3CPXA

Crystal structure of putative m42 glutamyl aminopeptidase (yp_676701.1) from cytophaga hutchinsonii atcc 33406 at 2.39 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
309
Chain Sequence
ENLYFQGMQLLKELCSIHAPSGNEEPLKDFILEYIRSNAGSWSYQPVIYADNDLQDCIVLVFGNPRTAVFAHMDSIGFTVSYNNHLHPIGSPSAKEGYRLVGKDSNGDIEGVLKIVDEEWMLETDRLIDRGTEVTFKPDFREEGDFILTPYLDDRLGVWTALELAKTLEHGIIAFTCWEEHGGGSVAYLARWIYETFHVKQSLICDITWVTEGVEAGKGVAISMRDRMIPRKKYVNRIIELARQTDIPFQLEVEGAGASDGRELQLSPYPWDWCFIGAPEKDAHTPNECVHKKDIESMVGLYKYLMEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative M42 glutamyl aminopeptidase (YP_676701.1) from Cytophaga hutchinsonii ATCC 33406 at 2.39 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
molecule keywords Aminopeptidase, M42 family
total genus 95
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3cpxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3cpxA01
5IB9A 2I3CA 1CBXA 4PXEA 1R3NA 4R8FA 1Z2LA 3CT9A 1AYEA 4ZY0A 1LAPA 3V7ZA 4B6ZA 2OR4A 1DE4C 2DEAA 2CTBA 3LWUA 4UF4A 4OIDA 4YWYA 2QVPA 5K8PA 2F7VA 4TWEA 3HUVA 4YU9A 6CPAA 1PYTB 4F9UA 4A38A 4MXUA 3B3VA 3IEHA 2O53A 2Q51A 5HXDA 4H2KA 2HC9A 3SJEA 4IAVA 3D7FA 1Z5RA 3SI2A 3D66A 3SJXA 2HB6A 5LYDA 1LANA 7CPAA 3IO1A 1LAMA 4NGNA 3IIBA 2F8HA 2POKA 3TC8A 2C6GA 3JRUA 3IJ3A 4BD9A 3H8FA 4MHZA 3MN8A 3B3CA 1BAVA 2ANPA 2PJ4A 1QQ9A 4ONWA 2PJ8A 3D7HA 5JM6A 1ZG9A 3B3TA 3NFZA 4UIAA 1TKJA 5DS0A 2XEIA 4X3RA 1Y0RA 4AXVA 1Z8LA 4MHYA 3KGQA 3RZAA 2PVVA 3T8WA 1HDUA 3H8GA 2PCUA 1BLLE 1H8LA 4MCSA 3IWWA 4PXBA 4CPAA 2QYVA 5LRGA 3GB0A 1F2OA 2XEJA 2AFXA 3PB8X 4PPZA 2AFSA 3K2KA 5D29A 2JBJA 4NGQA 4JYWA 5K8MA 2CTCA 2ZEOA 2C1CA 3SI0A 3IFEA 2RFHA 2WZNA 2OOTA 1XFOA 4FUUA 1CX8A 1NSAA 1HDQA 3BI0A 3FF3A 2V8HA 4A39A 1XJOA 2PJ1A 3SI1A 5K8NA 2G9DA 3NA6A 4ZY1A 2NSMA 3S9NA 2AFZA 1Y0YA 4NGPA 3N5FA 5JGFA 4EMEA 3KZWA 1PCAA 3WC7A 3DLJA 4NGRA 4MRIA 4PQAA 3VATA 2PJ0A 5CPAA 2PE3A 3PEIA 2EK8A 1ARMA 3CDXA 3IC1A 4W9YA 2ABZA 2RB7A 1CP7A 2WYRA 3PB7X 3PFOA 3PB6X 4P44A 2EWBA 4FAIA 5HVGA 2GLJA 3B7IA 4NGSA 2PJ9A 2ZEFA 3KQXA 3GUXA 4P4IA 3KR5A 3H8EA 4P4EA 4R6TA 1ZLIA 3SJFA 4OP4A 5LYLA 2ZEDA 3FMCA 2FVGA 1VGYA 4NJRA 4MCQA 4EFDA 4Q7AA 4DUKA 4IHMA 1VHOA 2O4HA 3LMSA 5HVHA 1DTDA 3QNVA 3B2YA 4OC5A 2GU2A 2XEGA 1CG2A 1LFWA 3FH4A 2XEFA 4OC1A 1YW6A 5I4MA 3KL9A 4MHPA 1YSJA 1FT7A 2BOAA 4Z65A 1XMBA 4P10A 2IJZA 2Q43A 2ZEHA 2PIZA 3CPXA 4K3NA 3NH5A 1FNOA 5K8OA 2JBKA 5THWA 2ZEMA 2PJCA 2BCOA 2ZEPA 3FX6A 1ZLHA 2JEWA 4UEEA 4FBEA 4OMEA 3I1UA 4P4JA 5J1QA 3DGVA 1TKHA 4JZ0A 4MCPA 4OC0A 2ZEGA 2GLFA 3VH9A 3B3WA 2IMOA 1YLOA 1Q7LA 5LYIA 4NGTA 4OIWA 2PJ5A 1IGBA 5ELYA 2CIJA 1R43A 3PFEA 5LRJA 3ISXA 1TF8A 1QMUA 2ZELA 4ZYQA 4KSIA 3TX8A 4P4DA 2PVWA 3NH8A 4X2TA 5D8NA 2ZENA 2Q4ZA 2AFUA 1TKFA 1UWYA 4X8IA 3D4UA 3VARA 4ZY2A 3FVLA 2V8GA 2PJBA 1CPSA 1YW4A 3WC6A 3BI1A 2EK9A 3BHXA 3CPAA 5CBMA 3RAMA 1VHEA 4P45A 5HVFA 3PRTA 4NJQA 2V77A 2PJ6A 2PJAA 4IK2A 4R76A 1CP6A 2V8DA 2PJ3A 3FECA 4A37A 2ZOFA 4FWUA 4UEFA 2V8VA 4OC4A 4GM5A 4MMOA 4ZI6A 2PIYA 2C6CA 3SJGA 1JQGA 1Y7EA 4UEZA 3BXMA 1ELMP 3PBBA 4RUHA 3WC5A 2QJ8A 3B35A 3D7DA 3KASA 3NH4A 4F9VA 3KQZA 3D7GA 4OC2A 3PB9X 2AFOA 3PB4X 3WABA 3WT4A 3L2NA 3D67A 3ISZA 4LQGA 4A94A 1LOKA 1AMPA 1ZG7A 8CPAA 3FEEA 1GYTA 4MCRA 4TNUA 4P6YA 2BO9A 4ZX9A 3B3SA 4PXDA 1F57A 3MRUA 4MHNA 4OC3A 4UIBA 2NYQA 4EWTA 3GLJA 2ZEEA 3RBUA 3HLPA 4NFRA 1YMEA 1TF9A 1M4LA 3S9LA 4ZX8A 3S9MA 3K9TA 2AFWA 1ARLA 2ZOGA 2PJ2A 2AFMA 1LCPA 2PRQA 5LYFA 1TXRA 1OBRA 4F8ZA 1ZG8A 2IQ6A 4P4FA 4DYOA 4WWVA 3KHXA 2VL1A 1XRYA 1ELLP 1KWMA 3KI9A 1CPXA 4WJBA 3FEDA 3PBEA 4NGMA 4R7MA 1BPMA 2CF4A 4OKOA 5LRKA 3KHZA 3FJUA 3D68A 5JH9A 4P4BA 1IY7A 4G1PA 5F09A 1BPNA 1F2PA 4PXCA 3KR4A 4DJLA 1RTQA 2C6PA 1XBUA 1VIXA 2PJ7A 4O23A 2GREA 2J9AA 1HEEA 3V38A 1EE3P
chains in the Genus database with same CATH superfamily
5IB9A 5HH1A 2I3CA 1KC8D 1MABA 4RCYA 3CT9A 4XKWA 1AYEA 1LAPA 2VZYA 3IGRA 4JLYA 3PZJA 3VNUA 5AN9A 1WDTA 4YWYA 2QVPA 3LQEA 1ZM4A 2VBSA 1YLEA 2F7VA 2RC5A 4TWEA 3HUVA 4RD6A 4QB9A 1NJID 4A38A 3OJXA 3PGPA 4UFWA 5KW9A 1QFJA 3B3VA 1VF7A 2O53A 4UAJA 1AIPA 4MI4A 4ONUA 4RPBA 4X06A 3RO0A 1QSRA 1LANA 7CPAA 5A89A 3CTAA 2B4BA 2JEVA 3CW2A 3CC4B 1JA1A 3H8FA 3T53B 4MHZA 1BAVA 2D4OA 1QQ9A 4ONWA 5JM6A 2P6GA 1F20A 1S3ZA 5EMIA 5DS0A 2XEIA 4X3RA 1DDGA 4G7WA 5L46A 1HA3A 3RZAA 1I8DA 4AB7A 4MHDA 3H8GA 2D4PA 2HLDA 4A2ZA 3GB0A 2ZTGA 3T56B 2GANA 2AFXA 3NE5B 4WZEA 4UWIA 1YVKA 1XOVA 2Q6KA 4EH1A 4JYWA 2FT0A 1FY7A 2YNCA 1ZM2A 2ZEOA 2OZHA 3IFEA 4RD0A 4II9A 2WZNA 2QTLA 2BEIA 4K30A 4FUUA 2WPWA 4E8OA 5CNPA 2V7QA 1BOBA 3W91A 3SI1A 1VQ8B 5K8NA 4XQFA 3LQ6A 4CYPA 4ZY1A 1I21A 2NSMA 1SM4A 3S9NA 1W35A 2AFZA 1Y0YA 3WY9A 4NGPA 3N5FA 2JLMA 3IWGA 4NCNA 3DLJA 1I18A 4UWJA 2OH1A 4PQAA 2HMAA 2PJ0A 5CPAA 4ACAA 2VNIA 3B82A 4MFPA 4KSFA 2HDNB 3PEIA 4W9YA 2HQYA 4UCMA 