3CPXA

Crystal structure of putative m42 glutamyl aminopeptidase (yp_676701.1) from cytophaga hutchinsonii atcc 33406 at 2.39 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
309
Chain Sequence
ENLYFQGMQLLKELCSIHAPSGNEEPLKDFILEYIRSNAGSWSYQPVIYADNDLQDCIVLVFGNPRTAVFAHMDSIGFTVSYNNHLHPIGSPSAKEGYRLVGKDSNGDIEGVLKIVDEEWMLETDRLIDRGTEVTFKPDFREEGDFILTPYLDDRLGVWTALELAKTLEHGIIAFTCWEEHGGGSVAYLARWIYETFHVKQSLICDITWVTEGVEAGKGVAISMRDRMIPRKKYVNRIIELARQTDIPFQLEVEGAGASDGRELQLSPYPWDWCFIGAPEKDAHTPNECVHKKDIESMVGLYKYLMEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase, M42 family
publication title Crystal structure of putative M42 glutamyl aminopeptidase (YP_676701.1) from Cytophaga hutchinsonii ATCC 33406 at 2.39 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
total genus 95
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3cpxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3cpxA01
2O4HA 1QMUA 2PJAA 4R8FA 5D8NA 4UEZA 2PJ1A 5THWA 3SJEA 5JM6A 3PFOA 2EWBA 4PQAA 2OR4A 3SI0A 4P45A 4A37A 2PJCA 1CPXA 1TXRA 4K3NA 2HC9A 3L2NA 4NGQA 3TC8A 5K8OA 2XEIA 4FBEA 3VARA 2VL1A 3PB6X 3FMCA 4Q7AA 4YWYA 1LFWA 3B3TA 4MHZA 3HLPA 2AFMA 3D7FA 3N5FA 4ZYQA 2BOAA 1ZG8A 1DTDA 4TNUA 3SJXA 2EK8A 2GU2A 1TKFA 1BAVA 4WJBA 2JBJA 3NFZA 4R6TA 2ZOGA 4AXVA 2CIJA 1IGBA 1JQGA 2ZEPA 4OP4A 2WYRA 2PVWA 2V8HA 3WC6A 4A39A 2V8DA 2V77A 2XEJA 3D68A 4PPZA 1F2PA 4FWUA 3GUXA 4DYOA 4BD9A 2C6PA 1IY7A 3KI9A 4MHPA 2NSMA 1OBRA 1XJOA 3SJGA 2POKA 1NSAA 3FJUA 2C6GA 2GLJA 3NH5A 2IJZA 3WC5A 3B3CA 5LYFA 4X8IA 3PB8X 4ZX8A 3S9NA 1CX8A 4MCSA 3KGQA 1YLOA 1YSJA 2PRQA 2ZEGA 3V38A 4P4DA 1AYEA 4P10A 3B3WA 5CBMA 4UIBA 4NGPA 2XEGA 3KHZA 3WABA 3KQZA 1M4LA 1LAMA 3B7IA 4JZ0A 7CPAA 4YU9A 4WWVA 2ZEMA 4ZX9A 1H8LA 3CPAA 3CT9A 1PYTB 1R3NA 5LRJA 4MXUA 3VATA 5HVGA 2ZEHA 2I3CA 4R76A 2F8HA 4OIDA 4NFRA 3FVLA 4B6ZA 1XBUA 1ELMP 1F2OA 1F57A 2GREA 3SI1A 5LRGA 2PJ2A 1LCPA 1BLLE 3FH4A 3H8EA 2Q4ZA 6CPAA 3MRUA 4EMEA 4UEFA 1KWMA 1XFOA 2PVVA 1GYTA 2ZOFA 4ZI6A 1YW4A 1Z5RA 4IHMA 5D29A 4MHYA 1BPNA 3D7HA 5HVFA 3D4UA 1ZG7A 3D7GA 3WT4A 3D66A 4MHNA 5JH9A 2IQ6A 2QJ8A 1R43A 4EWTA 4A94A 2AFSA 3GLJA 4DJLA 4GM5A 4P4IA 4OC3A 1YW6A 2PIYA 1HDQA 3B3SA 3PBBA 3ISZA 4MCRA 1TF8A 3D67A 4OMEA 4W9YA 8CPAA 3CDXA 4OIWA 3FEEA 2XEFA 3NH4A 2AFWA 5LYLA 1CBXA 3WC7A 2PJBA 3PFEA 4P4FA 3B2YA 1LOKA 2Q51A 3RAMA 4OC1A 2EK9A 4CPAA 1TF9A 2OOTA 1XRYA 4P6YA 3FEDA 5DS0A 2CTCA 4MCPA 5CPAA 1ZLIA 4JYWA 4P4EA 1TKHA 2ANPA 3QNVA 4PXEA 2DEAA 4R7MA 3S9MA 4OKOA 3KASA 1CP7A 2PE3A 3PRTA 3LWUA 3FX6A 4ZY1A 2ZENA 3BXMA 1ZLHA 5LYDA 3TX8A 3LMSA 4P4BA 4F8ZA 3NH8A 4X3RA 3B35A 4H2KA 1EE3P 2C6CA 3PB4X 2PJ0A 2RFHA 4NGRA 4NGSA 3PB9X 2PJ9A 1FNOA 5JGFA 1LAPA 1YMEA 2BCOA 3RZAA 5HVHA 3IWWA 4NJQA 5ELYA 2ABZA 4UF4A 2ZELA 3D7DA 3B3VA 2QYVA 3FF3A 4A38A 1CG2A 2F7VA 4ZY0A 3IJ3A 4O23A 1BPMA 4F9UA 5K8NA 2PJ4A 4F9VA 3KR4A 3BI1A 2WZNA 1DE4C 3BI0A 3V7ZA 3DLJA 1QQ9A 4ONWA 5F09A 3KL9A 2PJ7A 3S9LA 4P44A 4UIAA 2Q43A 1ARMA 1UWYA 3NA6A 3BHXA 1RTQA 4NGTA 1Y7EA 3IFEA 4NGNA 1HEEA 2V8GA 4OC0A 3K2KA 3ISXA 3PB7X 1HDUA 2PIZA 2HB6A 4FUUA 2QVPA 3T8WA 2AFUA 4X2TA 4OC5A 4OC2A 1ZG9A 4RUHA 3KZWA 4TWEA 2J9AA 4Z65A 4P4JA 1Y0YA 4NGMA 1ARLA 4IK2A 2C1CA 4IAVA 1Z8LA 1AMPA 4PXBA 2GLFA 5K8PA 3IO1A 4MRIA 3SJFA 3FECA 5LRKA 3I1UA 3K9TA 4ZY2A 3IC1A 1VIXA 2FVGA 3IIBA 3RBUA 2JEWA 1Z2LA 4DUKA 2ZEOA 2PJ8A 3H8GA 4NJRA 2CF4A 5LYIA 2ZEDA 1XMBA 4MMOA 4KSIA 3SI2A 4OC4A 2CTBA 2BO9A 4MCQA 4EFDA 2PCUA 1VHEA 3KR5A 1CPSA 3VH9A 1VHOA 2V8VA 2PJ3A 3HUVA 4G1PA 5K8MA 1LANA 3KQXA 5J1QA 5HXDA 2ZEEA 1Y0RA 3PBEA 3PEIA 2O53A 2AFXA 3MN8A 2RB7A 2PJ5A 4FAIA 3IEHA 1PCAA 2JBKA 5IB9A 3H8FA 2ZEFA 1CP6A 3GB0A 2G9DA 2NYQA 2PJ6A 3JRUA 3KHXA 4LQGA 3DGVA 1VGYA 1FT7A 2AFZA 2IMOA 4PXDA 1Q7LA 4PXCA 3CPXA 1TKJA 4UEEA 5I4MA 2AFOA 1ELLP
chains in the Genus database with same CATH superfamily
3TOAA 4DK0A 4CAWA 1QMUA 4TKOB 1QSRA 3JUWA 1PU9A 4JLYA 1L0CA 2XNDA 3SJEA 5JM6A 5E96A 2PJCA 1F20A 4K3NA 5FVJA 4Z4YA 3E20A 5K8OA 1VQ8B 1M4IA 4F0YA 2BSAA 3FMCA 4Q7AA 3B3TA 4MHZA 2X6YA 1NBMA 4PK2A 1QGZA 2AJ6A 2BOAA 4WZTA 4TNUA 3SJXA 2REFA 3SXNA 1QGYA 2EK8A 3OZWA 4R6TA 4X7DA 4AXVA 2Z10A 1OHHA 2CIJA 1HZEA 4RCYA 3QFTA 1E62A 3ZZTA 3F8KA 2F4NA 3WC6A 1W9XA 4AVBA 1XE4A 4PPZA 4X7FA 1JB9A 4KKTA 3SXOA 4MBUA 1NE9A 1TUIA 2GLJA 4KS9A 1S7NA 3B3CA 3LODA 3AVXA 4JWPA 4KORA 1YJNB 1FDRA 1JWQA 3ASSA 5F4JA 3FPKA 4B3GA 3H94A 4C43A 1H42A 2BM0A 4MFJA 1BPLA 4XL9A 2Q04A 2REEA 2RC5A 3TCVA 3N7ZA 4LQ6A 3I9SA 1PYTB 3BCFA 1R3NA 1Z4EA 3SLNA 4RD2A 1Z8XA 4RJLA 2KVOA 4XPKA 3TO6A 4NFRA 3B8HA 3CMAB 3A3GA 1QH0A 2I1LA 1E79A 2IL4A 1F57A 2ZZFA 3S6HA 4CGOA 1UD6A 1DDGA 1WSVA 2CNDA 2BPOA 1BMFA 5AG6A 1KJZA 3GY9A 1OZPA 2JJ1A 2FT0A 2Q6KA 1I21A 2BL1A 4EMEA 1KWMA 1XFOA 1GYTA 4RDKA 2V7XA 3VMFA 3TE4A 4MHYA 4B13A 5HVFA 3ZIAA 1YI2B 4NCNA 1ZG7A 3CXCB 4Y49C 4RD3A 2P6GA 4MHNA 4MYTA 2VNIA 5JH9A 1KC8D 1G7RA 3JTKA 4A94A 2AFSA 3W2HA 4P4IA 1HDQA 3CCSB 2DOGA 1Y7RA 3NE7A 1TF8A 4KKSA 3D67A 1IU8A 1ZM9A 2I79A 3CDXA 4OIWA 2B4BA 5LYLA 2Z3MA 3CCQB 4UWIA 2ZZGA 3OE7A 2ZBVA 2ZL5A 2F5IA 4MFLA 2Q51A 2EK9A 4CPAA 5DS0A 4PGOA 2C5BA 3V7AA 2YGWA 4MCPA 4QBJA 1CNFA 1J4JA 1WPCA 4JYWA 5AG4A 4HNYB 3OZVA 1K73D 5A89A 3CZXA 4B44A 1GO2A 2PE3A 3LWUA 5FO0A 5IYWA 4ZY1A 4KUBA 5HH1A 2D4PA 4QB9A 3AVWA 4U9ZA 4PABA 3LMSA 4P4BA 4WZLA 4X3RA 3B35A 1K8AD 4PV6A 5EC4A 1R57A 4CRZB 4AVAA 3PGPA 3CCJB 2VNJA 4UWJA 3BLNA 5GCNA 4CGMA 2HLDA 1M1DA 2PJ9A 1YX2A 1FRNA 1LAPA 2BCOA 2OZUA 1YHQB 3RZAA 2F1LA 1PJ5A 3AVTA 3R6KA 4X5KA 5DN6A 5IB0A 3FF3A 1H8HA 2VNHA 1YVOA 3T56B 3LACA 3UY5A 2WPDA 4DQLA 2QMUA 3W91A 4F9UA 