3CPWP

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cpwP00
1JJ2P 2QEXQ 1VQ9Q 1YJ9Q 1VQPQ 2OTLQ 1YJWQ 3G71Q 3CCRQ 1VQ5Q 3CCEQ 1Q86R 3G4SQ 1KD1R 3I55Q 3CCSQ 1S72Q 3CC4Q 1K8AR 3I56Q 1VQ7Q 3OW2P 1VQOQ 1QVFP 1YITQ 3CCUQ 1VQNQ 3G6EQ 1YJNQ 1QVGP 1VQ8Q 1YI2Q 3CD6Q 3CMEQ 1KC8R 1VQMQ 1VQ4Q 1KQSP 1NJIR 1W2BP 1VQKQ 3CCVQ 1M90R 1VQLQ 1M1KR 1VQ6Q 3CMAQ 1Q82R 3CCMQ 3CCLQ 2QA4Q 3CXCP 1K9MR 3CC7Q 1Q81R 1N8RR 3CCQQ 1Q7YR 1YIJQ 2OTJQ 3CC2Q 3CPWP 1YHQQ 1K73R 3CCJQ
chains in the Genus database with same CATH superfamily
2JTEA 5A0GA 2K2VA 1UHCA 5GAMj 2FHDA 2LJ0A 3OS1A 4E7ZA 1AVZC 4OGEA 4BY6B 1M5Q1 4E7JA 1U1SA 4LXCA 2OJ2A 3UDCA 2DKGA 3JCMe 1TG0A 1WHLA 4N0AC 3UWNA 2DK3A 3CCEQ 2W10A 1RUWA 2YUOA 1OQKA 2JMCA 4J8OA 3JCMV 3OQ5A 4F16A 3CBMA 2E5KA 3SB2A 2ED1A 2L89A 2ZGWA 4PLLA 2FRYA 4HVWA 2EVRA 1U1TA 3CC7T 2OTJA 3CPWP 2QEXT 1VQ9T 2YSQA 4FYYB 7AT1B 5D6WA 1BIBA 5CO7A 1D3BA 2HNIA 2AZVA 1Q81C 2X51A 3E19A 1NG2A 1WZOA 4X1VA 1JQQA 1JBMA 2E41A 4OMMA 2QTVA 1BKBA 1WXTA 1WHHA 5D6YA 2K4YA 2KRMA 1OPKA 3I35A 1Y71A 1ABQA 1Q81R 4J9DA 2XICA 3QZ5B 2IG0A 2RQUA 3LYIA 2DX1A 3OYHA 3V8LA 1XJWB 4JJDA 2CS7A 2ZPEB 3EFOA 3VU3C 1WJQA 1U5SA 2RI2A 1N8RU 1ZA2B 2CH4A 2FO0A 1S72A 1R8OB 1NE8A 4VUBA 5A0DA 1MHNA 3EFSA 3OY9A 2J6KA 5AYFA 4O6JA 1UJ0A 5GAMe 3RKWA 3G7ZA 2FPDA 3RDVA 4JPBW 3M57A 3CC4T 4ZGDB 4FYVB 2KR3A 2EBPA 5HY6A 2QQSA 2CP6A 1Q82U 2WACA 2RO0A 1T3LA 5GAOl 4M78A 4C8QD 3F70A 1RAAB 4KUIA 3JCMb 4PJNA 4ZNXA 2HKQB 1IGUA 3J80E 2O4XB 3TREA 4M4ZA 3EG3A 3A5ZB 3M0PA 1TSFA 2ED0A 3G6ET 3ZEHA 1AWWA 1H3ZA 4ZGEB 2M02A 5CKFA 1VQ6A 3MCAB 2VASA 2JTFA 1M1KR 2D6FA 3CCLQ 4AFSC 1SSHA 3BY7A 1OI1A 2KBTA 2K79A 2LTOA 1LVKA 1D09B 2AZSA 4II1A 3QG1A 1S72Q 1N8RC 3CCQT 1MGQA 1HJDA 2D9TA 1TH7A 1UJYA 1IHWA 4WTOB 1WLPB 3HHTB 4HVUA 1FX7A 2D0NA 1N6AA 5KYUA 1G83A 2JUFA 1K73R 4JS5A 3HRSA 1UGVA 1M90C 2LMJA 4XQ3A 1MNEA 2F2WA 1E6HA 4XU1A 1WYXA 3QZ9B 4KBMB 2KYMA 3G1JA 3CMET 9ATCB 3URGA 4IUQA 3QWYA 3OYBA 2XMFA 1YIJA 2DM1A 4LE9A 3H8ZA 4ZN3A 4Z02A 1JB0E 2DYBA 2NUTA 2MF2A 2EQIA 3S3OA 4OMPA 4BD3A 5FWBA 3X26B 2D0QB 4JDSA 1AD5A 2A08A 3R6NA 2L3QA 4FSSA 3FC3A 1QW1A 3RERA 2LNHB 4D8DA 4XU3A 5GAN7 3V7RA 1OZ3A 3KXTA 1G3WA 1BI3A 3META 5GANg 3NTIA 2RQTA 5KH6A 2NWMA 4CC2A 4F7UB 1IZ6A 3CCMT 5GJVB 5GAN3 3GIBA 2XU8A 2E10A 2LNVA 3RUXA 2F5TX 2LT1A 4R55A 2RA2A 3PMIA 2CYZB 4LD6A 4CC4B 1M4ZA 3Q1JA 2KT1A 2DL8A 3TVTA 1EX4A 1KSWA 1KHIA 5J3BA 3A8HB 2QEXQ 1VQ9Q 2DTIA 5CQXA 3VUBA 1GFDA 2EKHA 3OS0A 3BW1A 1YI2A 5GMKj 3CCQA 3ZFJA 4M7AA 2NUPA 3BE3A 3GF5A 5GMKh 4IKFA 4BY6C 1KC8C 4KH0B 4E7LA 1X75C 6AT1B 2DL7A 2BZYA 1XOVA 2O4XA 2HSEB 1D0XA 1GCQA 1G3YA 3H6ZA 3I55T 3OYNA 4Z89A 2QTXA 4FT2A 3LH0A 1PKTA 3A8OB 2DRMA 2ATCB 2C06A 1OV3A 1UGRB 3QIIA 4IUUA 2F2VA 5D6XA 2GCXA 1QCFA 1JJ2P 2MAMA 1BU1A 4QVCA 1M2VA 1FYNA 2CP7A 2KQWA 4OMOA 3JCMJ 3CCLT 1VQ6T 4LDXA 3CC4A 3VS4A 5DLOA 1M3BA 1PNJA 1E7OA 4C5HA 2VKNA 1K0SA 1MMGA 1V29B 4QQGA 2LJ1A 3JB9J 1F1BB 4AT1B 4PJOD 3NTKA 3SEMA 1RLQC 3QBYA 3CMAA 5GAN5 2CP0A 1NJIU 3RBBB 4EMGA 1VIEA 2QGFB 4X9CA 1N5ZA 1YITA 3G6EQ 4AFZC 2FEIA 2EGAA 2M0OA 2L3SA 4J9BA 1HXDA 2F1LA 3CCRA 1GL5A 3VYGA 2RN8A 4PFOA 3JB9F 3JCMP 2LQWA 1QVFA 4CC3A 2QQAA 4ESRA 4C5EA 5LJ3h 1RAHB 2XDPA 2EPDA 2A36A 1SSFA 4J9IA 1YCYA 1AWXA 1WHGA 3NTHA 4LUEA 3JCMW 1K8AR 3J7AF 1HK9A 1AT1B 1WJSA 3FB9A 4C92F 4M7DC 1AEYA 1WHJA 2KGTA 3I9QA 2GF7A 4M7AG 2MK5A 1I5OB 3S3NA 4FW1A 4N4HA 2HMAA 3LLRA 1KQ2A 4BE2A 2X35A 3I5RA 3CCRQ 3EHRA 2CZ7B 3CQTA 3QUIA 4PJOG 4F14A 1K0XA 1CKAA 2YRVA 2DILA 1K76A 5IHKA 1M27C 3DLLA 3MEWA 4M78D 4NOYA 3CCMQ 1J3TA 2FYKA 4OB2B 3M56A 2VB6A 1U8RA 4C5IA 1C1AA 2L8DA 2COWA 2QA4T 5EG2A 1LNXA 3CCUQ 1Q86U 3LX7A 4RTZA 2KROA 4PJOE 3M4YA 3A8GB 3SWNA 4FCYA 3JCMQ 3NPFA 3QHSA 1OX8A 2ZPHB 2D8HA 2C0IA 2XDBA 3OBYA 2DETA 4ZN1A 3RIRA 1KQSA 3SHWA 2YWWA 1O9SA 5GJWB 1WPYA 2DFUA 1I1JA 4EPCA 4PL6A 2DXUA 4M7AB 2O9VA 4XTXA 2AK5A 4ME7A 1A0NB 2P84A 1K4US 1VQKT 3VS7A 4X34A 4GY5A 4NL2A 4EIKA 1NPRA 1YCSB 3NHNA 4M7AD 1YHQA 3M0QA 3NGPA 3CCJQ 1YJWT 2JNGA 4JJCA 3OW2S 2W0ZA 2GQIA 1MUZA 4BI3A 2DL4A 4KULA 2M16A 1M1FA 2CP2A 3E9GA 4LDVA 1Y96B 2RJFA 1VQLA 3AHUA 3CBPA 1WQWA 2EJFA 3VYHB 4RUGA 1VQ6Q 4M7AC 4N4GA 3M4GA 1SRLA 1RL2A 2HL5C 1YHQQ 2KI7A 4HVVA 4M75E 