4G1VA 1CP7A 3FNCA 4RDLA 3PB7X 3PFOA 5AGEA 1FNBA 3P2HA 4CAWA 2OYNA 5HVGA 1H42A 2X0KA 3B7IA 2ZZQA 1L0CA 2BGJA 4QVAA 4AVAA 2ZEFA 3TFYA 1WOPA 3GUXA 4RPDA 3W2FA 1OHHA 4R6TA 3DDDA 3SJFA 5FIUA 2YWGA 4XKVA 4NF1A 1VGYA 1BQEA 4Z4UA 1VHOA 1P4MA 3R6KA 4QV2A 2Q7SA 3FIXA 2DYIA 3QNVA 1N71A 4ZBGA 1CG2A 1LFWA 2VBVA 1CNEA 1S60A 4OLLA 3R1KA 3KL9A 1YJNB 3BC9A 4QVTA 1FT7A 3CP8A 3LACA 2JJ1A 1NE9A 2BVNA 2BOAA 3EO4A 1PKVA 3BJ8A 4P10A 4YAUA 1OZPA 2Q43A 2BM1A 4JJXA 3R95A 2Q7BA 1FNOA 4RI1A 1ZO0A 1MRZA 4PAAA 2JBKA 2C2WA 2BMWA 4HE5A 1M1KD 3J81k 2ZEPA 2V7UA 4MY0A 4FD7A 4OADA 4UEEA 3AVXA 1KZLA 2R7HA 1HVXA 5TV2A 4DNTB 4C2YA 4NEXA 3ZBTA 4RJLA 1TKHA 4RD4A 2ZEGA 4OPOA 2GLFA 3VH9A 3B3WA 1UD4A 1YLOA 1Q7LA 5LYIA 5I0CA 2PJ5A 4KKUA 1Q86D 1VJSA 5ELYA 3LODA 1OB2A 5BSYA 1BMFA 1EFRA 3CC2B 5AG4A 4OPVA 4ZYQA 4KSIA 3I56B 1IOIA 1EP3B 4X2TA 3VMFA 2BPOA 4DNCA 1TKFA 4KOYA 1H8EA 5H5JA 2M5SA 4WZTA 4MFZA 4B5PA 1QX4A 4PC1A 3VARA 1YW4A 2V4DA 5E6TA 3A8IA 4AC9A 1R5NA 4E2AA 4UZEA 5J8FA 3GY9A 1VHEA 2I79A 1KUXA 3ASPA 4GQNA 1E1RA 1JJ2B 4HKFA 2A4NA 2B4DB 2X6WA 3CRZA 2R6HA 1U2RA 4EVYA 2JN9A 4R76A 3E0KA 2PJ3A 4M6IA 5AG7A 3U2QA 4FWUA 2J8RA 4UEFA 2V8VA 4C0SA 1E79A 2VI7A 3GKRA 1G7CA 4GM5A 4MMOA 4LC0A 2FXFA 4ZI6A 1N0VC 1COWA 4XORA 1OB0A 1NMTA 1BX0A 2DERA 1G7TA 2ZBVA 1JQGA 1SKQA 2XZPA 3CPWB 4U9YA 4UEZA 3BXMA 2HV2A 1CQXA 3EXNA 5HXBA 4TSFA 2PDOA 2AE6A 2Z3PA 1WSRA 5C82A 3D7DA 5F47A 1QSOA 3ZUGA 3L2NA 3ZZ0A 4LQGA 1LOKA 1ZG7A 2Z3KA 3FEEA 2WSSA 3WBKA 4KVME 4YFJA 1E62A 3MRUA 3OZUA 4UIBA 2NYQA 2EIXA 4U9ZA 2V7TA 3HLPA 2YNCC 4NFRA 5IYWA 3FXTA 2PQ8A 4NNJA 3S9LA 5IB0A 4ZX8A 4PGOA 4TT3A 2XZOA 3VWEA 2ZTNA 2AFMA 4M85A 2QDXA 3OZWA 2XNJA 2YWFA 1LCPA 2PRQA 1IIDA 1TXRA 1OBRA 3CCLB 1T6YA 5TY0A 4WWVA 4XONA 1MK4A 3I9SA 5DSZA 2XGJA 4Y9RA 1B87A 1WK4A 1ELLP 2REFA 3OPOA 2BGIA 1CPXA 2VYQA 3PBEA 2EVNA 4NCZA 4X05A 2Q6LA 5FL7A 3FJUA 3DR8A 4X7CA 4P4BA 5F09A 3P26A 4MYUA 4M1KA 3CCSB 1VIXA 2PJ7A 2C5BA 2C27A 4FWTA 3FKSA 2QEXB 3CD6B 1K9MD 1AUGA 2FE7A 1EP2B 3V38A 4K1XA 1CBXA 4LQ6A 1R3NA 3WNBA 2ZITA 4UCPA 4RD2A 4ZY0A 1W87A 4B6ZA 3GQBA 3AVTA 1DE4C 4CYQA 1VLYA 3C26A 4B44A 3AVWA 4B3GA 5A27A 2BM0A 1V0CA 3ZJ0A 2Q6IA 1VQ4B 1SQHA 4DQKA 1PYTB 1YX0A 5KTAA 4F9UA 1N0UA 4C2ZA 1R5OA 1VQOB 1VHSA 2DPTA 3SJZA 1LRZA 3SLNA 4H2KA 3SJEA 5HXDA 4IAVA 1M4DA 4TMTA 3D66A 2Q04A 1A2ZA 3CC7B 5KSWB 2XEXA 2DETA 1MJ9A 4NGNA 1JNYA 1Q81D 2POKA 2ZZFA 1XQBA 3NE8A 1YR0A 2OZGA 2PJ8A 1FNMA 1QGAA 1T6XA 3B3TA 3B8GA 3NFZA 1NSLA 4JWPA 2D3NA 4AXVA 2KVOA 3KGQA 4MHYA 3F0AA 2B3UA 3R96A 3MCAA 2B7CA 1BLLE 4KOUA 3T90A 3E1YE 3IWWA 5G21A 3FJOA 2C4UA 1F2OA 3V7AA 4DK0A 3FB3A 2AFSA 3OZVA 5D29A 2JBJA 2Q4VA 2H5MA 3QSYA 1IJFA 3CCJB 1FNCA 4JXQA 3CMAB 3SI0A 3TO7A 3ASRA 5AG6A 1Q82D 1XE4A 2REEA 3BI0A 3BCDA 3TO6A 3FF3A 2QTZA 5IX3A 2PJ1A 2G9DA 4I49A 3NA6A 4WZLA 1J4JA 2FS5A 4M2LA 5FVJA 1IB0A 1FNDA 4EMEA 1TLLA 1Z8TA 4CAVA 4MRIA 1YX2A 5A88A 1D2EA 2PE3A 4B43A 4UA3A 4QHYA 3A8JA 4KKSA 3ASSA 3CXPA 2EK8A 4YGOA 5FNZA 2D3LA 2EUIA 4CQJA 3QB8A 2J7KA 3A35A 4MFKA 2NPFA 2ABZA 2RB7A 3BCFA 2BSAA 4XPKA 3PB6X 1VQ9B 4RD1A 2EWBA 5F49A 1TIQA 4M6HA 2PJ9A 4Z1MA 1Y9KA 3KQXA 4XLHA 3R9GA 1S4MA 4FN5A 4P4EA 1QSNA 1K4JA 1N8RD 3SXOA 4Q7AA 2BF4A 2XNDA 4A30A 4Z4ZA 4P9SA 4IHMA 3K9UA 3UY5A 3LMSA 1DTDA 4OC5A 3B2YA 1N06A 4AG9A 2XEGA 2JIZA 5JPHA 1NRKA 5GV8A 4Z4YA 3CZXA 1S7FA 2NMTA 1XE1A 4OOXA 2GK6A 3F5BA 4OOVA 1V0FA 3OEEA 4IW3B 4ZGYB 3LD2A 4LBYA 4ASUA 4XLAA 5F46A 1S5KA 4XL9A 4MJ8A 4K3NA 3NH5A 2J8MA 4H6UA 3ES9A 3TOAA 1JA0A 3QE2A 5K8OA 1WP6A 2ZEMA 4TMXA 1KK0A 4DK1A 1YVOA 3H9NA 4FD5A 3I55B 4CGMA 2OBSA 3CB4A 2JEWA 4FBEA 1OGJA 5IYQA 2K5TA 4L89A 4OMEA 3I1UA 3A9LA 4MFQA 4HNYB 4YAOA 3R6JA 4C7HA 1KMHA 3BLNA 2ZXHA 4Y49C 5F48A 5J1QA 2X3UA 3DGVA 2FCKA 4NBSA 2W6JA 5C88A 4JZ0A 2PRBA 4OC0A 2F1LA 2IMOA 3TTHA 4OIWA 3GYAA 3Q39A 3GIUA 1K73D 3G3SA 1YGHA 2VBUA 1KUYA 3PFEA 5LRJA 3ISXA 1TF8A 3D2PA 4L8AA 2OU2A 4KOVA 2ATRA 1E63A 3QFCA 2F43A 1P4NA 3IU2A 4F0YA 3TE4A 2ZL5A 4ZV4A 3VR6A 1D8TA 1R5BA 2D74A 3A1PA 2X8KA 2PMDA 4CAFA 1RO5A 4X8IA 3D4UA 3W2GA 3DSBA 2V8GA 2PJBA 4KUAA 3GVLA 2GJPA 1CPSA 1IYKA 4B3FX 4UFXA 2I1LA 3CPAA 1MJAA 5CBMA 5J3OA 3JU4A 3A3BA 3RNZA 3OFNA 4N3NA 3PRTA 4ZCLA 2FIWA 2VZLA 5FA6A 4NJQA 5GV7A 3D2MA 1S7KA 2JDDA 4FD6A 4A37A 1VQ7B 2C4TA 3JQQA 1M90D 2E1BA 1VQMB 3RYOA 3U6BA 3CP2A 4B47A 3A3GA 2VJJA 4HNXB 2XOKA 1S72B 3CMMA 3GIRA 2PIYA 1WTHD 3GVKA 5H86A 4UFVA 1QUEA 2C6CA 2C78A 3V76A 4H89A 3SJGA 3WQZA 1WSVA 1Y7EA 3QFSA 1VQ5B 2C77A 4AVBA 1E3ZA 1GR1A 1ELMP 2AHOA 1NBMA 4CS0B 2WSAA 1YK3A 3TO9A 1UFHA 2GJKA 3WC5A 3NH4A 3B35A 1FRNA 1S0UA 3PB9X 3PB4X 2X85A 4ZCMA 3ISZA 4XPLA 4A94A 4B4DA 1AMPA 4BBHA 4MCRA 5AG5A 2DY1A 1ELOA 3Q6QA 4X5KA 4PABA 4P6YA 2BO9A 4CGPA 4PXDA 2YGWA 5HZAA 2YNDA 4PC3A 4OC3A 2B4DA 3F8KA 2DF5A 1YMEA 1TF9A 3G6EB 1M4LA 2LZJA 3K9TA 4C68A 1BO4A 5LYFA 1Z8XA 3G05A 