3CPWP

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cpwP00
1VQ6Q 1VQ4Q 1W2BP 1K8AR 1K9MR 3CXCP 1VQMQ 1YI2Q 1VQ5Q 1YJNQ 1QVFP 3CD6Q 1YITQ 3CCQQ 2QA4Q 1M90R 2OTJQ 3CCMQ 1JJ2P 2OTLQ 1Q81R 3CMAQ 1KD1R 2QEXQ 1VQPQ 3CCJQ 3I56Q 3I55Q 1YJ9Q 1Q7YR 1Q82R 1QVGP 1NJIR 1KQSP 3CC4Q 1VQNQ 3CPWP 3G6EQ 1VQOQ 1K73R 3CCVQ 1YIJQ 1VQ9Q 1VQ8Q 1N8RR 1VQKQ 3CMEQ 3CCLQ 3OW2P 1S72Q 1YHQQ 3CC2Q 1M1KR 3CC7Q 3CCSQ 3G4SQ 1VQLQ 1VQ7Q 3CCUQ 3CCEQ 1Q86R 1KC8R 1YJWQ 3G71Q 3CCRQ
chains in the Genus database with same CATH superfamily
2EVRA 4BY6C 5FWCA 2GTOA 2KBTA 3LWIA 3FB9A 1AHJB 4CRIA 1NJIU 3EG9A 5CIUA 4Z8AA 3OYLA 3PFSA 3M0TA 4PK4A 2AT1B 4BE1A 2B8AA 2EJFA 3L1AA 2MWOA 5KE3A 3GP8A 2DERA 3OYBA 2BTTA 2CYZB 3V7RA 1I4K1 3PTAA 4C0DC 1FX7A 2X4YA 1QKWA 3G71Q 1UB4A 3E9GA 1QCFA 3CBOA 2OTJA 2OAUA 4M78C 3VS7A 3CCMA 2LZ6B 4N0AA 2CSQA 2XDBA 1C6VX 3UPUA 1WA7A 2F1LA 5HCKA 3V7SA 1Q7YR 5IXFA 4CC4B 1YWPA 1FMWA 3V8LA 3EGUA 4TVRA 1Y96B 4M75C 1SRLA 2QEXT 3P8HA 2E5KA 5KCHA 3HRUA 5CQYA 4DBRA 5GANd 4AFZC 3RKXA 2CZ6B 1WXBA 1QVGA 2AZSA 3SB2A 4C8QB 2HQEA 3TEEA 2DIGA 2A7YA 1Z9ZA 3QIIA 5DM7R 2QA4T 4JPBW 1N5ZA 4PJOD 1QVFS 4MMKA 1I5OB 1WHLA 2NUPB 3CMAT 3CCJT 3I56A 2AIRB 3MKDA 1W1FA 2DXUA 3I35A 1PSFA 1X01A 4JJNK 3G6ET 2OTJQ 1D0YA 3CCMQ 1JJ2P 2CZ0B 2A37A 3JV3A 4OMOA 2QAZA 1C0MA 3JSCA 2L0AA 3MEWA 2EWNA 3NTHA 2XHCA 3UDCA 2NWMA 4J9BA 2QG9B 1Q7YU 5AT1B 2AHJB 4F17A 2LJ0A 3A8OB 4QQGA 4FM4B 1VQ7T 1ZBJA 4N4GA 3U23A 1M9SA 2DILA 1SF9A 5GANe 4ORZA 5HK0A 2E3IA 3BDUA 4F16A 4C92G 4J7IA 2DL8A 2DM1A 2JW4A 4JDSA 1YN8A 3CC2T 5GAOr 1YJ9A 2EYZA 1KK7A 5KYWB 4ATOA 1ZSGA 3QDFA 1ZSZB 4PL6A 1OOTA 2YUPA 3I56Q 1X75C 1UECA 1RADB 1YJWA 1V76A 2CT4A 1PRLC 4C92F 2JNGA 5GANg 4QKUA 1UHCA 4D8KA 2JMCA 2HKNA 2HQXA 3JB9H 4R56A 5LJ5h 3EG0A 1E7OA 2DVJA 5IAYA 2HL5C 2QDLA 2JVVA 2P84A 1K73C 2DL7A 2LVMA 2JT4A 1H3HA 1WHKA 1M3CA 3VS4A 2EQKA 3QWXX 4QQ6A 5GAOn 5CK9A 2HAXA 4E7KA 1U1TA 2FO0A 5DLOA 2DYBA 4M7DC 3OYEA 1YITA 1PKSA 2LJ1A 3M53A 1OU9A 3TSZA 3X28B 4M77B 1W70A 5LJ5j 1Q82C 4XU2A 2L3SA 2KVQG 2L2PA 1FXXA 3SHWA 2CP7A 3META 4XTYA 4NOYA 1YJ9Q 2KMTA 1KQSP 1UGRB 3CCUT 4LD6A 2ZPHB 3OW2A 2X4JA 3MEAA 1YI2A 3VYHB 2YUQA 3TREA 1YJWQ 2G6FX 3V7CA 5CCAA 3FC3A 2DEQA 3RR6A 2M51A 3HL8A 4LXCA 5KYUA 2DZCA 1QP2A 1GRIA 1B34B 4HVUA 3OYIA 4P5NA 1OEBA 1GL5A 1MNDA 2C06A 2KROA 2WSFE 3VUZA 2RH2A 1UGSB 1G83A 3ME9A 2QYZA 1BK2A 1YJNA 2R5AA 3X25B 4KUIA 1NLOC 1G5VA 5GJWB 3FLGA 1UFFA 1YITQ 2KSSA 2RQUA 4B9WA 2RO0A 3UF4A 2L8DA 3CCLA 5ECAA 1SHGA 2KRSA 2HBWA 4F7UA 2M0YA 3L2RA 4V2SA 3CPWA 2W10A 3CBPA 2AKLA 3KBGA 2GQVA 1GCPA 2DZ9A 5CR2A 4JRQA 5A0GA 1YI2Q 2Y4YA 3LX7A 3H9NA 1TS9A 2CUDA 1YIJA 3CMET 1D1AA 5LJ3d 1TOVA 2YRVA 2F2VA 4F7UG 3BY7A 3RKWA 1ARKA 1FWZA 1AOJA 1O9SA 2IIMA 2F2WA 3FIFA 2YDLA 2LT4A 4OF1A 3PVLA 3QSUA 2VXFA 2L89A 1YJNQ 1RABB 1WXUA 2LNHB 4F7UF 3LYIA 1B07A 1GCQC 3CC7T 2V8IA 4LE9A 4EIKA 3P8DA 4RG2A 2C0IA 2BE9B 5GANf 3O8VA 3CCLQ 3HFOA 4PJOG 1T0HA 1R0CB 4OP0A 3JB9G 1X43A 5GAMh 3VUBA 3QYHB 1OX8A 4EMKB 1HSQA 1V1CA 3L2QA 2VC8A 4MMLA 6AT1B 2E65A 2LQKA 1WQ7A 3EG3A 1YIJQ 3M57A 3JB9F 3M0SA 1BB9A 3M56A 2KDSA 3CD6T 4DBFA 5LJ3e 2FZGB 4M75A 1TU0B 4BDYA 4KUDK 5GAMj 4FIBA 1JXOA 4WF2A 7AT1B 1WX6A 1VQNT 4L59A 1QLYA 2XD0A 4IIOA 1NEBA 2DL4A 3OA6A 4EMHA 1K73R 3EFSA 2DTIA 5CKHA 2CP2A 1VQ6A 1NG2A 1ZX6A 4M75G 5LJ3g 2KYMA 4LDVA 4JLIA 2D0NA 4II1A 4ELYC 4OGCA 4C92C 2V1QA 4JS5A 1SKUB 3Q1JA 4PJNA 2COYA 1Q82R 2B86A 3OYNA 3CCSA 1VYVA 3RESA 4E47A 4M75F 2EBPA 2E10A 5GMKi 4RCBA 3DB3A 1SSHA 1QWFA 5IN1A 1N9RA 1IRXA 2PNIA 1KHCA 1M8VA 2RHXA 2LCSA 2P0KA 4PKCC 4EMGA 1IB8A 2LCLA 2BZYA 3G4ST 3GOXA 2DE0X 3TSWA 2QTVA 1LJOA 1EZZB 1QP3A 3QUIA 2LRQA 3OYDA 2WACA 3RUXA 3GIBA 1VQMT 4C8QE 3OYGA 4B9XA 1VQ6Q 2JJ9A 2RMOA 1K73U 5GMKm 2DXCA 1Y0MA 2JTEA 3C4SA 5KYUB 3CCSQ 4Z89A 1VQ5T 2EW3A 3A1PA 5CVIA 3R6NA 1KQSS 2JN0A 1Q82U 3P8BB 1GFCA 5DLQE 4ZTFA 2D6FA 3EFOA 1YHQT 2DPPB 3A8LB 5D6XA 3QKJA 5GAOm 4E7HA 5GMKl 4RUGA 4M7DA 3M0PA 4L5GA 2DD4A 1Y07A 2SRCA 2E6NA 3HRTA 1AZGB 2O01E 4HVVA 3URGA 2QTXA 2LX7A 3OY9A 5GJVB 2GQIA 4KH0B 1M3BA 4OMQA 2XICA 4J5YA 1K8AC 3T9NA 4JS4A 4N4IA 5GANh 3ZBDA 4QVCA 4MDXA 1WHJA 3GPLA 2XK0A 5GAOl 4GBQA 3SWNB 1M4ZA 1BYMA 1PNJA 4JJDA 2IPOB 2QXFA 4XTXA 