3CPXA

Crystal structure of putative m42 glutamyl aminopeptidase (yp_676701.1) from cytophaga hutchinsonii atcc 33406 at 2.39 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
309
Chain Sequence
ENLYFQGMQLLKELCSIHAPSGNEEPLKDFILEYIRSNAGSWSYQPVIYADNDLQDCIVLVFGNPRTAVFAHMDSIGFTVSYNNHLHPIGSPSAKEGYRLVGKDSNGDIEGVLKIVDEEWMLETDRLIDRGTEVTFKPDFREEGDFILTPYLDDRLGVWTALELAKTLEHGIIAFTCWEEHGGGSVAYLARWIYETFHVKQSLICDITWVTEGVEAGKGVAISMRDRMIPRKKYVNRIIELARQTDIPFQLEVEGAGASDGRELQLSPYPWDWCFIGAPEKDAHTPNECVHKKDIESMVGLYKYLMEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative M42 glutamyl aminopeptidase (YP_676701.1) from Cytophaga hutchinsonii ATCC 33406 at 2.39 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
molecule keywords Aminopeptidase, M42 family
total genus 95
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3cpxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3cpxA01
3GUXA 3B3CA 1GYTA 4R8FA 4BD9A 4P4BA 5K8NA 2RB7A 1F2PA 1LAMA 5LRKA 1TF9A 3D7GA 4K3NA 3PBBA 3WC5A 4ZI6A 3GLJA 4OC0A 4NGMA 2CF4A 3K2KA 3D68A 4OC3A 3MN8A 3B3TA 2ZEMA 5JH9A 4JZ0A 3B2YA 2AFZA 3N5FA 1M4LA 1Y0RA 3FMCA 5LRGA 3WT4A 1NSAA 2DEAA 1CP6A 2V8HA 2PJ3A 2C6CA 3WC7A 2PJAA 1FT7A 5HVHA 2JBKA 4NGPA 3FEEA 3HLPA 3NH8A 2PJ1A 3SI0A 5IB9A 2ZEOA 4NGTA 1EE3P 3KGQA 2PJCA 4OMEA 4OKOA 3WC6A 1LFWA 3VH9A 2PJ2A 1ARMA 1AYEA 2PRQA 2HC9A 5D29A 2PJ0A 3PEIA 5I4MA 2ZEEA 3PFEA 4JYWA 4NGRA 3BI1A 3JRUA 3WABA 2NYQA 2XEGA 3CPAA 3HUVA 3KQZA 4MCPA 5HXDA 1BPNA 4MMOA 5THWA 4A94A 3ISZA 3IJ3A 4A39A 4PXBA 1R43A 1CG2A 2G9DA 3TX8A 1FNOA 1XRYA 3KI9A 5JGFA 1ELLP 1VHEA 3PB9X 2AFOA 3KR4A 3LMSA 1VHOA 5LYDA 4X8IA 1ZG8A 3KQXA 3RBUA 2ANPA 1ZG7A 1ARLA 1VGYA 4A37A 3FVLA 3FJUA 4PXEA 2GU2A 4OP4A 1CX8A 1LANA 2C1CA 1BPMA 2HB6A 3SJGA 4FBEA 4WJBA 4P45A 2QJ8A 4A38A 1OBRA 2PIYA 4NJQA 2ZEGA 2AFMA 5HVFA 1TKHA 4EWTA 2ZELA 2ZEFA 2PJBA 3KZWA 4P4JA 4ZY0A 4MCQA 3RAMA 4IHMA 1F2OA 3PB8X 3IIBA 1LAPA 4UEZA 4FUUA 3IC1A 3KHXA 2Q51A 1AMPA 5LYLA 2PJ6A 2V8DA 4AXVA 4F9VA 2IQ6A 3B3SA 2O53A 4PQAA 2O4HA 5HVGA 4X3RA 1CP7A 2C6PA 3S9MA 2BOAA 1XFOA 4RUHA 2PVWA 2ZEPA 3D7FA 3FEDA 4UIAA 3NA6A 2FVGA 1XBUA 2V77A 1PCAA 4P10A 4ONWA 3CT9A 4PPZA 5K8MA 4IAVA 1TF8A 4PXCA 1HDUA 2EWBA 2IMOA 6CPAA 1Z2LA 2GLJA 4NGQA 3BXMA 4OC2A 5DS0A 1Y7EA 1TKJA 1YSJA 3H8EA 2BCOA 3IO1A 4NJRA 1BAVA 4P44A 3VARA 2QVPA 1ELMP 4F8ZA 8CPAA 1YMEA 7CPAA 1Y0YA 4MCRA 2AFXA 2V8GA 4O23A 4P4EA 1LOKA 2I3CA 4EFDA 4P4IA 2EK8A 1CPSA 3NH5A 4ZY2A 3FH4A 1YLOA 5LYFA 2NSMA 1ZG9A 3K9TA 4UF4A 4YU9A 1DTDA 3CDXA 5K8OA 2ABZA 2PVVA 4TWEA 3B3WA 3PB7X 3I1UA 3KHZA 4MXUA 3QNVA 2AFUA 2Q43A 1Z5RA 3LWUA 2QYVA 4X2TA 1CBXA 5D8NA 4YWYA 3H8FA 1F57A 1ZLHA 4OC1A 2CTBA 1Z8LA 4NGSA 1VIXA 3SJFA 2PCUA 1TXRA 5K8PA 4ZX9A 3FX6A 2RFHA 1R3NA 3S9LA 4FAIA 2BO9A 5CBMA 2GLFA 3S9NA 4MCSA 2PJ8A 4DUKA 1UWYA 1IY7A 4OC5A 3RZAA 2ZOGA 2EK9A 4MRIA 1YW6A 2PJ7A 2XEIA 4GM5A 4MHNA 2PJ5A 2OOTA 1YW4A 2V8VA 3TC8A 5F09A 3FECA 4R76A 4PXDA 5ELYA 4ZY1A 4R6TA 4Q7AA 3MRUA 4WWVA 3NH4A 4UIBA 3VATA 1PYTB 4F9UA 2POKA 4P4FA 3SJEA 1Q7LA 3PRTA 2JEWA 4B6ZA 2PE3A 2ZEHA 1XJOA 1KWMA 2AFWA 2ZEDA 4EMEA 2CIJA 2F7VA 3BHXA 3KR5A 3ISXA 4W9YA 1XMBA 1QQ9A 4P6YA 4R7MA 2IJZA 1ZLIA 1H8LA 4DJLA 1HEEA 2J9AA 1IGBA 2ZENA 3V7ZA 3KL9A 4P4DA 5LRJA 3IWWA 1LCPA 1RTQA 3DGVA 4Z65A 5JM6A 4OC4A 4KSIA 4UEFA 3D66A 4NFRA 3L2NA 3NFZA 4H2KA 2WZNA 1QMUA 2Q4ZA 2AFSA 4G1PA 3H8GA 1TKFA 3D7DA 4UEEA 5CPAA 3B3VA 4TNUA 4ZYQA 3PFOA 3B35A 3BI0A 3T8WA 2C6GA 2F8HA 1DE4C 3SI2A 4FWUA 2JBJA 3IFEA 3D7HA 3SJXA 2OR4A 3SI1A 4ZX8A 1BLLE 3V38A 1JQGA 4MHZA 2XEJA 3GB0A 2XEFA 3CPXA 2WYRA 3IEHA 4NGNA 5LYIA 2VL1A 1HDQA 2CTCA 4DYOA 4CPAA 4MHYA 2PJ9A 3DLJA 5J1QA 2PIZA 4OIWA 2PJ4A 2GREA 3KASA 4IK2A 3B7IA 3D4UA 4OIDA 3D67A 3PB6X 3PBEA 4LQGA 1CPXA 4MHPA 2ZOFA 3PB4X 3FF3A
chains in the Genus database with same CATH superfamily
1EP2B 1GYTA 4BD9A 4P4BA 2VNIA 1F2PA 1TF9A 4K3NA 1R5BA 4ZI6A 4OPOA 4B14A 4AVZA 1WU8A 2Z11A 1I8DA 3D68A 2G3AA 4OC3A 3HAGA 1S5KA 4MFKA 4OPSA 5JH9A 5FNZA 3QFTA 3ONUA 1YVKA 1D1NA 4WZKA 5I0CA 5LRGA 5HXBA 4UFWA 2Z10A 2D9RA 2C77A 1CP6A 4RD2A 3GKRA 1GAQA 2C6CA 1YI2B 2EIXA 3WC7A 1DG1G 4A2ZA 4RJLA 4CRYB 3VO1A 2Q44A 4NGPA 3NH8A 3PZJA 3SI0A 1L0CA 4YRHA 3P2HA 5IB9A 3WNBA 4MFZA 2BM1A 5G22A 2WJVA 2F5IA 4TMWA 4OPVA 4LC0A 2OBTA 2R98A 1R5NA 5THXA 4JXRA 4B3FX 2PRQA 4BBHA 4U9ZA 1VQKB 3KQZA 4MCPA 2OK8A 4CAXA 1W0JA 4WZEA 3A3BA 1W34A 1WK4A 2XZLA 2CXAA 3E1YE 3W2IA 5F4JA 3CCRB 1QVGB 1AIPA 1JNYA 1XE1A 1VQMB 2VEZA 3LMSA 3R6JA 3ZC3A 1U2RA 1JJ2B 1ZG8A 1EFTA 4G7XA 2VBSA 1VGYA 4Z4RA 1CX8A 1LANA 3OEHA 4QVJA 4XPLA 3SJGA 4X7FA 3ZZUA 4JXQA 1WOOA 2HQYA 4P45A 4UFXA 2QJ8A 1UD3A 4A38A 1OBRA 2PIYA 4DNRB 5KTAA 1SQHA 4HNWB 1UD5A 4MFLA 5HVFA 2C78A 2PIAA 4E2AA 3GYAA 1V5VA 2PJBA 1NDHA 5HMNA 1E3XA 2VZZA 1K28D 2EO8A 2CK3A 3FXTA 4TMXA 4B4DA 3ES9A 3LQ6A 1QUEA 4A30A 4C2XA 2BUEA 4M4SA 4RD1A 5LMZA 1F2OA 1G7RA 3KHXA 3RY8A 4UCMA 3SHPA 1R5OA 4PC6A 2G3TA 1OB0A 5FO0A 1QH0A 2V8DA 4KVOE 2VNHA 5F4MA 5FA6A 4AXVA 4F9VA 2IQ6A 4PQAA 1BMFA 5IYQA 3W2EA 2YWEA 2C6PA 3S9MA 2BOAA 3TE4A 3QAHA 4C68A 2ZEPA 1BO4A 4UIAA 2B5GB 3CT9A 2YNEA 4ASUA 5K8MA 4KVME 4Z4TA 4P3IA 3Q38A 2EWBA 1QVFB 4H6UA 6CPAA 1Z2LA 1MJ9A 2GLJA 4R3KA 4M0LA 2CNTA 1Y7EA 4ZGYB 2FX3A 1YSJA 3H94A 4A31A 2BF4A 1W2BB 4UFVA 3OKXA 4PGOA 4CYPA 4MCRA 1G7SA 1X12A 4O23A 1S60A 4Q7JB 4QFMA 1XOVA 4EFDA 3CTAA 3GY9A 4TMZA 2QDXA 2EK8A 1CPSA 3NH5A 4YGOA 4MYTA 4ZY2A 3FH4A 4XNHC 1YLOA 4B47A 4AF7A 2EFGA 1E62A 3V76A 4UF4A 4M1KA 1SKYB 1A8PA 4KS9A 3BJ8A 1D2EA 1VQPB 2Z3PA 1YREA 4KOUA 2WR8A 4P1VA 4CAVA 3E20A 1K73D 3QNVA 4X7CA 4JJXA 2I1LA 