3LVBA 2IQ6A 2CNSA 2GQFA 2JJ2A 4GXHA 4XM3A 2QN6A 4XLCA 1QVGB 2FSRA 3VO1A 5J35A 1XRYA 1KWMA 3KI9A 4WJBA 1E43A 3ZIAA 4NGMA 4E0FA 2CBXA 2AJ6A 1OGIA 2W6IA 1X12A 4M4SA 4H6ZA 2BV3A 5F4MA 1BPNA 4DJLA 2P6FA 1UD3A 2BL1A 5F4OA 3OE7A 1YITB 2O28A 4CAEA 4II3A 1XBUA 2P6EA 1IJEA 1WU8A 1YQEA 1DG1G 3FPPA 2J9AA 1EE3P 4Y7CA 4PXEA 5EC4A 2ZW4A 3S6KA 2EFGA 2Z10A 1Z2LA 5THXA 3R9FA 4A32A 1W0KA 3V7ZA 1B23P 1QSTA 1N07A 2V7WA 2DEAA 3CCQB 3LWUA 4OIDA 1XB2A 2VJIA 2Z3MA 4L8JA 1E64A 4UCNA 2Y0MA 2YWHA 1K28D 4JXRA 4YU9A 2WPDA 1PU9A 4QC6A 3H4QA 3N7ZA 2Z3OA 3ZC3A 4MXUA 4II2A 4ZGQB 3EFAA 3IEHA 2CW5A 4QFMA 2Q51A 3NE7A 1IHMA 4QVJA 2HC9A 1V5VA 4AF7A 3D7FA 2GE3A 4XLFA 4P22A 1KQSB 2Q0YA 2B5GA 4P1VA 4CAXA 3T51B 3W5HA 3IO1A 4E0AA 4YAWA 3IIBA 2F8HA 3AVVA 3TC8A 1Q2YA 2OK7A 3IJ3A 4QBJA 5F4JA 3W2HA 3B3CA 4KKTA 1DDIA 3MN8A 2ANPA 3BJ7A 3D7HA 5GCNA 1ZG9A 3DDYA 1TKJA 2HUZA 4BINA 2DEUA 2QA4B 1Y0RA 1Z8LA 1KTVA 5KTDA 4CYOA 1B2RA 5G22A 1HDUA 1G7RA 1SKYB 2BN4A 1H8LA 4GS4A 4J0QA 1VKCA 3KEWA 4CPAA 4Q38A 1YJWB 3AVUA 1WPCA 4DQLA 4PPZA 4C7IA 2DIEA 5K8MA 1VQ6B 1EFUA 2CTCA 1Q9SA 1YJ9B 3B78A 2C1CA 2B5OA 3JTKA 2RFHA 4X7FA 4LUAA 1XFOA 4CGOA 2VNHA 1HDQA 3WR7A 1YHQB 4A39A 1XJOA 1VQKB 1Z4RA 3QAYA 1PJ6A 2OTJB 1JWQA 2WZPP 2WPXA 3BQJA 3FYNA 3KZWA 4XMYA 1IICA 4NGRA 3VATA 1FX0A 1IU8A 3WYAA 3OWCA 4X0CA 5TR9A 3IC1A 3CCMB 1MJBA 2V31A 2ZBUA 3OJWA 1GJRA 3QFTA 2B58A 3W6SA 2X7BA 4CGLA 5G20A 2EBJA 2CNDA 1EWYA 4P4IA 1XMTA 3KR5A 2XNCA 3H8EA 2E1RA 4OP4A 2ZEDA 4RD3A 1P0HA 3OEHA 4PK3A 4MCQA 4DUKA 2PR8A 2QMLA 4OAEA 3D8PA 1GVHA 1AMOA 4J3GA 1EP1B 2PSWA 3FH4A 2XEFA 4OC1A 4HIZA 3ZPNA 3G71B 2R9VA 1XEBA 4MHPA 1YSJA 4LX9A 3WNCA 4Z65A 1HZEA 1XMBA 5LMZA 4BMHA 2IJZA 4UZFA 1PJ5A 2PIZA 3TOBA 4Z4RA 5J8CA 3V8IA 4AVZA 3ASQA 1VQNB 5G1ZA 4XLEA 2ARHA 2Z3LA 2YNEA 5THWA 2PJCA 1IYLA 5BWAB 2YWEA 3VNVA 4XNHB 3PUMA 4OOSA 3FX6A 1ZLHA 3WNDA 2OBTA 2VZZA 4B5OA 4XNFA 1EFCA 4XPDC 1ZM3A 1OB5A 4P4JA 4KORA 3W2IA 4U5YA 2VBQA 1Z9UA 2CXAA 4MCPA 4Q7JB 2G3AA 2QECA 1VQPB 2KCWA 1V0EA 4NGTA 5ISVA 1IGBA 2CIJA 3ZBUA 4FK8A 1QMUA 2ZELA 4UBRA 1KD1D 1I7PA 2FL4A 2PVWA 3FBUA 3NH8A 4X7EA 5D8NA 4B12A 3SXNA 5BSXA 4XD7A 1NB9A 5EBVA 3BI1A 3BHXA 4P26A 3RAMA 3W5UA 1TUIA 3ZZIA 3EY5A 4P45A 4A33A 5HVFA 3T9YA 3ASTA 3CXQA 2V7VA 1KK2A 2V77A 2WJVA 1W2BB 1WWZA 2PJ6A 3CMEB 2Z0ZA 5IV0A 3I1FA 4M3SA 4P2NA 2PJAA 2C5HA 1CP6A 2CC2A 1QGZA 4P12A 4MFLA 4P3YA 1QFYA 5EMNA 5A8AA 4FD4A 4R3KA 4R57A 4OC4A 5HMNA 2IL4A 4RDKA 4B13A 4XNHC 1RQRA 2RC4A 2WJYA 4RDJA 2QMUA 3SJPA 2B7BA 4LBVA 3OW7A 2Q44A 3PBBA 2GJRA 3EC4A 1ZM9A 4JD6A 3KASA 4KOSA 3D7GA 1BJKA 1UD6A 4G6IA 1TTTA 3PUNA 3VO2A 4DNRB 3D67A 3JVNA 4A95A 1QSMA 5JQ4A 4G5GA 3B3SA 1F57A 4MHNA 4PV6A 4PSWA 2ZEEA 2Q4YA 1KRHA 1D1NA 4KOTA 4R87A 2AFWA 1ARLA 1I12A 1EFTA 2VXKA 3AGQA 1Z8WA 4TMWA 1H8HA 4F8ZA 4B3XA 1IOFA 3G8WA 4B14A 2QIRA 4NSQA 1GAQA 5E96A 4KUBA 2DXQA 3S6FA 3MHPA 2VL1A 3AVYA 5DWMA 2DPSA 4ZCIA 1KJZA 3FEDA 3CCUB 1BPMA 2CF4A 4OKOA 3MMPA 2QE7A 2PR1A 4UZUA 3BY2A 3D68A 3FPKA 4KVXA 3CXSA 1B6BA 2B5GB 4G1PA 4PXCA 3KR4A 3JUWA 2ZZGA 2R98A 3IU1A 3OKXA 2QGGA 2RC6A 2R8VA 2CK3A 4O23A 3Q6RA 2JDCA 1HEEA 5LRGA 3SLDA 4B11A 2D9RA 2ODFA 4R8FA 2Z6BD 1Z4EA 4RS2A 3U6KA 4QUZA 1YREA 2OR4A 2GIVA 4OP7A 5A28A 2CTBA 4UF4A 4F6AA 2Z11A 2GK7A 1GHEA 5K8PA 1XIXA 1X10A 2JDIA 6CPAA 4B10A 2ZXVA 1M4GA 1F60A 1UD8A 4Z4SA 2EO8A 2VNJA 1Z5RA 3SI2A 3SJXA 5CDFA 4XOPA 2HB6A 5LYDA 5FO0A 1CJWA 1Y7RA 1BPLA 1W34A 2B3VA 3CCEB 1NB0A 3HAGA 4H9GA 1LAMA 1E3XA 4MY3A 4LBZA 2Z3NA 2C6GA 3JRUA 4XPDB 4BD9A 2ZL6A 3S6HA 2F5IA 5KNLA 2P0WA 2PJ4A 4U9UA 4YAFA 1IB1E 4YEJA 4UIAA 2GPJA 2PVVA 2VEZA 3T8WA 3FRMA 2OK8A 4PC2A 4JMQA 2PCUA 5B6IA 2Q6OA 3QFRA 4MCSA 1E1QA 4PXBA 4G1BA 2QYVA 4Q36A 5DWNA 3PA1A 1T5EA 2XEJA 3G4SB 3IWEA 3PB8X 1H85A 3ZZTA 4AVCA 3P27A 2ZL7A 1KK3A 3K2KA 5TRDA 4NGQA 2F1MA 3JQRA 4KSAA 3S6GA 4FXUA 1J9ZA 3R9EA 4AG7A 5DN6A 4CYNA 2P3MA 4Y9UA 2OOTA 3B8HA 1CX8A 4QUSA 1NSAA 2FIAA 4IF5A 3WXMA 3BNWA 2V8HA 3GSIA 1ON0A 3H94A 5IK2A 3TCVA 3PENA 5JGFA 3LO8A 3CXCB 3WC7A 1PCAA 4CRYB 3H5ZA 1QVFB 1ARMA 3CDXA 3CCRB 4CRZB 3LNNA 5KTCA 2OZUA 2CNMA 2WYRA 2F4NA 3P2FA 4HNWB 2FX3A 1CNFA 4P44A 4F7DA 4FAIA 5HKKA 1N08A 3E20A 2BSWA 4M53A 4C43A 2GLJA 4NGSA 1KK1A 3OP1A 1BX1A 4P3IA 1M44A 4WZKA 1ZLIA 1A8PA 5LYLA 3FMCA 2FVGA 2XZLA 2WUUA 2VBTA 3Q3AA 4NJRA 4EFDA 5IYNA 1U6MA 3KKWA 1RQPA 2O4HA 1FRQA 1FDRA 5HVHA 1EXMA 1QFZA 3ONYA 2GU2A 2BUEA 3DR6A 1TVCA 3QAHA 2X6XA 4Z4TA 3TT2A 1YW6A 5I4MA 4IUSA 4R9MA 5JBQA 3BH4A 2ZPAA 2VQYA 1G7SA 3PA2A 2ZW7A 4TN1A 2ZW6A 1R57A 2ZEHA 3OAAA 4C2XA 4RM0A 3CPXA 2G0BA 4A31A 1UD2A 4MBUA 4ORFA 4ZGNB 1VQLB 4YXWA 2I00A 3VWDA 4X7DA 1Q2DA 1WOSA 4YHBA 3ONUA 2PIAA 2BCOA 1QUFA 3I3GA 4Z4WA 4CGNA 3JQPA 2X6YA 3DNSA 1S7LA 4X07A 2WR8A 2VNKA 1ZUNB 1K8AD 4ACBA 1JB9A 4BPRA 2HCJB 1M4IA 1KUVA 4TKOB 1NDHA 1R43A 4Z4VA 2OB0A 1PJ7A 3ZZUA 3GVJA 3SHPA 2DOGA 