  3EG0 A;  4AG1 C;  3QBY A;  5J3B A;  4Y92 A;  1LPL A;  3JRZ A;  2EQM A;  2HQE A;  2RPN A;  5HY6 A;  1VQ5 A;  1IHV A;  2JMA A;  2NUZ A;  4M77 D;  4M7D F;  2PU9 B;  1Z9Q A;  1SEM A;  3VS0 A;  3RER A;  1YIT A;  1UJY A;  4OP0 A;  3A8G B;  1X6G A;  5LJ3 h;  1U1T A;  3GNG A;  5I21 A;  4RTX A;  3CCM T;  3M0Q A;  4HCK A;  5CKF A;  2JS0 A;  1WI7 A;  1UDL A;  2JT4 A;  3CCR T;  4PJO E;  4LNP A;  1K8A U;  5KYU A;  5GMK j;  4C0G A;  1XJW B;  3I9Q A;  3RIR A;  5FU7 C;  3UT1 A;  2KYM A;  1RI0 A;  2DBK A;  5LJ5 f;  5GAN 7;  4N4H A;  4HVV A;  2QEX A;  3AT1 B;  1E6H A;  2QXF A;  4ZN3 A;  4M75 A;  4RTW A;  2GQV A;  2QG9 B;  4C5I A;  2IIM A;  1YHQ T;  1TUC A;  1K8A R;  1FYN A;  2HL3 A;  2RQW A;  2AKK A;  1FX7 A;  4R55 A;  3CPW P;  1EIF A;  3GLX A;  5ECA A;  3OA6 A;  2VXE A;  2K57 A;  1TSF A;  2DZ9 A;  2Y4X A;  2VKN A;  2KRN A;  1RAH B;  1XTD A;  2EYZ A;  2AHJ B;  2DYB A;  1G3Y A;  1TTH B;  4C8Q D;  1JQQ A;  2CP5 A;  5FU6 B;  4FCY A;  4O6J A;  4EMG A;  3OYK A;  3A1P A;  4PJN A;  3CCQ A;  1M2V B;  1NM7 A;  5LJ3 f;  1V1C A;  3VS2 A;  2F2X A;  4M75 C;  4RTV A;  3E1S A;  2MF2 A;  3UA7 A;  4D8D A;  4OB2 B;  4RTY A;  3CEY A;  1N8R C;  3THK A;  1YP5 A;  2LMJ A;  4FYV B;  2DJZ A;  5A0D A;  4DBR A;  1Q82 R;  3FRN A;  5LJ5 e;  2K2V A;  1D1C A;  1VQ6 T;  1YFN A;  4J9E A;  2JVV A;  3MCA B;  3CC7 T;  2FPF A;  1XOV A;  1K0X A;  1M27 C;  5J39 A;  2JTM A;  2E1H A;  1YI2 A;  4C92 E;  2DXC A;  2QA4 Q;  1ABQ A;  3CPW A;  3VV0 A;  3PTA A;  1VQ9 A;  3CBP A;  1IHW A;  4VUB A;  4M7D B;  4HCB A;  4BUG A;  3HRU A;  1T0J A;  3OS0 A;  1B07 A;  5GMK h;  5KCO A;  2CH4 W;  5LJ3 e;  2IG0 A;  2DX1 A;  4OMP A;  3RMS A;  3SFM A;  2K3B A;  1R8O B;  4KUL A;  3QYG B;  4J5Y A;  1LCK A;  1HSQ A;  2YXY A;  1QVG S;  4JLI A;  3EG9 B;  3OB9 A;  2EQK A;  5GAO r;  4XTX A;  3JCM g;  2CP0 A;  4M78 G;  4F7U E;  1W2B S;  1KD1 C;  5GAN 3;  3HFN A;  2AKL A;  1GBQ A;  2QAS A;  2KXD A;  3GNF B;  1C0M A;  7AT1 B;  4M77 E;  5GAN 5;  3I55 T;  2QQS A;  3T9N A;  1X27 A;  4EDU A;  1KG1 A;  4AT1 B;  2RHU A;  4Z88 A;  4FSX A;  1YJN T;  1M90 U;  2FZG B;  1S72 A;  5GMK m;  2KQW