1Z5RA 4PC7A 1EFRA 3TOBA 1FNDA 3I1FA 3BC9A 4KOXA 2GJRA 3TCVA 4KLVA 3DR6A 1NSLA 3OE7A 2VQYA 3W6XA 2NPFA 1Q86D 3PUMA 4ZX9A 2E1BA 2PDOA 4FAIA 5CBMA 4OOXA 2B4BA 3S9NA 5C82A 5IYPA 4OC5A 3NE8A 3NE5B 1N71A 5HZAA 2ZOGA 3B82A 1M4DA 4C43A 4A33A 2PJ7A 1VQLB 1GO2A 2BGJA 4GM5A 4MHNA 3TC8A 2ATRA 3AVXA 1B23P 5A88A 4ZY1A 4LBVA 4Q7AA 4UIBA 4JMQA 3FKSA 4LQ6A 4FK8A 1PYTB 4P4FA 2RC4A 3CCJB 2PE3A 1YLEA 1XJOA 3PA1A 2I79A 2AFWA 3BHXA 4YFJA 3TO6A 4KKUA 1OZPA 1QQ9A 3F8KA 2IJZA 1ZLIA 4UCNA 3H5ZA 4DJLA 4QUSA 4F6AA 2J9AA 3V7ZA 3KL9A 2NMTA 1G7CA 3CCEB 4YALA 4FD7A 1VQOB 3D2MA 1I18A 2GQFA 1WPCA 3GIUA 3D66A 3IU1A 1BLIA 3FYNA 5AG4A 4RD3A 2BSAA 4ZGNB 2WZNA 5C88A 2Q4ZA 3H8GA 1XEBA 4UEEA 1VHSA 1I7PA 1KRHA 3D2PA 3B35A 2PR1A 2OTJB 3CXSA 4FWUA 2JBJA 5J8CA 2PLFA 1KUXA 3D7HA 3SJXA 4E0AA 2QIRA 1TIQA 2FCKA 4FD5A 4ONUA 4ZX8A 2BV3A 3V7AA 4XOTA 2ZZQA 3TFYA 4Z4SA 4M85A 2DXQA 4KUAA 1HDQA 2Q6LA 5E6TA 4XLAA 3LQEA 3D8PA 3OPOA 2PJ9A 4N3GA 4B13A 5J1QA 2PIZA 3T51B 1MJAA 3D4UA 3D67A 3PBEA 1CPXA 2B58A 1E1QA 4MHPA 2ZOFA 4B10A 4QVTA 3S6FA 5KTCA 3I56B 3I9SA 3VO2A 3CC2B 1D8TA 5K8NA 1DARA 2C2WA 1Z8WA 5IYWA 1LAMA 2VBTA 2ZBUA 4KKSA 2JJ2A 3D7GA 3QAYA 2J8MA 2BVNA 2QMUA 1M90D 4OC0A 1ZO0A 3W5VA 3D3SA 3T56B 4B3GA 1S7LA 3K2KA 1VLOA 4DK0A 1IIDA 2JDIA 2I00A 3CMEB 5EC4A 4X05A 3I55B 2ZEMA 2KVOA 4C7IA 5CDFA 2OU2A 2BM0A 5HKKA 4ZCMA 4RD0A 3BH4A 4NXYA 5HH1A 1SM4A 2PJAA 5JBQA 3MHPA 4B5PA 4QVAA 3WNDA 1B2RA 3HLPA 4XONA 2ZEOA 4NGTA 3TO7A 2VXKA 1Q82D 4XPKA 3ZPNA 2F1LA 5DN6A 4PV6A 3WC6A 1NJID 1IJEA 1NB0A 5TY0A 5AN9A 1TVCA 5FL7A 1ARMA 1WWZA 1AYEA 5D29A 2PJ0A 3PEIA 1DDIA 4Z4ZA 5I4MA 2ZEEA 5JPHA 1OB5A 4JYWA 4NGRA 2EUIA 4HNXB 1RXTA 3CXCB 1NRKA 1VQ6B 3CPAA 1V0EA 3JQQA 2Q0YA 4CAWA 5HXDA 2VZLA 5THWA 3MMPA 1E1RA 4CRZB 3CD6B 3FIXA 3WBKA 2DY1A 1R43A 4NCNA 1CG2A 2G9DA 4UBRA 2JDDA 1FNOA 4CGPA 2B5OA 1ELOA 3KI9A 1ELLP 3PB9X 5LYDA 3KQXA 1BPLA 1FDRA 4XKVA 1ZG7A 4OADA 1WSRA 1HZEA 3FVLA 4OP4A 4RD4A 2C1CA 3RYOA 1PJ6A 4RCZA 3VNVA 2Q4VA 1YX2A 5A8AA 3AVTA 1G7TA 2B4DA 4MHDA 3GVKA 3OEEA 3A3GA 4B12A 4H89A 4G6IA 4IF5A 2AFMA 1XMTA 2XEXA 3GSIA 3OW2B 1TKHA 1NBMA 1PKVA 4B43A 2R8VA 1Q2CA 1VF7A 3ASPA 1KD1D 4QBJA 4ZY0A 5TRDA 1VLYA 3W6SA 1OGIA 4YEJA 1K8AD 1XF8A 3PB8X 1YVOA 4M6IA 4UEZA 3IC1A 4IUSA 5A89A 2Q51A 5J8FA 1E79A 2C5BA 2PJ6A 2BGIA 2JJ1A 2X85A 1YJ9B 2R9VA 1VQ4B 3T9YA 1V0FA 2WZPP 4PSWA 3TT2A 2F1MA 2ZL6A 4Z4UA 1CP7A 1N06A 3ZJ0A 4OOSA 4CGNA 4XLHA 1XFOA 2YNCA 4RUHA 2PVWA 2Z0ZA 4G1VA 4XLEA 3NA6A 3A8KA 2WJYA 2V77A 2ZW7A 5KW9A 4ONWA 4P10A 3OWCA 1UMKA 4IAVA 3CXQA 2CBXA 2OZUA 2CNDA 2FXFA 3OZVA 3SJZA 1IOFA 4OC2A 1TKJA 3ZZTA 5F4OA 2B5GA 2B7CA 3QE2A 3IO1A 1EWYA 1MABA 1N05A 4A95A 3J81k 2Z3LA 2QVPA 8CPAA 4NEXA 3TOAA 7CPAA 3U2QA 2DPSA 4YXWA 4P4EA 4TN1A 5IV0A 2V4DA 4MBUA 2P3MA 1KMHA 2X53S 3P26A 1IJFA 5LYFA 2NSMA 1IB0A 4R71A 1ZG9A 3AVYA 1KUVA 4H9GA 1MRZA 1DTDA 1EXMA 2PVVA 2P6FA 2Q6KA 4NF1A 3B3WA 5AG7A 3PA2A 3QFRA 4KOTA 4XLCA 4PAAA 2FT0A 2ZTNA 4XOPA 1YJNB 2V7UA 3R6KA 1WTHD 5D8NA 2Q04A 2YWHA 2ZW4A 4MFPA 4OC1A 3CC4B 4ZCLA 2GE3A 1Z8LA 4NGSA 5J3OA 3R96A 1E3ZA 1F20A 4XORA 2PCUA 5H86A 1FNCA 4F7DA 3S9LA 2BO9A 4X06A 2ZITA 2WSSA 4XMYA 1XIXA 2PJ8A 4DUKA 1WOPA 4R57A 1Q81D 5EMNA 4YAFA 2D74A 1T5EA 4XKWA 2GFQA 3B78A 1YQEA 4DQKA 2XEIA 2Z6BD 2OOTA 3IWEA 2DYIA 4UWJA 1Z4EA 3MRUA 4WWVA 4CGMA 2X8KA 5DWNA 2F4NA 4MFJA 2YWGA 4F0YA 4F9UA 2JEVA 4OAEA 3SJEA 4AG7A 4AC9A 2FE7A 4Q36A 2JEWA 2PSWA 4B6ZA 5B6IA 3JUWA 3PVDA 3OAAA 1OB2A 2BL1A 3F0AA 3QFSA 3A9LA 3G4SB 3Q3AA 3VMFA 2HLDA 4B11A 5BSYA 2VBUA 3JVNA 4B48A 1XMBA 4P6YA 4R7MA 5GV7A 1P4MA 4YAWA 4UAJA 1H8LA 4RLZA 3V8IA 2ZENA 4FD4A 1Q2YA 4NSQA 1IICA 4Z65A 3W2HA 4RPBA 4C7HA 2VZYA 3R9GA 2HDNB 4RCYA 4CQJA 4JD6A 3OFNA 4UZFA 4ZV4A 1K9MD 1QFJA 4M6HA 5L46A 1QMUA 2B3VA 1XQBA 4LUAA 2HMAA 3D7DA 5CNPA 1GAWA 1KQSB 5CPAA 2W6JA 3DDYA 4ZYQA 2W6IA 3BCDA 3Q6QA 4OP7A 1DE4C 2ZXVA 3SI2A 3IFEA 2OR4A 1FX0A 1FRNA 1BLLE 2X7BA 3GB0A 2BN4A 3U6KA 2X6WA 3EO4A 3SLDA 4DYOA 1UD4A 2CNMA 4KSFA 3W2FA 5G1ZA 3LODA 2RC6A 2J8RA 4OIWA 4G5GA 2M5SA 3PB6X 3QB8A 1KK1A 4NNJA 2ZXHA 4K1XA 3PB4X 1BX0A 3FF3A 2I3CA 3B3CA 1WP6A 2Z3MA 4OOVA 3A8IA 4XPDC 4TT3A 1AUGA 5LRKA 4DQLA 3UY5A 1WOSA 3WC5A 3EY5A 2WSAA 1ZM9A 3GLJA 1RQRA 3ASTA 5IYRA 5GCNA 4NGMA 2VNKA 3FB3A 4CAFA 2CF4A 4I49A 1FY7A 3MN8A 3B3TA 2C4TA 2FIWA 3FJOA 4JZ0A 3B2YA 1H8HA 3CCMB 1E64A 1M4LA 1J9ZA 2C27A 4KOVA 3WT4A 2YWFA 4ZGQB 3AVVA 3CCQB 1NSAA 2DEAA 1W9XA 5IK2A 4KOYA 2YNCC 2D3NA 3E0KA 1S4MA 2PJ3A 3CW2A 4Y9RA 4P9SA 5HVHA 4MYUA 5KTDA 3W5HA 2HV2A 2JBKA 3ZIAA 4Y49C 3VR6A 3FEEA 2BPOA 2PJ1A 5A28A 2V7XA 3ZBUA 1EE3P 4PC1A 1IYKA 1M1KD 3WY9A 4OMEA 4OKOA 2IL4A 1LFWA 3BCFA 2PJ2A 4B5PB 2YGWA 2ARHA 3BLNA 2XNDA 3WR7A 1KUYA 2HC9A 4YAOA 1WSVA 2QTLA 3PFEA 2WPXA 3WABA 3SXOA 3BNWA 2C5HA 3HUVA 2VYQA 4QUZA 3DR8A 4A94A 5HZBA 2OBSA 3ISZA 1GVHA 3IJ3A 3MCAA 1QGZA 1UD2A 4B44A 2ZW6A 3OOCA 4BMHA 5AG5A 4CS0B 4HNYB 3WBJA 1XRYA 2Q6OA 4GQNA 4G7WA 1VHEA 3KR4A 4C0SA 1MJBA 3FRMA 4TSFA 4X8IA 2OZHA 1ARLA 5KNLA 4A37A 4X0CA 2E1RA 3FJUA 2QA4B 4FBEA 5J35A 3W91A 4Z4YA 1E63A 5EMIA 3CC7B 2HCJB 1N08A 4II3A 4RDLA 4B3XA 4R9MA 1TTTA 1HA3A 2BEIA 4DNCA 3IU2A 1GJRA 4KVXA 2ZXIA 1VQNB 3W2GA 4H6ZA 4U9UA 2QGGA 2ZELA 2LZJA 1QX4A 2ZEFA 2OTLB 1F60A 3CMMA 4P4JA 3G05A 2P6GA 4L8JA 4MFQA 4C2YA 3RAMA 4Z4WA 4P26A 1V0CA 3DNSA 2Z3NA 2R1IA 2GJKA 1CM0A 2CC2A 2PRBA 4P2NA 3LD2A 5IB0A 1AMPA 1IU8A 3P2FA 3VWEA 1KZFA 4RDKA 3B3SA 2O53A 5HVGA 5F49A 3SKBA 1N0VC 4KORA 2V31A 2ZZGA 2BSWA 3CZXA 3EC4A 1K4JA 4ROXA 4P3YA 3S6KA 4XD7A 5BWAB 1XE4A 4KOWA 2FVGA 1XBUA 2X6XA 4PPZA 2ZW5A 5TV2A 1TF8A 2IMOA 1RO5A 1W0KA 1QSRA 4RDJA 1BX1A 