3TX8A 4P4DA 4KLWA 2OTLB 2ZENA 2Q4ZA 2AFUA 4KS9A 1UWYA 4PC6A 4RLZA 4YALA 4KOXA 3FVLA 4ZY2A 4MFJA 1YI2B 1N05A 3WC6A 4TMVA 1UMKA 2EK9A 3PVDA 1WOOA 5H84A 1GAWA 2OBRA 4PC7A 5H59A 1PUAA 4N3GA 3SKBA 3W6XA 3SEJA 4M6GA 1QG0A 2X53S 4KVOE 4IK2A 1VLOA 4G7XA 2V8DA 3FECA 1Q2CA 2ZOFA 3CCVB 2ZZEA 4XOTA 1CM0A 1WORA 3D3SA 1RXTA 1Y9WA 4YELA 4KLVA 4F0XA 3CESA 1QH0A 4Y49B 3W2EA 2NV4A 4RUHA 2QJ8A 5HZBA 4HPSA 4F9VA 4LBWA 3KQZA 4OC2A 4B48A 2AFOA 3WABA 3WT4A 5IYRA 1XF8A 8CPAA 4PSXA 1GYTA 2PLFA 4TNUA 4PK2A 3OW2B 1YIJB 1M1DA 4ZX9A 3OOCA 4P25A 2CRVA 1Q7YD 4MYTA 4EWTA 2CNTA 3GLJA 4KZTA 3RBUA 3PP9A 1T6ZA 3AGPA 4RCZA 3S9MA 3BY1A 4TMZA 2ZOGA 2PJ2A 1GO2A 2V7XA 4P6VF 4OPSA 2ZXIA 4AF6A 2J8NA 3WBJA 4RN7A 1ZG8A 4P4FA 2GFQA 1I1DA 4DYOA 4NXYA 4M0LA 3A8KA 1UD5A 4XR6A 3KHXA 2DCUA 4WQMA 2G3TA 4ROXA 1W9XA 4KOWA 1S7NA 1DARA 4XN0A 4R7MA 4YRHA 5LRKA 1KZFA 3KHZA 5IYPA 3W5VA 2R1IA 1W0JA 3D26A 5JH9A 1IY7A 5FO1A 1F2PA 2CY2A 4HE6A 1RTQA 2C6PA 4R3LA 2PC1A 3RY8A 4R71A 1BLIA 4B5PB 3Q38A 1QGYA 2GREA 3MGDA 4XN3A 2ZW5A
chains in the Genus database with same CATH topology
5IB9A 2I3CA 1CBXA 4PXEA 1R3NA 4R8FA 1Z2LA 3CT9A 1AYEA 4ZY0A 1LAPA 3V7ZA 4B6ZA 2OR4A 1DE4C 2DEAA 2CTBA 3LWUA 4UF4A 4OIDA 4YWYA 2QVPA 5K8PA 2F7VA 4TWEA 3HUVA 4YU9A 6CPAA 1PYTB 4F9UA 4A38A 4MXUA 3B3VA 3IEHA 2O53A 2Q51A 5HXDA 4H2KA 2HC9A 3SJEA 4IAVA 3D7FA 1Z5RA 3SI2A 3D66A 3SJXA 2HB6A 5LYDA 1LANA 7CPAA 3IO1A 1LAMA 4NGNA 3IIBA 2F8HA 2POKA 3TC8A 2C6GA 3JRUA 3IJ3A 4BD9A 3H8FA 4MHZA 3MN8A 3B3CA 1BAVA 2ANPA 2PJ4A 1QQ9A 4ONWA 2PJ8A 3D7HA 5JM6A 1ZG9A 3B3TA 3NFZA 4UIAA 1TKJA 5DS0A 2XEIA 4X3RA 1Y0RA 4AXVA 1Z8LA 4MHYA 3KGQA 3RZAA 2PVVA 3T8WA 1HDUA 3H8GA 2PCUA 1BLLE 1H8LA 4MCSA 3IWWA 4PXBA 4CPAA 2QYVA 5LRGA 3GB0A 1F2OA 2XEJA 2AFXA 3PB8X 4PPZA 2AFSA 3K2KA 5D29A 2JBJA 4NGQA 4JYWA 5K8MA 2CTCA 2ZEOA 2C1CA 3SI0A 3IFEA 2RFHA 2WZNA 2OOTA 1XFOA 4FUUA 1CX8A 1NSAA 1HDQA 3BI0A 3FF3A 2V8HA 4A39A 1XJOA 2PJ1A 3SI1A 5K8NA 2G9DA 3NA6A 4ZY1A 2NSMA 3S9NA 2AFZA 1Y0YA 4NGPA 3N5FA 5JGFA 4EMEA 3KZWA 1PCAA 3WC7A 3DLJA 4NGRA 4MRIA 4PQAA 3VATA 2PJ0A 5CPAA 2PE3A 3PEIA 2EK8A 1ARMA 3CDXA 3IC1A 4W9YA 2ABZA 2RB7A 1CP7A 2WYRA 3PB7X 3PFOA 3PB6X 4P44A 2EWBA 4FAIA 5HVGA 2GLJA 3B7IA 4NGSA 2PJ9A 2ZEFA 3KQXA 3GUXA 4P4IA 3KR5A 3H8EA 4P4EA 4R6TA 1ZLIA 3SJFA 4OP4A 5LYLA 2ZEDA 3FMCA 2FVGA 1VGYA 4NJRA 4MCQA 4EFDA 4Q7AA 4DUKA 4IHMA 1VHOA 2O4HA 3LMSA 5HVHA 1DTDA 3QNVA 3B2YA 4OC5A 2GU2A 2XEGA 1CG2A 1LFWA 3FH4A 2XEFA 4OC1A 1YW6A 5I4MA 3KL9A 4MHPA 1YSJA 1FT7A 2BOAA 4Z65A 1XMBA 4P10A 2IJZA 2Q43A 2ZEHA 2PIZA 3CPXA 4K3NA 3NH5A 1FNOA 5K8OA 2JBKA 5THWA 2ZEMA 2PJCA 2BCOA 2ZEPA 3FX6A 1ZLHA 2JEWA 4UEEA 4FBEA 4OMEA 3I1UA 4P4JA 5J1QA 3DGVA 1TKHA 4JZ0A 4MCPA 4OC0A 2ZEGA 2GLFA 3VH9A 3B3WA 2IMOA 1YLOA 1Q7LA 5LYIA 4NGTA 4OIWA 2PJ5A 1IGBA 5ELYA 2CIJA 1R43A 3PFEA 5LRJA 3ISXA 1TF8A 1QMUA 2ZELA 4ZYQA 4KSIA 3TX8A 4P4DA 2PVWA 3NH8A 4X2TA 5D8NA 2ZENA 2Q4ZA 2AFUA 1TKFA 1UWYA 4X8IA 3D4UA 3VARA 4ZY2A 3FVLA 2V8GA 2PJBA 1CPSA 1YW4A 3WC6A 3BI1A 2EK9A 3BHXA 3CPAA 5CBMA 3RAMA 1VHEA 4P45A 5HVFA 3PRTA 4NJQA 2V77A 2PJ6A 2PJAA 4IK2A 4R76A 1CP6A 2V8DA 2PJ3A 3FECA 4A37A 2ZOFA 4FWUA 4UEFA 2V8VA 4OC4A 4GM5A 4MMOA 4ZI6A 2PIYA 2C6CA 3SJGA 1JQGA 1Y7EA 4UEZA 3BXMA 1ELMP 3PBBA 4RUHA 3WC5A 2QJ8A 3B35A 3D7DA 3KASA 3NH4A 4F9VA 3KQZA 3D7GA 4OC2A 3PB9X 2AFOA 3PB4X 3WABA 3WT4A 3L2NA 3D67A 3ISZA 4LQGA 4A94A 1LOKA 1AMPA 1ZG7A 8CPAA 3FEEA 1GYTA 4MCRA 4TNUA 4P6YA 2BO9A 4ZX9A 3B3SA 4PXDA 1F57A 3MRUA 4MHNA 4OC3A 4UIBA 2NYQA 4EWTA 3GLJA 2ZEEA 3RBUA 3HLPA 4NFRA 1YMEA 1TF9A 1M4LA 3S9LA 4ZX8A 3S9MA 3K9TA 2AFWA 1ARLA 2ZOGA 2PJ2A 2AFMA 1LCPA 2PRQA 5LYFA 1TXRA 1OBRA 4F8ZA 1ZG8A 2IQ6A 4P4FA 4DYOA 4WWVA 3KHXA 2VL1A 1XRYA 1ELLP 1KWMA 3KI9A 1CPXA 4WJBA 3FEDA 3PBEA 4NGMA 4R7MA 1BPMA 2CF4A 4OKOA 5LRKA 3KHZA 3FJUA 3D68A 5JH9A 4P4BA 1IY7A 4G1PA 5F09A 1BPNA 1F2PA 4PXCA 3KR4A 4DJLA 1RTQA 2C6PA 1XBUA 1VIXA 2PJ7A 4O23A 2GREA 2J9AA 1HEEA 3V38A 1EE3P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IB9 A;  2I3C A;  1CBX A;  4PXE A;  1R3N A;  4R8F A;  1Z2L A;  3CT9 A;  1AYE A;  4ZY0 A;  1LAP A;  3V7Z A;  4B6Z A;  2OR4 A;  1DE4 C;  2DEA A;  2CTB A;  3LWU A;  4UF4 A;  4OID A;  4YWY A;  2QVP A;  5K8P A;  2F7V A;  4TWE A;  3HUV A;  4YU9 A;  6CPA A;  1PYT B;  4F9U A;  4A38 A;  4MXU A;  3B3V A;  3IEH A;  2O53 A;  2Q51 A;  5HXD A;  4H2K A;  2HC9 A;  3SJE A;  4IAV A;  3D7F A;  1Z5R A;  3SI2 A;  3D66 A;  3SJX A;  2HB6 A;  5LYD A;  1LAN A;  7CPA A;  3IO1 A;  1LAM A;  4NGN A;  3IIB A;  2F8H A;  2POK A;  3TC8 A;  2C6G A;  3JRU A;  3IJ3 A;  4BD9 A;  3H8F A;  4MHZ A;  3MN8 A;  3B3C A;  1BAV A;  2ANP A;  2PJ4 A;  1QQ9 A;  4ONW A;  2PJ8 A;  3D7H A;  5JM6 A;  1ZG9 A;  3B3T A;  3NFZ A;  4UIA A;  1TKJ A;  5DS0 A;  2XEI A;  4X3R A;  1Y0R A;  4AXV A;  1Z8L A;  4MHY A;  3KGQ A;  3RZA A;  