A;  2LDM A;  5FLX E;  2MCN A;  4XQ3 A;  3IQL A;  1D0X A;  3F70 A;  4L6V 5;  1YJ9 T;  3PE0 A;  2DEU A;  5GAM f;  4PLI A;  3CCE T;  2FPD A;  2NUP B;  2LJ1 A;  2YUN A;  2RQV A;  4C0D C;  1MV3 A;  3OY9 A;  1M90 R;  1Z9Z A;  3RNJ A;  2PUK B;  4E7J A;  5KYX B;  2RJF A;  2ROT A;  1VYU A;  1VQL Q;  1WQW A;  5LJ5 d;  3G6E Q;  3EGD B;  1WXB A;  2KK4 A;  1QP2 A;  2CP3 A;  2JJ9 A;  1KHC A;  1MMA A;  4FL6 A;  3CXC S;  1WIE A;  2LC4 A;  2HKN A;  3EGX B;  1N8R R;  4M78 A;  4C8Q E;  1M8V A;  3EFS A;  2XU8 A;  2CDT A;  2LZ6 B;  2BTT A;  4DBF A;  1Y0M A;  2KXC A;  2HSE B;  3V8K A;  1WJQ A;  2QGF B;  1PSF A;  1KIK A;  1VQM Q;  4DQ2 A;  3CCV T;  1M3B A;  2JW4 A;  4PFO A;  5LJ3 d;  5I2S A;  4RUG A;  5GAM e;  3MET A;  5HKC A;  1IO6 A;  4J9B A;  5FU7 B;  3X28 B;  3R6N A;  2E6Z A;  3LYI A;  3I5R A;  1KQS S;  4E2F B;  2OTL A;  1M1F A;  2M0O A;  2YRV A;  2CS7 A;  2ZGW A;  2GF7 A;  1NZ9 A;  5HK3 A;  2XI9 A;  4PJO F;  1J3T A;  2K7A A;  2A08 A;  5CKE A;  1ZBX A;  1VQ4 Q;  3PIO A;  4BY6 C;  1WJR A;  5I22 A;  3OYE A;  3OQ5 A;  3H8Z A;  2V8I A;  2RHX A;  1AVZ C;  4MZP A;  4M75 D;  1YJW Q;  3VS6 A;  3A8L B;  2D6F A;  4QQ6 A;  4FU6 A;  2A28 A;  3WVD B;  2F5T X;  3URG A;  2YHT A;  1K9M U;  2VGN A;  1I8F A;  1PM3 A;  4M77 C;  2QA4 A;  4FT4 A;  2KEA A;  2RHZ A;  2DJQ A;  4GLM A;  2EFI A;  4AG2 C;  3LWH A;  2KT8 A;  3PVL A;  3CD6 T;  3MEW A;  1K9M R;  2DK3 A;  4HVU A;  3JCM J;  3PVQ A;  2EW3 A;  2RJC A;  2VGM A;  4BI4 A;  4IUV A;  4MML A;  1XNI A;  2HL5 C;  2MMP A;  1YIT Q;  2A0F B;  4ANJ A;  4C5G A;  5GAN g;  3REA B;  1M3C A;  1NPR A;  2QTX A;  2QQA A;  2YLC A;  2CZ1 B;  3BY7 A;  2OAU A;  2E10 A;  2VVK A;  3UDC A;  3M57 A;  3CC4 A;  4LD6 A;  1D0Z A;  4XTZ A;  1UEB A;  4IKF A;  4FM4 B;  1SHG A;  5GAM d;  2JM8 A;  3GOX A;  3ER0 A;  2GNC A;  1ZBJ A;  1K73 C;  2OTJ Q;  1VQ7 A;  5CVI A;  4OMF B;  1RUW A;  2GFA A;  3MP6 A;  2W0Z A;  3G7Z A;  2D8H A;  3A98 A;  2EGA A;  2HQH A;  1VQP T;  4C92 F;  3M5A A;  1I5L A;  2LQ8 A;  2EKH A;  3A8H B;  4QVD A;  2BUD A;  4LD9 K;  4A4G A;  1ZHI A;  5HK0 A;  3LH5 A;  3PGG A;  2EAY A;  1TXQ A;  1M1G A;  2DTH