1PD1A 2D8HA 4BY6B 1WJRA 3C95A 2A36A 2CH4W 3QPHA 2GFUA 3L2WA 1AWWA 4FU6A 4MZMA 1VQ4T 3PNWC 5LJ3f 1JU5C 2CGHA 2ZPBB 3CCQA 2X4WA 3M0RA 3JB9J 5D6WA 5GANj 1WPYA 4C0DB 2OJ2A 5CO7A 4XK8E 2QEXA 2CZ1B 2M02A 3CC4T 5GMKe 4M78B 4QQDA 4M77E 3VJPA 3NTKA 3VS1A 5CQXA 4RTYA 4OMMA 1JXMA 1FYNA 1NLPC 1WGSA 5IT9E 1NYFA 3EAEA 2DBMA 1OU8A 4PJOC 2OAWA 2GBQA 1H8KA 1OPLA 3OYYA 3VS6A 1AWXA 1X6BA 1S72T 1N8RC 2NYSA 2SEMA 2J6KA 4J9FA 2GGRA 1SPKA 4RTVA 2O9VA 1K4US 2ROTA 3A8GB 2KAFA 5FW9A 4RKUE 2KY9A 4KH1B 1KG1A 1SHFA 3H6ZA 2D0QB 4LDUA 4O5VA 2F5TX 3H0IA 4AMCA 1M8MA 1XOVA 2JUFA 3CCQQ 1GCQA 3EHQA 2CDTA 8ATCB 2QEXQ 4CC3A 1W4SA 1PWTA 2AZVA 3N5BB 1AEYA 4L6V5 4AG1C 3BW1A 3A98A 2XIDA 1ZA2B 3EH1A 4IUUA 4E7JA 1UEBA 1PCXA 2DL5A 1K9MC 4M7AD 1V29B 3JCMJ 1Y71A 1QVPA 2FL7A 1X27A 2DL3A 4EPCA 1D0ZA 4GLKA 4A4GA 2DFUA 4HCCA 2KYBA 2J06A 2HMAA 2ESWA 2AK5A 2HNIA 3C12A 1IZ6A 3G71T 4JJBA 3NMZC 1E6GA 3DKMA 3LLRA 4RTUA 1X6GA 2Z0WA 2EKHA 2FZCB 2DA9A 3HTRA 2GF7A 2DX1A 3OMCA 2L3RA 3L42A 2QQ9A 3E9FA 2C0OA 3GLXA 4CC7A 3CCVA 1BIAA 5LL6S 2DK3A 3JCMb 1NYGA 4O6JA 3LW5E 1Z9QA 3NTIA 4CI0C 4J83A 2D9TA 2PVOB 3EG1A 2LC4A 4BDZA 4KBMB 1VYTA 4C92A 1YWOA 1TH7A 2XG8D 5FU6C 4E2FB 4A4HA 4A63B 3RBBB 1G2BA 1VQ8A 1JEGA 4MDWA 1K9AA 3JCMd 1M5Q1 3CCUA 4C0FA 5GAN8 2WSEE 1TXQA 4RTTA 3RKYA 1MHNA 4M78D 4ZGJB 1M90C 2OTJT 3CCMT 3GBQA 1K8AR 1JO8A 1MMNA 4IURA 3RMSA 4M7DB 4C5IA 3S3OA 3RIRA 1AT1B 2NUTA 3LH0A 2ZPGB 3CEYA 1VQLA 3REBB 3CCVQ 2EQMA 5HKCA 2PUOB 3CCRA 3JCMX 1Y7XA 2LCCA 2CZ7B 5LJ3h 3UWNA 2OTLA 2WSCE 5GAN7 2ZPEB 2V8JA 1IGQA 1VQOA 2KT8A 1RAEB 2E41A 2FVUA 2HBPA 1AD5A 1IHVA 4X1VA 1WXTA 2CT3A 1VQ8Q 1K76A 1WI7A 3OS2A 4BI8B 1VIFA 3FJPA 1EX4A 3CCUQ 2VB6A 5A0DA 2DTHA 1AWOA 5LJ3j 3I56T 4NS5A 3A5ZB 4D6WA 1ZUKA 2ABLA 1I5LA 3QZ9B 4R0KA 1BCOA 1WNLA 1YNZA 4RCCA 2RQWA 1N8RR 2DMOA 4LUEA 5I11A 1VQLQ 1K8AU 1NEGA 2J7IA 1SEMA 3CCRQ 3SDZA 3EGDA 4RG8A 5CAIA 2CP0A 1XNIA 3CPWS 3CXCA 2ZPFB 2JZ2A 2RNAA 3S6WA 2OTLQ 4C8QD 3VU3C 2MYSA 3J80E 3HKSA 2K2VA 2RI2A 2O31A 4C5EA 2RQRA 3UATA 1VQOQ 2JM8A 2K5FA 3EG9B 4OMPA 2CP5A 1HK9A 4HCBA 1S1NA 1OI1A 3THKA 5IHKA 4XTUA 2YT6A 1ACMB 2Y90A 1K9MR 1YJ9T 1X6OA 3QDRB 4DOVA 3I55A 3E2UA 4JJCA 1W2BA 3M5AA 4M4ZA 4FSXA 1RAAB 4M7AE 5FLXE 1E6HA 2Y4XA 2H8HA 3G1JA 1MV3A 1YJWT 4J9CA 5KYYA 1NM7A 3EG2A 1M2VA 1OX9A 1TUCA 4J9GA 1I0CA 2KEAA 1VQPA 2O4XA 1BI3A 2L5QA 5KYNA 4BI4A 3PMTA 4Y28E 1U8RA 1K1ZA 3CCEA 4M7AG 1H3ZA 1M1GA 1RI0A 3I5SA 4A4KA 2JXBA 1YITT 4PJOA 4OVAA 2YUOA 2EQUA 4XTZA 2BKDN 1KD1C 2EJ9A 3CQTA 3FDRA 1GBRA 1VQ9A 2KE9A 2EYXA 2PQWA 2QGGA 3I55Q 2P0PA 1UE9A 1PM3A 1A0NB 3MEUA 5M9OA 1K9MU 2EFIA 1YI2T 2IG0A 4N4HA 4A4EA 4QVZA 2KQWA 2FZKB 3CPFA 1M90R 2P4TA 4KULA 1EIFA 1BIBA 2RB6A 4HKEA 1VQPQ 3FRNA 4FYXB 1QVGP 4C92B 1H92A 5L8RE 3OB9A 4PJOF 4M78E 3TCJA 1YP5A 3QO3A 2LX9A 4M77D 2KT1A 1YJNT 1VQMA 2E5QA 2VVKA 3CCEQ 3VS2A 4A4FA 3OBWA 1UTIA 1J3TA 2HDAA 3D7SB 3VKIA 4AG2C 4OMLA 4KRTA 1WLPB 3CBMA 4ZGEB 5HK3A 3CCLT 5GMKh 1SRMA 4BI3A 1Y57A 1VQ9Q 1QQJA 1WJSA 2QQSA 1OPKA 2PUKB 2RA2A 2NUTB 1RACB 5FU7C 2HSPA 3FJ5A 1G3YA 4ELZC 2EYYA 1WFWA 3LH5A 5J39A 4PFZA 1PHTA 1YIJT 4KGXB 2E3HA 4CC2A 4PJJA 3OYAA 2RJFA 3PGGA 4GY5A 2HL3A 9ATCB 5GMKj 2MPXC 3GF5A 2VYTA 5FROA 2ZCFB 2XI9A 4XU3A 2HEQA 4PNOA 3VYGA 5KYXA 3MJXA 2RQVA 1M90U 1WDXA 1KJWA 3WVDB 4J9DA 1K0XA 2JS2A 1RLPC 4HT8A 1VQMQ 1VQKA 2VGMA 2FPDA 1NPPA 4WTOB 2ED1A 5CKEA 3MEVA 2JS0A 1CKBA 1JJ2A 1ZUYA 3M4GA 2FYKA 2RHUA 1VOMA 4XU1A 2JTMA 3SEMA 3O5ZA 2KK4A 1D09B 1PKTA 2COWA 1JB0E 1OZ3A 2PVDB 1WZOA 1X2QA 2DJZA 2YLBA 3JCMQ 4DQ2A 2ECZA 2LQNA 2K3XA 2KXCA 3EGDB 3OBYA 2NUPA 2XMFA 1IGUA 2W0ZA 1D0XA 1ZUUA 2FG0A 4C0ZA 1UGPB 5AYFA 1X2KA 2X9HA 3VRYA 3V8JA 1KIKA 1FMKA 3OSSC 2P0QA 4C8QG 2DTOA 3M0QA 4E6RA 4FCYA 8AT1B 2MK5A 1M3AA 3REAB 3LGFA 3QG1A 4DEYA 5GAMd 1VQKQ 3JAME 2E64A 4PFPA 3M0UA 1KC8C 3OW2P 1VQ6T 1PRMC 2ZPIB 1ABOA 3UT1A 2X4XA 2MCNA 3A8MB 4XQ3A 5IHIA 4C8QF 2C0TA 2RHIA 3CXCP 2QGFB 4F7UB 4BB7A 1BCMA 5KYYB 2MWPA 3M58A 1KD1R 4ZTJA 4M7DE 3CCST 4QT7A 4AFUC 3L2UA 3H0HA 2ROLA 2O4XB 2K5IA 2M9UA 2MOXA 2DYIA 4C5HA 5KYWA 2JTFA 1UHFA 2FPEA 4FW2A 3MHXA 1KQ1A 1RI9A 2HD0A 2OI3A 4QW2A 2O9SA 2DAQA 2DNUA 2MMPA 4PJOB 1LOJA 1LPLA 1HD3A 4C0GA 2D8JA 3CPWP 1DJ7B 4AFQC 1KQSA 5FRMA 2X3XD 