3BXMA 3OJXA 4CGOA 5F47A 4ZBGA 4K30A 4NJRA 1BAVA 4P44A 2EBJA 3VARA 3G6EB 4F8ZA 2V7VA 1YMEA 1Y0YA 4BINA 1T6XA 1VQ7B 1LOKA 3KEWA 1QFYA 3C26A 4P4IA 2DIEA 2ZZFA 2DPTA 2Q6IA 2B4DB 2VI7A 4A32A 2WUUA 5K8OA 2ABZA 2ZBVA 3PGPA 3PB7X 1QSNA 3G8WA 2QE7A 2ZL5A 3WQZA 3KHZA 4AB7A 2PC1A 2VBVA 1QG0A 2XZPA 2AFUA 2Q43A 4MY3A 2NV4A 2QYVA 4X2TA 1CBXA 4FD6A 1F57A 1ZLHA 1S7NA 4P25A 2CTBA 3LO8A 3ASSA 4LBWA 1BOBA 1XB2A 3SJFA 2GK7A 3P27A 3FX6A 4X5KA 4RD6A 1R3NA 2Z3OA 4CAEA 4F0XA 4RN7A 4LBYA 2P0WA 2GLFA 1CQXA 3AGPA 4MCSA 4XPDB 1UWYA 3OZUA 1IY7A 4X7DA 3RZAA 3H4QA 1P0HA 2A4NA 1T6YA 2EK9A 3R95A 2J8NA 3FPPA 4MRIA 3BJ7A 1EFCA 1Y9WA 2O28A 2PJ5A 3K9UA 1YW4A 5F09A 5ISVA 3FECA 4U5YA 4R76A 4XLFA 4PXDA 5ELYA 4R6TA 2REEA 1QGYA 3OZWA 4FXUA 3NH4A 3VATA 1ZM3A 2POKA 3PRTA 4TMVA 3S6GA 1YJWB 2ZEHA 4HIZA 4G1BA 1QSMA 4EMEA 2OB0A 4ORFA 3A1PA 4RM0A 3CMAB 1DDGA 5E96A 3ISXA 1WDTA 3AVWA 1M4IA 1HEEA 4XN3A 1IGBA 4QHYA 5AGEA 2C4UA 5LRJA 4X07A 4UZUA 1RQPA 2DETA 4OC4A 4KSIA 1ZM2A 4NFRA 3Q6RA 1JA0A 4AG9A 3L2NA 2B7BA 3NFZA 4H2KA 3BQJA 2XNCA 1EP3B 4AVAA 4YHBA 3ZUGA 1M4GA 2AFSA 4G1PA 1FNMA 2DEUA 4FN5A 1KK0A 2GIVA 2QEXB 3CRZA 4TNUA 2Y0MA 3CCLB 3PUNA 3JU4A 3LACA 1YGHA 1KK3A 1IYLA 1JQGA 2XEFA 2QTZA 3SEJA 3IEHA 2CY2A 2VL1A 3PP9A 3RO0A 2CTCA 3GVLA 2JLMA 2DOGA 4QB9A 4ACAA 3WYAA 3ZBTA 1H85A 1OGJA 2PJ4A 4IK2A 4Z1MA 4OIDA 2AJ6A 2OH1A 4EVYA 1N8RD 4Y9UA 3Q39A 1S72B 4XR6A 3GUXA 5G21A 4WQMA 4IW3B 1VKCA 2KCWA 4MJ8A 4R8FA 1VJSA 2RB7A 2ODFA 1B6BA 5KSWB 4AVBA 3PBBA 3LVBA 1Y7RA 3I3GA 3TTHA 5GV8A 1HVXA 1A2ZA 4ZCIA 1Z8TA 2REFA 1MK4A 3A35A 5FVJA 2CRVA 1QUFA 4CYOA 3CB4A 4HE6A 3H9NA 2XGJA 2G0BA 4KUBA 3TO9A 3ONYA 1YR0A 2AFZA 3N5FA 3FMCA 1Y0RA 2DF5A 1UD8A 2Q4YA 2GPJA 4HKFA 4DNTB 3T90A 1COWA 2RC5A 2PR8A 2EVNA 2V8HA 2QECA 4B5OA 4OLLA 4KOSA 1T6ZA 1PJ7A 1FT7A 3JQPA 2H5MA 1S3ZA 1Q9SA 4KKTA 3DSBA 1N0UA 3KGQA 4QC6A 2PJCA 2GK6A 2DCUA 2GANA 3VH9A 2D3LA 2X6YA 1Y9KA 1Z4RA 1SKQA 1YITB 3QFCA 2YNDA 4PC2A 4AVCA 2XZOA 3B8GA 1M44A 4YELA 2OBRA 4Y49B 2V7WA 4WZLA 3BI1A 3JRUA 5JQ4A 2NYQA 4U9YA 2XEGA 1NMTA 2Z3KA 1BPNA 3W5UA 4MMOA 2J7KA 4L89A 3CCUB 1IOIA 1Q7YD 4J0QA 5H84A 1X10A 4A39A 4XL9A 4PXBA 2CW5A 4XN0A 3TX8A 1FRQA 1W35A 5BSXA 2JDCA 1TUIA 3RNZA 2K5TA 1ON0A 4UA3A 1Z8XA 3EXNA 1U6MA 5JGFA 2OZGA 2AFOA 1VHOA 3RBUA 2ANPA 3MGDA 1H42A 3BY2A 3VNUA 1I21A 2GU2A 4PXEA 3SXNA 1BPMA 2FS5A 2HB6A 1JB9A 1PUAA 3IWGA 4EH1A 3DDDA 4M3SA 2FL4A 4WJBA 4XM3A 4X7EA 1AMOA 2PMDA 2OYNA 2CNSA 4P6VF 5FIUA 4BPRA 3R1KA 4NJQA 2ZEGA 1UFHA 5FO1A 4EWTA 4HPSA 4CYNA 2VNJA 1QGAA 3KZWA 3CCVB 2D4OA 1CJWA 4MCQA 2V7QA 3AVUA 1R57A 3ZZ0A 4IHMA 2F43A 4R87A 3IIBA 1LAPA 5H5JA 4PK3A 4FUUA 1GR1A 2VJJA 2Q7BA 2WPWA 4JLYA 5LYLA 3D26A 2DERA 1VQ8B 4Z4VA 4FWTA 4M6GA 2PQ8A 2O4HA 4UZEA 2X3UA 4GS4A 3KKWA 4X3RA 4KZTA 3PENA 2AHOA 2QMLA 2X0KA 1OHHA 3R9FA 3D7FA 3FEDA 1PCAA 2R7HA 1Q2DA 3A8JA 4LX9A 1KK2A 3GQBA 1PU9A 3R9EA 2ZTGA 1J4JA 4PK2A 1CNEA 1YIJB 1HDUA 2P6EA 4PXCA 3LNNA 4NGQA 4L8AA 3AGQA 5DS0A 4XNHB 3B8HA 1UD6A 3U6BA 3OJWA 3F5BA 1W87A 2ZZEA 1QFZA 3H8EA 2BCOA 5EBVA 3CP2A 1TLLA 1ELMP 1I12A 2D4PA 3JTKA 4E8OA 4Q38A 2VJIA 1I1DA 3SLNA 2AFXA 2V8GA 4PSXA 4R3LA 1QSTA 3CP8A 1IHMA 1H8EA 5DSZA 1KZLA 5DWMA 4Y7CA 1M1DA 3GVJA 3K9TA 5G20A 1NE9A 3G71B 4GXHA 4KSAA 4YU9A 3CDXA 2ZPAA 2FSRA 2BMWA 2GJPA 2AE6A 4QV2A 3CCSB 5IX3A 3CESA 4TWEA 3SJPA 4JWPA 3I1UA 3JQRA 4MXUA 1BJKA 5TR9A 1YK3A 3LWUA 1CNFA 4KLWA 4WZTA 3IGRA 4DK1A 4YWYA 3H8FA 1LRZA 4PABA 3QSYA 1VIXA 4MI4A 1TXRA 5K8PA 1IB1E 1EFUA 2RFHA 5A27A 3BY1A 4UWIA 2R6HA 4M2LA 2WPDA 3ASQA 4II9A 1ZUNB 4CGLA 4PC3A 1GHEA 4RI1A 2XOKA 1YW6A 4RS2A 2V8VA 4C2ZA 4J3GA 1FNBA 4AF6A 5F46A 1PJ5A 1BQEA 2V7TA 1B87A 1Q7LA 2ZL7A 4XNFA 4YAUA 5H59A 1EP1B 4ACBA 3OP1A 1KWMA 3S6HA 1QSOA 2ZEDA 2CIJA 2F7VA 2VBQA 3KR5A 5F48A 1YHQB 4W9YA 4NCZA 2OK7A 2B3UA 4XQFA 2Q7SA 4RPDA 3OW7A 4N3NA 3WXMA 3GIRA 3WNCA 4P4DA 1YX0A 1S0UA 1ZM4A 3T53B 1E43A 3IWWA 1LCPA 1RTQA 3DGVA 2HUZA 5JM6A 3EFAA 1KJZA 4UEFA 1JA1A 3G3SA 1KC8D 2JN9A 4E0FA 4MY0A 1Z9UA 2FIAA 5AG6A 4M53A 3CXPA 4CYQA 2JIZA 3ASRA 4NBSA 4II2A 1TKFA 1P4NA 3NE7A 1VQ9B 3B3VA 1WORA 4P22A 4TMTA 1KTVA 3FPKA 1JWQA 3PFOA 3BI0A 3T8WA 2C6GA 2F8HA 4LBZA 3SI1A 3FNCA 1S7FA 3V38A 4MHZA 2XEJA 1S7KA 5IYNA 3CPXA 2WYRA 3VWDA 4P12A 3CPWB 4NGNA 5LYIA 4TKOB 4CPAA 3ZZIA 4MHYA 2XNJA 1N07A 2QN6A 4UCPA 3FBUA 4HE5A 3DLJA 1VQ5B 2GREA 3KASA 3N7ZA 3B7IA 4LQGA 1NB9A
chains in the Genus database with same CATH topology
3GUXA 3B3CA 1GYTA 4R8FA 4BD9A 4P4BA 5K8NA 2RB7A 1F2PA 1LAMA 5LRKA 1TF9A 3D7GA 4K3NA 3PBBA 3WC5A 4ZI6A 3GLJA 4OC0A 4NGMA 2CF4A 3K2KA 3D68A 4OC3A 3MN8A 3B3TA 2ZEMA 5JH9A 4JZ0A 3B2YA 2AFZA 3N5FA 1M4LA 1Y0RA 3FMCA 5LRGA 3WT4A 1NSAA 2DEAA 1CP6A 2V8HA 2PJ3A 2C6CA 3WC7A 2PJAA 1FT7A 5HVHA 2JBKA 4NGPA 3FEEA 3HLPA 3NH8A 2PJ1A 3SI0A 5IB9A 2ZEOA 4NGTA 1EE3P 3KGQA 2PJCA 4OMEA 4OKOA 3WC6A 1LFWA 3VH9A 2PJ2A 1ARMA 1AYEA 2PRQA 2HC9A 5D29A 2PJ0A 3PEIA 5I4MA 2ZEEA 3PFEA 4JYWA 4NGRA 3BI1A 3JRUA 3WABA 2NYQA 2XEGA 3CPAA 3HUVA 3KQZA 4MCPA 5HXDA 1BPNA 4MMOA 5THWA 4A94A 3ISZA 3IJ3A 4A39A 4PXBA 1R43A 1CG2A 2G9DA 3TX8A 1FNOA 1XRYA 3KI9A 5JGFA 1ELLP 1VHEA 3PB9X 2AFOA 3KR4A 3LMSA 1VHOA 5LYDA 4X8IA 1ZG8A 3KQXA 3RBUA 2ANPA 1ZG7A 1ARLA 1VGYA 4A37A 3FVLA 3FJUA 4PXEA 2GU2A 4OP4A 1CX8A 1LANA 2C1CA 1BPMA 2HB6A 3SJGA 4FBEA 4WJBA 4P45A 2QJ8A 4A38A 1OBRA 2PIYA 4NJQA 2ZEGA 2AFMA 5HVFA 1TKHA 4EWTA 2ZELA 2ZEFA 2PJBA 3KZWA 4P4JA 4ZY0A 4MCQA 3RAMA 4IHMA 1F2OA 3PB8X 3IIBA 1LAPA 4UEZA 4FUUA 3IC1A 3KHXA 2Q51A 1AMPA 5LYLA 2PJ6A 2V8DA 4AXVA 4F9VA 2IQ6A 3B3SA 2O53A 4PQAA 2O4HA 5HVGA 4X3RA 1CP7A 2C6PA 3S9MA 2BOAA 1XFOA 4RUHA 2PVWA 2ZEPA 