2PVV A;  3T8W A;  1HDU A;  3H8G A;  2PCU A;  1BLL E;  1H8L A;  4MCS A;  3IWW A;  4PXB A;  4CPA A;  2QYV A;  5LRG A;  3GB0 A;  1F2O A;  2XEJ A;  2AFX A;  3PB8 X;  4PPZ A;  2AFS A;  3K2K A;  5D29 A;  2JBJ A;  4NGQ A;  4JYW A;  5K8M A;  2CTC A;  2ZEO A;  2C1C A;  3SI0 A;  3IFE A;  2RFH A;  2WZN A;  2OOT A;  1XFO A;  4FUU A;  1CX8 A;  1NSA A;  1HDQ A;  3BI0 A;  3FF3 A;  2V8H A;  4A39 A;  1XJO A;  2PJ1 A;  3SI1 A;  5K8N A;  2G9D A;  3NA6 A;  4ZY1 A;  2NSM A;  3S9N A;  2AFZ A;  1Y0Y A;  4NGP A;  3N5F A;  5JGF A;  4EME A;  3KZW A;  1PCA A;  3WC7 A;  3DLJ A;  4NGR A;  4MRI A;  4PQA A;  3VAT A;  2PJ0 A;  5CPA A;  2PE3 A;  3PEI A;  2EK8 A;  1ARM A;  3CDX A;  3IC1 A;  4W9Y A;  2ABZ A;  2RB7 A;  1CP7 A;  2WYR A;  3PB7 X;  3PFO A;  3PB6 X;  4P44 A;  2EWB A;  4FAI A;  5HVG A;  2GLJ A;  3B7I A;  4NGS A;  2PJ9 A;  2ZEF A;  3KQX A;  3GUX A;  4P4I A;  3KR5 A;  3H8E A;  4P4E A;  4R6T A;  1ZLI A;  3SJF A;  4OP4 A;  5LYL A;  2ZED A;  3FMC A;  2FVG A;  1VGY A;  4NJR A;  4MCQ A;  4EFD A;  4Q7A A;  4DUK A;  4IHM A;  1VHO A;  2O4H A;  3LMS A;  5HVH A;  1DTD A;  3QNV A;  3B2Y A;  4OC5 A;  2GU2 A;  2XEG A;  1CG2 A;  1LFW A;  3FH4 A;  2XEF A;  4OC1 A;  1YW6 A;  5I4M A;  3KL9 A;  4MHP A;  1YSJ A;  1FT7 A;  2BOA A;  4Z65 A;  1XMB A;  4P10 A;  2IJZ A;  2Q43 A;  2ZEH A;  2PIZ A;  3CPX A;  4K3N A;  3NH5 A;  1FNO A;  5K8O A;  2JBK A;  5THW A;  2ZEM A;  2PJC A;  2BCO A;  2ZEP A;  3FX6 A;  1ZLH A;  2JEW A;  4UEE A;  4FBE A;  4OME A;  3I1U A;  4P4J A;  5J1Q A;  3DGV A;  1TKH A;  4JZ0 A;  4MCP A;  4OC0 A;  2ZEG A;  2GLF A;  3VH9 A;  3B3W A;  2IMO A;  1YLO A;  1Q7L A;  5LYI A;  4NGT A;  4OIW A;  2PJ5 A;  1IGB A;  5ELY A;  2CIJ A;  1R43 A;  3PFE A;  5LRJ A;  3ISX A;  1TF8 A;  1QMU A;  2ZEL A;  4ZYQ A;  4KSI A;  3TX8 A;  4P4D A;  2PVW A;  3NH8 A;  4X2T A;  5D8N A;  2ZEN A;  2Q4Z A;  2AFU A;  1TKF A;  1UWY A;  4X8I A;  3D4U A;  3VAR A;  4ZY2 A;  3FVL A;  2V8G A;  2PJB A;  1CPS A;  1YW4 A;  3WC6 A;  3BI1 A;  2EK9 A;  3BHX A;  3CPA A;  5CBM A;  3RAM A;  1VHE A;  4P45 A;  5HVF A;  3PRT A;  4NJQ A;  2V77 A;  2PJ6 A;  2PJA A;  4IK2 A;  4R76 A;  1CP6 A;  2V8D A;  2PJ3 A;  3FEC A;  4A37 A;  2ZOF A;  4FWU A;  4UEF A;  2V8V A;  4OC4 A;  4GM5 A;  4MMO A;  4ZI6 A;  2PIY A;  2C6C A;  3SJG A;  1JQG A;  1Y7E A;  4UEZ A;  3BXM A;  1ELM P;  3PBB A;  4RUH A;  3WC5 A;  2QJ8 A;  3B35 A;  3D7D A;  3KAS A;  3NH4 A;  4F9V A;  3KQZ A;  3D7G A;  4OC2 A;  3PB9 X;  2AFO A;  3PB4 X;  3WAB A;  3WT4 A;  3L2N A;  3D67 A;  3ISZ A;  4LQG A;  4A94 A;  1LOK A;  1AMP A;  1ZG7 A;  8CPA A;  3FEE A;  1GYT A;  4MCR A;  4TNU A;  4P6Y A;  2BO9 A;  4ZX9 A;  3B3S A;  4PXD A;  1F57 A;  3MRU A;  4MHN A;  4OC3 A;  4UIB A;  2NYQ A;  4EWT A;  3GLJ A;  2ZEE A;  3RBU A;  3HLP A;  4NFR A;  1YME A;  1TF9 A;  1M4L A;  3S9L A;  4ZX8 A;  3S9M A;  3K9T A;  2AFW A;  1ARL A;  2ZOG A;  2PJ2 A;  2AFM A;  1LCP A;  2PRQ A;  5LYF A;  1TXR A;  1OBR A;  4F8Z A;  1ZG8 A;  2IQ6 A;  4P4F A;  4DYO A;  4WWV A;  3KHX A;  2VL1 A;  1XRY A;  1ELL P;  1KWM A;  3KI9 A;  1CPX A;  4WJB A;  3FED A;  3PBE A;  4NGM A;  4R7M A;  1BPM A;  2CF4 A;  4OKO A;  5LRK A;  3KHZ A;  3FJU A;  3D68 A;  5JH9 A;  4P4B A;  1IY7 A;  4G1P A;  5F09 A;  1BPN A;  1F2P A;  4PXC A;  3KR4 A;  4DJL A;  1RTQ A;  2C6P A;  1XBU A;  1VIX A;  2PJ7 A;  4O23 A;  2GRE A;  2J9A A;  1HEE A;  3V38 A;  1EE3 P; 
#chains in the Genus database with same CATH topology
 5IB9 A;  5HH1 A;  2I3C A;  1KC8 D;  1MAB A;  4RCY A;  3CT9 A;  4XKW A;  1AYE A;  1LAP A;  2VZY A;  3IGR A;  4JLY A;  3PZJ A;  3VNU A;  5AN9 A;  1WDT A;  4YWY A;  2QVP A;  3LQE A;  1ZM4 A;  2VBS A;  1YLE A;  2F7V A;  2RC5 A;  4TWE A;  3HUV A;  4RD6 A;  4QB9 A;  1NJI D;  4A38 A;  3OJX A;  3PGP A;  4UFW A;  5KW9 A;  1QFJ A;  3B3V A;  1VF7 A;  2O53 A;  4UAJ A;  1AIP A;  4MI4 A;  4ONU A;  4RPB A;  4X06 A;  3RO0 A;  1QSR A;  1LAN A;  7CPA A;  5A89 A;  3CTA A;  2B4B A;  2JEV A;  3CW2 A;  3CC4 B;  1JA1 A;  3H8F A;  3T53 B;  4MHZ A;  1BAV A;  2D4O A;  1QQ9 A;  4ONW A;  5JM6 A;  2P6G A;  1F20 A;  1S3Z A;  5EMI A;  5DS0 A;  2XEI A;  4X3R A;  1DDG A;  4G7W A;  5L46 A;  1HA3 A;  3RZA A;  1I8D A;  4AB7 A;  4MHD A;  3H8G A;  2D4P A;  2HLD A;  4A2Z A;  3GB0 A;  2ZTG A;  3T56 B;  2GAN A;  2AFX A;  3NE5 B;  4WZE A;  4UWI A;  1YVK A;  1XOV A;  2Q6K A;  4EH1 A;  4JYW A;  2FT0 A;  1FY7 A;  2YNC A;  1ZM2 A;  2ZEO A;  2OZH A;  3IFE A;  4RD0 A;  4II9 A;  2WZN A;  2QTL A;  2BEI A;  4K30 A;  4FUU A;  2WPW A;  4E8O A;  5CNP A;  2V7Q A;  1BOB A;  3W91 A;  3SI1 A;  1VQ8 B;  5K8N A;  4XQF A;  3LQ6 A;  4CYP A;  4ZY1 A;  1I21 A;  2NSM A;  1SM4 A;  3S9N A;  1W35 A;  2AFZ A;  1Y0Y A;  3WY9 A;  4NGP A;  3N5F A;  2JLM A;  3IWG A;  4NCN A;  3DLJ A;  1I18 A;  4UWJ A;  2OH1 A;  