4F9VA 4TMXA 1N0UA 2EVNA 3ASRA 4PC3A 1DE4C 2P6EA 3V7ZA 1G7CA 4M2LA 3KL9A 2O28A 4UA3A 3S9LA 2CK3A 5H84A 2FSRA 2Q43A 4AG7A 1S7KA 1E43A 4XN0A 5CDFA 1YIJB 4NGTA 2CNSA 1YQEA 2GK7A 4I49A 5H5JA 3F0AA 2ZXIA 3P26A 2DYIA 3W2FA 1HDUA 4E2AA 4H9GA 4FUUA 2E1BA 3PZJA 4X2TA 1NDHA 2VBSA 1NRKA 3RYOA 4OC5A 1S72B 2Y0MA 1S7LA 1WWZA 4CGNA 1QUEA 2WUUA 2QEXB 4P4JA 4M53A 4ZGNB 5C88A 1Q81D 4IK2A 3WQZA 5HZAA 1IOFA 1R5OA 2C5HA 4NF1A 2DIEA 4P3YA 1B6BA 3SJPA 4GXHA 2M5SA 3A1PA 3V8IA 4ORFA 4E8OA 1IB0A 2LZJA 3S6KA 4KOUA 4B3FX 2PJ8A 1FNBA 3H8GA 3H5ZA 2CF4A 4PC7A 4NJRA 2ZEDA 1XMBA 2EBJA 5A8AA 3A8JA 2HCJB 4OC4A 3W5HA 2J8NA 1UD4A 2PCUA 2QE7A 1DG1G 4H89A 4UFXA 1Q2YA 3CESA 1T6ZA 1W2BB 4AF7A 4ASUA 2YNCA 1H8EA 1XE1A 1VHOA 2FX3A 2PJ3A 3HUVA 2D3NA 4G1PA 5K8MA 4JJXA 2ZEEA 3K9UA 1B23P 3PBEA 3IU2A 4XLFA 1MK4A 5KW9A 1QUFA 4JMQA 2OZGA 2PJ5A 3AGQA 3IEHA 2ZW5A 4B5PB 4IUSA 1PCAA 3H8FA 3OWCA 4P9SA 2X53S 3GB0A 3FXTA 3PUMA 2G9DA 2AFZA 1COWA 4TMVA 4X7CA 4Z4UA 1IIDA 1XIXA 2OTJB 1VLYA 4TMWA 4XKVA 2CNMA 4OLLA 3OP1A 3R9FA 4F0XA 1TKJA 4CYPA 1ELLP 1M44A 2QDXA 1DDIA 2VEZA 4DNTB 2Z3LA 2VZLA 1UD8A 5FIUA 2R6HA 5AN9A 1A8PA 3S6GA 1W0JA 2R7HA 1TVCA 2F43A 4KOSA 3CC7B 4UEZA 5IYQA 4E0AA 4FD6A 4C7IA 2XEXA 2Q4VA 2ATRA 3MGDA 2HQYA 3QE2A 3PFOA 1B2RA 3SI0A 4CYNA 5F4MA 3IWEA 4UCMA 4G7XA 2F1MA 3PENA 5L46A 2G3AA 1QSNA 4HNXB 4M0LA 1DARA 4DNCA 4FBEA 3GSIA 2DF5A 3SLDA 5J8CA 1EXMA 1QX4A 3PB6X 4YWYA 1BOBA 2VJIA 2AFMA 3D7FA 1VF7A 4ZYQA 2GANA 3A9LA 4YFJA 3EO4A 1ZG8A 1DTDA 3ZBTA 2PR1A 2PRBA 1TKFA 4WJBA 2DPSA 4OP4A 2WYRA 3R1KA 4B10A 2BN4A 2ZITA 4A39A 3TO9A 2ZXHA 3ASTA 3D68A 4CGPA 3KEWA 5HXBA 3BCDA 1N05A 3ZZIA 3GUXA 1AMOA 2GQFA 1NJID 1XJOA 2FE7A 3CD6B 1NSAA 2IJZA 2OK7A 4FXUA 1SQHA 2VBUA 3CTAA 1YLOA 2BGJA 2WR8A 4ZCLA 4M4SA 2PRQA 2QIRA 1A2ZA 1YSJA 4P4DA 3BY2A 3B3WA 1EP2B 3ONYA 1RO5A 4QVAA 3WABA 4KVOE 3BNWA 3KQZA 4NEXA 1LAMA 4JZ0A 1AIPA 4WWVA 2Z3NA 3CT9A 1MJBA 4FK8A 2JEVA 1NMTA 1XF8A 1MJAA 4NSQA 4F7DA 2Q0YA 3VATA 3MCAA 1JA1A 4OIDA 1BQEA 1XBUA 1KK1A 3IGRA 3WNDA 2PQ8A 4KOVA 3SI1A 4XORA 3LNNA 1NB0A 1BLLE 1V0CA 1OGIA 3W2EA 4J3GA 3FH4A 4WZEA 5DSZA 6CPAA 1Q2DA 2WJYA 1WSRA 3FRMA 2PVVA 5J35A 2OB0A 2VZZA 1YW4A 4IHMA 5D29A 1WOOA 3VNVA 1RQPA 1M4GA 4EWTA 3CMMA 4FD5A 3GLJA 4DJLA 2V4DA 3ONUA 4P12A 3B3SA 2CBXA 2QGGA 4MCRA 2AE6A 4A33A 3B82A 3CXQA 1QGAA 1VQ6B 2OYNA 3Q6QA 5IK2A 3PVDA 3QFCA 2X0KA 3EFAA 4C68A 1VQ9B 4P22A 1U6MA 4KOXA 2OOTA 3CCUB 2ZW7A 1VQ7B 2CTCA 3AGPA 4UZUA 2B5GB 1ZLIA 3W2IA 4P4EA 4NCZA 1J9ZA 1UFHA 4OPVA 3CRZA 4P3IA 2B58A 3S9MA 5FO1A 2GK6A 2YNEA 1CP7A 3BXMA 1ZLHA 5LYDA 4CRYB 2VBTA 2B7BA 5KTCA 2PSWA 4AB7A 4DK1A 1S0UA 1UD3A 4LC0A 1WOPA 5H86A 5IV0A 5DWNA 1I18A 3LD2A 2PJ0A 1N0VC 2P3MA 4G5GA 1M4DA 1MRZA 3OFNA 4NGRA 4NGSA 2JLMA 1WDTA 3PB9X 3TTHA 4XQFA 3FBUA 3NE5B 3IWWA 4UF4A 1NSLA 3D7DA 1YVKA 4PAAA 2QYVA 4A38A 5AG5A 5J3OA 1CG2A 4G6IA 2F7VA 4ZY0A 1P0HA 4O23A 1BPMA 5K8NA 1D1NA 3VNUA 5TR9A 5F49A 3D8PA 4UFWA 5IYRA 2WZNA 1Q86D 5G21A 2OH1A 2ZL7A 4YELA 3DLJA 4ONWA 5F09A 2DY1A 3GVJA 2EIXA 1YJ9B 1AUGA 3QAYA 1UWYA 3NA6A 5GV8A 3BHXA 3TO7A 2JDIA 4DNRB 3WY9A 2XZLA 2C27A 4DQKA 1IOIA 4Z4TA 4YAOA 1GJRA 4OC0A 3OKXA 4RI1A 2R1IA 3K2KA 2RC6A 3Q6RA 2ZXVA 4CQJA 2ZW4A 3HAGA 2QVPA 3FIXA 2R8VA 4ZCIA 2DEUA 2FS5A 4TWEA 1Z8TA 2FCKA 3FPPA 4M6GA 4Z65A 4PC2A 1I12A 4NGMA 5F46A 1ARLA 4IW3B 1WK4A 1VQ4B 2CC2A 4IAVA 1RXTA 1F60A 3SKBA 3U6BA 1Z8LA 1XB2A 1PUAA 4RD4A 1IHMA 4ROXA 1EWYA 1OB2A 1VHSA 1PKVA 4LUAA 4MRIA 1VQOB 2PC1A 1QG0A 4BBHA 3FECA 5LRKA 4RM0A 3IC1A 1VIXA 2FVGA 2OBSA 2NV4A 1UD5A 3CCEB 2Q44A 2B4DB 1FRQA 2Z0ZA 2ZL6A 1G7TA 3SI2A 1E64A 2BO9A 4MCQA 3DDDA 2BGIA 4NXYA 3CP8A 5GV7A 1CPSA 3R96A 5HZBA 5HKKA 4LBVA 2ZZEA 1P4NA 2VBVA 4C0SA 2AFXA 2A4NA 3C26A 1W87A 4RN7A 3CP2A 3OPOA 5IB9A 3LO8A 1WU8A 2Q4YA 3JVNA 4WQMA 2I00A 5THXA 2NYQA 1K9MD 1SKQA 2PJ6A 2P6FA 3KHXA 4LQGA 1UMKA 2QA4B 4KOWA 1KUVA 2G3TA 2R9VA 1QVGB 4PXDA 2C77A 1KMHA 1Q7LA 2PMDA 3ASQA 4LBYA 4UEEA 1KZLA 3GQBA 3RNZA 4B12A 2JDDA 2PJAA 2GJPA 4R8FA 1LRZA 1Z9UA 1Y9KA 2YWHA 1WP6A 1T5EA 3SJZA 5THWA 1BLIA 4P2NA 2HV2A 1EFRA 4P1VA 1S60A 2OR4A 4UCNA 4P45A 3R6JA 4IF5A 1TXRA 1VQLB 3SHPA 2VJJA 4PSWA 3TT2A 3L2NA 1E1RA 2XEIA 3R95A 2XOKA 2PDOA 1JNYA 2CY2A 4RD1A 2YWEA 4R71A 3HLPA 1ZM2A 5EMNA 4B5OA 3W2GA 3JQPA 3EY5A 2EO8A 2KCWA 5F4OA 3FYNA 4II9A 1IICA 5JPHA 4QC6A 4G7WA 4BPRA 2JBJA 5BSXA 2X3UA 4RCZA 3B78A 2QTLA 4TMZA 1M90D 2ZOGA 3BC9A 3PP9A 4KOYA 1V0FA 4FN5A 1VQMB 2D4OA 2ZEPA 1JQGA 1QFZA 2PVWA 4OPSA 2V8DA 4KLVA 2V7TA 4RS2A 4FWUA 3PUNA 4L8AA 5KTDA 4XLEA 4BD9A 4UZFA 3KI9A 5EBVA 4M1KA 4CGLA 3SJGA 2WSAA 2C6GA 1VQPB 3QAHA 3CMEB 2P0WA 3NH5A 2ODFA 3JU4A 5LYFA 4X8IA 4NNJA 3PB8X 2NMTA 3S9NA 1CX8A 2WSSA 1TIQA 4MCSA 3KGQA 1V5VA 4YHBA 2J7KA 1AYEA 4P10A 5CBMA 1ON0A 4UIBA 1KK3A 4NGPA 3KHZA 1R5BA 5AG7A 2J8RA 1GHEA 1QSMA 3CPAA 4CS0B 4XPDB 3GKRA 2OK8A 4OAEA 4KVXA 5HVGA 1WOSA 4OOXA 2F8HA 3GYAA 3FVLA 1NB9A 2WJVA 4B6ZA 1ELMP 4ZGYB 3FNCA 1B87A 2GREA 1K4JA 4B11A 2HDNB 5LRGA 1VJSA 2ZW6A 4AVCA 3I1FA 4UBRA 4C2ZA 4OP7A 3ZZ0A 1M1KD 4UEFA 2FIAA 1OGJA 2ZOFA 1I1DA 3R9EA 4ZI6A 1Z5RA 2OU2A 1E1QA 4XR6A 1KK0A 1PJ6A 3D7GA 3ASPA 1KQSB 2CW5A 3D66A 3OJXA 4HKFA 4B14A 2IQ6A 4H6UA 1N06A 1P4MA 1YW6A 2PIYA 3PBBA 4L89A 1MJ9A 3EC4A 3Q38A 3ISZA 4B4DA 1BX1A 2XGJA 4U5YA 4OMEA 1S5KA 4QFMA 8CPAA 3FEEA 3JQQA 5H59A 1KTVA 3PFEA 4P4FA 5IYNA 3CCRB 1GAQA 1LOKA 1X10A 4M6IA 5G22A 3RAMA 4OPOA 4OC1A 1TF9A 1XRYA 4P6YA 1RQRA 1Y9WA 2B7CA 2BEIA 4MI4A 5CPAA 2DCUA 4RD6A 2ANPA 2H5MA 3BJ7A 3QNVA 5KNLA 4PXEA 2WPWA 3EXNA 4OKOA 3OOCA 2ARHA 3KASA 2CNTA 2EUIA 5JQ4A 3QSYA 3Q39A 2Q7SA 5KSWB 2X6XA 3PRTA 1YJWB 2ZENA 4XNFA 