A;  2E6N A;  2A7Y A;  2BZY A;  5GAO m;  2E12 A;  2YDL A;  2HNI A;  1TWB A;  1MMG A;  3PNW C;  3JB9 G;  1B7T A;  2RMO A;  3CCQ Q;  4PJO B;  1PRM C;  4X9D A;  4M7D A;  3JCM h;  3P8H A;  4M7A G;  2MYS A;  2ZPF B;  1UJ0 A;  1AWX A;  3G71 A;  4J7F A;  4HT9 A;  2FZC B;  1U8R A;  1ZSZ B;  3CCL T;  2QQ9 A;  1KK7 A;  1VQO T;  4PKC C;  4EMK C;  3JSC A;  4F7U F;  4IUP A;  1VUB A;  1H3H A;  3OYG A;  1KQ1 A;  1VQ5 T;  3V7S A;  2J6K A;  2DTO A;  1RLP C;  2P4R A;  2BE9 B;  3E9F A;  2P0Q A;  3CCS Q;  4M77 F;  1P92 A;  4HA8 A;  5IHI A;  2X3X D;  4HCC A;  2DIG A;  2L8D A;  3HRT A;  3OYD A;  4PL6 A;  4QQG A;  1BU1 A;  2J05 A;  4XK8 E;  2X4W A;  4CC3 A;  2F2W A;  3L2R A;  1MNE A;  1B34 B;  1YIJ T;  2DVE A;  4ZN1 A;  1YCY A;  3PIP A;  1QKX A;  2RQR A;  4ESR A;  2KR3 A;  2EYX A;  3M9Q A;  4QW2 A;  3UWN A;  2QEX T;  1IRE B;  3CMA T;  3A8M B;  4M75 E;  3SHW A;  2B86 A;  5FWB A;  2JZ2 A;  3M0S A;  1NLP C;  2JUF A;  3KUF A;  4A54 A;  2CSQ A;  2RHY A;  1SHF A;  1WLP B;  2GTO A;  4NOY A;  2P4T A;  4OGE A;  1Q86 U;  4AMC A;  1MND A;  1O9S A;  1E7O A;  2L3P A;  1ZUY A;  4M7A A;  4MDX A;  1VQK Q;  2NUP A;  5KYW B;  1I07 A;  5GAN 6;  1QLY A;  4GY5 A;  2IPO B;  5L23 A;  4IUQ A;  1H92 A;  4E7K A;  1WHJ A;  4C92 B;  3JCM b;  3LH0 A;  1KC8 U;  1RAC B;  1K76 A;  1JJ2 A;  1RAE B;  1VQ4 A;  3N5B B;  4ME7 A;  4ZNX A;  3H9N A;  3CC2 T;  1QW1 A;  1AD5 A;  2HAX A;  5KYY A;  2K2M A;  2QQB A;  2VXF A;  1JRI A;  2PQW A;  2KYB A;  2YRD A;  4LE9 A;  1YJW A;  3EGX A;  1BIB A;  1K73 R;  1KC8 R;  4BI3 A;  4IIO A;  2YUO A;  4GBQ A;  2FB7 A;  2O9S A;  3M56 A;  4BY6 B;  2JN0 A;  1ZA1 B;  2MK5 A;  1O75 A;  4KUI A;  1H8K A;  9ATC B;  1VQN T;  2H8H A;  3QZ5 B;  1MMN A;  2CKK A;  1TUD A;  5CKB A;  1VA7 A;  2O4X B;  1EX4 A;  1X75 C;  1YI2 T;  4N4I A;  4F7U B;  3LLR A;  2ZPI B;  1GCP A;  2KVQ G;  5CQX A;  2KBT A;  3CPF A;  3UA6 A;  1YWO A;  1FMK A;  1XQH A;  2LP5 A;  2EJ9 A;  2HDA A;  2DER A;  4M77 B;  3ME9 A;  3TRE A;  3L42 A;  3UF4 A;  2QI2 A;  1BI3 A;  3OS2 A;  2AZS A;  2DXU A;  1WJS A;  1SF9 A;  2ENM A;  3EHQ A;  2DMO A;  3AHU A;  1X6B A;  1UB4 A;  4E7H