1W1FA 1I4K1 4XTVA 3JB9H 2H8HA 3QO3A 1YP5A 2XI9A 4PJOC 2EQJA 1JEGA 3MEVA 1SF9A 4A4GA 1EIFA 2O9SA 2NUTB 4MZTA 3PNWC 2HSPA 3X28B 3OS2A 2OTJQ 4E7HA 1RABB 3OSSC 2D8JA 1VUBA 4FYXB 1AZEA 2JVVA 2LCSA 2E3HA 2R57A 4DOVA 4XTWA 3PGGA 3JCMh 2VVKA 2JZ2A 1HSQA 4A53A 4GLMA 1ZUYA 2ZPGB 3OYEA 3EG9B 1QCNA 2QDLA 4JRQA 1Y7XA 5GAOn 3CMAQ 4FM4B 1PSFA 4F04B 1W6XA 1V1CA 4XU2A 3PT9A 2RH2A 2AKKA 5ECAA 3E9FA 1UECA 2MMPA 5DM7R 2HAXA 2QEXA 1VQ9A 3GPLA 3CC2T 4E7SA 1OYXA 3M0RA 4FYWB 2KYBA 4DA4A 4OMQA 4RKUE 1VQ5A 3CC7Q 1QMCA 1LOJA 5GANf 2L3PA 4KGZB 4NL3A 1YJ9Q 2F5KA 4IUTA 3I56Q 4OB3B 3CC2A 3MPUB 5GAN6 1MNDA 2V26A 3JAME 1BBZA 4A4FA 4BUGA 1KFZA 1TUGB 1IRXA 3VRYA 3G4SA 1UTIA 4QW2A 1BI1A 2LQNA 4TVRA 4JS4A 2JTMA 1M90R 4BE1A 2LDMA 1K9MR 1YITT 2KEAA 1G3TA 3RNJA 1K73C 1JXOA 5GAOr 4JLIA 1IREB 2D1XA 4C92E 5DLQE 1BB9A 2HCKA 4E7IA 1RAFB 2CUBA 4OMLA 4C8QC 2VXFA 1ZUKA 3MEAA 3CPWA 1VQOT 1M1KU 2RF0A 1YI2Q 4ORZA 1MMAA 4JUVA 1RAEB 1VQLQ 1PD0A 2YDLA 3OBWA 1C0MA 2BZ8A 3VUZA 1VQNT 2OAWA 1VIFA 4JJNK 2DNUA 1Y07A 1D0YA 1KJWA 2H3JA 1ARKA 3EGDA 2FG0A 1YJNA 1K9AA 2P0KA 2JT4A 3TSZA 3CC4Q 2FVUA 1KQSS 4M7DA 3NFCA 1RADB 4MMKA 4DOWA 1B7TA 3CCUT 2RK1A 2P0QA 1T3SA 4IUVA 1NZ9A 4E6RA 3N5BB 4ELZC 4YTLA 1NJIC 3G71A 3UA6A 1X6GA 1QVGA 2NUPB 3PVLA 1VQ8A 3OA6A 4J9FA 3EGXB 2LJ3A 2FZCB 2I2LA 2CUDA 2VUBA 4LDYA 4M77A 2OAUA 1O75A 2CKKA 3EH2A 5CQYA 4RCCA 1SHGA 1JO8A 1KIKA 2PZ1A 4NS5A 2M0YA 5KCHA 2OX7A 1X27A 1YN8A 1B3QA 4RMOA 3QYGB 5LJ3e 3PMTA 2ENMA 4PK4A 4P5NA 1YIJQ 1ZLMA 3M59A 3CCJT 3H0FA 1FWZA 4L5GA 4M7DF 2LX7A 1QKXA 1KD1C 5AT1B 3HFOA 3UPUA 1C6VX 2QAZA 2JW4A 4CI0C 4OF1A 2JS0A 1M2VB 2EYZA 3VS3A 2V8JA 4RTWA 5FW9A 1ZBXA 3CD6A 5KYYA 2LC4A 3CC2Q 2GQVA 1YHQT 5CR2A 1GXIE 2BIVA 1VYTA 4J6YA 1WXBA 2JMAA 2ZZDA 3OS5A 1IB8A 2L2PA 5CKHA 5KYWB 4KT0E 1TXQA 2RMOA 1JJ2A 3KFVA 4LN2A 5GAMf 4RTUA 3MP8A 3MO8A 4Y91A 3SWNB 2RD1A 1EFNA 4M7AF 4A4EA 4DBFA 1NLOC 3OYJA 4Z88A 1D0ZA 1GBQA 1SHFA 2DF6A 3E2UA 1PSEA 1K9MU 2QQBA 4OB0B 3VV0A 2GTOA 1WQ7A 1YJ9T 1TWBA 2QA4A 4FW2A 4QT7A 1M90U 2K5FA 1FMWA 2RHUA 1LCKA 4M75C 3SD4A 4A54A 2XHCA 3I56T 5FLXE 1FMVA 1SPKA 4RTYA 4XTYA 2E64A 1Q7YU 3P8DA 3SFMA 2JS2A 3CBOA 1M8VA 2B86A 1D1AA 3JV3A 2DXCA 2YUNA 4XK8E 4DBQA 2DXBA 1YBYA 2YUPA 3J81E 2EYQA 1ACMB 3WVDB 3OSVA 1K73U 3FLGA 4E47A 4OMNA 2WSEE 1VQPQ 4JLGA 3UF4A 4MZPA 3BDLA 1Q86R 3QDFA 3CCSQ 1LPLA 4QQ6A 4FU6A 1SRMA 1VQNQ 3FJ5A 3DB3A 1MV3A 2A0FB 5J26A 1QKWA 4KGXB 3SDZA 4M75G 1DJ7B 5CCAA 1W2BS 1I07A 1N8RR 3G6EA 2E1HA 5A2QE 4GBQA 1OU9A 3GP8A 5FROA 1M9SA 2PVGB 3PIPA 1BI0A 3L2ZA 2DAQA 3EGUA 2EW3A 3IQLA 3JSCA 1IXDA 1M1KC 2ROLA 3BDUA 3JCMc 4XU0A 1YI2T 4M7DG 1YWPA 2RJEA 3C4SA 1Y0MA 4XAXB 1QP2A 1KQ1A 2YRCA 1E6GA 4OGCA 2Y4YA 2ROTA 2BZXA 2M9UA 3PFSA 3PE0A 5KYUB 3GOXA 4B9XA 2YHTA 4FSXA 3ZL7C 2QG9B 2DTOA 3LWHA 3FIFA 5KYYB 3RKXA 1S72T 2LQKA 2CZ6B 2F69A 2VC8A 1Y96A 2CP3A 4F17A 4K11A 5LJ3f 2AIRB 2OTLQ 3X25B 1ZSZC 2GGRA 2MIOA 1QVGP 4LDUA 3M0SA 4M77C 1XQHA 5HKCA 3UA7A 2RB6A 4WF2A 1H641 1BYMA 4M77E 3CXCP 2YUQA 3CEYA 3C94A 2B8AA 1BCOA 2MPXC 5GANh 2EGCA 1K8AC 4M78C 2P4TA 3HSBA 3CMEA 4JRIA 4L59A 3G4SQ 2XD0A 3GNFB 1Q95G 3I5SA 2HZYA 4A63B 3L2VA 1B34A 2CZ1B 1W4SA 1Z9ZA 3VRZA 5LJ3j 1X69A 4C0GA 1ZSZA 5IXBA 3UT1A 3ASKA 2LQ8A 3FDRA 4Y92A 2DLPA 1GCQC 2X4YA 2RHYA 5GAN2 2Y90A 4HCBA 5CIUA 4IIOA 4PNOA 2F2XA 3EFRA 3MKDA 3EFOB 3G71Q 3REBB 3L2RA 3L2QA 2HBWA 2RHXA 4OP0A 4PJOB 4IURA 4RTVA 1IO6A 4HCKA 3EAEA 5L23A 1WX6A 2DIQA 2RI5A 4C0ZA 2RK2A 2HQXA 5IT9E 1WHMA 3MP6A 4HXJA 2RHZA 2Y4XA 2L0AA 2DYIA 2M1HA 1PHTA 2DD5A 2CSQA 3WXMB 5I2SA 5CKEA 1TS9A 2C0OA 1SEMA 2XK0A 2E3IA 1WGSA 2JJ9A 2ECZA 2PVOB 5LJ5h 4N0AA 3OW2A 1YJNT 4XTUA 1RLPC 2BKDN 2E6NA 4M75F 4D6WA 3CPWS 3KBGA 2ZCFB 1OOTA 2DMOA 2M51A 4ZTJA 5CKDA 4M7DE 2QYZA 1VA7A 4A4KA 1VQ8T 1ZUUA 2V1RA 1UGSB 4PFPA 4BACA 1HYOA 2OTLT 2XKOC 3NMZC 3S3MA 2O88A 3CC7A 1FMKA 2COYA 4BDYA 2RI3A 1VQ5Q 2DJQA 5KCOA 2YT6A 4HT8A 2RM4A 2J6OA 3PTAA 4RTTA 1VQ7T 2GFUA 2IPOB 3QKJA 3U23A 3OYKA 2EGEA 2ZPBB 4J9GA 2DZCA 1VQ4T 4QVDA 4ANJA 2COZA 3L1AA 5CAIA 5GAMh 5GANe 3HRUA 4IUPA 4HT9A 2K6DA 4HKEA 3QJYA 2L3RA 2X3WD 4O5VA 3P8HA 3EG2A 4AMCA 5J39A 1N9SA 4ZGJB 4KUDK 5LJ3g 5IH2A 3VS0A 2LT4A 2R5AA 2RQVA 2X3XD 4E7KA 1B34B 3G4ST 5IAYA 2E70A 