4QVJA 4KLWA 3TX8A 4F8ZA 3BH4A 4B5PA 1EP3B 4ZV4A 1VQKB 3IU1A 3P2FA 5TV2A 1EE3P 3PB4X 3QFRA 2D3LA 4Y7CA 1VKCA 4JXQA 2DPTA 1FNOA 3AVVA 1EP1B 4KSAA 4NJQA 2ABZA 4A95A 2Q6IA 3OZUA 4UZEA 3P2HA 2E1RA 5B6IA 2Z3PA 1HA3A 3CC2B 2YNDA 4UFVA 4MY0A 2PJ4A 2PLFA 3ZBUA 3MMPA 3KR4A 3BI1A 2JN9A 5ISVA 1MABA 2DERA 2Q7BA 2JIZA 4PSXA 2B3VA 4B3XA 4II2A 5FL7A 3WYAA 1ELOA 3S6FA 4CAVA 2XZOA 1IJFA 5I0CA 4M6HA 1ARMA 2X85A 2K5TA 4MJ8A 1RTQA 2RC4A 2QN6A 4XPDC 4U9UA 5J8FA 1I7PA 1Y7EA 1K28D 4YGOA 4II3A 2V8GA 2BMWA 1E63A 4RLZA 4X05A 4KKUA 2PIZA 2X7BA 3VO2A 1W35A 3T8WA 2AFUA 1FNDA 3CXPA 4G1BA 1ZG9A 2FL4A 4OC2A 4RUHA 4Q7JB 4Z1MA 2GE3A 3BQJA 2J9AA 5IX3A 4QV2A 4OOVA 1Y0YA 4JXRA 3SEJA 1V0EA 3JQRA 3VR6A 5G20A 1QFJA 1S4MA 5A28A 1AMPA 4XNHB 5KTAA 2Z3KA 4PXBA 3IO1A 1I8DA 3SJFA 1IYLA 4FD4A 1VLOA 3CC4B 1PJ7A 3I3GA 3I1UA 3DR6A 4ZY2A 2VQYA 4R87A 4Y9UA 3IIBA 4Q38A 1Q7YD 4CAFA 3AVUA 2ZEOA 2J8MA 4MMOA 4R9MA 4Z4ZA 4R57A 4Z4RA 2VI7A 4AF6A 1KUXA 4YALA 4MFQA 1VHEA 1KK2A 2VYQA 2WZPP 3KR5A 3J81k 4R3KA 3CPWB 1Q2CA 4CYOA 1FX0A 3DR8A 1YREA 3AVYA 3VH9A 2D9RA 3G8WA 2V8VA 4B43A 4PC6A 1LANA 3KQXA 4XLHA 5HXDA 3OAAA 1EFCA 4YAUA 4HE5A 3PEIA 2D74A 3I55B 4G1VA 4MY3A 3MN8A 1E3ZA 1ZUNB 3GIRA 4A32A 4C2YA 1YITB 3TOBA 4HPSA 2JBKA 4GQNA 2HMAA 1IJEA 4X0CA 4X7EA 4QUZA 1FT7A 2IMOA 4MHDA 1XEBA 3IWGA 2CXAA 4TSFA 4N3NA 3LQEA 4PXCA 3WR7A 3CPXA 2WPXA 1FNCA 4Y9RA 4Z4WA 4PK3A 2O4HA 4RPBA 2FXFA 2VBQA 3QB8A 5G1ZA 5D8NA 4JD6A 3VWDA 4MFPA 4RDLA 2PJ1A 3WNCA 3F5BA 4YXWA 3T51B 2EWBA 4PQAA 1YK3A 2X8KA 4PC1A 4A37A 1CPXA 4RDJA 4Z4SA 1CNEA 2HC9A 3QFSA 1YX0A 4NGQA 3TC8A 4YEJA 2ZZQA 5F48A 1T6YA 4QUSA 1XQBA 4BMHA 1KRHA 4N3GA 2GIVA 4KOTA 3VARA 3BJ8A 2V31A 3CB4A 2VL1A 4ZCMA 2GFQA 1LFWA 3N5FA 2GJKA 3WBJA 4A31A 3P27A 4K30A 3FJOA 4LX9A 4B48A 4Q36A 2B5GA 1JA0A 2GU2A 1BAVA 5CNPA 3NFZA 2GJRA 1S7FA 3D2MA 3NE8A 4J0QA 5DWMA 1SKYB 3GIUA 1IGBA 1YLEA 2ZPAA 4OOSA 2V8HA 4UCPA 2V77A 3MHPA 2XEJA 2V7WA 4XD7A 1F2PA 1N71A 1Z4RA 3H4QA 4XNHC 4DYOA 4XKWA 2C6PA 1IY7A 2V7VA 4HNWB 2NSMA 4MHPA 1OBRA 3CCVB 2POKA 1CM0A 3FJUA 2AHOA 4P26A 3WC5A 3VO1A 4Z4VA 4ZX8A 4AVZA 5JBQA 4XOPA 2VZYA 2ZEGA 1D8TA 3V38A 4KSFA 1UD2A 4ZBGA 3W5VA 2Q6OA 3B8GA 4XPLA 2YWGA 2XEGA 1WORA 1KUYA 2DXQA 1M4LA 1X12A 3B7IA 7CPAA 4YU9A 4CYQA 3CCLB 2ZEMA 4X07A 4ZX9A 4TT3A 1H8LA 3T90A 2FIWA 2ZBUA 5LRJA 1EFTA 3KKWA 1IYKA 4MXUA 1OB0A 2ZEHA 2I3CA 1H85A 1SM4A 4R76A 5TRDA 5BSYA 1OB5A 4R3LA 4BINA 1F2OA 4OADA 4ACBA 3DSBA 1XOVA 3G6EB 1ZO0A 2PJ2A 4P6VF 4RD0A 3PA2A 2BV3A 1LCPA 3A8IA 1QSTA 3H8EA 2Q4ZA 4XMYA 1KD1D 1G7SA 3MRUA 4F6AA 2ZTGA 4QHYA 5F47A 3FKSA 2PIAA 2B5OA 1BPNA 1ZM3A 3D7HA 2OZHA 3D4UA 4XN3A 3G4SB 3LVBA 4HIZA 3E1YE 5FNZA 3WT4A 1Q9SA 4P25A 1JJ2B 4RPDA 2QJ8A 1R43A 3GVKA 3BY1A 3VWEA 5E6TA 1WTHD 4GM5A 4OC3A 4B47A 1N08A 3FB3A 4AG9A 1YGHA 4CAXA 4W9YA 3G05A 2BUEA 1QSOA 2XEFA 3NH4A 2AFWA 1CBXA 2B4DA 3W6SA 3WC7A 4KVME 2PJBA 1TTTA 3W6XA 2GPJA 3B2YA 3CW2A 2V7UA 2HUZA 2R98A 2XNCA 3D26A 3FEDA 4C2XA 1HVXA 2G0BA 1E3XA 4EH1A 1TKHA 3ZZUA 4FWTA 2DEAA 4X06A 2QTZA 4R7MA 4UAJA 1Z8WA 3E0KA 1YR0A 2OTLB 1T6XA 4A30A 3T53B 2BSWA 1BX0A 4MFZA 3FX6A 4AC9A 4XM3A 4NBSA 1FNMA 3GVLA 4YRHA 3NH8A 4C7HA 2DETA 3G71B 4H2KA 2C6CA 3LQ6A 2C2WA 2Z6BD 2RFHA 4E0FA 2VNKA 1D2EA 2EFGA 2JDCA 2Q6LA 3G3SA 5JGFA 1FY7A 5HVHA 1YMEA 2PR8A 3CXSA 1GAWA 5ELYA 2ZELA 3B3VA 3Q3AA 2OBRA 4XLCA 3IJ3A 1W0KA 1TLLA 4YAWA 4ZGQB 4GS4A 2OBTA 2YNCC 2YWFA 4LBWA 4YAFA 4MFKA 3BI0A 1QQ9A 2BM1A 2QECA 3D2PA 5A88A 2PJ7A 1QVFB 3ES9A 1VQ5B 4P44A 4UIAA 5FA6A 4MYUA 1N07A 3V76A 4KZTA 4FD7A 3IFEA 4NGNA 1HEEA 2V7QA 1GR1A 3ISXA 3PB7X 4U9YA 3OW2B 3T9YA 2HB6A 1ZM4A 2BF4A 1VQNB 3OEEA 2CRVA 4LBZA 3KZWA 1IB1E 5HMNA 3DNSA 4EVYA 2VXKA 2ZTNA 2XNJA 3W5UA 3A8KA 1CJWA 4TMTA 5AGEA 4K1XA 2C1CA 5TY0A 1KZFA 4ONUA 2GLFA 5K8PA 1W34A 3WXMA 1QFYA 3A3BA 4H6ZA 2BVNA 3K9TA 1BJKA 5IYPA 1XMTA 3RBUA 2JEWA 3CCMB 1Z2LA 4DUKA 3ZPNA 4CAEA 3ZC3A 5LYIA 2C78A 3U2QA 4KSIA 4XLAA 4M85A 2CTBA 4A2ZA 2Z3OA 4EFDA 4XONA 2Z11A 3R9GA 1EFUA 3A35A 4HE6A 1S3ZA 2C4UA 1U2RA 2XZPA 1BO4A 3WNBA 3TFYA 4TN1A 3U6KA 2NPFA 4WZKA 5J1QA 1Q82D 2QMLA 5BWAB 1Y0RA 2X6WA 5A27A 2B3UA 3WBKA 2O53A 2W6IA 2JJ2A 5C82A 2RB7A 4ACAA 4FAIA 3D3SA 3ZUGA 5LMZA 1CQXA 4M3SA 4L8JA 3DDYA 2ZEFA 1CP6A 5EMIA 4XOTA 1N8RD 3JRUA 2W6JA 3DGVA 1VGYA 3ZJ0A 3I56B 2C4TA 3H9NA 4QVTA 3OJWA 3PA1A 1GVHA 3OW7A 4KUAA 4Y49B 5I4MA 3RY8A 2AFOA 3RO0A 3OEHA 1R5NA
chains in the Genus database with same CATH topology
2O4HA 1QMUA 2PJAA 4R8FA 5D8NA 4UEZA 2PJ1A 5THWA 3SJEA 5JM6A 3PFOA 2EWBA 4PQAA 2OR4A 3SI0A 4P45A 4A37A 2PJCA 1CPXA 1TXRA 4K3NA 2HC9A 3L2NA 4NGQA 3TC8A 5K8OA 2XEIA 4FBEA 3VARA 2VL1A 3PB6X 3FMCA 4Q7AA 4YWYA 1LFWA 3B3TA 4MHZA 3HLPA 2AFMA 3D7FA 3N5FA 4ZYQA 2BOAA 1ZG8A 1DTDA 4TNUA 3SJXA 2EK8A 2GU2A 1TKFA 1BAVA 4WJBA 2JBJA 3NFZA 4R6TA 2ZOGA 4AXVA 2CIJA 1IGBA 1JQGA 2ZEPA 4OP4A 2WYRA 2PVWA 2V8HA 3WC6A 4A39A 2V8DA 2V77A 2XEJA 3D68A 4PPZA 1F2PA 4FWUA 3GUXA 4DYOA 4BD9A 2C6PA 1IY7A 3KI9A 4MHPA 2NSMA 1OBRA 1XJOA 3SJGA 2POKA 1NSAA 3FJUA 2C6GA 2GLJA 3NH5A 2IJZA 3WC5A 3B3CA 5LYFA 4X8IA 3PB8X 4ZX8A 3S9NA 1CX8A 4MCSA 3KGQA 1YLOA 1YSJA 2PRQA 2ZEGA 3V38A 4P4DA 1AYEA 4P10A 3B3WA 5CBMA 4UIBA 4NGPA 2XEGA 3KHZA 3WABA 3KQZA 1M4LA 1LAMA 3B7IA 4JZ0A 7CPAA 4YU9A 4WWVA 2ZEMA 4ZX9A 1H8LA 3CPAA 3CT9A 1PYTB 1R3NA 5LRJA 4MXUA 3VATA 5HVGA 2ZEHA 2I3CA 4R76A 2F8HA 4OIDA 4NFRA 3FVLA 4B6ZA 1XBUA 1ELMP 1F2OA 1F57A 2GREA 3SI1A 5LRGA 2PJ2A 1LCPA 1BLLE 3FH4A 3H8EA 2Q4ZA 6CPAA 3MRUA 4EMEA 4UEFA 1KWMA 1XFOA 2PVVA 1GYTA 2ZOFA 4ZI6A 1YW4A 1Z5RA 4IHMA 5D29A 4MHYA 1BPNA 3D7HA 5HVFA 3D4UA 1ZG7A 3D7GA 3WT4A 3D66A 4MHNA 5JH9A 2IQ6A 