3D7FA 3FEDA 4UIAA 3NA6A 2FVGA 1XBUA 2V77A 1PCAA 4P10A 4ONWA 3CT9A 4PPZA 5K8MA 4IAVA 1TF8A 4PXCA 1HDUA 2EWBA 2IMOA 6CPAA 1Z2LA 2GLJA 4NGQA 3BXMA 4OC2A 5DS0A 1Y7EA 1TKJA 1YSJA 3H8EA 2BCOA 3IO1A 4NJRA 1BAVA 4P44A 3VARA 2QVPA 1ELMP 4F8ZA 8CPAA 1YMEA 7CPAA 1Y0YA 4MCRA 2AFXA 2V8GA 4O23A 4P4EA 1LOKA 2I3CA 4EFDA 4P4IA 2EK8A 1CPSA 3NH5A 4ZY2A 3FH4A 1YLOA 5LYFA 2NSMA 1ZG9A 3K9TA 4UF4A 4YU9A 1DTDA 3CDXA 5K8OA 2ABZA 2PVVA 4TWEA 3B3WA 3PB7X 3I1UA 3KHZA 4MXUA 3QNVA 2AFUA 2Q43A 1Z5RA 3LWUA 2QYVA 4X2TA 1CBXA 5D8NA 4YWYA 3H8FA 1F57A 1ZLHA 4OC1A 2CTBA 1Z8LA 4NGSA 1VIXA 3SJFA 2PCUA 1TXRA 5K8PA 4ZX9A 3FX6A 2RFHA 1R3NA 3S9LA 4FAIA 2BO9A 5CBMA 2GLFA 3S9NA 4MCSA 2PJ8A 4DUKA 1UWYA 1IY7A 4OC5A 3RZAA 2ZOGA 2EK9A 4MRIA 1YW6A 2PJ7A 2XEIA 4GM5A 4MHNA 2PJ5A 2OOTA 1YW4A 2V8VA 3TC8A 5F09A 3FECA 4R76A 4PXDA 5ELYA 4ZY1A 4R6TA 4Q7AA 3MRUA 4WWVA 3NH4A 4UIBA 3VATA 1PYTB 4F9UA 2POKA 4P4FA 3SJEA 1Q7LA 3PRTA 2JEWA 4B6ZA 2PE3A 2ZEHA 1XJOA 1KWMA 2AFWA 2ZEDA 4EMEA 2CIJA 2F7VA 3BHXA 3KR5A 3ISXA 4W9YA 1XMBA 1QQ9A 4P6YA 4R7MA 2IJZA 1ZLIA 1H8LA 4DJLA 1HEEA 2J9AA 1IGBA 2ZENA 3V7ZA 3KL9A 4P4DA 5LRJA 3IWWA 1LCPA 1RTQA 3DGVA 4Z65A 5JM6A 4OC4A 4KSIA 4UEFA 3D66A 4NFRA 3L2NA 3NFZA 4H2KA 2WZNA 1QMUA 2Q4ZA 2AFSA 4G1PA 3H8GA 1TKFA 3D7DA 4UEEA 5CPAA 3B3VA 4TNUA 4ZYQA 3PFOA 3B35A 3BI0A 3T8WA 2C6GA 2F8HA 1DE4C 3SI2A 4FWUA 2JBJA 3IFEA 3D7HA 3SJXA 2OR4A 3SI1A 4ZX8A 1BLLE 3V38A 1JQGA 4MHZA 2XEJA 3GB0A 2XEFA 3CPXA 2WYRA 3IEHA 4NGNA 5LYIA 2VL1A 1HDQA 2CTCA 4DYOA 4CPAA 4MHYA 2PJ9A 3DLJA 5J1QA 2PIZA 4OIWA 2PJ4A 2GREA 3KASA 4IK2A 3B7IA 3D4UA 4OIDA 3D67A 3PB6X 3PBEA 4LQGA 1CPXA 4MHPA 2ZOFA 3PB4X 3FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUX A;  3B3C A;  1GYT A;  4R8F A;  4BD9 A;  4P4B A;  5K8N A;  2RB7 A;  1F2P A;  1LAM A;  5LRK A;  1TF9 A;  3D7G A;  4K3N A;  3PBB A;  3WC5 A;  4ZI6 A;  3GLJ A;  4OC0 A;  4NGM A;  2CF4 A;  3K2K A;  3D68 A;  4OC3 A;  3MN8 A;  3B3T A;  2ZEM A;  5JH9 A;  4JZ0 A;  3B2Y A;  2AFZ A;  3N5F A;  1M4L A;  1Y0R A;  3FMC A;  5LRG A;  3WT4 A;  1NSA A;  2DEA A;  1CP6 A;  2V8H A;  2PJ3 A;  2C6C A;  3WC7 A;  2PJA A;  1FT7 A;  5HVH A;  2JBK A;  4NGP A;  3FEE A;  3HLP A;  3NH8 A;  2PJ1 A;  3SI0 A;  5IB9 A;  2ZEO A;  4NGT A;  1EE3 P;  3KGQ A;  2PJC A;  4OME A;  4OKO A;  3WC6 A;  1LFW A;  3VH9 A;  2PJ2 A;  1ARM A;  1AYE A;  2PRQ A;  2HC9 A;  5D29 A;  2PJ0 A;  3PEI A;  5I4M A;  2ZEE A;  3PFE A;  4JYW A;  4NGR A;  3BI1 A;  3JRU A;  3WAB A;  2NYQ A;  2XEG A;  3CPA A;  3HUV A;  3KQZ A;  4MCP A;  5HXD A;  1BPN A;  4MMO A;  5THW A;  4A94 A;  3ISZ A;  3IJ3 A;  4A39 A;  4PXB A;  1R43 A;  1CG2 A;  2G9D A;  3TX8 A;  1FNO A;  1XRY A;  3KI9 A;  5JGF A;  1ELL P;  1VHE A;  3PB9 X;  2AFO A;  3KR4 A;  3LMS A;  1VHO A;  5LYD A;  4X8I A;  1ZG8 A;  3KQX A;  3RBU A;  2ANP A;  1ZG7 A;  1ARL A;  1VGY A;  4A37 A;  3FVL A;  3FJU A;  4PXE A;  2GU2 A;  4OP4 A;  1CX8 A;  1LAN A;  2C1C A;  1BPM A;  2HB6 A;  3SJG A;  4FBE A;  4WJB A;  4P45 A;  2QJ8 A;  4A38 A;  1OBR A;  2PIY A;  4NJQ A;  2ZEG A;  2AFM A;  5HVF A;  1TKH A;  4EWT A;  2ZEL A;  2ZEF A;  2PJB A;  3KZW A;  4P4J A;  4ZY0 A;  4MCQ A;  3RAM A;  4IHM A;  1F2O A;  3PB8 X;  3IIB A;  1LAP A;  4UEZ A;  4FUU A;  3IC1 A;  3KHX A;  2Q51 A;  1AMP A;  5LYL A;  2PJ6 A;  2V8D A;  4AXV A;  4F9V A;  2IQ6 A;  3B3S A;  2O53 A;  4PQA A;  2O4H A;  5HVG A;  4X3R A;  1CP7 A;  2C6P A;  3S9M A;  2BOA A;  1XFO A;  4RUH A;  2PVW A;  2ZEP A;  3D7F A;  3FED A;  4UIA A;  3NA6 A;  2FVG A;  1XBU A;  2V77 A;  1PCA A;  4P10 A;  4ONW A;  3CT9 A;  4PPZ A;  5K8M A;  4IAV A;  1TF8 A;  4PXC A;  1HDU A;  2EWB A;  2IMO A;  6CPA A;  1Z2L A;  2GLJ A;  4NGQ A;  3BXM A;  4OC2 A;  5DS0 A;  1Y7E A;  1TKJ A;  1YSJ A;  3H8E A;  2BCO A;  3IO1 A;  4NJR A;  1BAV A;  4P44 A;  3VAR A;  2QVP A;  1ELM P;  4F8Z A;  8CPA A;  1YME A;  7CPA A;  1Y0Y A;  4MCR A;  2AFX A;  2V8G A;  4O23 A;  4P4E A;  1LOK A;  2I3C A;  4EFD A;  4P4I A;  2EK8 A;  1CPS A;  3NH5 A;  4ZY2 A;  3FH4 A;  1YLO A;  5LYF A;  2NSM A;  1ZG9 A;  3K9T A;  4UF4 A;  4YU9 A;  1DTD A;  3CDX A;  5K8O A;  2ABZ A;  2PVV A;  4TWE A;  3B3W A;  3PB7 X;  3I1U A;  3KHZ A;  4MXU A;  3QNV A;  2AFU A;  2Q43 A;  1Z5R A;  3LWU A;  2QYV A;  4X2T A;  1CBX A;  5D8N A;  4YWY A;  3H8F A;  1F57 A;  1ZLH A;  4OC1 A;  2CTB A;  1Z8L A;  4NGS A;  1VIX A;  3SJF A;  2PCU A;  1TXR A;  5K8P A;  4ZX9 A;  3FX6 A;  2RFH A;  1R3N A;  3S9L A;  4FAI A;  2BO9 A;  5CBM A;  2GLF A;  3S9N A;  4MCS A;  2PJ8 A;  4DUK A;  1UWY A;  1IY7 A;  4OC5 A;  3RZA A;  2ZOG A;  2EK9 A;  4MRI A;  1YW6 A;  2PJ7 A;  2XEI A;  4GM5 A;  4MHN A;  2PJ5 A;  2OOT A;  1YW4 A;  2V8V A;  3TC8 A;  5F09 A;  3FEC A;  4R76 A;  4PXD A;  5ELY A;  4ZY1 A;  4R6T A;  4Q7A A;  3MRU A;  4WWV A;  3NH4 A;  4UIB A;  3VAT A;  1PYT B;  4F9U A;  2POK A;  4P4F A;  3SJE A;  1Q7L A;  3PRT A;  2JEW A;  4B6Z A;  2PE3 A;  2ZEH A;  1XJO A;  1KWM A;  2AFW A;  2ZED A;  4EME A;  2CIJ A;  2F7V A;  3BHX A;  3KR5 A;  3ISX A;  4W9Y A;  1XMB A;  1QQ9 A;  4P6Y A;  4R7M A;  2IJZ A;  1ZLI A;  1H8L A;  4DJL A;  1HEE A;  2J9A A;  1IGB A;  2ZEN A;  3V7Z A;  3KL9 A;  4P4D A;  5LRJ A;  3IWW A;  1LCP A;  1RTQ A;  3DGV A;  4Z65 A;  5JM6 A;  4OC4 A;  4KSI A;  4UEF A;  3D66 A;  4NFR A;  3L2N A;  3NFZ A;  4H2K A;  2WZN A;  1QMU A;  2Q4Z A;  2AFS A;  4G1P A;  3H8G A;  1TKF A;  3D7D A;  4UEE A;  5CPA A;  3B3V A;  4TNU A;  4ZYQ A;  3PFO A;  3B35 A;  3BI0 A;  3T8W A;  2C6G A;  2F8H A;  1DE4 C;  3SI2 A;  4FWU A;  2JBJ A;  3IFE A;  3D7H A;  3SJX A;  2OR4 A;  3SI1 A;  4ZX8 A;  1BLL E;  3V38 A;  1JQG A;  4MHZ A;  2XEJ A;  3GB0 A;  2XEF A;  3CPX A;  2WYR A;  3IEH A;  4NGN A;  5LYI A;  2VL1 A;  1HDQ A;  2CTC A;  4DYO A;  4CPA A;  4MHY A;  2PJ9 A;  3DLJ A;  5J1Q A;  2PIZ A;  4OIW A;  2PJ4 A;  2GRE A;  3KAS A;  4IK2 A;  3B7I A;  3D4U A;  4OID A;  3D67 A;  3PB6 X;  3PBE A;  4LQG A;  1CPX A;  4MHP A;  2ZOF A;  3PB4 X;  3FF3 A; 