4PQA A;  2HMA A;  2PJ0 A;  5CPA A;  4ACA A;  2VNI A;  3B82 A;  4MFP A;  4KSF A;  2HDN B;  3PEI A;  4W9Y A;  2HQY A;  4UCM A;  4G1V A;  1CP7 A;  3FNC A;  4RDL A;  3PB7 X;  3PFO A;  5AGE A;  1FNB A;  3P2H A;  4CAW A;  2OYN A;  5HVG A;  1H42 A;  2X0K A;  3B7I A;  2ZZQ A;  1L0C A;  2BGJ A;  4QVA A;  4AVA A;  2ZEF A;  3TFY A;  1WOP A;  3GUX A;  4RPD A;  3W2F A;  1OHH A;  4R6T A;  3DDD A;  3SJF A;  5FIU A;  2YWG A;  4XKV A;  4NF1 A;  1VGY A;  1BQE A;  4Z4U A;  1VHO A;  1P4M A;  3R6K A;  4QV2 A;  2Q7S A;  3FIX A;  2DYI A;  3QNV A;  1N71 A;  4ZBG A;  1CG2 A;  1LFW A;  2VBV A;  1CNE A;  1S60 A;  4OLL A;  3R1K A;  3KL9 A;  1YJN B;  3BC9 A;  4QVT A;  1FT7 A;  3CP8 A;  3LAC A;  2JJ1 A;  1NE9 A;  2BVN A;  2BOA A;  3EO4 A;  1PKV A;  3BJ8 A;  4P10 A;  4YAU A;  1OZP A;  2Q43 A;  2BM1 A;  4JJX A;  3R95 A;  2Q7B A;  1FNO A;  4RI1 A;  1ZO0 A;  1MRZ A;  4PAA A;  2JBK A;  2C2W A;  2BMW A;  4HE5 A;  1M1K D;  3J81 k;  2ZEP A;  2V7U A;  4MY0 A;  4FD7 A;  4OAD A;  4UEE A;  3AVX A;  1KZL A;  2R7H A;  1HVX A;  5TV2 A;  4DNT B;  4C2Y A;  4NEX A;  3ZBT A;  4RJL A;  1TKH A;  4RD4 A;  2ZEG A;  4OPO A;  2GLF A;  3VH9 A;  3B3W A;  1UD4 A;  1YLO A;  1Q7L A;  5LYI A;  5I0C A;  2PJ5 A;  4KKU A;  1Q86 D;  1VJS A;  5ELY A;  3LOD A;  1OB2 A;  5BSY A;  1BMF A;  1EFR A;  3CC2 B;  5AG4 A;  4OPV A;  4ZYQ A;  4KSI A;  3I56 B;  1IOI A;  1EP3 B;  4X2T A;  3VMF A;  2BPO A;  4DNC A;  1TKF A;  4KOY A;  1H8E A;  5H5J A;  2M5S A;  4WZT A;  4MFZ A;  4B5P A;  1QX4 A;  4PC1 A;  3VAR A;  1YW4 A;  2V4D A;  5E6T A;  3A8I A;  4AC9 A;  1R5N A;  4E2A A;  4UZE A;  5J8F A;  3GY9 A;  1VHE A;  2I79 A;  1KUX A;  3ASP A;  4GQN A;  1E1R A;  1JJ2 B;  4HKF A;  2A4N A;  2B4D B;  2X6W A;  3CRZ A;  2R6H A;  1U2R A;  4EVY A;  2JN9 A;  4R76 A;  3E0K A;  2PJ3 A;  4M6I A;  5AG7 A;  3U2Q A;  4FWU A;  2J8R A;  4UEF A;  2V8V A;  4C0S A;  1E79 A;  2VI7 A;  3GKR A;  1G7C A;  4GM5 A;  4MMO A;  4LC0 A;  2FXF A;  4ZI6 A;  1N0V C;  1COW A;  4XOR A;  1OB0 A;  1NMT A;  1BX0 A;  2DER A;  1G7T A;  2ZBV A;  1JQG A;  1SKQ A;  2XZP A;  3CPW B;  4U9Y A;  4UEZ A;  3BXM A;  2HV2 A;  1CQX A;  3EXN A;  5HXB A;  4TSF A;  2PDO A;  2AE6 A;  2Z3P A;  1WSR A;  5C82 A;  3D7D A;  5F47 A;  1QSO A;  3ZUG A;  3L2N A;  3ZZ0 A;  4LQG A;  1LOK A;  1ZG7 A;  2Z3K A;  3FEE A;  2WSS A;  3WBK A;  4KVM E;  4YFJ A;  1E62 A;  3MRU A;  3OZU A;  4UIB A;  2NYQ A;  2EIX A;  4U9Z A;  2V7T A;  3HLP A;  2YNC C;  4NFR A;  5IYW A;  3FXT A;  2PQ8 A;  4NNJ A;  3S9L A;  5IB0 A;  4ZX8 A;  4PGO A;  4TT3 A;  2XZO A;  3VWE A;  2ZTN A;  2AFM A;  4M85 A;  2QDX A;  3OZW A;  2XNJ A;  2YWF A;  1LCP A;  2PRQ A;  1IID A;  1TXR A;  1OBR A;  3CCL B;  1T6Y A;  5TY0 A;  4WWV A;  4XON A;  1MK4 A;  3I9S A;  5DSZ A;  2XGJ A;  4Y9R A;  1B87 A;  1WK4 A;  1ELL P;  2REF A;  3OPO A;  2BGI A;  1CPX A;  2VYQ A;  3PBE A;  2EVN A;  4NCZ A;  4X05 A;  2Q6L A;  5FL7 A;  3FJU A;  3DR8 A;  4X7C A;  4P4B A;  5F09 A;  3P26 A;  4MYU A;  4M1K A;  3CCS B;  1VIX A;  2PJ7 A;  2C5B A;  2C27 A;  4FWT A;  3FKS A;  2QEX B;  3CD6 B;  1K9M D;  1AUG A;  2FE7 A;  1EP2 B;  3V38 A;  4K1X A;  1CBX A;  4LQ6 A;  1R3N A;  3WNB A;  2ZIT A;  4UCP A;  4RD2 A;  4ZY0 A;  1W87 A;  4B6Z A;  3GQB A;  3AVT A;  1DE4 C;  4CYQ A;  1VLY A;  3C26 A;  4B44 A;  3AVW A;  4B3G A;  5A27 A;  2BM0 A;  1V0C A;  3ZJ0 A;  2Q6I A;  1VQ4 B;  1SQH A;  4DQK A;  1PYT B;  1YX0 A;  5KTA A;  4F9U A;  1N0U A;  4C2Z A;  1R5O A;  1VQO B;  1VHS A;  2DPT A;  3SJZ A;  1LRZ A;  3SLN A;  4H2K A;  3SJE A;  5HXD A;  4IAV A;  1M4D A;  4TMT A;  3D66 A;  2Q04 A;  1A2Z A;  3CC7 B;  5KSW B;  2XEX A;  2DET A;  1MJ9 A;  4NGN A;  1JNY A;  1Q81 D;  2POK A;  2ZZF A;  1XQB A;  3NE8 A;  1YR0 A;  2OZG A;  2PJ8 A;  1FNM A;  1QGA A;  1T6X A;  3B3T A;  3B8G A;  3NFZ A;  1NSL A;  4JWP A;  2D3N A;  4AXV A;  2KVO A;  3KGQ A;  4MHY A;  3F0A A;  2B3U A;  3R96 A;  3MCA A;  2B7C A;  1BLL E;  4KOU A;  3T90 A;  3E1Y E;  3IWW A;  5G21 A;  3FJO A;  2C4U A;  1F2O A;  3V7A A;  4DK0 A;  3FB3 A;  2AFS A;  3OZV A;  5D29 A;  2JBJ A;  2Q4V A;  2H5M A;  3QSY A;  1IJF A;  3CCJ B;  1FNC A;  4JXQ A;  3CMA B;  3SI0 A;  3TO7 A;  3ASR A;  5AG6 A;  1Q82 D;  1XE4 A;  2REE A;  3BI0 A;  3BCD A;  3TO6 A;  3FF3 A;  2QTZ A;  5IX3 A;  2PJ1 A;  2G9D A;  4I49 A;  3NA6 A;  4WZL A;  1J4J A;  2FS5 A;  4M2L A;  5FVJ A;  1IB0 A;  1FND A;  4EME A;  1TLL A;  1Z8T A;  4CAV A;  4MRI A;  1YX2 A;  5A88 A;  1D2E A;  2PE3 A;  4B43 A;  4UA3 A;  4QHY A;  3A8J A;  4KKS A;  3ASS A;  3CXP A;  2EK8 A;  4YGO A;  5FNZ A;  2D3L A;  2EUI A;  4CQJ A;  3QB8 A;  2J7K A;  3A35 A;  4MFK A;  2NPF A;  2ABZ A;  2RB7 A;  3BCF A;  2BSA A;  4XPK A;  3PB6 X;  1VQ9 B;  4RD1 A;  2EWB A;  5F49 A;  1TIQ A;  4M6H A;  2PJ9 A;  4Z1M A;  1Y9K A;  3KQX A;  