3EG1A 3ER0A 3M54A 3VS2A 1VOMA 3CPFA 3EG0A 2ABLA 1X6OA 2RJCA 5GMKl 2CH4W 4OB1B 2KDSA 2FRWA 1PKSA 2FB7A 4PJOF 5GANj 2DA9A 1I5LA 1UG1A 1S1NA 1WI7A 1QLYA 3M9QA 3V8JA 2WSCE 2EFIA 5KE2A 1Q7YR 2AKLA 4F7UE 1B07A 1YJWQ 2DEUA 5KYWA 4J9EA 3OYLA 3JRZA 3OYIA 5CK9A 2LP5A 3RMQA 1Q82C 3H0IA 3V7CA 2PUKB 2EWNA 3V7SA 1KC8U 2CP5A 3M0UA 3FRNA 3CXCA 2EAYA 3A8LB 3JCMf 3DKMA 2FL7A 1WDXA 1ZX6A 4M77F 1Y57A 1GBRA 2R5MA 2HL3A 5KYXA 1WIEA 2FPEA 3VS5A 4FIBA 1R0BG 2YXYA 2HD0A 1UUEA 1TTHB 2DTHA 3LH5A 3OYGA 1VQOQ 4PJOA 4AG2C 3HFNA 3CCSA 1N9RA 1OX9A 1M1GA 4X9DA 1VQMQ 4D8KA 1LJOA 1VQLT 2DL5A 1I8FA 3CCQQ 3OYDA 1G8XA 4JZ3A 3QSUA 1NEBA 3DLMA 4HA8A 4BI8B 1WNLA 2EQKA 1AOJA 3EHQA 5IXFA 4MDWA 4J7FA 3G71T 1PC0A 4BI4A 3OMCA 3OW2P 1VQOA 1YJNQ 4R56A 3GNGA 1QVPA 1TU0B 2O2OA 3QDRB 2K3XA 1VQMA 3X24B 1PM3A 2YLBA 1ZBJA 2EYYA 4CRIA 1WXUA 3M58A 2MYSA 3H41A 2PUOB 2KMTA 2LCLA 3FJPA 3JB9G 1W2BA 4RCBA 3BFMA 4J9HA 3M53A 4C8QB 2EYWA 3S6WA 2JM9A 2DPPB 4M77G 1R77A 4KGVB 1X43A 2DL3A 3CCVT 1VQKA 1G3SA 2K7AA 1Q7YC 3TQ7P 1VYVA 3VKIA 4M75A 1JRIA 2SEMA 2K5LA 3LGLA 4C5GA 5EC7A 2O31A 5LJ5j 1D1CA 4M75D 4EMKC 1K9MC 4E2FB 1UHFA 2QGGA 3A1PA 2AT1B 1M3AA 4A4HA 1QP3A 4IIMA 2K3YA 1K8AU 4EMKA 1ABOA 2RQWA 2KSSA 4DBHA 4B6MA 2RPNA 4JRKA 2VGNA 1QWEA 1JU5C 2EJGA 2R58A 3LW5E 1VQ5T 2XDDA 3CMAT 1AWOA 4PLIA 3GBQA 3LWIA 2KXCA 2PTKA 2X4XA 4XTZA 5GAN4 3CCEA 3PIOA 1WHKA 4DQ2A 1NBEB 5FRMA 5FRNA 4EDUA 3OYAA 4F7UA 3T9NA 3HTRA 2V1QA 1RAIB 2QQ9A 2G6FX 2E12A 3CCLA 3PVQA 4OVAA 5GMKi 1NEGA 2P0PA 2J6FA 4C0DC 5I21A 3R6OA 5I2MA 5LL6S 2KK4A 2LX9A 2E6ZA 4QQDA 3H9NA 4PFZA 2MWPA 4ZTFA 3CD6Q 4M7AE 2EYXA 2RHIA 2BE9B 4QVZA 2DZ9A 5FU6C 2JN0A 1WA7A 2ESWA 1OZ2A 2EQMA 3WVEB 3JCMX 4CC7A 3FEOA 5LJ5f 2IVWA 3RR6A 2G3RA 4ELYC 2GTJA 2KVQG 1KD1U 1TUDA 3JCMg 4C92B 5HK0A 1JXMA 4PKCC 3CXCS 4LDWA 2GNCA 3VJPA 4C0DB 4UC4A 2QXFA 4HCZA 2A3LA 4C92C 4J83A 1VQ7A 1U3OA 4C92D 4C8QF 1T0JA 1UE9A 1GRIA 1KK7A 5GAOm 2PU9B 5M9OA 5C6SA 2DD4A 2HKNA 3E1SA 5LJ5d 4LD9K 3VS6A 1AHJB 1MMNA 2WSFE 4DEYA 1JJ2S 1G2BA 3ULRB 3EGXA 2DERA 3OYYA 3HRTA 4J5YA 1NM7A 3C12A 4M77B 1FXXA 1KHCA 2OTLA 1KQSP 1BI2A 3RMSA 2Z0WA 2K57A 4MMLA 1XTDA 2VXEA 5LJ3d 3KUFA 2P4RA 3EH1A 4M78F 4M77D 3I55Q 2LZ6B 1VQ7Q 5GMKe 2DRKA 1MV0B 1UEBA 2X4JA 2BUDA 2JOYA 4QKUA 4V2SA 2V8IA 3A8MB 4RG8A 1HD3A 3INZA 3HKSA 3CMEQ 3M5AA 5C0MA 1Q82R 5GAN8 4M75B 3A98A 3REAB 2DBKA 5HK3A 1YJ9A 1PRMC 2A28A 2JM8A 2HQHA 1M30A 2CSIA 2DVEA 5GAMd 2FPFA 2VV5A 1YIJT 1QVFP 4GLKA 4LNPA 3L42A 1IHVA 2GFAA 2KY9A 1NPPA 2ZPFB 3ZBDA 2XG8D 5D7UA 4M7DD 4AFUC 2V8KA 1TOVA 4MZMA 3GLXA 1IGQA 2RNAA 1M8MA 2CZ0B 1H3HA 2KRSA 1UGQB 3TU4K 1H92A 5DY9A 5GANd 2MCNA 3EG9A 2I0NA 4F7UG 3CCVQ 5IHIA 3HL8A 4PJMA 1BK2A 1N27A 3QPHA 2LCCA 2RQRA 1NLPC 4J6XA 3C0CA 3OYCA 2LRQA 4AFQC 5GAOp 5KYXB 2OI3A 2XIDA 2QQRA 1UFFA 3MP1A 2K9GA 5CVIA 3MHXA 4AG1C 5A0LA 2EKOA 2VGMA 3LGFA 1PD1A 1P92A 1ZQ1A 5I11A 4J9CA 2QA4Q 1PWTA 1OPLA 1BCMA 4JZ4A 2KT8A 1TUCA 3M0TA 2L5QA 3THKA 2E65A 3TCJA 3OYMA 3CCRT 5FWCA 4ATOA 5L8RE 1QWFA 4FT4A 2DVJA 4KH1B 1CKBA 3TEEA 3OMGA 2E4HA 2MOXA 2EIFA 4JRPA 1X2QA 1VQMT 1VQPT 1H8KA 4Y28E 1NJIR 1Z9QA 2A37A 1X6BA 3L2UA 8ATCB 3CCJA 2DXTA 1PRLC 5GAOq 2PQWA 4JJBA 2VWFA 1SKUB 4BE0A 3QJ6A 4M78B 1R0CB 3MJXA 1WFWA 3ME9A 2K2MA 2H3EB 2KE9A 3I55A 5LJ5g 2CGHA 1GCPA 4Q5WA 3RESA 3CCST 2PNIA 4L6V5 1OU8A 5LJ5e 3EGDB 3C95A 3CCET 2YRDA 4BDZA 2SRCA 2EQUA 1SG5A 3JCMd 3VS1A 3JB9I 3CCUA 1Q86C 2JXBA 3V8KA 4HCCA 3HPWA 3QYHB 1QCOA 1VQPA 1VQKQ 2E5QA 1AZGB 1GFCA 2K3BA 4OMFB 4C8QA 1VQNA 2HQEA 1QVFS 4EMKB 2K5IA 2ZPIB 2DBMA 3SWNC 2HDAA 2CT4A 2OTJT 5I22A 1VQ8Q 4M7DB 2VYTA 2EJ9A 2J05A 3I56A 2KAFA 2KNBB 5CKBA 1X01A 1KC8R 2DE0X 3O5ZA 4C0FA 2LVMA 2O01E 1W2BP 5FU6B 3TSWA 2QK0A 4MDXA 1I0CA 5GAMg 1OULA 1K1ZA 1EZZB 1M3CA 1AWJA 2GBQA 3CCVA 2X4WA 3JB9D 4C8QE 3HP9A 3X20B 1CSKA 4FL6A 1D3BB 1YFNA 1G5VA 2QI2A 3OYFA 1ZHIA 4F7UF 2RJDA 1M2OA 1U06A 2ZAEA 3CCMA 1ZA1B 1RAGB 2FZKB 1VQ4Q 1D1BA 1WJRA 2MWOA 5GMKm 4WCIA 1RACB 4DBRA 2PVDB 4M78E 4RTXA 2MI6A 2DEQA 2YLCA 4C8QG 1UDLA 3AT1B 2FZGB 1I81A 2KXDA 5KYNA 2J06A 2DO3A 1YITQ 1UB4A 1YWOA 4N4IA 4PJLA 4J7IA 3CD6T 1T0HA 1ZSZB 2C0TA 3DB4A 2A7YA 1VQ4A 2QASA 2CDTA 1QQJA 2NYSA 2IIMA 1RI9A 4C92A 1W70A 1X2KA 5HCKA 4Z8AA 4DEXA 1NYGA 1V76A 3QWXX 1KD1R 4M78G 3RKYA 3M55A 3OB9A 1PG5B 2X9HA 1NYFA 4LUDA 1OEBA 3D7SB 4PJJA 4C92G 3QXEB 1MMDA 1UGPB 2KRNA 1RI0A 5IHNA 4BB7A 1YNZA 2NUZA 2AHJB 1ZSGA 4R0KA 3P8BB 4J6WA 2BTTA 4KRTA 2NLUA 1BIAA 4EMHA 3L2WA 1XNIA 1KG1A 5KE3A 1VYUA 4B9WA 1PCXA 3H0HA 1QVGS 4RG2A 2QDYB 1Q81U 5FU7B 2HEQA 2CT3A 3O8VA 3MEUA 2CREA 2HBPA 3UATA 2DIGA 1YJWA 5FU7C 2J7IA 2DJZA 8AT1B 5IN1A 2BE7D