#chains in the Genus database with same CATH topology
 1EP2 B;  1GYT A;  4BD9 A;  4P4B A;  2VNI A;  1F2P A;  1TF9 A;  4K3N A;  1R5B A;  4ZI6 A;  4OPO A;  4B14 A;  4AVZ A;  1WU8 A;  2Z11 A;  1I8D A;  3D68 A;  2G3A A;  4OC3 A;  3HAG A;  1S5K A;  4MFK A;  4OPS A;  5JH9 A;  5FNZ A;  3QFT A;  3ONU A;  1YVK A;  1D1N A;  4WZK A;  5I0C A;  5LRG A;  5HXB A;  4UFW A;  2Z10 A;  2D9R A;  2C77 A;  1CP6 A;  4RD2 A;  3GKR A;  1GAQ A;  2C6C A;  1YI2 B;  2EIX A;  3WC7 A;  1DG1 G;  4A2Z A;  4RJL A;  4CRY B;  3VO1 A;  2Q44 A;  4NGP A;  3NH8 A;  3PZJ A;  3SI0 A;  1L0C A;  4YRH A;  3P2H A;  5IB9 A;  3WNB A;  4MFZ A;  2BM1 A;  5G22 A;  2WJV A;  2F5I A;  4TMW A;  4OPV A;  4LC0 A;  2OBT A;  2R98 A;  1R5N A;  5THX A;  4JXR A;  4B3F X;  2PRQ A;  4BBH A;  4U9Z A;  1VQK B;  3KQZ A;  4MCP A;  2OK8 A;  4CAX A;  1W0J A;  4WZE A;  3A3B A;  1W34 A;  1WK4 A;  2XZL A;  2CXA A;  3E1Y E;  3W2I A;  5F4J A;  3CCR B;  1QVG B;  1AIP A;  1JNY A;  1XE1 A;  1VQM B;  2VEZ A;  3LMS A;  3R6J A;  3ZC3 A;  1U2R A;  1JJ2 B;  1ZG8 A;  1EFT A;  4G7X A;  2VBS A;  1VGY A;  4Z4R A;  1CX8 A;  1LAN A;  3OEH A;  4QVJ A;  4XPL A;  3SJG A;  4X7F A;  3ZZU A;  4JXQ A;  1WOO A;  2HQY A;  4P45 A;  4UFX A;  2QJ8 A;  1UD3 A;  4A38 A;  1OBR A;  2PIY A;  4DNR B;  5KTA A;  1SQH A;  4HNW B;  1UD5 A;  4MFL A;  5HVF A;  2C78 A;  2PIA A;  4E2A A;  3GYA A;  1V5V A;  2PJB A;  1NDH A;  5HMN A;  1E3X A;  2VZZ A;  1K28 D;  2EO8 A;  2CK3 A;  3FXT A;  4TMX A;  4B4D A;  3ES9 A;  3LQ6 A;  1QUE A;  4A30 A;  4C2X A;  2BUE A;  4M4S A;  4RD1 A;  5LMZ A;  1F2O A;  1G7R A;  3KHX A;  3RY8 A;  4UCM A;  3SHP A;  1R5O A;  4PC6 A;  2G3T A;  1OB0 A;  5FO0 A;  1QH0 A;  2V8D A;  4KVO E;  2VNH A;  5F4M A;  5FA6 A;  4AXV A;  4F9V A;  2IQ6 A;  4PQA A;  1BMF A;  5IYQ A;  3W2E A;  2YWE A;  2C6P A;  3S9M A;  2BOA A;  3TE4 A;  3QAH A;  4C68 A;  2ZEP A;  1BO4 A;  4UIA A;  2B5G B;  3CT9 A;  2YNE A;  4ASU A;  5K8M A;  4KVM E;  4Z4T A;  4P3I A;  3Q38 A;  2EWB A;  1QVF B;  4H6U A;  6CPA A;  1Z2L A;  1MJ9 A;  2GLJ A;  4R3K A;  4M0L A;  2CNT A;  1Y7E A;  4ZGY B;  2FX3 A;  1YSJ A;  3H94 A;  4A31 A;  2BF4 A;  1W2B B;  4UFV A;  3OKX A;  4PGO A;  4CYP A;  4MCR A;  1G7S A;  1X12 A;  4O23 A;  1S60 A;  4Q7J B;  4QFM A;  1XOV A;  4EFD A;  3CTA A;  3GY9 A;  4TMZ A;  2QDX A;  2EK8 A;  1CPS A;  3NH5 A;  4YGO A;  4MYT A;  4ZY2 A;  3FH4 A;  4XNH C;  1YLO A;  4B47 A;  4AF7 A;  2EFG A;  1E62 A;  3V76 A;  4UF4 A;  4M1K A;  1SKY B;  1A8P A;  4KS9 A;  3BJ8 A;  1D2E A;  1VQP B;  2Z3P A;  1YRE A;  4KOU A;  2WR8 A;  4P1V A;  4CAV A;  3E20 A;  1K73 D;  3QNV A;  4X7C A;  4JJX A;  2I1L A;  1Z5R A;  4PC7 A;  1EFR A;  3TOB A;  1FND A;  3I1F A;  3BC9 A;  4KOX A;  2GJR A;  3TCV A;  4KLV A;  3DR6 A;  1NSL A;  3OE7 A;  2VQY A;  3W6X A;  2NPF A;  1Q86 D;  3PUM A;  4ZX9 A;  2E1B A;  2PDO A;  4FAI A;  5CBM A;  4OOX A;  2B4B A;  3S9N A;  5C82 A;  5IYP A;  4OC5 A;  3NE8 A;  3NE5 B;  1N71 A;  5HZA A;  2ZOG A;  3B82 A;  1M4D A;  4C43 A;  4A33 A;  2PJ7 A;  1VQL B;  1GO2 A;  2BGJ A;  4GM5 A;  4MHN A;  3TC8 A;  2ATR A;  3AVX A;  1B23 P;  5A88 A;  4ZY1 A;  4LBV A;  4Q7A A;  4UIB A;  4JMQ A;  3FKS A;  4LQ6 A;  4FK8 A;  1PYT B;  4P4F A;  2RC4 A;  3CCJ B;  2PE3 A;  1YLE A;  1XJO A;  3PA1 A;  2I79 A;  2AFW A;  3BHX A;  4YFJ A;  3TO6 A;  4KKU A;  1OZP A;  1QQ9 A;  3F8K A;  2IJZ A;  1ZLI A;  4UCN A;  3H5Z A;  4DJL A;  4QUS A;  4F6A A;  2J9A A;  3V7Z A;  3KL9 A;  2NMT A;  1G7C A;  3CCE B;  4YAL A;  4FD7 A;  1VQO B;  3D2M A;  1I18 A;  2GQF A;  1WPC A;  3GIU A;  3D66 A;  3IU1 A;  1BLI A;  3FYN A;  5AG4 A;  4RD3 A;  2BSA A;  4ZGN B;  2WZN A;  5C88 A;  2Q4Z A;  3H8G A;  1XEB A;  4UEE A;  1VHS A;  1I7P A;  1KRH A;  3D2P A;  3B35 A;  2PR1 A;  2OTJ B;  3CXS A;  4FWU A;  2JBJ A;  5J8C A;  2PLF A;  1KUX A;  3D7H A;  3SJX A;  4E0A A;  2QIR A;  1TIQ A;  2FCK A;  4FD5 A;  4ONU A;  4ZX8 A;  2BV3 A;  3V7A A;  4XOT A;  2ZZQ A;  3TFY A;  4Z4S A;  4M85 A;  2DXQ A;  4KUA A;  1HDQ A;  2Q6L A;  5E6T A;  4XLA A;  3LQE A;  3D8P A;  3OPO A;  2PJ9 A;  4N3G A;  4B13 A;  5J1Q A;  2PIZ A;  3T51 B;  1MJA A;  3D4U A;  3D67 A;  3PBE A;  1CPX A;  2B58 A;  1E1Q A;  4MHP A;  2ZOF A;  4B10 A;  4QVT A;  3S6F A;  5KTC A;  3I56 B;  3I9S A;  3VO2 A;  3CC2 B;  1D8T A;  5K8N A;  1DAR A;  2C2W A;  1Z8W A;  5IYW A;  1LAM A;  2VBT A;  2ZBU A;  4KKS A;  2JJ2 A;  3D7G A;  3QAY A;  2J8M A;  2BVN A;  2QMU A;  1M90 D;  4OC0 A;  1ZO0 A;  3W5V A;  3D3S A;  3T56 B;  4B3G A;  1S7L A;  3K2K A;  1VLO A;  4DK0 A;  1IID A;  2JDI A;  2I00 A;  3CME B;  5EC4 A;  4X05 A;  3I55 B;  2ZEM A;  2KVO A;  4C7I A;  5CDF A;  2OU2 A;  2BM0 A;  5HKK A;  4ZCM A;  4RD0 A;  3BH4 A;  4NXY A;  5HH1 A;  1SM4 A;  2PJA A;  5JBQ A;  3MHP A;  4B5P A;  4QVA A;  3WND A;  1B2R A;  3HLP A;  4XON A;  2ZEO A;  4NGT A;  3TO7 A;  2VXK A;  1Q82 D;  4XPK A;  3ZPN A;  2F1L A;  5DN6 A;  4PV6 A;  3WC6 A;  1NJI D;  1IJE A;  1NB0 A;  5TY0 A;  5AN9 A;  1TVC A;  5FL7 A;  1ARM A;  1WWZ A;  1AYE A;  5D29 A;  2PJ0 A;  3PEI A;  1DDI A;  4Z4Z A;  5I4M A;  2ZEE A;  5JPH A;  1OB5 A;  4JYW A;  4NGR A;  2EUI A;  4HNX B;  1RXT A;  3CXC B;  