4M7AC 4AT1B 1KQ2A 3AT1B 4NL3A 2H3EB 5KH6A 3GNGA 2EKOA 3NPFA 4KGVB 3SD4A 2DXTA 3RMQA 4F14A 5CKFA 1ZLMA 1U06A 2EJGA 2CREA 3FEOA 1TSFA 2BZ8A 3PIOA 2ZAEA 4M77A 1MGQA 2YXYA 2DF6A 2RM4A 5GAMg 2G3RA 1B3QA 2QA4A 1F1BB 3CMAA 1KD1U 3CCJA 4AFSC 2I2LA 2K7AA 3G6EA 2GNCA 3J81E 1OYXA 4M75B 2LQWA 1M1KC 1WHHA 1ZBXA 4M77G 2YRDA 2KXDA 5C0MA 2VXEA 4FL6A 3QWYA 1B34A 4HVWA 4J9EA 4K11A 2O88A 1QVGS 2LMJA 2M16A 3UA7A 1AZEA 2DJQA 1BI0A 3LWHA 4DA4A 4M77F 1TG0A 1PD0A 3BFMA 4J6YA 2XU8A 4ZNXA 1GFDA 3ZFJA 5GAN5 1VQ7A 3OMGA 1Q81C 5GAOq 3RERA 4QVDA 2K79A 4BE2A 1ABQA 2LDMA 5EC7A 2KR3A 1UJ0A 4LN2A 1KFZA 3CC2A 1WHGA 2QA4Q 4OB3B 5KYXB 4X34A 4LUDA 4J6XA 2QQBA 3CMAQ 1NPRA 3C94A 3CCJQ 1QW1A 5FU6B 2DBKA 2L3PA 1P92A 2YRCA 3G6EQ 1RL2A 1KSWA 3JCMP 3VS5A 4XU0A 2X51A 4IUVA 5KE2A 4RMOA 1CSKA 3CCQT 2FRYA 3M55A 3LGLA 2O2OA 3EFRA 1UGVA 5GAN2 3NHNA 1BBZA 2HQHA 1LCKA 2DRKA 2DEUA 1R77A 3J7AF 4VUBA 2HKQB 3ULRB 3ASKA 3PIPA 3NGPA 2ENMA 3EGXA 1PG5B 2VV5A 4X9CA 1OQKA 1UUEA 1VQ7Q 1MMGA 2HZYA 1KC8R 2PTKA 1YCSB 1BU1A 1LNXA 1RAHB 1G3SA 2LT1A 4FYWB 3JB9D 1RAIB 5IXBA 2JMAA 5FWBA 1D1CA 5J3BA 2GTJA 1LVKA 3CC2Q 1VA7A 2VGNA 2DO3A 4DOWA 4EMKA 4HA8A 3PMIA 4C92E 2F69A 2PVGB 1I81A 3EFOB 1G8XA 1BKBA 1D3BA 1BI2A 5D6YA 4OMFB 2LTOA 1M27C 1ZHIA 4A53A 3OYMA 1U5SA 3INZA 4IUQA 3MP1A 4E7IA 4C8QC 4DEXA 1XQHA 3H0FA 1GBQA 1N6AA 3M9QA 2NUZA 1QVFA 1ZA1B 4LNPA 5GAMf 4JUVA 5GAN6 2X3WD 3TU4K 1HXDA 2BUDA 3JRZA 5CKBA 1IREB 5I2SA 4J9HA 3A8HB 4M75D 3L2ZA 4ESRA 1SSFA 2RN8A 3DB4A 5GAN4 3OW2S 3WVEB 3X26B 2RQTA 2FHDA 4DBQA 1TTHB 3H8ZA 3OYCA 3CXCS 2K4YA 1UDLA 1KC8U 1SG5A 4KT0E 1YFNA 3HP9A 4MZPA 1RAFB 1WYXA 2A28A 3JCMe 3WXMB 1C1AA 2J6FA 3HFNA 1CKAA 1O75A 5I22A 3OYFA 2HCKA 4JLGA 3VS3A 4ANJA 3CCVT 4Z02A 3CMEA 4D8DA 4E7SA 3F70A 1XTDA 2NLUA 4HCZA 4LDYA 1YBYA 1W2BS 1M1KR 1AWJA 4LDXA 3AHUA 3MCAB 2K3YA 3JCMg 2OX7A 4C5GA 1ZSZC 2LP5A 2DD5A 2KRNA 2R58A 2RF0A 2GFAA 3UA6A 1VQ8T 4OB0B 2FB7A 5DY9A 2VWFA 1I8FA 2PZ1A 4WCIA 4Z88A 3CC7A 2VKNA 2COZA 2R5MA 1VYUA 5L23A 3QJYA 1VIEA 1MUZA 2P4RA 2V8KA 1EFNA 1G3TA 1WJQA 2K5LA 1Q81R 2CSIA 1IHWA 2XDDA 4XTVA 2V26A 2EQIA 4ZN3A 1N9SA 1AVZC 4FT2A 3QZ5B 3OS1A 1VQLT 1RAGB 3H41A 4BACA 4JZ4A 5GAOp 3CCRT 1IXDA 3CMEQ 5GAN3 1VUBA 4M7AA 2QASA 1TWBA 1W6XA 1T3SA 2EPDA 3HPWA 4M77C 3QHSA 3CD6A 2JOYA 2F2XA 4J6WA 2KNBB 2OTLT 4Y91A 2IVWA 1VQNA 1TUGB 2GCXA 3OYHA 4B6MA 4F7UE 1VQOT 4JRKA 2E70A 1N8RU 1M1KU 1YCYA 2F5KA 4E7LA 1G3WA 4JZ3A 1Q86C 3CC7Q 4OGEA 4J8OA 2ED0A 4BD3A 3RDVA 4M7DD 3DLLA 3IQLA 3BDLA 3HRSA 2BIVA 4X9DA 1GXIE 5IH2A 3X20B 4ZGDB 2CUBA 4M7AF 2VASA 5LJ5d 2DIQA 3OQ5A 3M59A 4PJOE 4IIMA 3SWNA 1T0JA 3PVQA 4YTLA 1Q81U 2J05A 2K3BA 2I0NA 2RJDA 4Y92A 3TQ7P 3EHRA 5A2QE 3BE3A 2YSQA 2H3JA 2MI6A 3EGXB 2QI2A 4E7ZA 4BUGA 5FU7B 1NE8A 1H641 3CD6Q 1NJIC 1IO6A 4JRPA 2FRWA 1PSEA 4N0AC 4RTXA 3TVTA 3PT9A 4J9IA 4PJLA 2KRMA 5HY6A 1VQNQ 3G4SA 2X35A 3ZL7C 4EDUA 4OMNA 2DRMA 3V8KA 3E19A 1MV0B 4M78A 2E6ZA 5C6SA 2KI7A 5D7UA 4LD9K 2RI3A 1I1JA 4XTWA 3I55T 2QK0A 2CS7A 4FYYB 1FMVA 1UG1A 1QCOA 3G7ZA 2YUNA 1D3BB 1MMDA 2LJ3A 2L3QA 4M75E 2RK1A 4RTZA 4M78G 3JCMf 1VQ5A 5LJ5e 4PLIA 3HHTB 3JCMV 2QDYB 1JJ2S 3KFVA 3M4YA 3L2VA 2CH4A 1VQPT 2DLPA 4RTWA 3VS0A 2YHTA 4UC4A 3ER0A 4GLMA 1MNEA 4FYVB 1YHQA 4FW1A 3QJ6A 1OZ2A 4M78F 4HCKA 3CCET 4IKFA 1JRIA 3OSVA 1B7TA 2LQ8A 2BZXA 2E1HA 2DETA 2K57A 3G4SQ 2VUBA 4EMKC 3OYKA 1WHMA 5LJ5g 2RPNA 4IUTA 4FSSA 2RHZA 5A0LA 2R57A 4ME7A 2K6DA 3S3NA 1UGQB 4PLLA 1VQ9T 1RLQC 4R55A 1RUWA 4FT4A 1BI1A 4OB2B 1XJWB 1QVFP 3GNFB 1Y96A 2CP6A 2A08A 1WIEA 2RD1A 2ZZDA 2V1RA 4JRIA 2AKKA 2MAMA 3HSBA 1QKXA 4A54A 1HJDA 1VQ5Q 3R6OA 1Q7YC 4C8QA 2FPFA 1UJYA 2RK2A 1K0SA 2EYQA 3ZEHA 2ZGWA 3VRZA 3X24B 2A0FB 4XAXB 3SFMA 5I21A 4HT9A 1NZ9A 1YHQQ 2D1XA 1U3OA 3EH2A 1VQ4A 1R8OB 3MO8A 1X69A 1TUDA 2K2MA 4LDWA 2EGCA 2QQRA 3OYJA 1Q95G 1QMCA 3MP8A 2FEIA 2EGEA 5J26A 3CC4A 4KGZB 3MP6A 2CP3A 2E4HA 2EGAA 3JCMc 2XKOC 1WQWA 2EIFA 1I07A 2M0OA 2EQJA 1Q86R 1OV3A 1HYOA 4OB1B 4M7AB 1N27A 3KUFA 4C92D 4BE0A 1M2VB 1M2OA 2LNVA 1KHIA 1S72A 5FRNA 5I2MA 1U1SA 2A3LA 2KGTA 4IUPA 3JB9I 2K9GA 2DKGA 1ZSZA 3OS5A 2J6OA 1VQ4Q 2RJEA 1W2BP 1VQKT 1NBEB 3QBYA 2M1HA 4Q5WA 3E1SA 5IHNA 2EAYA 3RNJA 1D1BA 3QYGB 5EG2A 1NJIR 5KCOA 3CC4Q 2QQAA 4M7DG 3NFCA 3KXTA 2HSEB 4PFOA 4F04B 1T3LA 2MIOA 5GAMe 2RJCA 2XDPA 2RHYA 5CKDA 1QWEA 2YWWA 4PJMA 1ZQ1A 4NL2A 4J7FA 3I9QA 1R0BG 2ATCB 3S3MA 4MZTA 1JQQA 1M30A 2DVEA 4M7DF 2PU9B 3JCMW 3C0CA 2YLCA 3I5RA 1Q86U 3G71A 1S72Q 3VV0A 1QCNA 2EYWA 5LJ5f 3MPUB 3M54A 2JM9A 4ZN1A 4DBHA 4HXJA 1M1FA 3DLMA 3JCMh 3QXEB 2E12A 3PE0A 1OULA 3OS0A 1MMAA 2CKKA 2MF2A 2BE7D 2RI5A 1JBMA 2DXBA 3SWNC 1PC0A