chains in the Genus database with same CATH topology
1JJ2P 2QEXQ 1VQ9Q 1YJ9Q 1VQPQ 2OTLQ 1YJWQ 3G71Q 3CCRQ 1VQ5Q 3CCEQ 1Q86R 3G4SQ 1KD1R 3I55Q 3CCSQ 1S72Q 3CC4Q 1K8AR 3I56Q 1VQ7Q 3OW2P 1VQOQ 1QVFP 1YITQ 3CCUQ 1VQNQ 3G6EQ 1YJNQ 1QVGP 1VQ8Q 1YI2Q 3CD6Q 3CMEQ 1KC8R 1VQMQ 1VQ4Q 1KQSP 1NJIR 1W2BP 1VQKQ 3CCVQ 1M90R 1VQLQ 1M1KR 1VQ6Q 3CMAQ 1Q82R 3CCMQ 3CCLQ 2QA4Q 3CXCP 1K9MR 3CC7Q 1Q81R 1N8RR 3CCQQ 1Q7YR 1YIJQ 2OTJQ 3CC2Q 3CPWP 1YHQQ 1K73R 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 P;  2QEX Q;  1VQ9 Q;  1YJ9 Q;  1VQP Q;  2OTL Q;  1YJW Q;  3G71 Q;  3CCR Q;  1VQ5 Q;  3CCE Q;  1Q86 R;  3G4S Q;  1KD1 R;  3I55 Q;  3CCS Q;  1S72 Q;  3CC4 Q;  1K8A R;  3I56 Q;  1VQ7 Q;  3OW2 P;  1VQO Q;  1QVF P;  1YIT Q;  3CCU Q;  1VQN Q;  3G6E Q;  1YJN Q;  1QVG P;  1VQ8 Q;  1YI2 Q;  3CD6 Q;  3CME Q;  1KC8 R;  1VQM Q;  1VQ4 Q;  1KQS P;  1NJI R;  1W2B P;  1VQK Q;  3CCV Q;  1M90 R;  1VQL Q;  1M1K R;  1VQ6 Q;  3CMA Q;  1Q82 R;  3CCM Q;  3CCL Q;  2QA4 Q;  3CXC P;  1K9M R;  3CC7 Q;  1Q81 R;  1N8R R;  3CCQ Q;  1Q7Y R;  1YIJ Q;  2OTJ Q;  3CC2 Q;  3CPW P;  1YHQ Q;  1K73 R;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 2JTE A;  5A0G A;  2K2V A;  1UHC A;  5GAM j;  2FHD A;  2LJ0 A;  3OS1 A;  4E7Z A;  1AVZ C;  4OGE A;  4BY6 B;  1M5Q 1;  4E7J A;  1U1S A;  4LXC A;  2OJ2 A;  3UDC A;  2DKG A;  3JCM e;  1TG0 A;  1WHL A;  4N0A C;  3UWN A;  2DK3 A;  3CCE Q;  2W10 A;  1RUW A;  2YUO A;  1OQK A;  2JMC A;  4J8O A;  3JCM V;  3OQ5 A;  4F16 A;  3CBM A;  2E5K A;  3SB2 A;  2ED1 A;  2L89 A;  2ZGW A;  4PLL A;  2FRY A;  4HVW A;  2EVR A;  1U1T A;  3CC7 T;  2OTJ A;  3CPW P;  2QEX T;  1VQ9 T;  2YSQ A;  4FYY B;  7AT1 B;  5D6W A;  1BIB A;  5CO7 A;  1D3B A;  2HNI A;  2AZV A;  1Q81 C;  2X51 A;  3E19 A;  1NG2 A;  1WZO A;  4X1V A;  1JQQ A;  1JBM A;  2E41 A;  4OMM A;  2QTV A;  1BKB A;  1WXT A;  1WHH A;  5D6Y A;  2K4Y A;  2KRM A;  1OPK A;  3I35 A;  1Y71 A;  1ABQ A;  1Q81 R;  4J9D A;  2XIC A;  3QZ5 B;  2IG0 A;  2RQU A;  3LYI A;  2DX1 A;  3OYH A;  3V8L A;  1XJW B;  4JJD A;  2CS7 A;  2ZPE B;  3EFO A;  3VU3 C;  1WJQ A;  1U5S A;  2RI2 A;  1N8R U;  1ZA2 B;  2CH4 A;  2FO0 A;  1S72 A;  1R8O B;  1NE8 A;  4VUB A;  5A0D A;  1MHN A;  3EFS A;  3OY9 A;  2J6K A;  5AYF A;  4O6J A;  1UJ0 A;  5GAM e;  3RKW A;  3G7Z A;  2FPD A;  3RDV A;  4JPB W;  3M57 A;  3CC4 T;  4ZGD B;  4FYV B;  2KR3 A;  2EBP A;  5HY6 A;  2QQS A;  2CP6 A;  1Q82 U;  2WAC A;  2RO0 A;  1T3L A;  5GAO l;  4M78 A;  4C8Q D;  3F70 A;  1RAA B;  4KUI A;  3JCM b;  4PJN A;  4ZNX A;  2HKQ B;  1IGU A;  3J80 E;  2O4X B;  3TRE A;  4M4Z A;  3EG3 A;  3A5Z B;  3M0P A;  1TSF A;  2ED0 A;  3G6E T;  3ZEH A;  1AWW A;  1H3Z A;  4ZGE B;  2M02 A;  5CKF A;  1VQ6 A;  3MCA B;  2VAS A;  2JTF A;  1M1K R;  2D6F A;  3CCL Q;  4AFS C;  1SSH A;  3BY7 A;  1OI1 A;  2KBT A;  2K79 A;  2LTO A;  1LVK A;  1D09 B;  2AZS A;  4II1 A;  3QG1 A;  1S72 Q;  1N8R C;  3CCQ T;  1MGQ A;  1HJD A;  2D9T A;  1TH7 A;  1UJY A;  1IHW A;  4WTO B;  1WLP B;  3HHT B;  4HVU A;  1FX7 A;  2D0N A;  1N6A A;  5KYU A;  1G83 A;  2JUF A;  1K73 R;  4JS5 A;  3HRS A;  1UGV A;  1M90 C;  2LMJ A;  4XQ3 A;  1MNE A;  2F2W A;  1E6H A;  4XU1 A;  1WYX A;  3QZ9 B;  4KBM B;  2KYM A;  3G1J A;  3CME T;  9ATC B;  3URG A;  4IUQ A;  3QWY A;  3OYB A;  2XMF A;  1YIJ A;  2DM1 A;  4LE9 A;  3H8Z A;  4ZN3 A;  4Z02 A;  1JB0 E;  2DYB A;  2NUT A;  2MF2 A;  2EQI A;  3S3O A;  4OMP A;  4BD3 A;  5FWB A;  3X26 B;  2D0Q B;  4JDS A;  1AD5 A;  2A08 A;  3R6N A;  2L3Q A;  4FSS A;  3FC3 A;  1QW1 A;  3RER A;  2LNH B;  4D8D A;  4XU3 A;  5GAN 7;  3V7R A;  1OZ3 A;  3KXT A;  1G3W A;  1BI3 A;  3MET A;  5GAN g;  3NTI A;  2RQT A;  5KH6 A;  2NWM A;  4CC2 A;  4F7U B;  1IZ6 A;  3CCM T;  5GJV B;  5GAN 3;  3GIB A;  2XU8 A;  2E10 A;  