1NRK A;  1VQ6 B;  3CPA A;  1V0E A;  3JQQ A;  2Q0Y A;  4CAW A;  5HXD A;  2VZL A;  5THW A;  3MMP A;  1E1R A;  4CRZ B;  3CD6 B;  3FIX A;  3WBK A;  2DY1 A;  1R43 A;  4NCN A;  1CG2 A;  2G9D A;  4UBR A;  2JDD A;  1FNO A;  4CGP A;  2B5O A;  1ELO A;  3KI9 A;  1ELL P;  3PB9 X;  5LYD A;  3KQX A;  1BPL A;  1FDR A;  4XKV A;  1ZG7 A;  4OAD A;  1WSR A;  1HZE A;  3FVL A;  4OP4 A;  4RD4 A;  2C1C A;  3RYO A;  1PJ6 A;  4RCZ A;  3VNV A;  2Q4V A;  1YX2 A;  5A8A A;  3AVT A;  1G7T A;  2B4D A;  4MHD A;  3GVK A;  3OEE A;  3A3G A;  4B12 A;  4H89 A;  4G6I A;  4IF5 A;  2AFM A;  1XMT A;  2XEX A;  3GSI A;  3OW2 B;  1TKH A;  1NBM A;  1PKV A;  4B43 A;  2R8V A;  1Q2C A;  1VF7 A;  3ASP A;  1KD1 D;  4QBJ A;  4ZY0 A;  5TRD A;  1VLY A;  3W6S A;  1OGI A;  4YEJ A;  1K8A D;  1XF8 A;  3PB8 X;  1YVO A;  4M6I A;  4UEZ A;  3IC1 A;  4IUS A;  5A89 A;  2Q51 A;  5J8F A;  1E79 A;  2C5B A;  2PJ6 A;  2BGI A;  2JJ1 A;  2X85 A;  1YJ9 B;  2R9V A;  1VQ4 B;  3T9Y A;  1V0F A;  2WZP P;  4PSW A;  3TT2 A;  2F1M A;  2ZL6 A;  4Z4U A;  1CP7 A;  1N06 A;  3ZJ0 A;  4OOS A;  4CGN A;  4XLH A;  1XFO A;  2YNC A;  4RUH A;  2PVW A;  2Z0Z A;  4G1V A;  4XLE A;  3NA6 A;  3A8K A;  2WJY A;  2V77 A;  2ZW7 A;  5KW9 A;  4ONW A;  4P10 A;  3OWC A;  1UMK A;  4IAV A;  3CXQ A;  2CBX A;  2OZU A;  2CND A;  2FXF A;  3OZV A;  3SJZ A;  1IOF A;  4OC2 A;  1TKJ A;  3ZZT A;  5F4O A;  2B5G A;  2B7C A;  3QE2 A;  3IO1 A;  1EWY A;  1MAB A;  1N05 A;  4A95 A;  3J81 k;  2Z3L A;  2QVP A;  8CPA A;  4NEX A;  3TOA A;  7CPA A;  3U2Q A;  2DPS A;  4YXW A;  4P4E A;  4TN1 A;  5IV0 A;  2V4D A;  4MBU A;  2P3M A;  1KMH A;  2X53 S;  3P26 A;  1IJF A;  5LYF A;  2NSM A;  1IB0 A;  4R71 A;  1ZG9 A;  3AVY A;  1KUV A;  4H9G A;  1MRZ A;  1DTD A;  1EXM A;  2PVV A;  2P6F A;  2Q6K A;  4NF1 A;  3B3W A;  5AG7 A;  3PA2 A;  3QFR A;  4KOT A;  4XLC A;  4PAA A;  2FT0 A;  2ZTN A;  4XOP A;  1YJN B;  2V7U A;  3R6K A;  1WTH D;  5D8N A;  2Q04 A;  2YWH A;  2ZW4 A;  4MFP A;  4OC1 A;  3CC4 B;  4ZCL A;  2GE3 A;  1Z8L A;  4NGS A;  5J3O A;  3R96 A;  1E3Z A;  1F20 A;  4XOR A;  2PCU A;  5H86 A;  1FNC A;  4F7D A;  3S9L A;  2BO9 A;  4X06 A;  2ZIT A;  2WSS A;  4XMY A;  1XIX A;  2PJ8 A;  4DUK A;  1WOP A;  4R57 A;  1Q81 D;  5EMN A;  4YAF A;  2D74 A;  1T5E A;  4XKW A;  2GFQ A;  3B78 A;  1YQE A;  4DQK A;  2XEI A;  2Z6B D;  2OOT A;  3IWE A;  2DYI A;  4UWJ A;  1Z4E A;  3MRU A;  4WWV A;  4CGM A;  2X8K A;  5DWN A;  2F4N A;  4MFJ A;  2YWG A;  4F0Y A;  4F9U A;  2JEV A;  4OAE A;  3SJE A;  4AG7 A;  4AC9 A;  2FE7 A;  4Q36 A;  2JEW A;  2PSW A;  4B6Z A;  5B6I A;  3JUW A;  3PVD A;  3OAA A;  1OB2 A;  2BL1 A;  3F0A A;  3QFS A;  3A9L A;  3G4S B;  3Q3A A;  3VMF A;  2HLD A;  4B11 A;  5BSY A;  2VBU A;  3JVN A;  4B48 A;  1XMB A;  4P6Y A;  4R7M A;  5GV7 A;  1P4M A;  4YAW A;  4UAJ A;  1H8L A;  4RLZ A;  3V8I A;  2ZEN A;  4FD4 A;  1Q2Y A;  4NSQ A;  1IIC A;  4Z65 A;  3W2H A;  4RPB A;  4C7H A;  2VZY A;  3R9G A;  2HDN B;  4RCY A;  4CQJ A;  4JD6 A;  3OFN A;  4UZF A;  4ZV4 A;  1K9M D;  1QFJ A;  4M6H A;  5L46 A;  1QMU A;  2B3V A;  1XQB A;  4LUA A;  2HMA A;  3D7D A;  5CNP A;  1GAW A;  1KQS B;  5CPA A;  2W6J A;  3DDY A;  4ZYQ A;  2W6I A;  3BCD A;  3Q6Q A;  4OP7 A;  1DE4 C;  2ZXV A;  3SI2 A;  3IFE A;  2OR4 A;  1FX0 A;  1FRN A;  1BLL E;  2X7B A;  3GB0 A;  2BN4 A;  3U6K A;  2X6W A;  3EO4 A;  3SLD A;  4DYO A;  1UD4 A;  2CNM A;  4KSF A;  3W2F A;  5G1Z A;  3LOD A;  2RC6 A;  2J8R A;  4OIW A;  4G5G A;  2M5S A;  3PB6 X;  3QB8 A;  1KK1 A;  4NNJ A;  2ZXH A;  4K1X A;  3PB4 X;  1BX0 A;  3FF3 A;  2I3C A;  3B3C A;  1WP6 A;  2Z3M A;  4OOV A;  3A8I A;  4XPD C;  4TT3 A;  1AUG A;  5LRK A;  4DQL A;  3UY5 A;  1WOS A;  3WC5 A;  3EY5 A;  2WSA A;  1ZM9 A;  3GLJ A;  1RQR A;  3AST A;  5IYR A;  5GCN A;  4NGM A;  2VNK A;  3FB3 A;  4CAF A;  2CF4 A;  4I49 A;  1FY7 A;  3MN8 A;  3B3T A;  2C4T A;  2FIW A;  3FJO A;  4JZ0 A;  3B2Y A;  1H8H A;  3CCM B;  1E64 A;  1M4L A;  1J9Z A;  2C27 A;  4KOV A;  3WT4 A;  2YWF A;  4ZGQ B;  3AVV A;  3CCQ B;  1NSA A;  2DEA A;  1W9X A;  5IK2 A;  4KOY A;  2YNC C;  2D3N A;  3E0K A;  1S4M A;  2PJ3 A;  3CW2 A;  4Y9R A;  4P9S A;  5HVH A;  4MYU A;  5KTD A;  3W5H A;  2HV2 A;  2JBK A;  3ZIA A;  4Y49 C;  3VR6 A;  3FEE A;  2BPO A;  2PJ1 A;  5A28 A;  2V7X A;  3ZBU A;  1EE3 P;  4PC1 A;  1IYK A;  1M1K D;  3WY9 A;  4OME A;  4OKO A;  2IL4 A;  1LFW A;  3BCF A;  2PJ2 A;  4B5P B;  2YGW A;  2ARH A;  3BLN A;  2XND A;  3WR7 A;  1KUY A;  2HC9 A;  4YAO A;  1WSV A;  2QTL A;  3PFE A;  2WPX A;  3WAB A;  3SXO A;  3BNW A;  2C5H A;  3HUV A;  2VYQ A;  4QUZ A;  3DR8 A;  4A94 A;  5HZB A;  2OBS A;  3ISZ A;  1GVH A;  3IJ3 A;  3MCA A;  1QGZ A;  1UD2 A;  4B44 A;  2ZW6 A;  3OOC A;  4BMH A;  5AG5 A;  4CS0 B;  4HNY B;  3WBJ A;  1XRY A;  2Q6O A;  4GQN A;  4G7W A;  1VHE A;  3KR4 A;  4C0S A;  1MJB A;  3FRM A;  4TSF A;  4X8I A;  2OZH A;  1ARL A;  5KNL A;  4A37 A;  4X0C A;  2E1R A;  3FJU A;  2QA4 B;  4FBE A;  5J35 A;  3W91 A;  4Z4Y A;  1E63 A;  5EMI A;  3CC7 B;  2HCJ B;  1N08 A;  4II3 A;  4RDL A;  4B3X A;  4R9M A;  1TTT A;  1HA3 A;  2BEI A;  4DNC A;  3IU2 A;  1GJR A;  4KVX A;  2ZXI A;  1VQN B;  3W2G A;  4H6Z A;  4U9U A;  2QGG A;  2ZEL A;  2LZJ A;  1QX4 A;  2ZEF A;  2OTL B;  1F60 A;  3CMM A;  4P4J A;  3G05 A;  2P6G A;  4L8J A;  4MFQ A;  4C2Y A;  3RAM A;  4Z4W A;  4P26 A;  1V0C A;  3DNS A;  2Z3N A;  2R1I A;  2GJK A;  1CM0 A;  2CC2 A;  2PRB A;  4P2N A;  3LD2 A;  5IB0 A;  1AMP A;  1IU8 A;  3P2F A;  3VWE A;  1KZF A;  4RDK A;  3B3S A;  2O53 A;  5HVG A;  5F49 A;  3SKB A;  1N0V