chains in the Genus database with same CATH topology
1VQ6Q 1VQ4Q 1W2BP 1K8AR 1K9MR 3CXCP 1VQMQ 1YI2Q 1VQ5Q 1YJNQ 1QVFP 3CD6Q 1YITQ 3CCQQ 2QA4Q 1M90R 2OTJQ 3CCMQ 1JJ2P 2OTLQ 1Q81R 3CMAQ 1KD1R 2QEXQ 1VQPQ 3CCJQ 3I56Q 3I55Q 1YJ9Q 1Q7YR 1Q82R 1QVGP 1NJIR 1KQSP 3CC4Q 1VQNQ 3CPWP 3G6EQ 1VQOQ 1K73R 3CCVQ 1YIJQ 1VQ9Q 1VQ8Q 1N8RR 1VQKQ 3CMEQ 3CCLQ 3OW2P 1S72Q 1YHQQ 3CC2Q 1M1KR 3CC7Q 3CCSQ 3G4SQ 1VQLQ 1VQ7Q 3CCUQ 3CCEQ 1Q86R 1KC8R 1YJWQ 3G71Q 3CCRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 Q;  1VQ4 Q;  1W2B P;  1K8A R;  1K9M R;  3CXC P;  1VQM Q;  1YI2 Q;  1VQ5 Q;  1YJN Q;  1QVF P;  3CD6 Q;  1YIT Q;  3CCQ Q;  2QA4 Q;  1M90 R;  2OTJ Q;  3CCM Q;  1JJ2 P;  2OTL Q;  1Q81 R;  3CMA Q;  1KD1 R;  2QEX Q;  1VQP Q;  3CCJ Q;  3I56 Q;  3I55 Q;  1YJ9 Q;  1Q7Y R;  1Q82 R;  1QVG P;  1NJI R;  1KQS P;  3CC4 Q;  1VQN Q;  3CPW P;  3G6E Q;  1VQO Q;  1K73 R;  3CCV Q;  1YIJ Q;  1VQ9 Q;  1VQ8 Q;  1N8R R;  1VQK Q;  3CME Q;  3CCL Q;  3OW2 P;  1S72 Q;  1YHQ Q;  3CC2 Q;  1M1K R;  3CC7 Q;  3CCS Q;  3G4S Q;  1VQL Q;  1VQ7 Q;  3CCU Q;  3CCE Q;  1Q86 R;  1KC8 R;  1YJW Q;  3G71 Q;  3CCR Q; 
#chains in the Genus database with same CATH topology
 2EVR A;  4BY6 C;  5FWC A;  2GTO A;  2KBT A;  3LWI A;  3FB9 A;  1AHJ B;  4CRI A;  1NJI U;  3EG9 A;  5CIU A;  4Z8A A;  3OYL A;  3PFS A;  3M0T A;  4PK4 A;  2AT1 B;  4BE1 A;  2B8A A;  2EJF A;  3L1A A;  2MWO A;  5KE3 A;  3GP8 A;  2DER A;  3OYB A;  2BTT A;  2CYZ B;  3V7R A;  1I4K 1;  3PTA A;  4C0D C;  1FX7 A;  2X4Y A;  1QKW A;  3G71 Q;  1UB4 A;  3E9G A;  1QCF A;  3CBO A;  2OTJ A;  2OAU A;  4M78 C;  3VS7 A;  3CCM A;  2LZ6 B;  4N0A A;  2CSQ A;  2XDB A;  1C6V X;  3UPU A;  1WA7 A;  2F1L A;  5HCK A;  3V7S A;  1Q7Y R;  5IXF A;  4CC4 B;  1YWP A;  1FMW A;  3V8L A;  3EGU A;  4TVR A;  1Y96 B;  4M75 C;  1SRL A;  2QEX T;  3P8H A;  2E5K A;  5KCH A;  3HRU A;  5CQY A;  4DBR A;  5GAN d;  4AFZ C;  3RKX A;  2CZ6 B;  1WXB A;  1QVG A;  2AZS A;  3SB2 A;  4C8Q B;  2HQE A;  3TEE A;  2DIG A;  2A7Y A;  1Z9Z A;  3QII A;  5DM7 R;  2QA4 T;  4JPB W;  1N5Z A;  4PJO D;  1QVF S;  4MMK A;  1I5O B;  1WHL A;  2NUP B;  3CMA T;  3CCJ T;  3I56 A;  2AIR B;  3MKD A;  1W1F A;  2DXU A;  3I35 A;  1PSF A;  1X01 A;  4JJN K;  3G6E T;  2OTJ Q;  1D0Y A;  3CCM Q;  1JJ2 P;  2CZ0 B;  2A37 A;  3JV3 A;  4OMO A;  2QAZ A;  1C0M A;  3JSC A;  2L0A A;  3MEW A;  2EWN A;  3NTH A;  2XHC A;  3UDC A;  2NWM A;  4J9B A;  2QG9 B;  1Q7Y U;  5AT1 B;  2AHJ B;  4F17 A;  2LJ0 A;  3A8O B;  4QQG A;  4FM4 B;  1VQ7 T;  1ZBJ A;  4N4G A;  3U23 A;  1M9S A;  2DIL A;  1SF9 A;  5GAN e;  4ORZ A;  5HK0 A;  2E3I A;  3BDU A;  4F16 A;  4C92 G;  4J7I A;  2DL8 A;  2DM1 A;  2JW4 A;  4JDS A;  1YN8 A;  3CC2 T;  5GAO r;  1YJ9 A;  2EYZ A;  1KK7 A;  5KYW B;  4ATO A;  1ZSG A;  3QDF A;  1ZSZ B;  4PL6 A;  1OOT A;  2YUP A;  3I56 Q;  1X75 C;  1UEC A;  1RAD B;  1YJW A;  1V76 A;  2CT4 A;  1PRL C;  4C92 F;  2JNG A;  5GAN g;  4QKU A;  1UHC A;  4D8K A;  2JMC A;  2HKN A;  2HQX A;  3JB9 H;  4R56 A;  5LJ5 h;  3EG0 A;  1E7O A;  2DVJ A;  5IAY A;  2HL5 C;  2QDL A;  2JVV A;  2P84 A;  1K73 C;  2DL7 A;  2LVM A;  2JT4 A;  1H3H A;  1WHK A;  1M3C A;  3VS4 A;  2EQK A;  3QWX X;  4QQ6 A;  5GAO n;  5CK9 A;  2HAX A;  4E7K A;  1U1T A;  2FO0 A;  5DLO A;  2DYB A;  4M7D C;  3OYE A;  1YIT A;  1PKS A;  2LJ1 A;  3M53 A;  1OU9 A;  3TSZ A;  3X28 B;  4M77 B;  1W70 A;  5LJ5 j;  1Q82 C;  4XU2 A;  2L3S A;  2KVQ G;  2L2P A;  1FXX A;  3SHW A;  2CP7 A;  3MET A;  4XTY A;  4NOY A;  1YJ9 Q;  2KMT A;  1KQS P;  1UGR B;  3CCU T;  4LD6 A;  2ZPH B;  3OW2 A;  2X4J A;  3MEA A;  1YI2 A;  3VYH B;  2YUQ A;  3TRE A;  1YJW Q;  2G6F X;  3V7C A;  5CCA A;  3FC3 A;  2DEQ A;  3RR6 A;  2M51 A;  3HL8 A;  4LXC A;  5KYU A;  2DZC A;  1QP2 A;  1GRI A;  1B34 B;  4HVU A;  3OYI