2LNV A;  3RUX A;  2F5T X;  2LT1 A;  4R55 A;  2RA2 A;  3PMI A;  2CYZ B;  4LD6 A;  4CC4 B;  1M4Z A;  3Q1J A;  2KT1 A;  2DL8 A;  3TVT A;  1EX4 A;  1KSW A;  1KHI A;  5J3B A;  3A8H B;  2QEX Q;  1VQ9 Q;  2DTI A;  5CQX A;  3VUB A;  1GFD A;  2EKH A;  3OS0 A;  3BW1 A;  1YI2 A;  5GMK j;  3CCQ A;  3ZFJ A;  4M7A A;  2NUP A;  3BE3 A;  3GF5 A;  5GMK h;  4IKF A;  4BY6 C;  1KC8 C;  4KH0 B;  4E7L A;  1X75 C;  6AT1 B;  2DL7 A;  2BZY A;  1XOV A;  2O4X A;  2HSE B;  1D0X A;  1GCQ A;  1G3Y A;  3H6Z A;  3I55 T;  3OYN A;  4Z89 A;  2QTX A;  4FT2 A;  3LH0 A;  1PKT A;  3A8O B;  2DRM A;  2ATC B;  2C06 A;  1OV3 A;  1UGR B;  3QII A;  4IUU A;  2F2V A;  5D6X A;  2GCX A;  1QCF A;  1JJ2 P;  2MAM A;  1BU1 A;  4QVC A;  1M2V A;  1FYN A;  2CP7 A;  2KQW A;  4OMO A;  3JCM J;  3CCL T;  1VQ6 T;  4LDX A;  3CC4 A;  3VS4 A;  5DLO A;  1M3B A;  1PNJ A;  1E7O A;  4C5H A;  2VKN A;  1K0S A;  1MMG A;  1V29 B;  4QQG A;  2LJ1 A;  3JB9 J;  1F1B B;  4AT1 B;  4PJO D;  3NTK A;  3SEM A;  1RLQ C;  3QBY A;  3CMA A;  5GAN 5;  2CP0 A;  1NJI U;  3RBB B;  4EMG A;  1VIE A;  2QGF B;  4X9C A;  1N5Z A;  1YIT A;  3G6E Q;  4AFZ C;  2FEI A;  2EGA A;  2M0O A;  2L3S A;  4J9B A;  1HXD A;  2F1L A;  3CCR A;  1GL5 A;  3VYG A;  2RN8 A;  4PFO A;  3JB9 F;  3JCM P;  2LQW A;  1QVF A;  4CC3 A;  2QQA A;  4ESR A;  4C5E A;  5LJ3 h;  1RAH B;  2XDP A;  2EPD A;  2A36 A;  1SSF A;  4J9I A;  1YCY A;  1AWX A;  1WHG A;  3NTH A;  4LUE A;  3JCM W;  1K8A R;  3J7A F;  1HK9 A;  1AT1 B;  1WJS A;  3FB9 A;  4C92 F;  4M7D C;  1AEY A;  1WHJ A;  2KGT A;  3I9Q A;  2GF7 A;  4M7A G;  2MK5 A;  1I5O B;  3S3N A;  4FW1 A;  4N4H A;  2HMA A;  3LLR A;  1KQ2 A;  4BE2 A;  2X35 A;  3I5R A;  3CCR Q;  3EHR A;  2CZ7 B;  3CQT A;  3QUI A;  4PJO G;  4F14 A;  1K0X A;  1CKA A;  2YRV A;  2DIL A;  1K76 A;  5IHK A;  1M27 C;  3DLL A;  3MEW A;  4M78 D;  4NOY A;  3CCM Q;  1J3T A;  2FYK A;  4OB2 B;  3M56 A;  2VB6 A;  1U8R A;  4C5I A;  1C1A A;  2L8D A;  2COW A;  2QA4 T;  5EG2 A;  1LNX A;  3CCU Q;  1Q86 U;  3LX7 A;  4RTZ A;  2KRO A;  4PJO E;  3M4Y A;  3A8G B;  3SWN A;  4FCY A;  3JCM Q;  3NPF A;  3QHS A;  1OX8 A;  2ZPH B;  2D8H A;  2C0I A;  2XDB A;  3OBY A;  2DET A;  4ZN1 A;  3RIR A;  1KQS A;  3SHW A;  2YWW A;  1O9S A;  5GJW B;  1WPY A;  2DFU A;  1I1J A;  4EPC A;  4PL6 A;  2DXU A;  4M7A B;  2O9V A;  4XTX A;  2AK5 A;  4ME7 A;  1A0N B;  2P84 A;  1K4U S;  1VQK T;  3VS7 A;  4X34 A;  4GY5 A;  4NL2 A;  4EIK A;  1NPR A;  1YCS B;  3NHN A;  4M7A D;  1YHQ A;  3M0Q A;  3NGP A;  3CCJ Q;  1YJW T;  2JNG A;  4JJC A;  3OW2 S;  2W0Z A;  2GQI A;  1MUZ A;  4BI3 A;  2DL4 A;  4KUL A;  2M16 A;  1M1F A;  2CP2 A;  3E9G A;  4LDV A;  1Y96 B;  2RJF A;  1VQL A;  3AHU A;  3CBP A;  1WQW A;  2EJF A;  3VYH B;  4RUG A;  1VQ6 Q;  4M7A C;  4N4G A;  3M4G A;  1SRL A;  1RL2 A;  2HL5 C;  1YHQ Q;  2KI7 A;  4HVV A;  4M75 E;  1W1F A;  1I4K 1;  4XTV A;  3JB9 H;  2H8H A;  3QO3 A;  1YP5 A;  2XI9 A;  4PJO C;  2EQJ A;  1JEG A;  3MEV A;  1SF9 A;  4A4G A;  1EIF A;  2O9S A;  2NUT B;  4MZT A;  3PNW C;  2HSP A;  3X28 B;  3OS2 A;  2OTJ Q;  4E7H A;  1RAB B;  3OSS C;  2D8J A;  1VUB A;  4FYX B;  1AZE A;  2JVV A;  2LCS A;  2E3H A;  2R57 A;  4DOV A;  4XTW A;  3PGG A;  3JCM h;  2VVK A;  2JZ2 A;  1HSQ A;  4A53 A;  4GLM A;  1ZUY A;  2ZPG B;  3OYE A;  3EG9 B;  1QCN A;  2QDL A;  4JRQ A;  1Y7X A;  5GAO n;  3CMA Q;  4FM4 B;  1PSF A;  4F04 B;  1W6X A;  1V1C A;  4XU2 A;  3PT9 A;  2RH2 A;  2AKK A;  5ECA A;  3E9F A;  1UEC A;  2MMP A;  5DM7 R;  2HAX A;  2QEX A;  1VQ9 A;  3GPL A;  3CC2 T;  4E7S A;  1OYX A;  3M0R A;  4FYW B;  2KYB A;  4DA4 A;  4OMQ A;  4RKU E;  1VQ5 A;  3CC7 Q;  1QMC A;  1LOJ A;  5GAN f;  2L3P A;  4KGZ B;  4NL3 A;  1YJ9 Q;  2F5K A;  4IUT A;  3I56 Q;  4OB3 B;  3CC2 A;  3MPU B;  5GAN 6;  1MND A;  2V26 A;  3JAM E;  1BBZ A;  4A4F A;  4BUG A;  1KFZ A;  1TUG B;  1IRX A;  3VRY A;  3G4S A;  1UTI A;  4QW2 A;  1BI1 A;  2LQN A;  4TVR A;  4JS4 A;  2JTM A;  1M90 R;  4BE1 A;  2LDM A;  1K9M R;  1YIT T;  2KEA A;  1G3T A;  3RNJ A;  1K73 C;  1JXO A;  5GAO r;  4JLI A;  1IRE B;  2D1X A;  4C92 E;  5DLQ E;  1BB9 A;  2HCK A;  4E7I A;  1RAF B;  2CUB A;  4OML A;  4C8Q C;  2VXF A;  1ZUK