C;  4KOR A;  2V31 A;  2ZZG A;  2BSW A;  3CZX A;  3EC4 A;  1K4J A;  4ROX A;  4P3Y A;  3S6K A;  4XD7 A;  5BWA B;  1XE4 A;  4KOW A;  2FVG A;  1XBU A;  2X6X A;  4PPZ A;  2ZW5 A;  5TV2 A;  1TF8 A;  2IMO A;  1RO5 A;  1W0K A;  1QSR A;  4RDJ A;  1BX1 A;  3BXM A;  3OJX A;  4CGO A;  5F47 A;  4ZBG A;  4K30 A;  4NJR A;  1BAV A;  4P44 A;  2EBJ A;  3VAR A;  3G6E B;  4F8Z A;  2V7V A;  1YME A;  1Y0Y A;  4BIN A;  1T6X A;  1VQ7 B;  1LOK A;  3KEW A;  1QFY A;  3C26 A;  4P4I A;  2DIE A;  2ZZF A;  2DPT A;  2Q6I A;  2B4D B;  2VI7 A;  4A32 A;  2WUU A;  5K8O A;  2ABZ A;  2ZBV A;  3PGP A;  3PB7 X;  1QSN A;  3G8W A;  2QE7 A;  2ZL5 A;  3WQZ A;  3KHZ A;  4AB7 A;  2PC1 A;  2VBV A;  1QG0 A;  2XZP A;  2AFU A;  2Q43 A;  4MY3 A;  2NV4 A;  2QYV A;  4X2T A;  1CBX A;  4FD6 A;  1F57 A;  1ZLH A;  1S7N A;  4P25 A;  2CTB A;  3LO8 A;  3ASS A;  4LBW A;  1BOB A;  1XB2 A;  3SJF A;  2GK7 A;  3P27 A;  3FX6 A;  4X5K A;  4RD6 A;  1R3N A;  2Z3O A;  4CAE A;  4F0X A;  4RN7 A;  4LBY A;  2P0W A;  2GLF A;  1CQX A;  3AGP A;  4MCS A;  4XPD B;  1UWY A;  3OZU A;  1IY7 A;  4X7D A;  3RZA A;  3H4Q A;  1P0H A;  2A4N A;  1T6Y A;  2EK9 A;  3R95 A;  2J8N A;  3FPP A;  4MRI A;  3BJ7 A;  1EFC A;  1Y9W A;  2O28 A;  2PJ5 A;  3K9U A;  1YW4 A;  5F09 A;  5ISV A;  3FEC A;  4U5Y A;  4R76 A;  4XLF A;  4PXD A;  5ELY A;  4R6T A;  2REE A;  1QGY A;  3OZW A;  4FXU A;  3NH4 A;  3VAT A;  1ZM3 A;  2POK A;  3PRT A;  4TMV A;  3S6G A;  1YJW B;  2ZEH A;  4HIZ A;  4G1B A;  1QSM A;  4EME A;  2OB0 A;  4ORF A;  3A1P A;  4RM0 A;  3CMA B;  1DDG A;  5E96 A;  3ISX A;  1WDT A;  3AVW A;  1M4I A;  1HEE A;  4XN3 A;  1IGB A;  4QHY A;  5AGE A;  2C4U A;  5LRJ A;  4X07 A;  4UZU A;  1RQP A;  2DET A;  4OC4 A;  4KSI A;  1ZM2 A;  4NFR A;  3Q6R A;  1JA0 A;  4AG9 A;  3L2N A;  2B7B A;  3NFZ A;  4H2K A;  3BQJ A;  2XNC A;  1EP3 B;  4AVA A;  4YHB A;  3ZUG A;  1M4G A;  2AFS A;  4G1P A;  1FNM A;  2DEU A;  4FN5 A;  1KK0 A;  2GIV A;  2QEX B;  3CRZ A;  4TNU A;  2Y0M A;  3CCL B;  3PUN A;  3JU4 A;  3LAC A;  1YGH A;  1KK3 A;  1IYL A;  1JQG A;  2XEF A;  2QTZ A;  3SEJ A;  3IEH A;  2CY2 A;  2VL1 A;  3PP9 A;  3RO0 A;  2CTC A;  3GVL A;  2JLM A;  2DOG A;  4QB9 A;  4ACA A;  3WYA A;  3ZBT A;  1H85 A;  1OGJ A;  2PJ4 A;  4IK2 A;  4Z1M A;  4OID A;  2AJ6 A;  2OH1 A;  4EVY A;  1N8R D;  4Y9U A;  3Q39 A;  1S72 B;  4XR6 A;  3GUX A;  5G21 A;  4WQM A;  4IW3 B;  1VKC A;  2KCW A;  4MJ8 A;  4R8F A;  1VJS A;  2RB7 A;  2ODF A;  1B6B A;  5KSW B;  4AVB A;  3PBB A;  3LVB A;  1Y7R A;  3I3G A;  3TTH A;  5GV8 A;  1HVX A;  1A2Z A;  4ZCI A;  1Z8T A;  2REF A;  1MK4 A;  3A35 A;  5FVJ A;  2CRV A;  1QUF A;  4CYO A;  3CB4 A;  4HE6 A;  3H9N A;  2XGJ A;  2G0B A;  4KUB A;  3TO9 A;  3ONY A;  1YR0 A;  2AFZ A;  3N5F A;  3FMC A;  1Y0R A;  2DF5 A;  1UD8 A;  2Q4Y A;  2GPJ A;  4HKF A;  4DNT B;  3T90 A;  1COW A;  2RC5 A;  2PR8 A;  2EVN A;  2V8H A;  2QEC A;  4B5O A;  4OLL A;  4KOS A;  1T6Z A;  1PJ7 A;  1FT7 A;  3JQP A;  2H5M A;  1S3Z A;  1Q9S A;  4KKT A;  3DSB A;  1N0U A;  3KGQ A;  4QC6 A;  2PJC A;  2GK6 A;  2DCU A;  2GAN A;  3VH9 A;  2D3L A;  2X6Y A;  1Y9K A;  1Z4R A;  1SKQ A;  1YIT B;  3QFC A;  2YND A;  4PC2 A;  4AVC A;  2XZO A;  3B8G A;  1M44 A;  4YEL A;  2OBR A;  4Y49 B;  2V7W A;  4WZL A;  3BI1 A;  3JRU A;  5JQ4 A;  2NYQ A;  4U9Y A;  2XEG A;  1NMT A;  2Z3K A;  1BPN A;  3W5U A;  4MMO A;  2J7K A;  4L89 A;  3CCU B;  1IOI A;  1Q7Y D;  4J0Q A;  5H84 A;  1X10 A;  4A39 A;  4XL9 A;  4PXB A;  2CW5 A;  4XN0 A;  3TX8 A;  1FRQ A;  1W35 A;  5BSX A;  2JDC A;  1TUI A;  3RNZ A;  2K5T A;  1ON0 A;  4UA3 A;  1Z8X A;  3EXN A;  1U6M A;  5JGF A;  2OZG A;  2AFO A;  1VHO A;  3RBU A;  2ANP A;  3MGD A;  1H42 A;  3BY2 A;  3VNU A;  1I21 A;  2GU2 A;  4PXE A;  3SXN A;  1BPM A;  2FS5 A;  2HB6 A;  1JB9 A;  1PUA A;  3IWG A;  4EH1 A;  3DDD A;  4M3S A;  2FL4 A;  4WJB A;  4XM3 A;  4X7E A;  1AMO A;  2PMD A;  2OYN A;  2CNS A;  4P6V F;  5FIU A;  4BPR A;  3R1K A;  4NJQ A;  2ZEG A;  1UFH A;  5FO1 A;  4EWT A;  4HPS A;  4CYN A;  2VNJ A;  1QGA A;  3KZW A;  3CCV B;  2D4O A;  1CJW A;  4MCQ A;  2V7Q A;  3AVU A;  1R57 A;  3ZZ0 A;  4IHM A;  2F43 A;  4R87 A;  3IIB A;  1LAP A;  5H5J A;  4PK3 A;  4FUU A;  1GR1 A;  2VJJ A;  2Q7B A;  2WPW A;  4JLY A;  5LYL A;  3D26 A;  2DER A;  1VQ8 B;  4Z4V A;  4FWT A;  4M6G A;  2PQ8 A;  2O4H A;  4UZE A;  2X3U A;  4GS4 A;  3KKW A;  4X3R A;  4KZT A;  3PEN A;  2AHO A;  2QML A;  2X0K A;  1OHH A;  3R9F A;  3D7F A;  3FED A;  1PCA A;  2R7H A;  1Q2D A;  3A8J A;  4LX9 A;  1KK2 A;  3GQB A;  1PU9 A;  3R9E A;  2ZTG A;  1J4J A;  4PK2 A;  1CNE A;  1YIJ B;  1HDU A;  2P6E A;  4PXC A;  3LNN A;  4NGQ A;  4L8A A;  3AGQ A;  5DS0 A;  4XNH B;  3B8H A;  1UD6 A;  3U6B A;  3OJW A;  3F5B A;  1W87 A;  2ZZE A;  1QFZ A;  3H8E A;  2BCO A;  5EBV A;  3CP2 A;  1TLL A;  1ELM P;  1I12 A;  2D4P A;  3JTK A;  4E8O A;  4Q38 A;  2VJI A;  1I1D A;  3SLN A;  2AFX A;  2V8G A;  4PSX A;  4R3L A;  1QST A;  3CP8 A;  1IHM A;  1H8E A;  5DSZ A;  1KZL A;  5DWM A;  4Y7C A;  1M1D A;  3GVJ A;  3K9T A;  5G20 A;  1NE9 A;  3G71 B;  4GXH A;  4KSA A;  4YU9 A;  3CDX A;  2ZPA A;  2FSR A;  2BMW A;  2GJP A;  2AE6 A;  4QV2 A;  3CCS B;  5IX3 A;  3CES A;  4TWE A;  3SJP A;  4JWP A;  3I1U A;  3JQR A;  4MXU A;  1BJK A;  5TR9 A;  1YK3 A;  3LWU A;  1CNF A;  4KLW A;  4WZT A;  3IGR A;  4DK1 A;  4YWY A;  3H8F A;  1LRZ A;  4PAB A;  3QSY A;  1VIX A;  4MI4 A;  1TXR A;  5K8P A;  1IB1 E;  1EFU A;  2RFH A;  5A27 A;  3BY1 A;  4UWI A;  2R6H A;  4M2L A;  2WPD A;  3ASQ A;  4II9 A;  1ZUN B;  4CGL A;  4PC3 