A;  4P5N A;  1OEB A;  1GL5 A;  1MND A;  2C06 A;  2KRO A;  2WSF E;  3VUZ A;  2RH2 A;  1UGS B;  1G83 A;  3ME9 A;  2QYZ A;  1BK2 A;  1YJN A;  2R5A A;  3X25 B;  4KUI A;  1NLO C;  1G5V A;  5GJW B;  3FLG A;  1UFF A;  1YIT Q;  2KSS A;  2RQU A;  4B9W A;  2RO0 A;  3UF4 A;  2L8D A;  3CCL A;  5ECA A;  1SHG A;  2KRS A;  2HBW A;  4F7U A;  2M0Y A;  3L2R A;  4V2S A;  3CPW A;  2W10 A;  3CBP A;  2AKL A;  3KBG A;  2GQV A;  1GCP A;  2DZ9 A;  5CR2 A;  4JRQ A;  5A0G A;  1YI2 Q;  2Y4Y A;  3LX7 A;  3H9N A;  1TS9 A;  2CUD A;  1YIJ A;  3CME T;  1D1A A;  5LJ3 d;  1TOV A;  2YRV A;  2F2V A;  4F7U G;  3BY7 A;  3RKW A;  1ARK A;  1FWZ A;  1AOJ A;  1O9S A;  2IIM A;  2F2W A;  3FIF A;  2YDL A;  2LT4 A;  4OF1 A;  3PVL A;  3QSU A;  2VXF A;  2L89 A;  1YJN Q;  1RAB B;  1WXU A;  2LNH B;  4F7U F;  3LYI A;  1B07 A;  1GCQ C;  3CC7 T;  2V8I A;  4LE9 A;  4EIK A;  3P8D A;  4RG2 A;  2C0I A;  2BE9 B;  5GAN f;  3O8V A;  3CCL Q;  3HFO A;  4PJO G;  1T0H A;  1R0C B;  4OP0 A;  3JB9 G;  1X43 A;  5GAM h;  3VUB A;  3QYH B;  1OX8 A;  4EMK B;  1HSQ A;  1V1C A;  3L2Q A;  2VC8 A;  4MML A;  6AT1 B;  2E65 A;  2LQK A;  1WQ7 A;  3EG3 A;  1YIJ Q;  3M57 A;  3JB9 F;  3M0S A;  1BB9 A;  3M56 A;  2KDS A;  3CD6 T;  4DBF A;  5LJ3 e;  2FZG B;  4M75 A;  1TU0 B;  4BDY A;  4KUD K;  5GAM j;  4FIB A;  1JXO A;  4WF2 A;  7AT1 B;  1WX6 A;  1VQN T;  4L59 A;  1QLY A;  2XD0 A;  4IIO A;  1NEB A;  2DL4 A;  3OA6 A;  4EMH A;  1K73 R;  3EFS A;  2DTI A;  5CKH A;  2CP2 A;  1VQ6 A;  1NG2 A;  1ZX6 A;  4M75 G;  5LJ3 g;  2KYM A;  4LDV A;  4JLI A;  2D0N A;  4II1 A;  4ELY C;  4OGC A;  4C92 C;  2V1Q A;  4JS5 A;  1SKU B;  3Q1J A;  4PJN A;  2COY A;  1Q82 R;  2B86 A;  3OYN A;  3CCS A;  1VYV A;  3RES A;  4E47 A;  4M75 F;  2EBP A;  2E10 A;  5GMK i;  4RCB A;  3DB3 A;  1SSH A;  1QWF A;  5IN1 A;  1N9R A;  1IRX A;  2PNI A;  1KHC A;  1M8V A;  2RHX A;  2LCS A;  2P0K A;  4PKC C;  4EMG A;  1IB8 A;  2LCL A;  2BZY A;  3G4S T;  3GOX A;  2DE0 X;  3TSW A;  2QTV A;  1LJO A;  1EZZ B;  1QP3 A;  3QUI A;  2LRQ A;  3OYD A;  2WAC A;  3RUX A;  3GIB A;  1VQM T;  4C8Q E;  3OYG A;  4B9X A;  1VQ6 Q;  2JJ9 A;  2RMO A;  1K73 U;  5GMK m;  2DXC A;  1Y0M A;  2JTE A;  3C4S A;  5KYU B;  3CCS Q;  4Z89 A;  1VQ5 T;  2EW3 A;  3A1P A;  5CVI A;  3R6N A;  1KQS S;  2JN0 A;  1Q82 U;  3P8B B;  1GFC A;  5DLQ E;  4ZTF A;  2D6F A;  3EFO A;  1YHQ T;  2DPP B;  3A8L B;  5D6X A;  3QKJ A;  5GAO m;  4E7H A;  5GMK l;  4RUG A;  4M7D A;  3M0P A;  4L5G A;  2DD4 A;  1Y07 A;  2SRC A;  2E6N A;  3HRT A;  1AZG B;  2O01 E;  4HVV A;  3URG A;  2QTX A;  2LX7 A;  3OY9 A;  5GJV B;  2GQI A;  4KH0 B;  1M3B A;  4OMQ A;  2XIC A;  4J5Y A;  1K8A C;  3T9N A;  4JS4 A;  4N4I A;  5GAN h;  3ZBD A;  4QVC A;  4MDX A;  1WHJ A;  3GPL A;  2XK0 A;  5GAO l;  4GBQ A;  3SWN B;  1M4Z A;  1BYM A;  1PNJ A;  4JJD A;  2IPO B;  2QXF A;  4XTX A;  1PD1 A;  2D8H A;  4BY6 B;  1WJR A;  3C95 A;  2A36 A;  2CH4 W;  3QPH A;  2GFU A;  3L2W A;  1AWW A;  4FU6 A;  4MZM A;  1VQ4 T;  3PNW C;  5LJ3 f;  1JU5 C;  2CGH A;  2ZPB B;  3CCQ A;  2X4W A;  3M0R A;  3JB9 J;  5D6W A;  5GAN j;  1WPY A;  4C0D B;  2OJ2 A;  5CO7 A;  4XK8 E;  2QEX A;  2CZ1 B;  2M02 A;  3CC4 T;  5GMK e;  4M78 B;  4QQD A;  4M77 E;  3VJP A;  3NTK A;  3VS1 A;  5CQX A;  4RTY A;  4OMM A;  1JXM A;  1FYN A;  1NLP C;  1WGS A;  5IT9 E;  1NYF A;  3EAE A;  2DBM A;  1OU8 A;  4PJO C;  2OAW A;  2GBQ A;  1H8K A;  1OPL A;  3OYY A;  3VS6 A;  1AWX A;  1X6B A;  1S72 T;  1N8R C;  2NYS A;  2SEM A;  2J6K A;  4J9F A;  2GGR A;  1SPK A;  4RTV A;  2O9V A;  1K4U S;  2ROT A;  3A8G B;  2KAF A;  5FW9 A;  4RKU E;  2KY9 A;  4KH1 B;  1KG1 A;  1SHF A;  3H6Z A;  2D0Q B;  4LDU A;  4O5V A;  2F5T X;  3H0I A;  4AMC A;  1M8M A;  1XOV A;  2JUF A;  3CCQ Q;  1GCQ A;  3EHQ A;  2CDT A;  8ATC B;  2QEX Q;  4CC3 A;  1W4S A;  1PWT A;  2AZV A;  3N5B B;  1AEY A;  4L6V 5;  4AG1 C;  3BW1 A;  3A98 A;  2XID A;  1ZA2 B;  3EH1 A;  4IUU A;  4E7J A;  1UEB A;  1PCX A;  2DL5 A;  1K9M C;  4M7A D;  1V29 B;  3JCM J;  1Y71 A;  1QVP A;  2FL7 A;  1X27 A;  2DL3 A;  4EPC A;  1D0Z A;  4GLK A;  4A4G A;  2DFU A;  4HCC A;  2KYB A;  2J06 A;  2HMA A;  2ESW A;  2AK5 A;  2HNI A;  3C12 A;  1IZ6 