4XLH A;  3R9G A;  1S4M A;  4FN5 A;  4P4E A;  1QSN A;  1K4J A;  1N8R D;  3SXO A;  4Q7A A;  2BF4 A;  2XND A;  4A30 A;  4Z4Z A;  4P9S A;  4IHM A;  3K9U A;  3UY5 A;  3LMS A;  1DTD A;  4OC5 A;  3B2Y A;  1N06 A;  4AG9 A;  2XEG A;  2JIZ A;  5JPH A;  1NRK A;  5GV8 A;  4Z4Y A;  3CZX A;  1S7F A;  2NMT A;  1XE1 A;  4OOX A;  2GK6 A;  3F5B A;  4OOV A;  1V0F A;  3OEE A;  4IW3 B;  4ZGY B;  3LD2 A;  4LBY A;  4ASU A;  4XLA A;  5F46 A;  1S5K A;  4XL9 A;  4MJ8 A;  4K3N A;  3NH5 A;  2J8M A;  4H6U A;  3ES9 A;  3TOA A;  1JA0 A;  3QE2 A;  5K8O A;  1WP6 A;  2ZEM A;  4TMX A;  1KK0 A;  4DK1 A;  1YVO A;  3H9N A;  4FD5 A;  3I55 B;  4CGM A;  2OBS A;  3CB4 A;  2JEW A;  4FBE A;  1OGJ A;  5IYQ A;  2K5T A;  4L89 A;  4OME A;  3I1U A;  3A9L A;  4MFQ A;  4HNY B;  4YAO A;  3R6J A;  4C7H A;  1KMH A;  3BLN A;  2ZXH A;  4Y49 C;  5F48 A;  5J1Q A;  2X3U A;  3DGV A;  2FCK A;  4NBS A;  2W6J A;  5C88 A;  4JZ0 A;  2PRB A;  4OC0 A;  2F1L A;  2IMO A;  3TTH A;  4OIW A;  3GYA A;  3Q39 A;  3GIU A;  1K73 D;  3G3S A;  1YGH A;  2VBU A;  1KUY A;  3PFE A;  5LRJ A;  3ISX A;  1TF8 A;  3D2P A;  4L8A A;  2OU2 A;  4KOV A;  2ATR A;  1E63 A;  3QFC A;  2F43 A;  1P4N A;  3IU2 A;  4F0Y A;  3TE4 A;  2ZL5 A;  4ZV4 A;  3VR6 A;  1D8T A;  1R5B A;  2D74 A;  3A1P A;  2X8K A;  2PMD A;  4CAF A;  1RO5 A;  4X8I A;  3D4U A;  3W2G A;  3DSB A;  2V8G A;  2PJB A;  4KUA A;  3GVL A;  2GJP A;  1CPS A;  1IYK A;  4B3F X;  4UFX A;  2I1L A;  3CPA A;  1MJA A;  5CBM A;  5J3O A;  3JU4 A;  3A3B A;  3RNZ A;  3OFN A;  4N3N A;  3PRT A;  4ZCL A;  2FIW A;  2VZL A;  5FA6 A;  4NJQ A;  5GV7 A;  3D2M A;  1S7K A;  2JDD A;  4FD6 A;  4A37 A;  1VQ7 B;  2C4T A;  3JQQ A;  1M90 D;  2E1B A;  1VQM B;  3RYO A;  3U6B A;  3CP2 A;  4B47 A;  3A3G A;  2VJJ A;  4HNX B;  2XOK A;  1S72 B;  3CMM A;  3GIR A;  2PIY A;  1WTH D;  3GVK A;  5H86 A;  4UFV A;  1QUE A;  2C6C A;  2C78 A;  3V76 A;  4H89 A;  3SJG A;  3WQZ A;  1WSV A;  1Y7E A;  3QFS A;  1VQ5 B;  2C77 A;  4AVB A;  1E3Z A;  1GR1 A;  1ELM P;  2AHO A;  1NBM A;  4CS0 B;  2WSA A;  1YK3 A;  3TO9 A;  1UFH A;  2GJK A;  3WC5 A;  3NH4 A;  3B35 A;  1FRN A;  1S0U A;  3PB9 X;  3PB4 X;  2X85 A;  4ZCM A;  3ISZ A;  4XPL A;  4A94 A;  4B4D A;  1AMP A;  4BBH A;  4MCR A;  5AG5 A;  2DY1 A;  1ELO A;  3Q6Q A;  4X5K A;  4PAB A;  4P6Y A;  2BO9 A;  4CGP A;  4PXD A;  2YGW A;  5HZA A;  2YND A;  4PC3 A;  4OC3 A;  2B4D A;  3F8K A;  2DF5 A;  1YME A;  1TF9 A;  3G6E B;  1M4L A;  2LZJ A;  3K9T A;  4C68 A;  1BO4 A;  5LYF A;  1Z8X A;  3G05 A;  3LVB A;  2IQ6 A;  2CNS A;  2GQF A;  2JJ2 A;  4GXH A;  4XM3 A;  2QN6 A;  4XLC A;  1QVG B;  2FSR A;  3VO1 A;  5J35 A;  1XRY A;  1KWM A;  3KI9 A;  4WJB A;  1E43 A;  3ZIA A;  4NGM A;  4E0F A;  2CBX A;  2AJ6 A;  1OGI A;  2W6I A;  1X12 A;  4M4S A;  4H6Z A;  2BV3 A;  5F4M A;  1BPN A;  4DJL A;  2P6F A;  1UD3 A;  2BL1 A;  5F4O A;  3OE7 A;  1YIT B;  2O28 A;  4CAE A;  4II3 A;  1XBU A;  2P6E A;  1IJE A;  1WU8 A;  1YQE A;  1DG1 G;  3FPP A;  2J9A A;  1EE3 P;  4Y7C A;  4PXE A;  5EC4 A;  2ZW4 A;  3S6K A;  2EFG A;  2Z10 A;  1Z2L A;  5THX A;  3R9F A;  4A32 A;  1W0K A;  3V7Z A;  1B23 P;  1QST A;  1N07 A;  2V7W A;  2DEA A;  3CCQ B;  3LWU A;  4OID A;  1XB2 A;  2VJI A;  2Z3M A;  4L8J A;  1E64 A;  4UCN A;  2Y0M A;  2YWH A;  1K28 D;  4JXR A;  4YU9 A;  2WPD A;  1PU9 A;  4QC6 A;  3H4Q A;  3N7Z A;  2Z3O A;  3ZC3 A;  4MXU A;  4II2 A;  4ZGQ B;  3EFA A;  3IEH A;  2CW5 A;  4QFM A;  2Q51 A;  3NE7 A;  1IHM A;  4QVJ A;  2HC9 A;  1V5V A;  4AF7 A;  3D7F A;  2GE3 A;  4XLF A;  4P22 A;  1KQS B;  2Q0Y A;  2B5G A;  4P1V A;  4CAX A;  3T51 B;  3W5H A;  3IO1 A;  4E0A A;  4YAW A;  3IIB A;  2F8H A;  3AVV A;  3TC8 A;  1Q2Y A;  2OK7 A;  3IJ3 A;  4QBJ A;  5F4J A;  3W2H A;  3B3C A;  4KKT A;  1DDI A;  3MN8 A;  2ANP A;  3BJ7 A;  3D7H A;  5GCN A;  1ZG9 A;  3DDY A;  1TKJ A;  2HUZ A;  4BIN A;  2DEU A;  2QA4 B;  1Y0R A;  1Z8L A;  1KTV A;  5KTD A;  4CYO A;  1B2R A;  5G22 A;  1HDU A;  1G7R A;  1SKY B;  2BN4 A;  1H8L A;  4GS4 A;  4J0Q A;  1VKC A;  3KEW A;  4CPA A;  4Q38 A;  1YJW B;  3AVU A;  1WPC A;  4DQL A;  4PPZ A;  4C7I A;  2DIE A;  5K8M A;  1VQ6 B;  1EFU A;  2CTC A;  1Q9S A;  1YJ9 B;  3B78 A;  2C1C A;  2B5O A;  3JTK A;  2RFH A;  4X7F A;  4LUA A;  1XFO A;  4CGO A;  2VNH A;  1HDQ A;  3WR7 A;  1YHQ B;  4A39 A;  1XJO A;  1VQK B;  1Z4R A;  3QAY A;  1PJ6 A;  2OTJ B;  1JWQ A;  2WZP P;  2WPX A;  3BQJ A;  3FYN A;  3KZW A;  4XMY A;  1IIC A;  4NGR A;  3VAT A;  1FX0 A;  1IU8 A;  3WYA A;  3OWC A;  4X0C A;  5TR9 A;  3IC1 A;  3CCM B;  1MJB A;  2V31 A;  2ZBU A;  3OJW A;  1GJR A;  3QFT A;  2B58 A;  3W6S A;  2X7B A;  4CGL A;  5G20 A;  2EBJ A;  2CND A;  1EWY A;  4P4I A;  1XMT A;  3KR5 A;  2XNC A;  3H8E A;  2E1R A;  4OP4 A;  2ZED A;  4RD3 A;  1P0H A;  3OEH A;  4PK3 A;  4MCQ A;  