A;  1ACM B;  2Y4Y A;  4DOW A;  4F17 A;  2I2L A;  2ZPH B;  2QDY B;  2PVD B;  4M4Z A;  4IUR A;  2OTJ A;  1QP3 A;  2YSQ A;  1PCX A;  4KGV B;  1KHI A;  5IT9 E;  5C6S A;  2KRO A;  2EKO A;  1AWJ A;  4JRK A;  5EG2 A;  4ELZ C;  5GJV B;  4A4H A;  1NBE B;  2R57 A;  5GAN h;  3V7C A;  2OTL Q;  1PSE A;  1BBZ A;  1S72 T;  1JXM A;  1Y71 A;  2X9H A;  1Q82 U;  2RM4 A;  4C8Q B;  5KCH A;  3MJX A;  2DLP A;  2YWW A;  2KI7 A;  2EPD A;  3ZEH A;  4AFZ C;  2RK2 A;  5KE3 A;  2FHD A;  4PJO G;  1W6X A;  3QXE B;  3CME A;  3OSS C;  1ZSG A;  2DL7 A;  1M1K R;  2C0T A;  3PMI A;  2MWO A;  3SB2 A;  3NPF A;  1D0Y A;  3FJP A;  1F1B B;  4LDX A;  4E7L A;  2PZ1 A;  3CCS A;  4RTT A;  1N27 A;  4J9C A;  3JCM d;  3E9G A;  2LX9 A;  3CCU T;  3M53 A;  3CCJ A;  2G6F X;  2OAW A;  2XKO C;  2ZPE B;  2M16 A;  1PRL C;  1OPK A;  3EHR A;  3JCM W;  3VJP A;  4RMO A;  4EMK B;  3GBQ A;  4M78 E;  1YJ9 Q;  2KSS A;  4NL2 A;  1Y57 A;  1NE8 A;  2DFU A;  3HSB A;  1OEB A;  3EFO B;  4OML A;  4XU2 A;  1ARK A;  1VQ8 A;  1VIE A;  4FT2 A;  3NTH A;  2ROL A;  3L1A A;  2CP2 A;  1QQJ A;  2MI6 A;  2XMF A;  3JB9 I;  3MEU A;  1AHJ B;  4CC7 A;  4HVW A;  1UGV A;  2EYY A;  1UHC A;  3SWN A;  5GAO q;  1YNZ A;  4QT7 A;  2BZX A;  4FYY B;  1PD1 A;  2GBQ A;  2JTE A;  3VRY A;  1VQK A;  2WAC A;  3CCM A;  2DD4 A;  2HSP A;  1TS9 A;  3CC4 Q;  4HT8 A;  4PJO A;  2FL7 A;  3BDU A;  1QVF P;  5IH2 A;  3CCR A;  1QCN A;  2DIQ A;  2MIO A;  4O5V A;  4KGX B;  1S1N A;  1X01 A;  6AT1 B;  1VQ7 Q;  1FMV A;  4N4G A;  1MGQ A;  2W10 A;  2ED1 A;  3OYY A;  4PFP A;  1ZSZ A;  4AFQ C;  3JCM c;  4XTU A;  4YTL A;  4NS5 A;  2E64 A;  5D6W A;  1YHQ A;  1ZUK A;  2FZK B;  1Y96 B;  3OSV A;  3Q1J A;  4RG8 A;  2E5K A;  3QII A;  1U5S A;  2NLU A;  4J6W A;  3X25 B;  4OB0 B;  3QDF A;  3LWI A;  3SWN C;  2JXB A;  1SG5 A;  4FW1 A;  2XD0 A;  3X26 B;  3VS5 A;  3ULR B;  4CC4 B;  4IIM A;  3G1J A;  2HD0 A;  4M75 F;  1BB9 A;  2FEI A;  2A37 A;  1D3B B;  2NWM A;  2H3E B;  1EFN A;  5GAO p;  2F1L A;  3JB9 D;  1B34 A;  2NYS A;  4CI0 C;  2KGT A;  1BI2 A;  3VS4 A;  4J6X A;  5CK9 A;  4WTO B;  4JJN K;  2XG8 D;  1N8R U;  4M7A D;  3QUI A;  3G71 