A;  3G71 T;  4JJB A;  3NMZ C;  1E6G A;  3DKM A;  3LLR A;  4RTU A;  1X6G A;  2Z0W A;  2EKH A;  2FZC B;  2DA9 A;  3HTR A;  2GF7 A;  2DX1 A;  3OMC A;  2L3R A;  3L42 A;  2QQ9 A;  3E9F A;  2C0O A;  3GLX A;  4CC7 A;  3CCV A;  1BIA A;  5LL6 S;  2DK3 A;  3JCM b;  1NYG A;  4O6J A;  3LW5 E;  1Z9Q A;  3NTI A;  4CI0 C;  4J83 A;  2D9T A;  2PVO B;  3EG1 A;  2LC4 A;  4BDZ A;  4KBM B;  1VYT A;  4C92 A;  1YWO A;  1TH7 A;  2XG8 D;  5FU6 C;  4E2F B;  4A4H A;  4A63 B;  3RBB B;  1G2B A;  1VQ8 A;  1JEG A;  4MDW A;  1K9A A;  3JCM d;  1M5Q 1;  3CCU A;  4C0F A;  5GAN 8;  2WSE E;  1TXQ A;  4RTT A;  3RKY A;  1MHN A;  4M78 D;  4ZGJ B;  1M90 C;  2OTJ T;  3CCM T;  3GBQ A;  1K8A R;  1JO8 A;  1MMN A;  4IUR A;  3RMS A;  4M7D B;  4C5I A;  3S3O A;  3RIR A;  1AT1 B;  2NUT A;  3LH0 A;  2ZPG B;  3CEY A;  1VQL A;  3REB B;  3CCV Q;  2EQM A;  5HKC A;  2PUO B;  3CCR A;  3JCM X;  1Y7X A;  2LCC A;  2CZ7 B;  5LJ3 h;  3UWN A;  2OTL A;  2WSC E;  5GAN 7;  2ZPE B;  2V8J A;  1IGQ A;  1VQO A;  2KT8 A;  1RAE B;  2E41 A;  2FVU A;  2HBP A;  1AD5 A;  1IHV A;  4X1V A;  1WXT A;  2CT3 A;  1VQ8 Q;  1K76 A;  1WI7 A;  3OS2 A;  4BI8 B;  1VIF A;  3FJP A;  1EX4 A;  3CCU Q;  2VB6 A;  5A0D A;  2DTH A;  1AWO A;  5LJ3 j;  3I56 T;  4NS5 A;  3A5Z B;  4D6W A;  1ZUK A;  2ABL A;  1I5L A;  3QZ9 B;  4R0K A;  1BCO A;  1WNL A;  1YNZ A;  4RCC A;  2RQW A;  1N8R R;  2DMO A;  4LUE A;  5I11 A;  1VQL Q;  1K8A U;  1NEG A;  2J7I A;  1SEM A;  3CCR Q;  3SDZ A;  3EGD A;  4RG8 A;  5CAI A;  2CP0 A;  1XNI A;  3CPW S;  3CXC A;  2ZPF B;  2JZ2 A;  2RNA A;  3S6W A;  2OTL Q;  4C8Q D;  3VU3 C;  2MYS A;  3J80 E;  3HKS A;  2K2V A;  2RI2 A;  2O31 A;  4C5E A;  2RQR A;  3UAT A;  1VQO Q;  2JM8 A;  2K5F A;  3EG9 B;  4OMP A;  2CP5 A;  1HK9 A;  4HCB A;  1S1N A;  1OI1 A;  3THK A;  5IHK A;  4XTU A;  2YT6 A;  1ACM B;  2Y90 A;  1K9M R;  1YJ9 T;  1X6O A;  3QDR B;  4DOV A;  3I55 A;  3E2U A;  4JJC A;  1W2B A;  3M5A A;  4M4Z A;  4FSX A;  1RAA B;  4M7A E;  5FLX E;  1E6H A;  2Y4X A;  2H8H A;  3G1J A;  1MV3 A;  1YJW T;  4J9C A;  5KYY A;  1NM7 A;  3EG2 A;  1M2V A;  1OX9 A;  1TUC A;  4J9G A;  1I0C A;  2KEA A;  1VQP A;  2O4X A;  1BI3 A;  2L5Q A;  5KYN A;  4BI4 A;  3PMT A;  4Y28 E;  1U8R A;  1K1Z A;  3CCE A;  4M7A G;  1H3Z A;  1M1G A;  1RI0 A;  3I5S A;  4A4K A;  2JXB A;  1YIT T;  4PJO A;  4OVA A;  2YUO A;  2EQU A;  4XTZ A;  2BKD N;  1KD1 C;  2EJ9 A;  3CQT A;  3FDR A;  1GBR A;  1VQ9 A;  2KE9 A;  2EYX A;  2PQW A;  2QGG A;  3I55 Q;  2P0P A;  1UE9 A;  1PM3 A;  1A0N B;  3MEU A;  5M9O A;  1K9M U;  2EFI A;  1YI2 T;  2IG0 A;  4N4H A;  4A4E A;  4QVZ A;  2KQW A;  2FZK B;  3CPF A;  1M90 R;  2P4T A;  4KUL A;  1EIF A;  1BIB A;  2RB6 A;  4HKE A;  1VQP Q;  3FRN A;  4FYX B;  1QVG P;  4C92 B;  1H92 A;  5L8R E;  3OB9 A;  4PJO F;  4M78 E;  3TCJ A;  1YP5 A;  3QO3 A;  2LX9 A;  4M77 D;  2KT1 A;  1YJN T;  1VQM A;  2E5Q A;  2VVK A;  3CCE Q;  3VS2 A;  4A4F A;  3OBW A;  1UTI A;  1J3T A;  2HDA A;  3D7S B;  3VKI A;  4AG2 C;  4OML A;  4KRT A;  1WLP B;  3CBM A;  4ZGE B;  5HK3 A;  3CCL T;  5GMK h;  1SRM A;  4BI3 A;  1Y57 A;  1VQ9 Q;  1QQJ A;  1WJS A;  2QQS A;  1OPK A;  2PUK B;  2RA2 A;  2NUT B;  1RAC B;  5FU7 C;  2HSP A;  3FJ5 A;  1G3Y A;  4ELZ C;  2EYY A;  1WFW A;  3LH5 A;  5J39 A;  4PFZ A;  1PHT A;  1YIJ T;  4KGX B;  2E3H A;  4CC2 A;  4PJJ A;  3OYA A;  2RJF A;  3PGG A;  4GY5 A;  2HL3 A;  9ATC B;  5GMK j;  2MPX C;  3GF5 A;  2VYT A;  5FRO A;  2ZCF B;  2XI9 A;  4XU3 A;  2HEQ A;  4PNO A;  3VYG A;  5KYX A;  3MJX A;  2RQV A;  1M90 U;  1WDX A;  1KJW A;  3WVD B;  4J9D A;  1K0X A;  2JS2 A;  1RLP C;  4HT8 A;  1VQM Q;  1VQK A;  2VGM A;  2FPD A;  1NPP A;  4WTO B;  2ED1 A;  5CKE A;  3MEV A;  2JS0 A;  1CKB A;  1JJ2 A;  1ZUY A;  3M4G A;  2FYK A;  2RHU A;  1VOM A;  4XU1 A;  2JTM A;  3SEM A;  3O5Z A;  2KK4 A;  1D09 B;  1PKT A;  2COW A;  1JB0 E;  1OZ3 A;  2PVD B;  1WZO A;  1X2Q A;  2DJZ A;  2YLB A;  3JCM Q;  4DQ2 A;  2ECZ A;  2LQN A;  2K3X A;  2KXC A;  3EGD B;  3OBY A;  2NUP A;  2XMF A;  1IGU A;  2W0Z A;  1D0X A;  1ZUU A;  2FG0 A;  4C0Z A;  1UGP B;  5AYF A;  1X2K A;  2X9H A;  3VRY A;  3V8J A;  1KIK A;  1FMK A;  3OSS C;  2P0Q A;  4C8Q G;  2DTO