2QJ8A 1R43A 4EWTA 4A94A 2AFSA 3GLJA 4DJLA 4GM5A 4P4IA 4OC3A 1YW6A 2PIYA 1HDQA 3B3SA 3PBBA 3ISZA 4MCRA 1TF8A 3D67A 4OMEA 4W9YA 8CPAA 3CDXA 4OIWA 3FEEA 2XEFA 3NH4A 2AFWA 5LYLA 1CBXA 3WC7A 2PJBA 3PFEA 4P4FA 3B2YA 1LOKA 2Q51A 3RAMA 4OC1A 2EK9A 4CPAA 1TF9A 2OOTA 1XRYA 4P6YA 3FEDA 5DS0A 2CTCA 4MCPA 5CPAA 1ZLIA 4JYWA 4P4EA 1TKHA 2ANPA 3QNVA 4PXEA 2DEAA 4R7MA 3S9MA 4OKOA 3KASA 1CP7A 2PE3A 3PRTA 3LWUA 3FX6A 4ZY1A 2ZENA 3BXMA 1ZLHA 5LYDA 3TX8A 3LMSA 4P4BA 4F8ZA 3NH8A 4X3RA 3B35A 4H2KA 1EE3P 2C6CA 3PB4X 2PJ0A 2RFHA 4NGRA 4NGSA 3PB9X 2PJ9A 1FNOA 5JGFA 1LAPA 1YMEA 2BCOA 3RZAA 5HVHA 3IWWA 4NJQA 5ELYA 2ABZA 4UF4A 2ZELA 3D7DA 3B3VA 2QYVA 3FF3A 4A38A 1CG2A 2F7VA 4ZY0A 3IJ3A 4O23A 1BPMA 4F9UA 5K8NA 2PJ4A 4F9VA 3KR4A 3BI1A 2WZNA 1DE4C 3BI0A 3V7ZA 3DLJA 1QQ9A 4ONWA 5F09A 3KL9A 2PJ7A 3S9LA 4P44A 4UIAA 2Q43A 1ARMA 1UWYA 3NA6A 3BHXA 1RTQA 4NGTA 1Y7EA 3IFEA 4NGNA 1HEEA 2V8GA 4OC0A 3K2KA 3ISXA 3PB7X 1HDUA 2PIZA 2HB6A 4FUUA 2QVPA 3T8WA 2AFUA 4X2TA 4OC5A 4OC2A 1ZG9A 4RUHA 3KZWA 4TWEA 2J9AA 4Z65A 4P4JA 1Y0YA 4NGMA 1ARLA 4IK2A 2C1CA 4IAVA 1Z8LA 1AMPA 4PXBA 2GLFA 5K8PA 3IO1A 4MRIA 3SJFA 3FECA 5LRKA 3I1UA 3K9TA 4ZY2A 3IC1A 1VIXA 2FVGA 3IIBA 3RBUA 2JEWA 1Z2LA 4DUKA 2ZEOA 2PJ8A 3H8GA 4NJRA 2CF4A 5LYIA 2ZEDA 1XMBA 4MMOA 4KSIA 3SI2A 4OC4A 2CTBA 2BO9A 4MCQA 4EFDA 2PCUA 1VHEA 3KR5A 1CPSA 3VH9A 1VHOA 2V8VA 2PJ3A 3HUVA 4G1PA 5K8MA 1LANA 3KQXA 5J1QA 5HXDA 2ZEEA 1Y0RA 3PBEA 3PEIA 2O53A 2AFXA 3MN8A 2RB7A 2PJ5A 4FAIA 3IEHA 1PCAA 2JBKA 5IB9A 3H8FA 2ZEFA 1CP6A 3GB0A 2G9DA 2NYQA 2PJ6A 3JRUA 3KHXA 4LQGA 3DGVA 1VGYA 1FT7A 2AFZA 2IMOA 4PXDA 1Q7LA 4PXCA 3CPXA 1TKJA 4UEEA 5I4MA 2AFOA 1ELLP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4H A;  1QMU A;  2PJA A;  4R8F A;  5D8N A;  4UEZ A;  2PJ1 A;  5THW A;  3SJE A;  5JM6 A;  3PFO A;  2EWB A;  4PQA A;  2OR4 A;  3SI0 A;  4P45 A;  4A37 A;  2PJC A;  1CPX A;  1TXR A;  4K3N A;  2HC9 A;  3L2N A;  4NGQ A;  3TC8 A;  5K8O A;  2XEI A;  4FBE A;  3VAR A;  2VL1 A;  3PB6 X;  3FMC A;  4Q7A A;  4YWY A;  1LFW A;  3B3T A;  4MHZ A;  3HLP A;  2AFM A;  3D7F A;  3N5F A;  4ZYQ A;  2BOA A;  1ZG8 A;  1DTD A;  4TNU A;  3SJX A;  2EK8 A;  2GU2 A;  1TKF A;  1BAV A;  4WJB A;  2JBJ A;  3NFZ A;  4R6T A;  2ZOG A;  4AXV A;  2CIJ A;  1IGB A;  1JQG A;  2ZEP A;  4OP4 A;  2WYR A;  2PVW A;  2V8H A;  3WC6 A;  4A39 A;  2V8D A;  2V77 A;  2XEJ A;  3D68 A;  4PPZ A;  1F2P A;  4FWU A;  3GUX A;  4DYO A;  4BD9 A;  2C6P A;  1IY7 A;  3KI9 A;  4MHP A;  2NSM A;  1OBR A;  1XJO A;  3SJG A;  2POK A;  1NSA A;  3FJU A;  2C6G A;  2GLJ A;  3NH5 A;  2IJZ A;  3WC5 A;  3B3C A;  5LYF A;  4X8I A;  3PB8 X;  4ZX8 A;  3S9N A;  1CX8 A;  4MCS A;  3KGQ A;  1YLO A;  1YSJ A;  2PRQ A;  2ZEG A;  3V38 A;  4P4D A;  1AYE A;  4P10 A;  3B3W A;  5CBM A;  4UIB A;  4NGP A;  2XEG A;  3KHZ A;  3WAB A;  3KQZ A;  1M4L A;  1LAM A;  3B7I A;  4JZ0 A;  7CPA A;  4YU9 A;  4WWV A;  2ZEM A;  4ZX9 A;  1H8L A;  3CPA A;  3CT9 A;  1PYT B;  1R3N A;  5LRJ A;  4MXU A;  3VAT A;  5HVG A;  2ZEH A;  2I3C A;  4R76 A;  2F8H A;  4OID A;  4NFR A;  3FVL A;  4B6Z A;  1XBU A;  1ELM P;  1F2O A;  1F57 A;  2GRE A;  3SI1 A;  5LRG A;  2PJ2 A;  1LCP A;  1BLL E;  3FH4 A;  3H8E A;  2Q4Z A;  6CPA A;  3MRU A;  4EME A;  4UEF A;  1KWM A;  1XFO A;  2PVV A;  1GYT A;  2ZOF A;  4ZI6 A;  1YW4 A;  1Z5R A;  4IHM A;  5D29 A;  4MHY A;  1BPN A;  3D7H A;  5HVF A;  3D4U A;  1ZG7 A;  3D7G A;  3WT4 A;  3D66 A;  4MHN A;  5JH9 A;  2IQ6 A;  2QJ8 A;  1R43 A;  4EWT A;  4A94 A;  2AFS A;  3GLJ A;  4DJL A;  4GM5 A;  4P4I A;  4OC3 A;  1YW6 A;  2PIY A;  1HDQ A;  3B3S A;  3PBB A;  3ISZ A;  4MCR A;  1TF8 A;  3D67 A;  4OME A;  4W9Y A;  8CPA A;  3CDX A;  4OIW A;  3FEE A;  2XEF A;  3NH4 A;  2AFW A;  5LYL A;  1CBX A;  3WC7 A;  2PJB A;  3PFE A;  4P4F A;  3B2Y A;  1LOK A;  2Q51 A;  3RAM A;  4OC1 A;  2EK9 A;  4CPA A;  1TF9 A;  2OOT A;  1XRY A;  4P6Y A;  3FED A;  5DS0 A;  2CTC A;  4MCP A;  5CPA A;  1ZLI A;  4JYW A;  4P4E A;  1TKH A;  2ANP A;  3QNV A;  4PXE A;  2DEA A;  4R7M A;  3S9M A;  4OKO A;  3KAS A;  1CP7 A;  2PE3 A;  3PRT A;  3LWU A;  3FX6 A;  4ZY1 A;  2ZEN A;  3BXM A;  1ZLH A;  5LYD A;  3TX8 A;  3LMS A;  4P4B A;  4F8Z A;  3NH8 A;  4X3R A;  3B35 A;  4H2K A;  1EE3 P;  2C6C A;  3PB4 X;  2PJ0 A;  2RFH A;  4NGR A;  4NGS A;  3PB9 X;  2PJ9 A;  1FNO A;  5JGF A;  1LAP A;  1YME A;  2BCO A;  3RZA A;  5HVH A;  3IWW A;  4NJQ A;  5ELY A;  2ABZ A;  4UF4 A;  2ZEL A;  3D7D A;  3B3V A;  2QYV A;  3FF3 A;  4A38 A;  1CG2 A;  2F7V A;  4ZY0 A;  3IJ3 A;  4O23 A;  1BPM A;  4F9U A;  5K8N A;  2PJ4 A;  4F9V A;  3KR4 A;  3BI1 A;  2WZN A;  1DE4 C;  3BI0 A;  3V7Z A;  3DLJ A;  1QQ9 A;  4ONW A;  5F09 A;  3KL9 A;  2PJ7 A;  3S9L A;  4P44 A;  4UIA A;  2Q43 A;  1ARM A;  1UWY A;  3NA6 A;  3BHX A;  1RTQ A;  4NGT A;  1Y7E A;  3IFE A;  4NGN A;  1HEE A;  2V8G A;  4OC0 A;  3K2K A;  3ISX A;  3PB7 X;  1HDU A;  2PIZ A;  2HB6 A;  4FUU A;  2QVP A;  3T8W A;  2AFU A;  4X2T A;  4OC5 A;  4OC2 A;  1ZG9 A;  4RUH A;  3KZW A;  4TWE A;  2J9A A;  4Z65 A;  4P4J A;  1Y0Y A;  4NGM A;  1ARL A;  4IK2 A;  2C1C A;  4IAV A;  1Z8L A;  1AMP A;  4PXB A;  2GLF A;  5K8P A;  3IO1 A;  4MRI A;  3SJF A;  3FEC A;  5LRK A;  3I1U A;  3K9T A;  4ZY2 A;  3IC1 A;  1VIX A;  2FVG A;  3IIB A;  3RBU A;  2JEW A;  1Z2L A;  4DUK A;  2ZEO A;  2PJ8 A;  3H8G A;  4NJR A;  2CF4 A;  5LYI A;  2ZED A;  1XMB A;  4MMO A;  4KSI A;  3SI2 A;  4OC4 A;  2CTB A;  2BO9 A;  4MCQ A;  4EFD A;  2PCU A;  1VHE A;  3KR5 A;  1CPS A;  3VH9 A;  1VHO A;  2V8V A;  2PJ3 A;  3HUV A;  4G1P A;  5K8M A;  1LAN A;  3KQX A;  5J1Q A;  5HXD A;  2ZEE A;  1Y0R A;  3PBE A;  3PEI A;  2O53 A;  2AFX A;  3MN8 A;  2RB7 A;  2PJ5 A;  4FAI A;  3IEH A;  1PCA A;  2JBK A;  5IB9 A;  3H8F A;  2ZEF A;  1CP6 A;  3GB0 A;  2G9D A;  2NYQ A;  2PJ6 A;  3JRU A;  3KHX A;  4LQG A;  3DGV A;  1VGY A;  1FT7 A;  2AFZ A;  2IMO A;  4PXD A;  1Q7L A;  4PXC A;  3CPX A;  1TKJ A;  4UEE A;  5I4M A;  2AFO A;  1ELL P; 