Q;  2QA4 T;  4LDY A;  4BB7 A;  4PK4 A;  2M51 A;  4DBQ A;  4WF2 A;  2D8J A;  3I5S A;  1AZG B;  4IUT A;  2EIF A;  1OPL A;  2DET A;  1QVF A;  3I56 Q;  2FVU A;  3FIF A;  4OGC A;  5CQY A;  2DL8 A;  2YRC A;  2O9V A;  5KE2 A;  2JMC A;  1IB8 A;  3V8L A;  2GQI A;  3DLL A;  1X6O A;  3RKW A;  8ATC B;  1QWE A;  2LVM A;  2XDB A;  2RJD A;  5M9O A;  3CC7 A;  3SEM A;  2YUP A;  2DRK A;  1HJD A;  4J9I A;  4Z89 A;  5GMK e;  3OYH A;  1WHG A;  3EFR A;  4OMQ A;  1NG2 A;  3E2U A;  4BD3 A;  2KAF A;  3FLG A;  1K9A A;  2R58 A;  2EVR A;  1Q7Y C;  3FEO A;  3OMC A;  4KGZ B;  1UG1 A;  1Q81 C;  1TU0 B;  1WHH A;  1V29 B;  1MV0 B;  4HKE A;  3VKI A;  3M58 A;  1K4U S;  3MEA A;  3L2Z A;  3SD4 A;  4M78 C;  4IUU A;  1I5O B;  4RCB A;  5AT1 B;  2COY A;  1NEG A;  1JU5 C;  5LJ5 g;  4J9H A;  4Z02 A;  2L3Q A;  2P84 A;  2DD5 A;  1KD1 U;  1CKB A;  1W1F A;  4V2S A;  2C0O A;  2LTO A;  3M4G A;  3QDR B;  4C8Q G;  5IAY A;  4C5E A;  5KYU B;  1TH7 A;  1C6V X;  4A63 B;  1VQL T;  1KD1 R;  2CZ6 B;  2J7I A;  3I55 A;  3G6E T;  2QGG A;  1SPK A;  3VU3 C;  4CC2 A;  3LGL A;  2CP7 A;  2EGE A;  1ZA2 B;  3QJY A;  2EQU A;  1YJN A;  4M75 B;  4DA4 A;  1SKU B;  4RG2 A;  1KQS P;  1G3S A;  4MZM A;  3TEE A;  5FWC A;  4BAC A;  5LJ3 g;  4KBM B;  2FRW A;  2RQT A;  4XTW A;  1YJ9 A;  3CCE A;  2HCK A;  4LUE A;  1LNX A;  3HPW A;  4TVR A;  4M7D G;  1VQM T;  1OQK A;  5CR2 A;  3NFC A;  4JZ4 A;  2DXT A;  5FRO A;  5KYN A;  2MOX A;  1GFC A;  2E3I A;  1W4S A;  3CBO A;  5GMK l;  4ORZ A;  2KRM A;  1A0N B;  2E3H A;  5EC7 A;  4UC4 A;  4JRQ A;  2FO0 A;  3H0H A;  1WA7 A;  4J7I A;  1M2V A;  2RA2 A;  1NJI C;  2HKQ B;  4C8Q A;  1RL2 A;  4ZTJ A;  1QKW A;  1OZ2 A;  4F16 A;  1KFZ A;  2C06 A;  2E5Q A;  3EH2 A;  3P8B B;  2L0A A;  3JCM X;  4M7A E;  2D1X A;  1IRX A;  1PWT A;  1GCQ A;  1KQS A;  4B9X A;  1AT1 B;  4BI8 B;  2DA9 A;  2LCC A;  2OI3 A;  2LCL A;  2VB6 A;  2GGR A;  4M78 F;  3L2Q A;  1VQ4 T;  5IHN A;  2BZ8 A;  5CCA A;  5AYF A;  4HXJ A;  4OMO A;  1BK2 A;  2LQW A;  2CH4 A;  1SSH A;  1LOJ A;  1RLQ C;  4KH1 B;  1M3A A;  1BCM A;  5FU6 C;  1YJW T;  3J80 E;  2F69 A;  1BCO A;  4LDU A;  1QVP A;  1M8M