A;  3M0Q A;  4E6R A;  4FCY A;  8AT1 B;  2MK5 A;  1M3A A;  3REA B;  3LGF A;  3QG1 A;  4DEY A;  5GAM d;  1VQK Q;  3JAM E;  2E64 A;  4PFP A;  3M0U A;  1KC8 C;  3OW2 P;  1VQ6 T;  1PRM C;  2ZPI B;  1ABO A;  3UT1 A;  2X4X A;  2MCN A;  3A8M B;  4XQ3 A;  5IHI A;  4C8Q F;  2C0T A;  2RHI A;  3CXC P;  2QGF B;  4F7U B;  4BB7 A;  1BCM A;  5KYY B;  2MWP A;  3M58 A;  1KD1 R;  4ZTJ A;  4M7D E;  3CCS T;  4QT7 A;  4AFU C;  3L2U A;  3H0H A;  2ROL A;  2O4X B;  2K5I A;  2M9U A;  2MOX A;  2DYI A;  4C5H A;  5KYW A;  2JTF A;  1UHF A;  2FPE A;  4FW2 A;  3MHX A;  1KQ1 A;  1RI9 A;  2HD0 A;  2OI3 A;  4QW2 A;  2O9S A;  2DAQ A;  2DNU A;  2MMP A;  4PJO B;  1LOJ A;  1LPL A;  1HD3 A;  4C0G A;  2D8J A;  3CPW P;  1DJ7 B;  4AFQ C;  1KQS A;  5FRM A;  2X3X D;  4M7A C;  4AT1 B;  1KQ2 A;  3AT1 B;  4NL3 A;  2H3E B;  5KH6 A;  3GNG A;  2EKO A;  3NPF A;  4KGV B;  3SD4 A;  2DXT A;  3RMQ A;  4F14 A;  5CKF A;  1ZLM A;  1U06 A;  2EJG A;  2CRE A;  3FEO A;  1TSF A;  2BZ8 A;  3PIO A;  2ZAE A;  4M77 A;  1MGQ A;  2YXY A;  2DF6 A;  2RM4 A;  5GAM g;  2G3R A;  1B3Q A;  2QA4 A;  1F1B B;  3CMA A;  1KD1 U;  3CCJ A;  4AFS C;  2I2L A;  2K7A A;  3G6E A;  2GNC A;  3J81 E;  1OYX A;  4M75 B;  2LQW A;  1M1K C;  1WHH A;  1ZBX A;  4M77 G;  2YRD A;  2KXD A;  5C0M A;  2VXE A;  4FL6 A;  3QWY A;  1B34 A;  4HVW A;  4J9E A;  4K11 A;  2O88 A;  1QVG S;  2LMJ A;  2M16 A;  3UA7 A;  1AZE A;  2DJQ A;  1BI0 A;  3LWH A;  4DA4 A;  4M77 F;  1TG0 A;  1PD0 A;  3BFM A;  4J6Y A;  2XU8 A;  4ZNX A;  1GFD A;  3ZFJ A;  5GAN 5;  1VQ7 A;  3OMG A;  1Q81 C;  5GAO q;  3RER A;  4QVD A;  2K79 A;  4BE2 A;  1ABQ A;  2LDM A;  5EC7 A;  2KR3 A;  1UJ0 A;  4LN2 A;  1KFZ A;  3CC2 A;  1WHG A;  2QA4 Q;  4OB3 B;  5KYX B;  4X34 A;  4LUD A;  4J6X A;  2QQB A;  3CMA Q;  1NPR A;  3C94 A;  3CCJ Q;  1QW1 A;  5FU6 B;  2DBK A;  2L3P A;  1P92 A;  2YRC A;  3G6E Q;  1RL2 A;  1KSW A;  3JCM P;  3VS5 A;  4XU0 A;  2X51 A;  4IUV A;  5KE2 A;  4RMO A;  1CSK A;  3CCQ T;  2FRY A;  3M55 A;  3LGL A;  2O2O A;  3EFR A;  1UGV A;  5GAN 2;  3NHN A;  1BBZ A;  2HQH A;  1LCK A;  2DRK A;  2DEU A;  1R77 A;  3J7A F;  4VUB A;  2HKQ B;  3ULR B;  3ASK A;  3PIP A;  3NGP A;  2ENM A;  3EGX A;  1PG5 B;  2VV5 A;  4X9C A;  1OQK A;  1UUE A;  1VQ7 Q;  1MMG A;  2HZY A;  1KC8 R;  2PTK A;  1YCS B;  1BU1 A;  1LNX A;  1RAH B;  1G3S A;  2LT1 A;  4FYW B;  3JB9 D;  1RAI B;  5IXB A;  2JMA A;  5FWB A;  1D1C A;  5J3B A;  2GTJ A;  1LVK A;  3CC2 Q;  1VA7 A;  2VGN A;  2DO3 A;  4DOW A;  4EMK A;  4HA8 A;  3PMI A;  4C92 E;  2F69 A;  2PVG B;  1I81 A;  3EFO B;  1G8X A;  1BKB A;  1D3B A;  1BI2 A;  5D6Y A;  4OMF B;  2LTO A;  1M27 C;  1ZHI A;  4A53 A;  3OYM A;  1U5S A;  3INZ A;  4IUQ A;  3MP1 A;  4E7I A;  4C8Q C;  4DEX A;  1XQH A;  3H0F A;  1GBQ A;  1N6A A;  3M9Q A;  2NUZ A;  1QVF A;  1ZA1 B;  4LNP A;  5GAM f;  4JUV A;  5GAN 6;  2X3W D;  3TU4 K;  1HXD A;  2BUD A;  3JRZ A;  5CKB A;  1IRE B;  5I2S A;  4J9H A;  3A8H B;  4M75 D;  3L2Z A;  4ESR A;  1SSF A;  2RN8 A;  3DB4 A;  5GAN 4;  3OW2 S;  3WVE B;  3X26 B;  2RQT A;  2FHD A;  4DBQ A;  1TTH B;  3H8Z A;  3OYC A;  3CXC S;  2K4Y A;  1UDL A;  1KC8 U;  1SG5 A;  4KT0 E;  1YFN A;  3HP9 A;  4MZP A;  1RAF B;  1WYX A;  2A28 A;  3JCM e;  3WXM B;  1C1A A;  2J6F A;  3HFN A;  1CKA A;  1O75 A;  5I22 A;  3OYF A;  2HCK A;  4JLG A;  3VS3 A;  4ANJ A;  3CCV T;  4Z02 A;  3CME A;  4D8D A;  4E7S A;  3F70 A;  1XTD A;  2NLU A;  4HCZ A;  4LDY A;  1YBY A;  1W2B S;  1M1K R;  1AWJ A;  4LDX A;  3AHU A;  3MCA B;  2K3Y A;  3JCM g;  2OX7 A;  4C5G A;  1ZSZ C;  2LP5 A;  2DD5 A;  2KRN A;  2R58 A;  2RF0 A;  2GFA A;  3UA6 A;  1VQ8 T;  4OB0 B;  2FB7 A;  5DY9 A;  2VWF A;  1I8F A;  2PZ1 A;  4WCI A;  4Z88 A;  3CC7 A;  2VKN A;  2COZ A;  2R5M A;  1VYU A;  5L23 A;  3QJY A;  1VIE A;  1MUZ A;  2P4R A;  2V8K A;  1EFN A;  1G3T A;  1WJQ A;  2K5L A;  1Q81 R;  2CSI A;  1IHW A;  2XDD A;  4XTV A;  2V26 A;  2EQI A;  4ZN3 A;  1N9S A;  1AVZ C;  4FT2 A;  3QZ5 B;  3OS1 A;  1VQL T;  1RAG B;  3H41 A;  4BAC A;  4JZ4 A;  5GAO p;  3CCR T;  1IXD A;  3CME Q;  5GAN 3;  1VUB A;  4M7A A;  2QAS A;  1TWB A;  1W6X A;  1T3S A;  2EPD A;  3HPW A;  4M77 C;  3QHS A;  3CD6 A;  2JOY