A;  3MEA A;  3CPW A;  1VQO T;  1M1K U;  2RF0 A;  1YI2 Q;  4ORZ A;  1MMA A;  4JUV A;  1RAE B;  1VQL Q;  1PD0 A;  2YDL A;  3OBW A;  1C0M A;  2BZ8 A;  3VUZ A;  1VQN T;  2OAW A;  1VIF A;  4JJN K;  2DNU A;  1Y07 A;  1D0Y A;  1KJW A;  2H3J A;  1ARK A;  3EGD A;  2FG0 A;  1YJN A;  1K9A A;  2P0K A;  2JT4 A;  3TSZ A;  3CC4 Q;  2FVU A;  1KQS S;  4M7D A;  3NFC A;  1RAD B;  4MMK A;  4DOW A;  1B7T A;  3CCU T;  2RK1 A;  2P0Q A;  1T3S A;  4IUV A;  1NZ9 A;  4E6R A;  3N5B B;  4ELZ C;  4YTL A;  1NJI C;  3G71 A;  3UA6 A;  1X6G A;  1QVG A;  2NUP B;  3PVL A;  1VQ8 A;  3OA6 A;  4J9F A;  3EGX B;  2LJ3 A;  2FZC B;  2I2L A;  2CUD A;  2VUB A;  4LDY A;  4M77 A;  2OAU A;  1O75 A;  2CKK A;  3EH2 A;  5CQY A;  4RCC A;  1SHG A;  1JO8 A;  1KIK A;  2PZ1 A;  4NS5 A;  2M0Y A;  5KCH A;  2OX7 A;  1X27 A;  1YN8 A;  1B3Q A;  4RMO A;  3QYG B;  5LJ3 e;  3PMT A;  2ENM A;  4PK4 A;  4P5N A;  1YIJ Q;  1ZLM A;  3M59 A;  3CCJ T;  3H0F A;  1FWZ A;  4L5G A;  4M7D F;  2LX7 A;  1QKX A;  1KD1 C;  5AT1 B;  3HFO A;  3UPU A;  1C6V X;  2QAZ A;  2JW4 A;  4CI0 C;  4OF1 A;  2JS0 A;  1M2V B;  2EYZ A;  3VS3 A;  2V8J A;  4RTW A;  5FW9 A;  1ZBX A;  3CD6 A;  5KYY A;  2LC4 A;  3CC2 Q;  2GQV A;  1YHQ T;  5CR2 A;  1GXI E;  2BIV A;  1VYT A;  4J6Y A;  1WXB A;  2JMA A;  2ZZD A;  3OS5 A;  1IB8 A;  2L2P A;  5CKH A;  5KYW B;  4KT0 E;  1TXQ A;  2RMO A;  1JJ2 A;  3KFV A;  4LN2 A;  5GAM f;  4RTU A;  3MP8 A;  3MO8 A;  4Y91 A;  3SWN B;  2RD1 A;  1EFN A;  4M7A F;  4A4E A;  4DBF A;  1NLO C;  3OYJ A;  4Z88 A;  1D0Z A;  1GBQ A;  1SHF A;  2DF6 A;  3E2U A;  1PSE A;  1K9M U;  2QQB A;  4OB0 B;  3VV0 A;  2GTO A;  1WQ7 A;  1YJ9 T;  1TWB A;  2QA4 A;  4FW2 A;  4QT7 A;  1M90 U;  2K5F A;  1FMW A;  2RHU A;  1LCK A;  4M75 C;  3SD4 A;  4A54 A;  2XHC A;  3I56 T;  5FLX E;  1FMV A;  1SPK A;  4RTY A;  4XTY A;  2E64 A;  1Q7Y U;  3P8D A;  3SFM A;  2JS2 A;  3CBO A;  1M8V A;  2B86 A;  1D1A A;  3JV3 A;  2DXC A;  2YUN A;  4XK8 E;  4DBQ A;  2DXB A;  1YBY A;  2YUP A;  3J81 E;  2EYQ A;  1ACM B;  3WVD B;  3OSV A;  1K73 U;  3FLG A;  4E47 A;  4OMN A;  2WSE E;  1VQP Q;  4JLG A;  3UF4 A;  4MZP A;  3BDL A;  1Q86 R;  3QDF A;  3CCS Q;  1LPL A;  4QQ6 A;  4FU6 A;  1SRM A;  1VQN Q;  3FJ5 A;  3DB3 A;  1MV3 A;  2A0F B;  5J26 A;  1QKW A;  4KGX B;  3SDZ A;  4M75 G;  1DJ7 B;  5CCA A;  1W2B S;  1I07 A;  1N8R R;  3G6E A;  2E1H A;  5A2Q E;  4GBQ A;  1OU9 A;  3GP8 A;  5FRO A;  1M9S A;  2PVG B;  3PIP A;  1BI0 A;  3L2Z A;  2DAQ A;  3EGU A;  2EW3 A;  3IQL A;  3JSC A;  1IXD A;  1M1K C;  2ROL A;  3BDU A;  3JCM c;  4XU0 A;  1YI2 T;  4M7D G;  1YWP A;  2RJE A;  3C4S A;  1Y0M A;  4XAX B;  1QP2 A;  1KQ1 A;  2YRC A;  1E6G A;  4OGC A;  2Y4Y A;  2ROT A;  2BZX A;  2M9U A;  3PFS A;  3PE0 A;  5KYU B;  3GOX A;  4B9X A;  2YHT A;  4FSX A;  3ZL7 C;  2QG9 B;  2DTO A;  3LWH A;  3FIF A;  5KYY B;  3RKX A;  1S72 T;  2LQK A;  2CZ6 B;  2F69 A;  2VC8 A;  1Y96 A;  2CP3 A;  4F17 A;  4K11 A;  5LJ3 f;  2AIR B;  2OTL Q;  3X25 B;  1ZSZ C;  2GGR A;  2MIO A;  1QVG P;  4LDU A;  3M0S A;  4M77 C;  1XQH A;  5HKC A;  3UA7 A;  2RB6 A;  4WF2 A;  1H64 1;  1BYM A;  4M77 E;  3CXC P;  2YUQ A;  3CEY A;  3C94 A;  2B8A A;  1BCO A;  2MPX C;  5GAN h;  2EGC A;  1K8A C;  4M78 C;  2P4T A;  3HSB A;  3CME A;  4JRI A;  4L59 A;  3G4S Q;  2XD0 A;  3GNF B;  1Q95 G;  3I5S A;  2HZY A;  4A63 B;  3L2V A;  1B34 A;  2CZ1 B;  1W4S A;  1Z9Z A;  3VRZ A;  5LJ3 j;  1X69 A;  4C0G A;  1ZSZ A;  5IXB A;  3UT1 A;  3ASK A;  2LQ8 A;  3FDR A;  4Y92 A;  2DLP A;  1GCQ C;  2X4Y A;  2RHY A;  5GAN 2;  2Y90 A;  4HCB A;  5CIU A;  4IIO A;  4PNO A;  2F2X A;  3EFR A;  3MKD A;  3EFO B;  3G71 Q;  3REB B;  3L2R A;  3L2Q A;  2HBW A;  2RHX A;  4OP0 A;  4PJO B;  4IUR A;  4RTV A;  1IO6 A;  4HCK A;  3EAE A;  5L23 A;  1WX6 A;  2DIQ A;  2RI5 A;  4C0Z A;  2RK2 A;  2HQX A;  5IT9 E;  1WHM A;  3MP6 A;  4HXJ A;  2RHZ A;  2Y4X A;  2L0A A;  2DYI A;  2M1H A;  1PHT A;  2DD5 A;  2CSQ A;  3WXM B;  5I2S A;  5CKE A;  1TS9 A;  2C0O A;  1SEM A;  2XK0 A;  2E3I A;  1WGS A;  2JJ9 A;  2ECZ A;  2PVO B;  5LJ5 h;  4N0A A;  3OW2 A;  1YJN T;  4XTU A;  1RLP C;  2BKD N;  2E6N A;  4M75 F;  4D6W A;  3CPW S;  3KBG A;  2ZCF B;  1OOT