#chains in the Genus database with same CATH topology
 3TOA A;  4DK0 A;  4CAW A;  1QMU A;  4TKO B;  1QSR A;  3JUW A;  1PU9 A;  4JLY A;  1L0C A;  2XND A;  3SJE A;  5JM6 A;  5E96 A;  2PJC A;  1F20 A;  4K3N A;  5FVJ A;  4Z4Y A;  3E20 A;  5K8O A;  1VQ8 B;  1M4I A;  4F0Y A;  2BSA A;  3FMC A;  4Q7A A;  3B3T A;  4MHZ A;  2X6Y A;  1NBM A;  4PK2 A;  1QGZ A;  2AJ6 A;  2BOA A;  4WZT A;  4TNU A;  3SJX A;  2REF A;  3SXN A;  1QGY A;  2EK8 A;  3OZW A;  4R6T A;  4X7D A;  4AXV A;  2Z10 A;  1OHH A;  2CIJ A;  1HZE A;  4RCY A;  3QFT A;  1E62 A;  3ZZT A;  3F8K A;  2F4N A;  3WC6 A;  1W9X A;  4AVB A;  1XE4 A;  4PPZ A;  4X7F A;  1JB9 A;  4KKT A;  3SXO A;  4MBU A;  1NE9 A;  1TUI A;  2GLJ A;  4KS9 A;  1S7N A;  3B3C A;  3LOD A;  3AVX A;  4JWP A;  4KOR A;  1YJN B;  1FDR A;  1JWQ A;  3ASS A;  5F4J A;  3FPK A;  4B3G A;  3H94 A;  4C43 A;  1H42 A;  2BM0 A;  4MFJ A;  1BPL A;  4XL9 A;  2Q04 A;  2REE A;  2RC5 A;  3TCV A;  3N7Z A;  4LQ6 A;  3I9S A;  1PYT B;  3BCF A;  1R3N A;  1Z4E A;  3SLN A;  4RD2 A;  1Z8X A;  4RJL A;  2KVO A;  4XPK A;  3TO6 A;  4NFR A;  3B8H A;  3CMA B;  3A3G A;  1QH0 A;  2I1L A;  1E79 A;  2IL4 A;  1F57 A;  2ZZF A;  3S6H A;  4CGO A;  1UD6 A;  1DDG A;  1WSV A;  2CND A;  2BPO A;  1BMF A;  5AG6 A;  1KJZ A;  3GY9 A;  1OZP A;  2JJ1 A;  2FT0 A;  2Q6K A;  1I21 A;  2BL1 A;  4EME A;  1KWM A;  1XFO A;  1GYT A;  4RDK A;  2V7X A;  3VMF A;  3TE4 A;  4MHY A;  4B13 A;  5HVF A;  3ZIA A;  1YI2 B;  4NCN A;  1ZG7 A;  3CXC B;  4Y49 C;  4RD3 A;  2P6G A;  4MHN A;  4MYT A;  2VNI A;  5JH9 A;  1KC8 D;  1G7R A;  3JTK A;  4A94 A;  2AFS A;  3W2H A;  4P4I A;  1HDQ A;  3CCS B;  2DOG A;  1Y7R A;  3NE7 A;  1TF8 A;  4KKS A;  3D67 A;  1IU8 A;  1ZM9 A;  2I79 A;  3CDX A;  4OIW A;  2B4B A;  5LYL A;  2Z3M A;  3CCQ B;  4UWI A;  2ZZG A;  3OE7 A;  2ZBV A;  2ZL5 A;  2F5I A;  4MFL A;  2Q51 A;  2EK9 A;  4CPA A;  5DS0 A;  4PGO A;  2C5B A;  3V7A A;  2YGW A;  4MCP A;  4QBJ A;  1CNF A;  1J4J A;  1WPC A;  4JYW A;  5AG4 A;  4HNY B;  3OZV A;  1K73 D;  5A89 A;  3CZX A;  4B44 A;  1GO2 A;  2PE3 A;  3LWU A;  5FO0 A;  5IYW A;  4ZY1 A;  4KUB A;  5HH1 A;  2D4P A;  4QB9 A;  3AVW A;  4U9Z A;  4PAB A;  3LMS A;  4P4B A;  4WZL A;  4X3R A;  3B35 A;  1K8A D;  4PV6 A;  5EC4 A;  1R57 A;  4CRZ B;  4AVA A;  3PGP A;  3CCJ B;  2VNJ A;  4UWJ A;  3BLN A;  5GCN A;  4CGM A;  2HLD A;  1M1D A;  2PJ9 A;  1YX2 A;  1FRN A;  1LAP A;  2BCO A;  2OZU A;  1YHQ B;  3RZA A;  2F1L A;  1PJ5 A;  3AVT A;  3R6K A;  4X5K A;  5DN6 A;  5IB0 A;  3FF3 A;  1H8H A;  2VNH A;  1YVO A;  3T56 B;  3LAC A;  3UY5 A;  2WPD A;  4DQL A;  2QMU A;  3W91 A;  4F9U A;  4F9V A;  4TMX A;  1N0U A;  2EVN A;  3ASR A;  4PC3 A;  1DE4 C;  2P6E A;  3V7Z A;  1G7C A;  4M2L A;  3KL9 A;  2O28 A;  4UA3 A;  3S9L A;  2CK3 A;  5H84 A;  2FSR A;  2Q43 A;  4AG7 A;  1S7K A;  1E43 A;  4XN0 A;  5CDF A;  1YIJ B;  4NGT A;  2CNS A;  1YQE A;  2GK7 A;  4I49 A;  5H5J A;  3F0A A;  2ZXI A;  3P26 A;  2DYI A;  3W2F A;  1HDU A;  4E2A A;  4H9G A;  4FUU A;  2E1B A;  3PZJ A;  4X2T A;  1NDH A;  2VBS A;  1NRK A;  3RYO A;  4OC5 A;  1S72 B;  2Y0M A;  1S7L A;  1WWZ A;  4CGN A;  1QUE A;  2WUU A;  2QEX B;  4P4J A;  4M53 A;  4ZGN B;  5C88 A;  1Q81 D;  4IK2 A;  3WQZ A;  5HZA A;  1IOF A;  1R5O A;  2C5H A;  4NF1 A;  2DIE A;  4P3Y A;  1B6B A;  3SJP A;  4GXH A;  2M5S A;  3A1P A;  3V8I A;  4ORF A;  4E8O A;  1IB0 A;  2LZJ A;  3S6K A;  4KOU A;  4B3F X;  2PJ8 A;  1FNB A;  3H8G A;  3H5Z A;  2CF4 A;  4PC7 A;  4NJR A;  2ZED A;  1XMB A;  2EBJ A;  5A8A A;  3A8J A;  2HCJ B;  4OC4 A;  3W5H A;  2J8N A;  1UD4 A;  2PCU A;  2QE7 A;  1DG1 G;  4H89 A;  4UFX A;  1Q2Y A;  3CES A;  1T6Z A;  1W2B B;  4AF7 A;  4ASU A;  2YNC A;  1H8E A;  1XE1 A;  1VHO A;  2FX3 A;  2PJ3 A;  3HUV A;  2D3N A;  4G1P A;  5K8M A;  4JJX A;  2ZEE A;  3K9U A;  1B23 P;  3PBE A;  3IU2 A;  4XLF A;  1MK4 A;  5KW9 A;  1QUF A;  4JMQ A;  2OZG A;  2PJ5 A;  3AGQ A;  3IEH A;  2ZW5 A;  4B5P B;  4IUS A;  1PCA A;  3H8F A;  3OWC A;  4P9S A;  2X53 S;  3GB0 A;  3FXT A;  3PUM A;  2G9D A;  2AFZ A;  1COW A;  4TMV A;  4X7C A;  4Z4U A;  1IID A;  1XIX A;  2OTJ B;  1VLY A;  4TMW A;  4XKV A;  2CNM A;  4OLL A;  3OP1 A;  3R9F A;  4F0X A;  1TKJ A;  4CYP A;  1ELL P;  1M44 A;  2QDX A;  1DDI A;  2VEZ A;  4DNT B;  2Z3L A;  2VZL A;  1UD8 A;  5FIU A;  2R6H A;  5AN9 A;  1A8P A;  3S6G A;  1W0J A;  2R7H A;  1TVC A;  2F43 A;  4KOS A;  3CC7 B;  4UEZ A;  5IYQ A;  4E0A A;  4FD6 A;  4C7I A;  2XEX A;  2Q4V A;  2ATR A;  3MGD A;  2HQY A;  3QE2 A;  3PFO A;  1B2R A;  3SI0 A;  4CYN A;  5F4M A;  3IWE A;  4UCM A;  4G7X A;  2F1M A;  3PEN A;  5L46 A;  2G3A A;  1QSN A;  4HNX B;  4M0L A;  1DAR A;  4DNC A;  4FBE A;  3GSI A;  2DF5 A;  3SLD A;  5J8C A;  1EXM A;  1QX4 A;  3PB6 X;  4YWY A;  1BOB A;  2VJI A;  2AFM A;  3D7F A;  1VF7 A;  4ZYQ A;  2GAN A;  3A9L A;  4YFJ A;  3EO4 A;  1ZG8 A;  1DTD A;  3ZBT A;  2PR1 A;  2PRB A;  1TKF A;  4WJB A;  2DPS A;  4OP4 A;  2WYR A;  3R1K A;  4B10 A;  2BN4 A;  2ZIT A;  4A39 A;  3TO9 A;  2ZXH A;  3AST A;  3D68 A;  4CGP A;  3KEW A;  5HXB A;  3BCD A;  1N05 A;  3ZZI A;  3GUX A;  1AMO A;  2GQF A;  1NJI D;  1XJO A;  2FE7 A;  3CD6 B;  