A;  2Z0W A;  4K11 A;  5IXB A;  2P0P A;  2EQJ A;  2BKD N;  2DL4 A;  2LNH B;  3CME Q;  4JRI A;  2DIL A;  5IN1 A;  4FYX B;  1NEB A;  2VAS A;  1X43 A;  3NMZ C;  1PNJ A;  2P0K A;  4PFZ A;  4C0D B;  4D6W A;  3EG3 A;  3I56 A;  1Y7X A;  1D1A A;  3O8V A;  5LJ5 j;  2DM1 A;  1UGP B;  1JJ2 P;  1B3Q A;  2GFU A;  1OX8 A;  2LT1 A;  1QCO A;  2K79 A;  4Y28 E;  1YIT T;  3EG9 A;  5GAM g;  2X35 A;  3CCJ Q;  1G3W A;  3LX7 A;  2EJF A;  4X34 A;  4CRI A;  3G4S Q;  4M7D C;  3QZ9 B;  3KXT A;  2DYI A;  4LN2 A;  4AFS C;  2X51 A;  3NHN A;  4XU3 A;  1M30 A;  3JB9 J;  1VQ8 Q;  1N6A A;  1T3S A;  3A5Z B;  1K8A C;  4PJL A;  4JJD A;  3CD6 A;  1KJW A;  3QSU A;  2JM9 A;  2OTJ T;  2HMA A;  3GIB A;  3JCM f;  3OYJ A;  5DM7 R;  1V76 A;  3QPH A;  2CT3 A;  3VS1 A;  2E65 A;  2RH2 A;  1KQ2 A;  1H3Z A;  2A36 A;  3CCM Q;  2FRY A;  3U23 A;  4Y91 A;  3CCR Q;  2I0N A;  1JXO A;  5KYX A;  4ZGD B;  4M78 D;  1K73 U;  4E47 A;  4JZ3 A;  3EGD A;  3JV3 A;  1WDX A;  1M5Q 1;  3PT9 A;  5GAN j;  4OF1 A;  3CCQ T;  2AZV A;  3TQ7 P;  3OYA A;  5CKD A;  3OYN A;  3FB9 A;  5I2M A;  3V7R A;  1YHQ Q;  5A2Q E;  1QMC A;  2LJ3 A;  2DF6 A;  1U06 A;  4MMK A;  4J9D A;  4Q5W A;  2J6F A;  1MMD A;  4PJJ A;  1ABO A;  4M7A C;  2DTI A;  4BDZ A;  3JCM e;  5CIU A;  3A8O B;  5LJ5 h;  2WSE E;  4R0K A;  3HRS A;  1GRI A;  2NUT B;  5GAN 2;  1VQ9 T;  1D09 B;  3RKY A;  3OYL A;  1WXU A;  4XU0 A;  2M0Y A;  2LJ0 A;  5FW9 A;  2CYZ B;  5IXF A;  3OW2 P;  3CCL A;  2QYZ A;  3OS1 A;  1JB0 E;  2M02 A;  3V8J A;  1IZ6 A;  1VQO A;  1JBM A;  4HCZ A;  2C0I A;  5GJW B;  5GAO l;  1VOM A;  1VQ6 Q;  1YWP A;  4JLG A;  5DY9 A;  1PKS A;  3CPW S;  4RTZ A;  2D9T A;  4RCC A;  4II1 A;  1X2K A;  2LQK A;  3CCU Q;  2D0N A;  3S3N A;  3CC7 Q;  2EYQ A;  2D0Q B;  5D6X A;  3UPU A;  1VQK T;  1RAA B;  2ZAE A;  2RD1 A;  2YUQ A;  1SSF A;  1IGQ A;  2YT6 A;  3EG1 A;  2DEQ A;  4C0F A;  1BYM A;  1YIJ A;  1G2B A;  1N9S A;  1UGR B;  3DLM A;  3NTK A;  3HTR A;  3JCM V;  3EGU A;  1HD3 A;  3M0R A;  3ZL7 C;  5GAM j;  1AEY A;  1CSK A;  1EZZ B;  3MP1 A;  4DOV A;  4B6M A;  2CUB A;  3CMA A;  4QVZ A;  3OYB A;  4KT0 E;  2ESW A;  3OBW A;  2EWN