A;  1GHE A;  4RI1 A;  2XOK A;  1YW6 A;  4RS2 A;  2V8V A;  4C2Z A;  4J3G A;  1FNB A;  4AF6 A;  5F46 A;  1PJ5 A;  1BQE A;  2V7T A;  1B87 A;  1Q7L A;  2ZL7 A;  4XNF A;  4YAU A;  5H59 A;  1EP1 B;  4ACB A;  3OP1 A;  1KWM A;  3S6H A;  1QSO A;  2ZED A;  2CIJ A;  2F7V A;  2VBQ A;  3KR5 A;  5F48 A;  1YHQ B;  4W9Y A;  4NCZ A;  2OK7 A;  2B3U A;  4XQF A;  2Q7S A;  4RPD A;  3OW7 A;  4N3N A;  3WXM A;  3GIR A;  3WNC A;  4P4D A;  1YX0 A;  1S0U A;  1ZM4 A;  3T53 B;  1E43 A;  3IWW A;  1LCP A;  1RTQ A;  3DGV A;  2HUZ A;  5JM6 A;  3EFA A;  1KJZ A;  4UEF A;  1JA1 A;  3G3S A;  1KC8 D;  2JN9 A;  4E0F A;  4MY0 A;  1Z9U A;  2FIA A;  5AG6 A;  4M53 A;  3CXP A;  4CYQ A;  2JIZ A;  3ASR A;  4NBS A;  4II2 A;  1TKF A;  1P4N A;  3NE7 A;  1VQ9 B;  3B3V A;  1WOR A;  4P22 A;  4TMT A;  1KTV A;  3FPK A;  1JWQ A;  3PFO A;  3BI0 A;  3T8W A;  2C6G A;  2F8H A;  4LBZ A;  3SI1 A;  3FNC A;  1S7F A;  3V38 A;  4MHZ A;  2XEJ A;  1S7K A;  5IYN A;  3CPX A;  2WYR A;  3VWD A;  4P12 A;  3CPW B;  4NGN A;  5LYI A;  4TKO B;  4CPA A;  3ZZI A;  4MHY A;  2XNJ A;  1N07 A;  2QN6 A;  4UCP A;  3FBU A;  4HE5 A;  3DLJ A;  1VQ5 B;  2GRE A;  3KAS A;  3N7Z A;  3B7I A;  4LQG A;  1NB9 A; 
#chains in the Genus database with same CATH homology
 3GUX A;  3B3C A;  1GYT A;  4R8F A;  4BD9 A;  4P4B A;  5K8N A;  2RB7 A;  1F2P A;  1LAM A;  5LRK A;  1TF9 A;  3D7G A;  4K3N A;  3PBB A;  3WC5 A;  4ZI6 A;  3GLJ A;  4OC0 A;  4NGM A;  2CF4 A;  3K2K A;  3D68 A;  4OC3 A;  3MN8 A;  3B3T A;  2ZEM A;  5JH9 A;  4JZ0 A;  3B2Y A;  2AFZ A;  3N5F A;  1M4L A;  1Y0R A;  3FMC A;  5LRG A;  3WT4 A;  1NSA A;  2DEA A;  1CP6 A;  2V8H A;  2PJ3 A;  2C6C A;  3WC7 A;  2PJA A;  1FT7 A;  5HVH A;  2JBK A;  4NGP A;  3FEE A;  3HLP A;  3NH8 A;  2PJ1 A;  3SI0 A;  5IB9 A;  2ZEO A;  4NGT A;  1EE3 P;  3KGQ A;  2PJC A;  4OME A;  4OKO A;  3WC6 A;  1LFW A;  3VH9 A;  2PJ2 A;  1ARM A;  1AYE A;  2PRQ A;  2HC9 A;  5D29 A;  2PJ0 A;  3PEI A;  5I4M A;  2ZEE A;  3PFE A;  4JYW A;  4NGR A;  3BI1 A;  3JRU A;  3WAB A;  2NYQ A;  2XEG A;  3CPA A;  3HUV A;  3KQZ A;  4MCP A;  5HXD A;  1BPN A;  4MMO A;  5THW A;  4A94 A;  3ISZ A;  3IJ3 A;  4A39 A;  4PXB A;  1R43 A;  1CG2 A;  2G9D A;  3TX8 A;  1FNO A;  1XRY A;  3KI9 A;  5JGF A;  1ELL P;  1VHE A;  3PB9 X;  2AFO A;  3KR4 A;  3LMS A;  1VHO A;  5LYD A;  4X8I A;  1ZG8 A;  3KQX A;  3RBU A;  2ANP A;  1ZG7 A;  1ARL A;  1VGY A;  4A37 A;  3FVL A;  3FJU A;  4PXE A;  2GU2 A;  4OP4 A;  1CX8 A;  1LAN A;  2C1C A;  1BPM A;  2HB6 A;  3SJG A;  4FBE A;  4WJB A;  4P45 A;  2QJ8 A;  4A38 A;  1OBR A;  2PIY A;  4NJQ A;  2ZEG A;  2AFM A;  5HVF A;  1TKH A;  4EWT A;  2ZEL A;  2ZEF A;  2PJB A;  3KZW A;  4P4J A;  4ZY0 A;  4MCQ A;  3RAM A;  4IHM A;  1F2O A;  3PB8 X;  3IIB A;  1LAP A;  4UEZ A;  4FUU A;  3IC1 A;  3KHX A;  2Q51 A;  1AMP A;  5LYL A;  2PJ6 A;  2V8D A;  4AXV A;  4F9V A;  2IQ6 A;  3B3S A;  2O53 A;  4PQA A;  2O4H A;  5HVG A;  4X3R A;  1CP7 A;  2C6P A;  3S9M A;  2BOA A;  1XFO A;  4RUH A;  2PVW A;  2ZEP A;  3D7F A;  3FED A;  4UIA A;  3NA6 A;  2FVG A;  1XBU A;  2V77 A;  1PCA A;  4P10 A;  4ONW A;  3CT9 A;  4PPZ A;  5K8M A;  4IAV A;  1TF8 A;  4PXC A;  1HDU A;  2EWB A;  2IMO A;  6CPA A;  1Z2L A;  2GLJ A;  4NGQ A;  3BXM A;  4OC2 A;  5DS0 A;  1Y7E A;  1TKJ A;  1YSJ A;  3H8E A;  2BCO A;  3IO1 A;  4NJR A;  1BAV A;  4P44 A;  3VAR A;  2QVP A;  1ELM P;  4F8Z A;  8CPA A;  1YME A;  7CPA A;  1Y0Y A;  4MCR A;  2AFX A;  2V8G A;  4O23 A;  4P4E A;  1LOK A;  2I3C A;  4EFD A;  4P4I A;  2EK8 A;  1CPS A;  3NH5 A;  4ZY2 A;  3FH4 A;  1YLO A;  5LYF A;  2NSM A;  1ZG9 A;  3K9T A;  4UF4 A;  4YU9 A;  1DTD A;  3CDX A;  5K8O A;  2ABZ A;  2PVV A;  4TWE A;  3B3W A;  3PB7 X;  3I1U A;  3KHZ A;  4MXU A;  3QNV A;  2AFU A;  2Q43 A;  1Z5R A;  3LWU A;  2QYV A;  4X2T A;  1CBX A;  5D8N A;  4YWY A;  3H8F A;  1F57 A;  1ZLH A;  4OC1 A;  2CTB A;  1Z8L A;  4NGS A;  1VIX A;  3SJF A;  2PCU A;  1TXR A;  5K8P A;  4ZX9 A;  3FX6 A;  2RFH A;  1R3N A;  3S9L A;  4FAI A;  2BO9 A;  5CBM A;  2GLF A;  3S9N A;  4MCS A;  2PJ8 A;  4DUK A;  1UWY A;  1IY7 A;  4OC5 A;  3RZA A;  2ZOG A;  2EK9 A;  4MRI A;  1YW6 A;  2PJ7 A;  2XEI A;  4GM5 A;  4MHN A;  2PJ5 A;  2OOT A;  1YW4 A;  2V8V A;  3TC8 A;  5F09 A;  3FEC A;  4R76 A;  4PXD A;  5ELY A;  4ZY1 A;  4R6T A;  4Q7A A;  3MRU A;  4WWV A;  3NH4 A;  4UIB A;  3VAT A;  1PYT B;  4F9U A;  2POK A;  4P4F A;  3SJE A;  1Q7L A;  3PRT A;  2JEW A;  4B6Z A;  2PE3 A;  2ZEH A;  1XJO A;  1KWM A;  2AFW A;  2ZED A;  4EME A;  2CIJ A;  2F7V A;  3BHX A;  3KR5 A;  3ISX A;  4W9Y A;  1XMB A;  1QQ9 A;  4P6Y A;  4R7M A;  2IJZ A;  1ZLI A;  1H8L A;  4DJL A;  1HEE A;  2J9A A;  1IGB A;  2ZEN A;  3V7Z A;  3KL9 A;  4P4D A;  5LRJ A;  3IWW A;  1LCP A;  1RTQ A;  3DGV A;  4Z65 A;  5JM6 A;  4OC4 A;  4KSI A;  4UEF A;  3D66 A;  4NFR A;  3L2N A;  3NFZ A;  4H2K A;  2WZN A;  1QMU A;  2Q4Z A;  2AFS A;  4G1P A;  3H8G A;  1TKF A;  3D7D A;  4UEE A;  5CPA A;  3B3V A;  4TNU A;  4ZYQ A;  3PFO A;  3B35 A;  3BI0 A;  3T8W A;  2C6G A;  2F8H A;  1DE4 C;  3SI2 A;  4FWU A;  2JBJ A;  3IFE A;  3D7H A;  3SJX A;  2OR4 A;  3SI1 A;  4ZX8 A;  1BLL E;  3V38 A;  1JQG A;  4MHZ A;  2XEJ A;  3GB0 A;  2XEF A;  3CPX A;  2WYR A;  3IEH A;  4NGN A;  5LYI A;  2VL1 A;  1HDQ A;  2CTC A;  4DYO A;  4CPA A;  4MHY A;  2PJ9 A;  3DLJ A;  5J1Q A;  2PIZ A;  4OIW A;  2PJ4 A;  2GRE A;  3KAS A;  4IK2 A;  3B7I A;  3D4U A;  4OID A;  3D67 A;  3PB6 X;  3PBE A;  4LQG A;  1CPX A;  4MHP A;  2ZOF A;  3PB4 X;  3FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...