A;  2DMO A;  2M51 A;  4ZTJ A;  5CKD A;  4M7D E;  2QYZ A;  1VA7 A;  4A4K A;  1VQ8 T;  1ZUU A;  2V1R A;  1UGS B;  4PFP A;  4BAC A;  1HYO A;  2OTL T;  2XKO C;  3NMZ C;  3S3M A;  2O88 A;  3CC7 A;  1FMK A;  2COY A;  4BDY A;  2RI3 A;  1VQ5 Q;  2DJQ A;  5KCO A;  2YT6 A;  4HT8 A;  2RM4 A;  2J6O A;  3PTA A;  4RTT A;  1VQ7 T;  2GFU A;  2IPO B;  3QKJ A;  3U23 A;  3OYK A;  2EGE A;  2ZPB B;  4J9G A;  2DZC A;  1VQ4 T;  4QVD A;  4ANJ A;  2COZ A;  3L1A A;  5CAI A;  5GAM h;  5GAN e;  3HRU A;  4IUP A;  4HT9 A;  2K6D A;  4HKE A;  3QJY A;  2L3R A;  2X3W D;  4O5V A;  3P8H A;  3EG2 A;  4AMC A;  5J39 A;  1N9S A;  4ZGJ B;  4KUD K;  5LJ3 g;  5IH2 A;  3VS0 A;  2LT4 A;  2R5A A;  2RQV A;  2X3X D;  4E7K A;  1B34 B;  3G4S T;  5IAY A;  2E70 A;  3EG1 A;  3ER0 A;  3M54 A;  3VS2 A;  1VOM A;  3CPF A;  3EG0 A;  2ABL A;  1X6O A;  2RJC A;  5GMK l;  2CH4 W;  4OB1 B;  2KDS A;  2FRW A;  1PKS A;  2FB7 A;  4PJO F;  5GAN j;  2DA9 A;  1I5L A;  1UG1 A;  1S1N A;  1WI7 A;  1QLY A;  3M9Q A;  3V8J A;  2WSC E;  2EFI A;  5KE2 A;  1Q7Y R;  2AKL A;  4F7U E;  1B07 A;  1YJW Q;  2DEU A;  5KYW A;  4J9E A;  3OYL A;  3JRZ A;  3OYI A;  5CK9 A;  2LP5 A;  3RMQ A;  1Q82 C;  3H0I A;  3V7C A;  2PUK B;  2EWN A;  3V7S A;  1KC8 U;  2CP5 A;  3M0U A;  3FRN A;  3CXC A;  2EAY A;  3A8L B;  3JCM f;  3DKM A;  2FL7 A;  1WDX A;  1ZX6 A;  4M77 F;  1Y57 A;  1GBR A;  2R5M A;  2HL3 A;  5KYX A;  1WIE A;  2FPE A;  3VS5 A;  4FIB A;  1R0B G;  2YXY A;  2HD0 A;  1UUE A;  1TTH B;  2DTH A;  3LH5 A;  3OYG A;  1VQO Q;  4PJO A;  4AG2 C;  3HFN A;  3CCS A;  1N9R A;  1OX9 A;  1M1G A;  4X9D A;  1VQM Q;  4D8K A;  1LJO A;  1VQL T;  2DL5 A;  1I8F A;  3CCQ Q;  3OYD A;  1G8X A;  4JZ3 A;  3QSU A;  1NEB A;  3DLM A;  4HA8 A;  4BI8 B;  1WNL A;  2EQK A;  1AOJ A;  3EHQ A;  5IXF A;  4MDW A;  4J7F A;  3G71 T;  1PC0 A;  4BI4 A;  3OMC A;  3OW2 P;  1VQO A;  1YJN Q;  4R56 A;  3GNG A;  1QVP A;  1TU0 B;  2O2O A;  3QDR B;  2K3X A;  1VQM A;  3X24 B;  1PM3 A;  2YLB A;  1ZBJ A;  2EYY A;  4CRI A;  1WXU A;  3M58 A;  2MYS A;  3H41 A;  2PUO B;  2KMT A;  2LCL A;  3FJP A;  3JB9 G;  1W2B A;  4RCB A;  3BFM A;  4J9H A;  3M53 A;  4C8Q B;  2EYW A;  3S6W A;  2JM9 A;  2DPP B;  4M77 G;  1R77 A;  4KGV B;  1X43 A;  2DL3 A;  3CCV T;  1VQK A;  1G3S A;  2K7A A;  1Q7Y C;  3TQ7 P;  1VYV A;  3VKI A;  4M75 A;  1JRI A;  2SEM A;  2K5L A;  3LGL A;  4C5G A;  5EC7 A;  2O31 A;  5LJ5 j;  1D1C A;  4M75 D;  4EMK C;  1K9M C;  4E2F B;  1UHF A;  2QGG A;  3A1P A;  2AT1 B;  1M3A A;  4A4H A;  1QP3 A;  4IIM A;  2K3Y A;  1K8A U;  4EMK A;  1ABO A;  2RQW A;  2KSS A;  4DBH A;  4B6M A;  2RPN A;  4JRK A;  2VGN A;  1QWE A;  1JU5 C;  2EJG A;  2R58 A;  3LW5 E;  1VQ5 T;  2XDD A;  3CMA T;  1AWO A;  4PLI A;  3GBQ A;  3LWI A;  2KXC A;  2PTK A;  2X4X A;  4XTZ A;  5GAN 4;  3CCE A;  3PIO A;  1WHK A;  4DQ2 A;  1NBE B;  5FRM A;  5FRN A;  4EDU A;  3OYA A;  4F7U A;  3T9N A;  3HTR A;  2V1Q A;  1RAI B;  2QQ9 A;  2G6F X;  2E12 A;  3CCL A;  3PVQ A;  4OVA A;  5GMK i;  1NEG A;  2P0P A;  2J6F A;  4C0D C;  5I21 A;  3R6O A;  5I2M A;  5LL6 S;  2KK4 A;  2LX9 A;  2E6Z A;  4QQD A;  3H9N A;  4PFZ A;  2MWP A;  4ZTF A;  3CD6 Q;  4M7A E;  2EYX A;  2RHI A;  2BE9 B;  4QVZ A;  2DZ9 A;  5FU6 C;  2JN0 A;  1WA7 A;  2ESW A;  1OZ2 A;  2EQM A;  3WVE B;  3JCM X;  4CC7 A;  3FEO A;  5LJ5 f;  2IVW A;  3RR6 A;  2G3R A;  4ELY C;  2GTJ A;  2KVQ G;  1KD1 U;  1TUD A;  3JCM g;  4C92 B;  5HK0 A;  1JXM A;  4PKC C;  3CXC S;  4LDW A;  2GNC A;  3VJP A;  4C0D B;  4UC4 A;  2QXF A;  4HCZ A;  2A3L A;  4C92 C;  4J83 A;  1VQ7 A;  1U3O A;  4C92 D;  4C8Q F;  1T0J A;  1UE9 A;  1GRI A;  1KK7 A;  5GAO m;  2PU9 B;  5M9O A;  5C6S A;  2DD4 A;  2HKN A;  3E1S A;  5LJ5 d;  4LD9 K;  3VS6 A;  1AHJ B;  1MMN A;  2WSF E;  4DEY A;  1JJ2 S;  1G2B A;  3ULR B;  3EGX A;  2DER A;  3OYY A;  3HRT A;  4J5Y A;  1NM7 A;  3C12 A;  4M77 B;  1FXX A;  1KHC A;  2OTL A;  1KQS P;  1BI2 A;  3RMS A;  2Z0W A;  2K57 A;  4MML A;  1XTD A;  2VXE A;  5LJ3 d;  3KUF A;  2P4R A;  3EH1 A;  4M78 F;  4M77 D;  3I55 Q;  2LZ6 B;  1VQ7 Q;  5GMK e;  2DRK A;  1MV0 B;  1UEB A;  2X4J A;  2BUD A;  2JOY A;  4QKU A;  4V2S A;  2V8I A;  3A8M B;  4RG8 A;  1HD3 