A;  2X4J A;  3QWY A;  2XID A;  3CBM A;  3SDZ A;  2ZCF B;  1WPY A;  3KBG A;  1M1K U;  2FG0 A;  2ABL A;  2WSC E;  2XHC A;  3VUZ A;  1M90 C;  3OW2 A;  2H3J A;  2EBP A;  1AWW A;  3L2V A;  1G3T A;  1WHL A;  4RTU A;  3QHS A;  2MAM A;  3QYH B;  4C0Z A;  1RAB B;  2E4H A;  5L8R E;  2XDD A;  2DAQ A;  3HL8 A;  2QQR A;  1QWF A;  3JB9 F;  3P8D A;  3RDV A;  5LL6 S;  3I55 Q;  3C94 A;  5I11 A;  1JO8 A;  3CC2 A;  4M7A F;  1NPP A;  2VYT A;  1AWO A;  1YJN Q;  2COW A;  4FYW B;  3INZ A;  2QAZ A;  2Y90 A;  2RI2 A;  3G4S A;  1AOJ A;  5D7U A;  4N0A A;  1ZQ1 A;  1PKT A;  2PVO B;  3CCE Q;  5GAN f;  4OVA A;  2RO0 A;  2CZ7 B;  3MKD A;  1UFF A;  2VUB A;  2L3S A;  3ZBD A;  2HEQ A;  1UHF A;  1VQN A;  5FRM A;  2K5I A;  4BE1 A;  2HQX A;  2OJ2 A;  4EIK A;  3EG2 A;  1QVF S;  5FRN A;  4M7D D;  2E41 A;  2KE9 A;  2G3R A;  1WHM A;  2EQI A;  2K5F A;  3QJ6 A;  3HKS A;  2CGH A;  2RQU A;  1PD0 A;  3VYG A;  2DO3 A;  2V8J A;  1G8X A;  2M1H A;  2LRQ A;  2L89 A;  2F2V A;  2CT4 A;  4JUV A;  5GAM h;  1WHK A;  3GP8 A;  4N0A C;  2OTL T;  3LW5 E;  4JDS A;  1BKB A;  4LUD A;  4PNO A;  4AFU C;  3JCM Q;  4MZT A;  3QWX X;  4JRP A;  3H0F A;  1LJO A;  4C92 G;  3CCV Q;  1R0C B;  1SRL A;  3H41 A;  4J8O A;  5D6Y A;  3FJ5 A;  5GAN e;  2DKG A;  1W70 A;  3OYM A;  1FWZ A;  4A4E A;  4LXC A;  1VYT A;  1VIF A;  3C12 A;  1G5V A;  1RAI B;  1QVG P;  1HYO A;  4PJO C;  2HBP A;  4C5H A;  4E7S A;  2FYK A;  1LVK A;  5CO7 A;  3PMT A;  1UGQ B;  1W2B P;  1WYX A;  2V8K A;  1FMW A;  2ZPB B;  1ZSZ C;  2COZ A;  3M0U A;  4LDW A;  4JPB W;  1IGU A;  1K9M C;  1ZX6 A;  4M7A B;  5GMK i;  1KSW A;  4JS5 A;  4F7U G;  2O2O A;  3H0I A;  3ZFJ A;  5C0M A;  1WX6 A;  1I81 A;  5A0L A;  3VYH B;  2BIV A;  4A53 A;  1AZE A;  1TG0 A;  2DZC A;  4DEY A;  3M4Y A;  4M77 G;  3L2W A;  3TSZ A;  1VQ6 A;  5KYW A;  5KH6 A;  1E6G A;  4XAX B;  2QTV A;  2ZZD A;  2ATC B;  4EMH A;  5KYY B;  3CCU A;  3OYF A;  4OB1 B;  4C92 A;  1R0B G;  2EJG A;  4E7I A;  2XIC A;  2J6O A;  3CC4 T;  5J26 A;  3JB9 H;  2B8A A;  3TSW A;  2VWF A;  3J7A F;  3HFO A;  2LQN A;  3QO3 A;  4XTV A;  4R56 A;  1OI1 A;  3MHX A;  3CD6 Q;  3OYC A;  1QVG