1NSA A;  2IJZ A;  2OK7 A;  4FXU A;  1SQH A;  2VBU A;  3CTA A;  1YLO A;  2BGJ A;  2WR8 A;  4ZCL A;  4M4S A;  2PRQ A;  2QIR A;  1A2Z A;  1YSJ A;  4P4D A;  3BY2 A;  3B3W A;  1EP2 B;  3ONY A;  1RO5 A;  4QVA A;  3WAB A;  4KVO E;  3BNW A;  3KQZ A;  4NEX A;  1LAM A;  4JZ0 A;  1AIP A;  4WWV A;  2Z3N A;  3CT9 A;  1MJB A;  4FK8 A;  2JEV A;  1NMT A;  1XF8 A;  1MJA A;  4NSQ A;  4F7D A;  2Q0Y A;  3VAT A;  3MCA A;  1JA1 A;  4OID A;  1BQE A;  1XBU A;  1KK1 A;  3IGR A;  3WND A;  2PQ8 A;  4KOV A;  3SI1 A;  4XOR A;  3LNN A;  1NB0 A;  1BLL E;  1V0C A;  1OGI A;  3W2E A;  4J3G A;  3FH4 A;  4WZE A;  5DSZ A;  6CPA A;  1Q2D A;  2WJY A;  1WSR A;  3FRM A;  2PVV A;  5J35 A;  2OB0 A;  2VZZ A;  1YW4 A;  4IHM A;  5D29 A;  1WOO A;  3VNV A;  1RQP A;  1M4G A;  4EWT A;  3CMM A;  4FD5 A;  3GLJ A;  4DJL A;  2V4D A;  3ONU A;  4P12 A;  3B3S A;  2CBX A;  2QGG A;  4MCR A;  2AE6 A;  4A33 A;  3B82 A;  3CXQ A;  1QGA A;  1VQ6 B;  2OYN A;  3Q6Q A;  5IK2 A;  3PVD A;  3QFC A;  2X0K A;  3EFA A;  4C68 A;  1VQ9 B;  4P22 A;  1U6M A;  4KOX A;  2OOT A;  3CCU B;  2ZW7 A;  1VQ7 B;  2CTC A;  3AGP A;  4UZU A;  2B5G B;  1ZLI A;  3W2I A;  4P4E A;  4NCZ A;  1J9Z A;  1UFH A;  4OPV A;  3CRZ A;  4P3I A;  2B58 A;  3S9M A;  5FO1 A;  2GK6 A;  2YNE A;  1CP7 A;  3BXM A;  1ZLH A;  5LYD A;  4CRY B;  2VBT A;  2B7B A;  5KTC A;  2PSW A;  4AB7 A;  4DK1 A;  1S0U A;  1UD3 A;  4LC0 A;  1WOP A;  5H86 A;  5IV0 A;  5DWN A;  1I18 A;  3LD2 A;  2PJ0 A;  1N0V C;  2P3M A;  4G5G A;  1M4D A;  1MRZ A;  3OFN A;  4NGR A;  4NGS A;  2JLM A;  1WDT A;  3PB9 X;  3TTH A;  4XQF A;  3FBU A;  3NE5 B;  3IWW A;  4UF4 A;  1NSL A;  3D7D A;  1YVK A;  4PAA A;  2QYV A;  4A38 A;  5AG5 A;  5J3O A;  1CG2 A;  4G6I A;  2F7V A;  4ZY0 A;  1P0H A;  4O23 A;  1BPM A;  5K8N A;  1D1N A;  3VNU A;  5TR9 A;  5F49 A;  3D8P A;  4UFW A;  5IYR A;  2WZN A;  1Q86 D;  5G21 A;  2OH1 A;  2ZL7 A;  4YEL A;  3DLJ A;  4ONW A;  5F09 A;  2DY1 A;  3GVJ A;  2EIX A;  1YJ9 B;  1AUG A;  3QAY A;  1UWY A;  3NA6 A;  5GV8 A;  3BHX A;  3TO7 A;  2JDI A;  4DNR B;  3WY9 A;  2XZL A;  2C27 A;  4DQK A;  1IOI A;  4Z4T A;  4YAO A;  1GJR A;  4OC0 A;  3OKX A;  4RI1 A;  2R1I A;  3K2K A;  2RC6 A;  3Q6R A;  2ZXV A;  4CQJ A;  2ZW4 A;  3HAG A;  2QVP A;  3FIX A;  2R8V A;  4ZCI A;  2DEU A;  2FS5 A;  4TWE A;  1Z8T A;  2FCK A;  3FPP A;  4M6G A;  4Z65 A;  4PC2 A;  1I12 A;  4NGM A;  5F46 A;  1ARL A;  4IW3 B;  1WK4 A;  1VQ4 B;  2CC2 A;  4IAV A;  1RXT A;  1F60 A;  3SKB A;  3U6B A;  1Z8L A;  1XB2 A;  1PUA A;  4RD4 A;  1IHM A;  4ROX A;  1EWY A;  1OB2 A;  1VHS A;  1PKV A;  4LUA A;  4MRI A;  1VQO B;  2PC1 A;  1QG0 A;  4BBH A;  3FEC A;  5LRK A;  4RM0 A;  3IC1 A;  1VIX A;  2FVG A;  2OBS A;  2NV4 A;  1UD5 A;  3CCE B;  2Q44 A;  2B4D B;  1FRQ A;  2Z0Z A;  2ZL6 A;  1G7T A;  3SI2 A;  1E64 A;  2BO9 A;  4MCQ A;  3DDD A;  2BGI A;  4NXY A;  3CP8 A;  5GV7 A;  1CPS A;  3R96 A;  5HZB A;  5HKK A;  4LBV A;  2ZZE A;  1P4N A;  2VBV A;  4C0S A;  2AFX A;  2A4N A;  3C26 A;  1W87 A;  4RN7 A;  3CP2 A;  3OPO A;  5IB9 A;  3LO8 A;  1WU8 A;  2Q4Y A;  3JVN A;  4WQM A;  2I00 A;  5THX A;  2NYQ A;  1K9M D;  1SKQ A;  2PJ6 A;  2P6F A;  3KHX A;  4LQG A;  1UMK A;  2QA4 B;  4KOW A;  1KUV A;  2G3T A;  2R9V A;  1QVG B;  4PXD A;  2C77 A;  1KMH A;  1Q7L A;  2PMD A;  3ASQ A;  4LBY A;  4UEE A;  1KZL A;  3GQB A;  3RNZ A;  4B12 A;  2JDD A;  2PJA A;  2GJP A;  4R8F A;  1LRZ A;  1Z9U A;  1Y9K A;  2YWH A;  1WP6 A;  1T5E A;  3SJZ A;  5THW A;  1BLI A;  4P2N A;  2HV2 A;  1EFR A;  4P1V A;  1S60 A;  2OR4 A;  4UCN A;  4P45 A;  3R6J A;  4IF5 A;  1TXR A;  1VQL B;  3SHP A;  2VJJ A;  4PSW A;  3TT2 A;  3L2N A;  1E1R A;  2XEI A;  3R95 A;  2XOK A;  2PDO A;  1JNY A;  2CY2 A;  4RD1 A;  2YWE A;  4R71 A;  3HLP A;  1ZM2 A;  5EMN A;  4B5O A;  3W2G A;  3JQP A;  3EY5 A;  2EO8 A;  2KCW A;  5F4O A;  3FYN A;  4II9 A;  1IIC A;  5JPH A;  4QC6 A;  4G7W A;  4BPR A;  2JBJ A;  5BSX A;  2X3U A;  4RCZ A;  3B78 A;  2QTL A;  4TMZ A;  1M90 D;  2ZOG A;  3BC9 A;  3PP9 A;  4KOY A;  1V0F A;  4FN5 A;  1VQM B;  2D4O A;  2ZEP A;  1JQG A;  1QFZ A;  2PVW A;  4OPS A;  2V8D A;  4KLV A;  2V7T A;  4RS2 A;  4FWU A;  3PUN A;  4L8A A;  5KTD A;  4XLE A;  4BD9 A;  4UZF A;  3KI9 A;  5EBV A;  4M1K A;  4CGL A;  3SJG A;  2WSA A;  2C6G A;  1VQP B;  3QAH A;  3CME B;  2P0W A;  3NH5 A;  2ODF A;  3JU4 A;  5LYF A;  4X8I A;  4NNJ A;  3PB8 X;  2NMT A;  3S9N A;  1CX8 A;  2WSS A;  1TIQ A;  4MCS A;  3KGQ A;  1V5V A;  4YHB A;  2J7K A;  1AYE A;  4P10 A;  5CBM A;  1ON0 A;  4UIB A;  1KK3 A;  4NGP A;  3KHZ A;  1R5B A;  5AG7 A;  2J8R A;  1GHE A;  1QSM A;  3CPA A;  4CS0 B;  4XPD B;  3GKR A;  2OK8 A;  4OAE A;  4KVX A;  5HVG A;  1WOS A;  4OOX A;  2F8H A;  3GYA A;  3FVL A;  1NB9 A;  2WJV A;  4B6Z A;  1ELM P;  4ZGY B;  3FNC A;  1B87 A;  2GRE A;  1K4J A;  4B11 A;  2HDN B;  5LRG A;  1VJS A;  2ZW6 A;  4AVC A;  3I1F A;  4UBR A;  4C2Z A;  4OP7 A;  3ZZ0 A;  1M1K D;  4UEF A;  2FIA A;  1OGJ A;  2ZOF A;  1I1D A;  3R9E A;  4ZI6 A;  1Z5R A;  2OU2 A;  1E1Q A;  4XR6 A;  1KK0 A;  1PJ6 A;  3D7G A;  3ASP A;  1KQS B;  2CW5 A;  3D66 A;  3OJX A;  4HKF A;  4B14 A;  2IQ6 A;  4H6U A;  1N06 A;  1P4M A;  1YW6 A;  2PIY A;  3PBB A;  4L89 A;  1MJ9 A;  3EC4 A;  3Q38 A;  3ISZ A;  4B4D A;  1BX1 A;  2XGJ A;  4U5Y A;  4OME A;  1S5K A;  4QFM A;  8CPA A;  3FEE A;  3JQQ A;  5H59 A;  1KTV A;  3PFE A;  4P4F A;  5IYN A;  3CCR B;  1GAQ A;  1LOK A;  1X10 A;  4M6I A;  5G22 A;  3RAM A;  4OPO A;  4OC1 A;  1TF9 A;  1XRY A;  4P6Y A;  1RQR A;  1Y9W A;  2B7C A;  2BEI A;  4MI4 A;  