A;  2F2X A;  4J6W A;  2KNB B;  2OTL T;  4Y91 A;  2IVW A;  1VQN A;  1TUG B;  2GCX A;  3OYH A;  4B6M A;  4F7U E;  1VQO T;  4JRK A;  2E70 A;  1N8R U;  1M1K U;  1YCY A;  2F5K A;  4E7L A;  1G3W A;  4JZ3 A;  1Q86 C;  3CC7 Q;  4OGE A;  4J8O A;  2ED0 A;  4BD3 A;  3RDV A;  4M7D D;  3DLL A;  3IQL A;  3BDL A;  3HRS A;  2BIV A;  4X9D A;  1GXI E;  5IH2 A;  3X20 B;  4ZGD B;  2CUB A;  4M7A F;  2VAS A;  5LJ5 d;  2DIQ A;  3OQ5 A;  3M59 A;  4PJO E;  4IIM A;  3SWN A;  1T0J A;  3PVQ A;  4YTL A;  1Q81 U;  2J05 A;  2K3B A;  2I0N A;  2RJD A;  4Y92 A;  3TQ7 P;  3EHR A;  5A2Q E;  3BE3 A;  2YSQ A;  2H3J A;  2MI6 A;  3EGX B;  2QI2 A;  4E7Z A;  4BUG A;  5FU7 B;  1NE8 A;  1H64 1;  3CD6 Q;  1NJI C;  1IO6 A;  4JRP A;  2FRW A;  1PSE A;  4N0A C;  4RTX A;  3TVT A;  3PT9 A;  4J9I A;  4PJL A;  2KRM A;  5HY6 A;  1VQN Q;  3G4S A;  2X35 A;  3ZL7 C;  4EDU A;  4OMN A;  2DRM A;  3V8K A;  3E19 A;  1MV0 B;  4M78 A;  2E6Z A;  5C6S A;  2KI7 A;  5D7U A;  4LD9 K;  2RI3 A;  1I1J A;  4XTW A;  3I55 T;  2QK0 A;  2CS7 A;  4FYY B;  1FMV A;  1UG1 A;  1QCO A;  3G7Z A;  2YUN A;  1D3B B;  1MMD A;  2LJ3 A;  2L3Q A;  4M75 E;  2RK1 A;  4RTZ A;  4M78 G;  3JCM f;  1VQ5 A;  5LJ5 e;  4PLI A;  3HHT B;  3JCM V;  2QDY B;  1JJ2 S;  3KFV A;  3M4Y A;  3L2V A;  2CH4 A;  1VQP T;  2DLP A;  4RTW A;  3VS0 A;  2YHT A;  4UC4 A;  3ER0 A;  4GLM A;  1MNE A;  4FYV B;  1YHQ A;  4FW1 A;  3QJ6 A;  1OZ2 A;  4M78 F;  4HCK A;  3CCE T;  4IKF A;  1JRI A;  3OSV A;  1B7T A;  2LQ8 A;  2BZX A;  2E1H A;  2DET A;  2K57 A;  3G4S Q;  2VUB A;  4EMK C;  3OYK A;  1WHM A;  5LJ5 g;  2RPN A;  4IUT A;  4FSS A;  2RHZ A;  5A0L A;  2R57 A;  4ME7 A;  2K6D A;  3S3N A;  1UGQ B;  4PLL A;  1VQ9 T;  1RLQ C;  4R55 A;  1RUW A;  4FT4 A;  1BI1 A;  4OB2 B;  1XJW B;  1QVF P;  3GNF B;  1Y96 A;  2CP6 A;  2A08 A;  1WIE A;  2RD1 A;  2ZZD A;  2V1R A;  4JRI A;  2AKK A;  2MAM A;  3HSB A;  1QKX A;  4A54 A;  1HJD A;  1VQ5 Q;  3R6O A;  1Q7Y C;  4C8Q A;  2FPF A;  1UJY A;  2RK2 A;  1K0S A;  2EYQ A;  3ZEH A;  2ZGW A;  3VRZ A;  3X24 B;  2A0F B;  4XAX B;  3SFM A;  5I21 A;  4HT9 A;  1NZ9 A;  1YHQ Q;  2D1X A;  1U3O A;  3EH2 A;  1VQ4 A;  1R8O B;  3MO8 A;  1X69 A;  1TUD A;  2K2M A;  4LDW A;  2EGC A;  2QQR A;  3OYJ A;  1Q95 G;  1QMC A;  3MP8 A;  2FEI A;  2EGE A;  5J26 A;  3CC4 A;  4KGZ B;  3MP6 A;  2CP3 A;  2E4H A;  2EGA A;  3JCM c;  2XKO C;  1WQW A;  2EIF A;  1I07 A;  2M0O A;  2EQJ A;  1Q86 R;  1OV3 A;  1HYO A;  4OB1 B;  4M7A B;  1N27 A;  3KUF A;  4C92 D;  4BE0 A;  1M2V B;  1M2O A;  2LNV A;  1KHI A;  1S72 A;  5FRN A;  5I2M A;  1U1S A;  2A3L A;  2KGT A;  4IUP A;  3JB9 I;  2K9G A;  2DKG A;  1ZSZ A;  3OS5 A;  2J6O A;  1VQ4 Q;  2RJE A;  1W2B P;  1VQK T;  1NBE B;  3QBY A;  2M1H A;  4Q5W A;  3E1S A;  5IHN A;  2EAY A;  3RNJ A;  1D1B A;  3QYG B;  5EG2 A;  1NJI R;  5KCO A;  3CC4 Q;  2QQA A;  4M7D G;  3NFC A;  3KXT A;  2HSE B;  4PFO A;  4F04 B;  1T3L A;  2MIO A;  5GAM e;  2RJC A;  2XDP A;  2RHY A;  5CKD A;  1QWE A;  2YWW A;  4PJM A;  1ZQ1 A;  4NL2 A;  4J7F A;  3I9Q A;  1R0B G;  2ATC B;  3S3M A;  4MZT A;  1JQQ A;  1M30 A;  2DVE A;  4M7D F;  2PU9 B;  3JCM W;  3C0C A;  2YLC A;  3I5R A;  1Q86 U;  3G71 A;  1S72 Q;  3VV0 A;  1QCN A;  2EYW A;  5LJ5 f;  3MPU B;  3M54 A;  2JM9 A;  4ZN1 A;  4DBH A;  4HXJ A;  1M1F A;  3DLM A;  3JCM h;  3QXE B;  2E12 A;  3PE0 A;  1OUL A;  3OS0 A;  1MMA A;  2CKK A;  2MF2 A;  2BE7 D;  2RI5 A;  1JBM A;  2DXB A;  3SWN C;  1PC0 A; 
#chains in the Genus database with same CATH homology
 1VQ6 Q;  1VQ4 Q;  1W2B P;  1K8A R;  1K9M R;  3CXC P;  1VQM Q;  1YI2 Q;  1VQ5 Q;  1YJN Q;  1QVF P;  3CD6 Q;  1YIT Q;  3CCQ Q;  2QA4 Q;  1M90 R;  2OTJ Q;  3CCM Q;  1JJ2 P;  2OTL Q;  1Q81 R;  3CMA Q;  1KD1 R;  2QEX Q;  1VQP Q;  3CCJ Q;  3I56 Q;  3I55 Q;  1YJ9 Q;  1Q7Y R;  1Q82 R;  1QVG P;  1NJI R;  1KQS P;  3CC4 Q;  1VQN Q;  3CPW P;  3G6E Q;  1VQO Q;  1K73 R;  3CCV Q;  1YIJ Q;  1VQ9 Q;  1VQ8 Q;  1N8R R;  1VQK Q;  3CME Q;  3CCL Q;  3OW2 P;  1S72 Q;  1YHQ Q;  3CC2 Q;  1M1K R;  3CC7 Q;  3CCS Q;  3G4S Q;  1VQL Q;  1VQ7 Q;  3CCU Q;  3CCE Q;  1Q86 R;  1KC8 R;  1YJW Q;  3G71 Q;  3CCR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...