A;  3INZ A;  3HKS A;  3CME Q;  3M5A A;  5C0M A;  1Q82 R;  5GAN 8;  4M75 B;  3A98 A;  3REA B;  2DBK A;  5HK3 A;  1YJ9 A;  1PRM C;  2A28 A;  2JM8 A;  2HQH A;  1M30 A;  2CSI A;  2DVE A;  5GAM d;  2FPF A;  2VV5 A;  1YIJ T;  1QVF P;  4GLK A;  4LNP A;  3L42 A;  1IHV A;  2GFA A;  2KY9 A;  1NPP A;  2ZPF B;  3ZBD A;  2XG8 D;  5D7U A;  4M7D D;  4AFU C;  2V8K A;  1TOV A;  4MZM A;  3GLX A;  1IGQ A;  2RNA A;  1M8M A;  2CZ0 B;  1H3H A;  2KRS A;  1UGQ B;  3TU4 K;  1H92 A;  5DY9 A;  5GAN d;  2MCN A;  3EG9 A;  2I0N A;  4F7U G;  3CCV Q;  5IHI A;  3HL8 A;  4PJM A;  1BK2 A;  1N27 A;  3QPH A;  2LCC A;  2RQR A;  1NLP C;  4J6X A;  3C0C A;  3OYC A;  2LRQ A;  4AFQ C;  5GAO p;  5KYX B;  2OI3 A;  2XID A;  2QQR A;  1UFF A;  3MP1 A;  2K9G A;  5CVI A;  3MHX A;  4AG1 C;  5A0L A;  2EKO A;  2VGM A;  3LGF A;  1PD1 A;  1P92 A;  1ZQ1 A;  5I11 A;  4J9C A;  2QA4 Q;  1PWT A;  1OPL A;  1BCM A;  4JZ4 A;  2KT8 A;  1TUC A;  3M0T A;  2L5Q A;  3THK A;  2E65 A;  3TCJ A;  3OYM A;  3CCR T;  5FWC A;  4ATO A;  5L8R E;  1QWF A;  4FT4 A;  2DVJ A;  4KH1 B;  1CKB A;  3TEE A;  3OMG A;  2E4H A;  2MOX A;  2EIF A;  4JRP A;  1X2Q A;  1VQM T;  1VQP T;  1H8K A;  4Y28 E;  1NJI R;  1Z9Q A;  2A37 A;  1X6B A;  3L2U A;  8ATC B;  3CCJ A;  2DXT A;  1PRL C;  5GAO q;  2PQW A;  4JJB A;  2VWF A;  1SKU B;  4BE0 A;  3QJ6 A;  4M78 B;  1R0C B;  3MJX A;  1WFW A;  3ME9 A;  2K2M A;  2H3E B;  2KE9 A;  3I55 A;  5LJ5 g;  2CGH A;  1GCP A;  4Q5W A;  3RES A;  3CCS T;  2PNI A;  4L6V 5;  1OU8 A;  5LJ5 e;  3EGD B;  3C95 A;  3CCE T;  2YRD A;  4BDZ A;  2SRC A;  2EQU A;  1SG5 A;  3JCM d;  3VS1 A;  3JB9 I;  3CCU A;  1Q86 C;  2JXB A;  3V8K A;  4HCC A;  3HPW A;  3QYH B;  1QCO A;  1VQP A;  1VQK Q;  2E5Q A;  1AZG B;  1GFC A;  2K3B A;  4OMF B;  4C8Q A;  1VQN A;  2HQE A;  1QVF S;  4EMK B;  2K5I A;  2ZPI B;  2DBM A;  3SWN C;  2HDA A;  2CT4 A;  2OTJ T;  5I22 A;  1VQ8 Q;  4M7D B;  2VYT A;  2EJ9 A;  2J05 A;  3I56 A;  2KAF A;  2KNB B;  5CKB A;  1X01 A;  1KC8 R;  2DE0 X;  3O5Z A;  4C0F A;  2LVM A;  2O01 E;  1W2B P;  5FU6 B;  3TSW A;  2QK0 A;  4MDX A;  1I0C A;  5GAM g;  1OUL A;  1K1Z A;  1EZZ B;  1M3C A;  1AWJ A;  2GBQ A;  3CCV A;  2X4W A;  3JB9 D;  4C8Q E;  3HP9 A;  3X20 B;  1CSK A;  4FL6 A;  1D3B B;  1YFN A;  1G5V A;  2QI2 A;  3OYF A;  1ZHI A;  4F7U F;  2RJD A;  1M2O A;  1U06 A;  2ZAE A;  3CCM A;  1ZA1 B;  1RAG B;  2FZK B;  1VQ4 Q;  1D1B A;  1WJR A;  2MWO A;  5GMK m;  4WCI A;  1RAC B;  4DBR A;  2PVD B;  4M78 E;  4RTX A;  2MI6 A;  2DEQ A;  2YLC A;  4C8Q G;  1UDL A;  3AT1 B;  2FZG B;  1I81 A;  2KXD A;  5KYN A;  2J06 A;  2DO3 A;  1YIT Q;  1UB4 A;  1YWO A;  4N4I A;  4PJL A;  4J7I A;  3CD6 T;  1T0H A;  1ZSZ B;  2C0T A;  3DB4 A;  2A7Y A;  1VQ4 A;  2QAS A;  2CDT A;  1QQJ A;  2NYS A;  2IIM A;  1RI9 A;  4C92 A;  1W70 A;  1X2K A;  5HCK A;  4Z8A A;  4DEX A;  1NYG A;  1V76 A;  3QWX X;  1KD1 R;  4M78 G;  3RKY A;  3M55 A;  3OB9 A;  1PG5 B;  2X9H A;  1NYF A;  4LUD A;  1OEB A;  3D7S B;  4PJJ A;  4C92 G;  3QXE B;  1MMD A;  1UGP B;  2KRN A;  1RI0 A;  5IHN A;  4BB7 A;  1YNZ A;  2NUZ A;  2AHJ B;  1ZSG A;  4R0K A;  3P8B B;  4J6W A;  2BTT A;  4KRT A;  2NLU A;  1BIA A;  4EMH A;  3L2W A;  1XNI A;  1KG1 A;  5KE3 A;  1VYU A;  4B9W A;  1PCX A;  3H0H A;  1QVG S;  4RG2 A;  2QDY B;  1Q81 U;  5FU7 B;  2HEQ A;  2CT3 A;  3O8V A;  3MEU A;  2CRE A;  2HBP A;  3UAT A;  2DIG A;  1YJW A;  5FU7 C;  2J7I A;  2DJZ A;  8AT1 B;  5IN1 A;  2BE7 D; 
#chains in the Genus database with same CATH homology
 1JJ2 P;  2QEX Q;  1VQ9 Q;  1YJ9 Q;  1VQP Q;  2OTL Q;  1YJW Q;  3G71 Q;  3CCR Q;  1VQ5 Q;  3CCE Q;  1Q86 R;  3G4S Q;  1KD1 R;  3I55 Q;  3CCS Q;  1S72 Q;  3CC4 Q;  1K8A R;  3I56 Q;  1VQ7 Q;  3OW2 P;  1VQO Q;  1QVF P;  1YIT Q;  3CCU Q;  1VQN Q;  3G6E Q;  1YJN Q;  1QVG P;  1VQ8 Q;  1YI2 Q;  3CD6 Q;  3CME Q;  1KC8 R;  1VQM Q;  1VQ4 Q;  1KQS P;  1NJI R;  1W2B P;  1VQK Q;  3CCV Q;  1M90 R;  1VQL Q;  1M1K R;  1VQ6 Q;  3CMA Q;  1Q82 R;  3CCM Q;  3CCL Q;  2QA4 Q;  3CXC P;  1K9M R;  3CC7 Q;  1Q81 R;  1N8R R;  3CCQ Q;  1Q7Y R;  1YIJ Q;  2OTJ Q;  3CC2 Q;  3CPW P;  1YHQ Q;  1K73 R;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...