5CPA A;  2DCU A;  4RD6 A;  2ANP A;  2H5M A;  3BJ7 A;  3QNV A;  5KNL A;  4PXE A;  2WPW A;  3EXN A;  4OKO A;  3OOC A;  2ARH A;  3KAS A;  2CNT A;  2EUI A;  5JQ4 A;  3QSY A;  3Q39 A;  2Q7S A;  5KSW B;  2X6X A;  3PRT A;  1YJW B;  2ZEN A;  4XNF A;  4QVJ A;  4KLW A;  3TX8 A;  4F8Z A;  3BH4 A;  4B5P A;  1EP3 B;  4ZV4 A;  1VQK B;  3IU1 A;  3P2F A;  5TV2 A;  1EE3 P;  3PB4 X;  3QFR A;  2D3L A;  4Y7C A;  1VKC A;  4JXQ A;  2DPT A;  1FNO A;  3AVV A;  1EP1 B;  4KSA A;  4NJQ A;  2ABZ A;  4A95 A;  2Q6I A;  3OZU A;  4UZE A;  3P2H A;  2E1R A;  5B6I A;  2Z3P A;  1HA3 A;  3CC2 B;  2YND A;  4UFV A;  4MY0 A;  2PJ4 A;  2PLF A;  3ZBU A;  3MMP A;  3KR4 A;  3BI1 A;  2JN9 A;  5ISV A;  1MAB A;  2DER A;  2Q7B A;  2JIZ A;  4PSX A;  2B3V A;  4B3X A;  4II2 A;  5FL7 A;  3WYA A;  1ELO A;  3S6F A;  4CAV A;  2XZO A;  1IJF A;  5I0C A;  4M6H A;  1ARM A;  2X85 A;  2K5T A;  4MJ8 A;  1RTQ A;  2RC4 A;  2QN6 A;  4XPD C;  4U9U A;  5J8F A;  1I7P A;  1Y7E A;  1K28 D;  4YGO A;  4II3 A;  2V8G A;  2BMW A;  1E63 A;  4RLZ A;  4X05 A;  4KKU A;  2PIZ A;  2X7B A;  3VO2 A;  1W35 A;  3T8W A;  2AFU A;  1FND A;  3CXP A;  4G1B A;  1ZG9 A;  2FL4 A;  4OC2 A;  4RUH A;  4Q7J B;  4Z1M A;  2GE3 A;  3BQJ A;  2J9A A;  5IX3 A;  4QV2 A;  4OOV A;  1Y0Y A;  4JXR A;  3SEJ A;  1V0E A;  3JQR A;  3VR6 A;  5G20 A;  1QFJ A;  1S4M A;  5A28 A;  1AMP A;  4XNH B;  5KTA A;  2Z3K A;  4PXB A;  3IO1 A;  1I8D A;  3SJF A;  1IYL A;  4FD4 A;  1VLO A;  3CC4 B;  1PJ7 A;  3I3G A;  3I1U A;  3DR6 A;  4ZY2 A;  2VQY A;  4R87 A;  4Y9U A;  3IIB A;  4Q38 A;  1Q7Y D;  4CAF A;  3AVU A;  2ZEO A;  2J8M A;  4MMO A;  4R9M A;  4Z4Z A;  4R57 A;  4Z4R A;  2VI7 A;  4AF6 A;  1KUX A;  4YAL A;  4MFQ A;  1VHE A;  1KK2 A;  2VYQ A;  2WZP P;  3KR5 A;  3J81 k;  4R3K A;  3CPW B;  1Q2C A;  4CYO A;  1FX0 A;  3DR8 A;  1YRE A;  3AVY A;  3VH9 A;  2D9R A;  3G8W A;  2V8V A;  4B43 A;  4PC6 A;  1LAN A;  3KQX A;  4XLH A;  5HXD A;  3OAA A;  1EFC A;  4YAU A;  4HE5 A;  3PEI A;  2D74 A;  3I55 B;  4G1V A;  4MY3 A;  3MN8 A;  1E3Z A;  1ZUN B;  3GIR A;  4A32 A;  4C2Y A;  1YIT B;  3TOB A;  4HPS A;  2JBK A;  4GQN A;  2HMA A;  1IJE A;  4X0C A;  4X7E A;  4QUZ A;  1FT7 A;  2IMO A;  4MHD A;  1XEB A;  3IWG A;  2CXA A;  4TSF A;  4N3N A;  3LQE A;  4PXC A;  3WR7 A;  3CPX A;  2WPX A;  1FNC A;  4Y9R A;  4Z4W A;  4PK3 A;  2O4H A;  4RPB A;  2FXF A;  2VBQ A;  3QB8 A;  5G1Z A;  5D8N A;  4JD6 A;  3VWD A;  4MFP A;  4RDL A;  2PJ1 A;  3WNC A;  3F5B A;  4YXW A;  3T51 B;  2EWB A;  4PQA A;  1YK3 A;  2X8K A;  4PC1 A;  4A37 A;  1CPX A;  4RDJ A;  4Z4S A;  1CNE A;  2HC9 A;  3QFS A;  1YX0 A;  4NGQ A;  3TC8 A;  4YEJ A;  2ZZQ A;  5F48 A;  1T6Y A;  4QUS A;  1XQB A;  4BMH A;  1KRH A;  4N3G A;  2GIV A;  4KOT A;  3VAR A;  3BJ8 A;  2V31 A;  3CB4 A;  2VL1 A;  4ZCM A;  2GFQ A;  1LFW A;  3N5F A;  2GJK A;  3WBJ A;  4A31 A;  3P27 A;  4K30 A;  3FJO A;  4LX9 A;  4B48 A;  4Q36 A;  2B5G A;  1JA0 A;  2GU2 A;  1BAV A;  5CNP A;  3NFZ A;  2GJR A;  1S7F A;  3D2M A;  3NE8 A;  4J0Q A;  5DWM A;  1SKY B;  3GIU A;  1IGB A;  1YLE A;  2ZPA A;  4OOS A;  2V8H A;  4UCP A;  2V77 A;  3MHP A;  2XEJ A;  2V7W A;  4XD7 A;  1F2P A;  1N71 A;  1Z4R A;  3H4Q A;  4XNH C;  4DYO A;  4XKW A;  2C6P A;  1IY7 A;  2V7V A;  4HNW B;  2NSM A;  4MHP A;  1OBR A;  3CCV B;  2POK A;  1CM0 A;  3FJU A;  2AHO A;  4P26 A;  3WC5 A;  3VO1 A;  4Z4V A;  4ZX8 A;  4AVZ A;  5JBQ A;  4XOP A;  2VZY A;  2ZEG A;  1D8T A;  3V38 A;  4KSF A;  1UD2 A;  4ZBG A;  3W5V A;  2Q6O A;  3B8G A;  4XPL A;  2YWG A;  2XEG A;  1WOR A;  1KUY A;  2DXQ A;  1M4L A;  1X12 A;  3B7I A;  7CPA A;  4YU9 A;  4CYQ A;  3CCL B;  2ZEM A;  4X07 A;  4ZX9 A;  4TT3 A;  1H8L A;  3T90 A;  2FIW A;  2ZBU A;  5LRJ A;  1EFT A;  3KKW A;  1IYK A;  4MXU A;  1OB0 A;  2ZEH A;  2I3C A;  1H85 A;  1SM4 A;  4R76 A;  5TRD A;  5BSY A;  1OB5 A;  4R3L A;  4BIN A;  1F2O A;  4OAD A;  4ACB A;  3DSB A;  1XOV A;  3G6E B;  1ZO0 A;  2PJ2 A;  4P6V F;  4RD0 A;  3PA2 A;  2BV3 A;  1LCP A;  3A8I A;  1QST A;  3H8E A;  2Q4Z A;  4XMY A;  1KD1 D;  1G7S A;  3MRU A;  4F6A A;  2ZTG A;  4QHY A;  5F47 A;  3FKS A;  2PIA A;  2B5O A;  1BPN A;  1ZM3 A;  3D7H A;  2OZH A;  3D4U A;  4XN3 A;  3G4S B;  3LVB A;  4HIZ A;  3E1Y E;  5FNZ A;  3WT4 A;  1Q9S A;  4P25 A;  1JJ2 B;  4RPD A;  2QJ8 A;  1R43 A;  3GVK A;  3BY1 A;  3VWE A;  5E6T A;  1WTH D;  4GM5 A;  4OC3 A;  4B47 A;  1N08 A;  3FB3 A;  4AG9 A;  1YGH A;  4CAX A;  4W9Y A;  3G05 A;  2BUE A;  1QSO A;  2XEF A;  3NH4 A;  2AFW A;  1CBX A;  2B4D A;  3W6S A;  3WC7 A;  4KVM E;  2PJB A;  1TTT A;  3W6X A;  2GPJ A;  3B2Y A;  3CW2 A;  2V7U A;  2HUZ A;  2R98 A;  2XNC A;  3D26 A;  3FED A;  4C2X A;  1HVX A;  2G0B A;  1E3X A;  4EH1 A;  1TKH A;  3ZZU A;  4FWT A;  2DEA A;  4X06 A;  2QTZ A;  4R7M A;  4UAJ A;  1Z8W A;  3E0K A;  1YR0 A;  2OTL B;  1T6X A;  4A30 A;  3T53 B;  2BSW A;  1BX0 A;  4MFZ A;  3FX6 A;  4AC9 A;  4XM3 A;  4NBS A;  1FNM A;  3GVL A;  4YRH A;  3NH8 A;  4C7H A;  2DET A;  3G71 B;  4H2K A;  2C6C A;  3LQ6 A;  2C2W A;  2Z6B D;  2RFH A;  4E0F A;  2VNK A;  1D2E A;  2EFG A;  2JDC A;  2Q6L A;  3G3S A;  5JGF A;  1FY7 A;  5HVH A;  1YME A;  2PR8 A;  3CXS A;  1GAW A;  5ELY A;  2ZEL A;  3B3V A;  3Q3A A;  2OBR A;  4XLC A;  3IJ3 A;  1W0K A;  1TLL A;  4YAW A;  4ZGQ B;  4GS4 A;  2OBT A;  2YNC C;  2YWF A;  4LBW A;  4YAF A;  4MFK A;  3BI0 A;  1QQ9 A;  2BM1 A;  2QEC A;  3D2P A;  5A88 A;  2PJ7 A;  1QVF B;  3ES9 A;  1VQ5 B;  4P44 A;  4UIA A;  5FA6 A;  4MYU A;  1N07 A;  3V76 A;  4KZT A;  4FD7 A;  3IFE A;  4NGN A;  1HEE A;  2V7Q A;  1GR1 