A;  1PC0 A;  5GAN 8;  1VQ7 T;  3R6O A;  3M0P A;  1PG5 B;  3M0T A;  4ZTF A;  4QQD A;  1WQ7 A;  3CXC P;  3HP9 A;  2PUO B;  2L5Q A;  1W2B A;  4DBH A;  5GAN 4;  2EYW A;  3PFS A;  3MEV A;  1BIA A;  2X3W D;  3HHT B;  2CZ0 B;  1YN8 A;  3TU4 K;  2RK1 A;  2F5K A;  4C92 C;  2O4X A;  4KRT A;  2RJE A;  2NUT A;  4KUD K;  4F7U A;  3VRZ A;  4J9F A;  2GCX A;  1OYX A;  4JJC A;  5GAN d;  4M7D E;  3MP8 A;  4M77 A;  3NGP A;  3X20 B;  2BE7 D;  3G71 T;  1VQP Q;  1GBR A;  3OS5 A;  2XK0 A;  4ZGE B;  3JCM P;  4JJB A;  2PVG B;  4D8K A;  3S6W A;  3I35 A;  4A4F A;  1YCS B;  3I56 T;  3BW1 A;  4MDW A;  2K4Y A;  3RMQ A;  2RI3 A;  2O31 A;  3CQT A;  4RKU E;  4P5N A;  1WGS A;  5A0G A;  3WXM B;  2DRM A;  1OOT A;  2KRS A;  4L59 A;  2K6D A;  4OB3 B;  3E19 A;  3CXC A;  2K3X A;  4XU1 A;  1M9S A;  2R5M A;  1RI9 A;  2AK5 A;  3QKJ A;  4QVC A;  3JAM E;  3L2U A;  1TUG B;  2RI5 A;  2VC8 A;  2M9U A;  2KT1 A;  3CCL Q;  2O88 A;  2PTK A;  4BDY A;  1CKA A;  2J06 A;  1UE9 A;  4B9W A;  2V1Q A;  1WZO A;  3DKM A;  1VQO Q;  3LGF A;  2DE0 X;  3BFM A;  3TVT A;  2KDS A;  2LCS A;  3S3O A;  1GXI E;  2ED0 A;  1VQ5 Q;  3M55 A;  2K5L A;  3VS7 A;  3DB4 A;  3H6Z A;  4WCI A;  3BE3 A;  1M2O A;  4KH0 B;  4JS4 A;  2EGC A;  2SRC A;  3EH1 A;  4F04 B;  3X24 B;  1GL5 A;  5CKH A;  1MUZ A;  2RN8 A;  2X4X A;  4GLK A;  1RAD B;  3QG1 A;  4OMN A;  1Q86 C;  2SEM A;  3M54 A;  1I4K 1;  1VYV A;  3VS3 A; 
#chains in the Genus database with same CATH homology
 1YIJ Q;  3CCV Q;  1S72 Q;  1Q81 R;  1VQ8 Q;  3CCM Q;  3CC2 Q;  1VQN Q;  3CPW P;  3CC4 Q;  1JJ2 P;  3CCS Q;  1VQ5 Q;  1K73 R;  1VQL Q;  1VQ6 Q;  1K9M R;  1VQP Q;  3G6E Q;  3CCR Q;  1W2B P;  1KC8 R;  1YJN Q;  1QVF P;  3CD6 Q;  1N8R R;  3G71 Q;  3CCJ Q;  1Q86 R;  2QEX Q;  3CME Q;  3CMA Q;  1YI2 Q;  1KQS P;  1YIT Q;  1VQ4 Q;  3CCU Q;  2QA4 Q;  1VQM Q;  3CC7 Q;  1VQ9 Q;  2OTJ Q;  3G4S Q;  1VQ7 Q;  3CXC P;  1M1K R;  1Q82 R;  2OTL Q;  3OW2 P;  3CCL Q;  1Q7Y R;  3I56 Q;  1QVG P;  1YJ9 Q;  1K8A R;  1M90 R;  1VQO Q;  1NJI R;  3CCQ Q;  1KD1 R;  3I55 Q;  1VQK Q;  3CCE Q;  1YHQ Q;  1YJW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...