A;  3ISX A;  3PB7 X;  4U9Y A;  3OW2 B;  3T9Y A;  2HB6 A;  1ZM4 A;  2BF4 A;  1VQN B;  3OEE A;  2CRV A;  4LBZ A;  3KZW A;  1IB1 E;  5HMN A;  3DNS A;  4EVY A;  2VXK A;  2ZTN A;  2XNJ A;  3W5U A;  3A8K A;  1CJW A;  4TMT A;  5AGE A;  4K1X A;  2C1C A;  5TY0 A;  1KZF A;  4ONU A;  2GLF A;  5K8P A;  1W34 A;  3WXM A;  1QFY A;  3A3B A;  4H6Z A;  2BVN A;  3K9T A;  1BJK A;  5IYP A;  1XMT A;  3RBU A;  2JEW A;  3CCM B;  1Z2L A;  4DUK A;  3ZPN A;  4CAE A;  3ZC3 A;  5LYI A;  2C78 A;  3U2Q A;  4KSI A;  4XLA A;  4M85 A;  2CTB A;  4A2Z A;  2Z3O A;  4EFD A;  4XON A;  2Z11 A;  3R9G A;  1EFU A;  3A35 A;  4HE6 A;  1S3Z A;  2C4U A;  1U2R A;  2XZP A;  1BO4 A;  3WNB A;  3TFY A;  4TN1 A;  3U6K A;  2NPF A;  4WZK A;  5J1Q A;  1Q82 D;  2QML A;  5BWA B;  1Y0R A;  2X6W A;  5A27 A;  2B3U A;  3WBK A;  2O53 A;  2W6I A;  2JJ2 A;  5C82 A;  2RB7 A;  4ACA A;  4FAI A;  3D3S A;  3ZUG A;  5LMZ A;  1CQX A;  4M3S A;  4L8J A;  3DDY A;  2ZEF A;  1CP6 A;  5EMI A;  4XOT A;  1N8R D;  3JRU A;  2W6J A;  3DGV A;  1VGY A;  3ZJ0 A;  3I56 B;  2C4T A;  3H9N A;  4QVT A;  3OJW A;  3PA1 A;  1GVH A;  3OW7 A;  4KUA A;  4Y49 B;  5I4M A;  3RY8 A;  2AFO A;  3RO0 A;  3OEH A;  1R5N A; 
#chains in the Genus database with same CATH homology
 2O4H A;  1QMU A;  2PJA A;  4R8F A;  5D8N A;  4UEZ A;  2PJ1 A;  5THW A;  3SJE A;  5JM6 A;  3PFO A;  2EWB A;  4PQA A;  2OR4 A;  3SI0 A;  4P45 A;  4A37 A;  2PJC A;  1CPX A;  1TXR A;  4K3N A;  2HC9 A;  3L2N A;  4NGQ A;  3TC8 A;  5K8O A;  2XEI A;  4FBE A;  3VAR A;  2VL1 A;  3PB6 X;  3FMC A;  4Q7A A;  4YWY A;  1LFW A;  3B3T A;  4MHZ A;  3HLP A;  2AFM A;  3D7F A;  3N5F A;  4ZYQ A;  2BOA A;  1ZG8 A;  1DTD A;  4TNU A;  3SJX A;  2EK8 A;  2GU2 A;  1TKF A;  1BAV A;  4WJB A;  2JBJ A;  3NFZ A;  4R6T A;  2ZOG A;  4AXV A;  2CIJ A;  1IGB A;  1JQG A;  2ZEP A;  4OP4 A;  2WYR A;  2PVW A;  2V8H A;  3WC6 A;  4A39 A;  2V8D A;  2V77 A;  2XEJ A;  3D68 A;  4PPZ A;  1F2P A;  4FWU A;  3GUX A;  4DYO A;  4BD9 A;  2C6P A;  1IY7 A;  3KI9 A;  4MHP A;  2NSM A;  1OBR A;  1XJO A;  3SJG A;  2POK A;  1NSA A;  3FJU A;  2C6G A;  2GLJ A;  3NH5 A;  2IJZ A;  3WC5 A;  3B3C A;  5LYF A;  4X8I A;  3PB8 X;  4ZX8 A;  3S9N A;  1CX8 A;  4MCS A;  3KGQ A;  1YLO A;  1YSJ A;  2PRQ A;  2ZEG A;  3V38 A;  4P4D A;  1AYE A;  4P10 A;  3B3W A;  5CBM A;  4UIB A;  4NGP A;  2XEG A;  3KHZ A;  3WAB A;  3KQZ A;  1M4L A;  1LAM A;  3B7I A;  4JZ0 A;  7CPA A;  4YU9 A;  4WWV A;  2ZEM A;  4ZX9 A;  1H8L A;  3CPA A;  3CT9 A;  1PYT B;  1R3N A;  5LRJ A;  4MXU A;  3VAT A;  5HVG A;  2ZEH A;  2I3C A;  4R76 A;  2F8H A;  4OID A;  4NFR A;  3FVL A;  4B6Z A;  1XBU A;  1ELM P;  1F2O A;  1F57 A;  2GRE A;  3SI1 A;  5LRG A;  2PJ2 A;  1LCP A;  1BLL E;  3FH4 A;  3H8E A;  2Q4Z A;  6CPA A;  3MRU A;  4EME A;  4UEF A;  1KWM A;  1XFO A;  2PVV A;  1GYT A;  2ZOF A;  4ZI6 A;  1YW4 A;  1Z5R A;  4IHM A;  5D29 A;  4MHY A;  1BPN A;  3D7H A;  5HVF A;  3D4U A;  1ZG7 A;  3D7G A;  3WT4 A;  3D66 A;  4MHN A;  5JH9 A;  2IQ6 A;  2QJ8 A;  1R43 A;  4EWT A;  4A94 A;  2AFS A;  3GLJ A;  4DJL A;  4GM5 A;  4P4I A;  4OC3 A;  1YW6 A;  2PIY A;  1HDQ A;  3B3S A;  3PBB A;  3ISZ A;  4MCR A;  1TF8 A;  3D67 A;  4OME A;  4W9Y A;  8CPA A;  3CDX A;  4OIW A;  3FEE A;  2XEF A;  3NH4 A;  2AFW A;  5LYL A;  1CBX A;  3WC7 A;  2PJB A;  3PFE A;  4P4F A;  3B2Y A;  1LOK A;  2Q51 A;  3RAM A;  4OC1 A;  2EK9 A;  4CPA A;  1TF9 A;  2OOT A;  1XRY A;  4P6Y A;  3FED A;  5DS0 A;  2CTC A;  4MCP A;  5CPA A;  1ZLI A;  4JYW A;  4P4E A;  1TKH A;  2ANP A;  3QNV A;  4PXE A;  2DEA A;  4R7M A;  3S9M A;  4OKO A;  3KAS A;  1CP7 A;  2PE3 A;  3PRT A;  3LWU A;  3FX6 A;  4ZY1 A;  2ZEN A;  3BXM A;  1ZLH A;  5LYD A;  3TX8 A;  3LMS A;  4P4B A;  4F8Z A;  3NH8 A;  4X3R A;  3B35 A;  4H2K A;  1EE3 P;  2C6C A;  3PB4 X;  2PJ0 A;  2RFH A;  4NGR A;  4NGS A;  3PB9 X;  2PJ9 A;  1FNO A;  5JGF A;  1LAP A;  1YME A;  2BCO A;  3RZA A;  5HVH A;  3IWW A;  4NJQ A;  5ELY A;  2ABZ A;  4UF4 A;  2ZEL A;  3D7D A;  3B3V A;  2QYV A;  3FF3 A;  4A38 A;  1CG2 A;  2F7V A;  4ZY0 A;  3IJ3 A;  4O23 A;  1BPM A;  4F9U A;  5K8N A;  2PJ4 A;  4F9V A;  3KR4 A;  3BI1 A;  2WZN A;  1DE4 C;  3BI0 A;  3V7Z A;  3DLJ A;  1QQ9 A;  4ONW A;  5F09 A;  3KL9 A;  2PJ7 A;  3S9L A;  4P44 A;  4UIA A;  2Q43 A;  1ARM A;  1UWY A;  3NA6 A;  3BHX A;  1RTQ A;  4NGT A;  1Y7E A;  3IFE A;  4NGN A;  1HEE A;  2V8G A;  4OC0 A;  3K2K A;  3ISX A;  3PB7 X;  1HDU A;  2PIZ A;  2HB6 A;  4FUU A;  2QVP A;  3T8W A;  2AFU A;  4X2T A;  4OC5 A;  4OC2 A;  1ZG9 A;  4RUH A;  3KZW A;  4TWE A;  2J9A A;  4Z65 A;  4P4J A;  1Y0Y A;  4NGM A;  1ARL A;  4IK2 A;  2C1C A;  4IAV A;  1Z8L A;  1AMP A;  4PXB A;  2GLF A;  5K8P A;  3IO1 A;  4MRI A;  3SJF A;  3FEC A;  5LRK A;  3I1U A;  3K9T A;  4ZY2 A;  3IC1 A;  1VIX A;  2FVG A;  3IIB A;  3RBU A;  2JEW A;  1Z2L A;  4DUK A;  2ZEO A;  2PJ8 A;  3H8G A;  4NJR A;  2CF4 A;  5LYI A;  2ZED A;  1XMB A;  4MMO A;  4KSI A;  3SI2 A;  4OC4 A;  2CTB A;  2BO9 A;  4MCQ A;  4EFD A;  2PCU A;  1VHE A;  3KR5 A;  1CPS A;  3VH9 A;  1VHO A;  2V8V A;  2PJ3 A;  3HUV A;  4G1P A;  5K8M A;  1LAN A;  3KQX A;  5J1Q A;  5HXD A;  2ZEE A;  1Y0R A;  3PBE A;  3PEI A;  2O53 A;  2AFX A;  3MN8 A;  2RB7 A;  2PJ5 A;  4FAI A;  3IEH A;  1PCA A;  2JBK A;  5IB9 A;  3H8F A;  2ZEF A;  1CP6 A;  3GB0 A;  2G9D A;  2NYQ A;  2PJ6 A;  3JRU A;  3KHX A;  4LQG A;  3DGV A;  1VGY A;  1FT7 A;  2AFZ A;  2IMO A;  4PXD A;  1Q7L A;  4PXC A;  3CPX A;  1TKJ A;  4UEE A;  5I4M A;  2AFO A;  1ELL P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...