4DUK A;  2PR8 A;  2QML A;  4OAE A;  3D8P A;  1GVH A;  1AMO A;  4J3G A;  1EP1 B;  2PSW A;  3FH4 A;  2XEF A;  4OC1 A;  4HIZ A;  3ZPN A;  3G71 B;  2R9V A;  1XEB A;  4MHP A;  1YSJ A;  4LX9 A;  3WNC A;  4Z65 A;  1HZE A;  1XMB A;  5LMZ A;  4BMH A;  2IJZ A;  4UZF A;  1PJ5 A;  2PIZ A;  3TOB A;  4Z4R A;  5J8C A;  3V8I A;  4AVZ A;  3ASQ A;  1VQN B;  5G1Z A;  4XLE A;  2ARH A;  2Z3L A;  2YNE A;  5THW A;  2PJC A;  1IYL A;  5BWA B;  2YWE A;  3VNV A;  4XNH B;  3PUM A;  4OOS A;  3FX6 A;  1ZLH A;  3WND A;  2OBT A;  2VZZ A;  4B5O A;  4XNF A;  1EFC A;  4XPD C;  1ZM3 A;  1OB5 A;  4P4J A;  4KOR A;  3W2I A;  4U5Y A;  2VBQ A;  1Z9U A;  2CXA A;  4MCP A;  4Q7J B;  2G3A A;  2QEC A;  1VQP B;  2KCW A;  1V0E A;  4NGT A;  5ISV A;  1IGB A;  2CIJ A;  3ZBU A;  4FK8 A;  1QMU A;  2ZEL A;  4UBR A;  1KD1 D;  1I7P A;  2FL4 A;  2PVW A;  3FBU A;  3NH8 A;  4X7E A;  5D8N A;  4B12 A;  3SXN A;  5BSX A;  4XD7 A;  1NB9 A;  5EBV A;  3BI1 A;  3BHX A;  4P26 A;  3RAM A;  3W5U A;  1TUI A;  3ZZI A;  3EY5 A;  4P45 A;  4A33 A;  5HVF A;  3T9Y A;  3AST A;  3CXQ A;  2V7V A;  1KK2 A;  2V77 A;  2WJV A;  1W2B B;  1WWZ A;  2PJ6 A;  3CME B;  2Z0Z A;  5IV0 A;  3I1F A;  4M3S A;  4P2N A;  2PJA A;  2C5H A;  1CP6 A;  2CC2 A;  1QGZ A;  4P12 A;  4MFL A;  4P3Y A;  1QFY A;  5EMN A;  5A8A A;  4FD4 A;  4R3K A;  4R57 A;  4OC4 A;  5HMN A;  2IL4 A;  4RDK A;  4B13 A;  4XNH C;  1RQR A;  2RC4 A;  2WJY A;  4RDJ A;  2QMU A;  3SJP A;  2B7B A;  4LBV A;  3OW7 A;  2Q44 A;  3PBB A;  2GJR A;  3EC4 A;  1ZM9 A;  4JD6 A;  3KAS A;  4KOS A;  3D7G A;  1BJK A;  1UD6 A;  4G6I A;  1TTT A;  3PUN A;  3VO2 A;  4DNR B;  3D67 A;  3JVN A;  4A95 A;  1QSM A;  5JQ4 A;  4G5G A;  3B3S A;  1F57 A;  4MHN A;  4PV6 A;  4PSW A;  2ZEE A;  2Q4Y A;  1KRH A;  1D1N A;  4KOT A;  4R87 A;  2AFW A;  1ARL A;  1I12 A;  1EFT A;  2VXK A;  3AGQ A;  1Z8W A;  4TMW A;  1H8H A;  4F8Z A;  4B3X A;  1IOF A;  3G8W A;  4B14 A;  2QIR A;  4NSQ A;  1GAQ A;  5E96 A;  4KUB A;  2DXQ A;  3S6F A;  3MHP A;  2VL1 A;  3AVY A;  5DWM A;  2DPS A;  4ZCI A;  1KJZ A;  3FED A;  3CCU B;  1BPM A;  2CF4 A;  4OKO A;  3MMP A;  2QE7 A;  2PR1 A;  4UZU A;  3BY2 A;  3D68 A;  3FPK A;  4KVX A;  3CXS A;  1B6B A;  2B5G B;  4G1P A;  4PXC A;  3KR4 A;  3JUW A;  2ZZG A;  2R98 A;  3IU1 A;  3OKX A;  2QGG A;  2RC6 A;  2R8V A;  2CK3 A;  4O23 A;  3Q6R A;  2JDC A;  1HEE A;  5LRG A;  3SLD A;  4B11 A;  2D9R A;  2ODF A;  4R8F A;  2Z6B D;  1Z4E A;  4RS2 A;  3U6K A;  4QUZ A;  1YRE A;  2OR4 A;  2GIV A;  4OP7 A;  5A28 A;  2CTB A;  4UF4 A;  4F6A A;  2Z11 A;  2GK7 A;  1GHE A;  5K8P A;  1XIX A;  1X10 A;  2JDI A;  6CPA A;  4B10 A;  2ZXV A;  1M4G A;  1F60 A;  1UD8 A;  4Z4S A;  2EO8 A;  2VNJ A;  1Z5R A;  3SI2 A;  3SJX A;  5CDF A;  4XOP A;  2HB6 A;  5LYD A;  5FO0 A;  1CJW A;  1Y7R A;  1BPL A;  1W34 A;  2B3V A;  3CCE B;  1NB0 A;  3HAG A;  4H9G A;  1LAM A;  1E3X A;  4MY3 A;  4LBZ A;  2Z3N A;  2C6G A;  3JRU A;  4XPD B;  4BD9 A;  2ZL6 A;  3S6H A;  2F5I A;  5KNL A;  2P0W A;  2PJ4 A;  4U9U A;  4YAF A;  1IB1 E;  4YEJ A;  4UIA A;  2GPJ A;  2PVV A;  2VEZ A;  3T8W A;  3FRM A;  2OK8 A;  4PC2 A;  4JMQ A;  2PCU A;  5B6I A;  2Q6O A;  3QFR A;  4MCS A;  1E1Q A;  4PXB A;  4G1B A;  2QYV A;  4Q36 A;  5DWN A;  3PA1 A;  1T5E A;  2XEJ A;  3G4S B;  3IWE A;  3PB8 X;  1H85 A;  3ZZT A;  4AVC A;  3P27 A;  2ZL7 A;  1KK3 A;  3K2K A;  5TRD A;  4NGQ A;  2F1M A;  3JQR A;  4KSA A;  3S6G A;  4FXU A;  1J9Z A;  3R9E A;  4AG7 A;  5DN6 A;  4CYN A;  2P3M A;  4Y9U A;  2OOT A;  3B8H A;  1CX8 A;  4QUS A;  1NSA A;  2FIA A;  4IF5 A;  3WXM A;  3BNW A;  2V8H A;  3GSI A;  1ON0 A;  3H94 A;  5IK2 A;  3TCV A;  3PEN A;  5JGF A;  3LO8 A;  3CXC B;  3WC7 A;  1PCA A;  4CRY B;  3H5Z A;  1QVF B;  1ARM A;  3CDX A;  3CCR B;  4CRZ B;  3LNN A;  5KTC A;  2OZU A;  2CNM A;  2WYR A;  2F4N A;  3P2F A;  4HNW B;  2FX3 A;  1CNF A;  4P44 A;  4F7D A;  4FAI A;  5HKK A;  1N08 A;  3E20 A;  2BSW A;  4M53 A;  4C43 A;  2GLJ A;  4NGS A;  1KK1 A;  3OP1 A;  1BX1 A;  4P3I A;  1M44 A;  4WZK A;  1ZLI A;  1A8P A;  5LYL A;  3FMC A;  2FVG A;  2XZL A;  2WUU A;  2VBT A;  3Q3A A;  4NJR A;  4EFD A;  5IYN A;  1U6M A;  3KKW A;  1RQP A;  2O4H A;  1FRQ A;  1FDR A;  5HVH A;  1EXM A;  1QFZ A;  3ONY A;  2GU2 A;  2BUE A;  3DR6 A;  1TVC A;  3QAH A;  2X6X A;  4Z4T A;  3TT2 A;  1YW6 A;  5I4M A;  4IUS A;  4R9M A;  5JBQ A;  3BH4 A;  2ZPA A;  2VQY A;  1G7S A;  3PA2 A;  2ZW7 A;  4TN1 A;  2ZW6 A;  1R57 A;  2ZEH A;  3OAA A;  4C2X A;  4RM0 A;  3CPX A;  2G0B A;  4A31 A;  1UD2 A;  4MBU A;  4ORF A;  4ZGN B;  1VQL B;  4YXW A;  2I00 A;  3VWD A;  4X7D A;  1Q2D A;  1WOS A;  4YHB A;  3ONU A;  2PIA A;  2BCO A;  1QUF A;  3I3G A;  4Z4W A;  4CGN A;  3JQP A;  2X6Y A;  3DNS A;  1S7L A;  4X07 A;  2WR8 A;  2VNK A;  1ZUN B;  1K8A D;  4ACB A;  1JB9 A;  4BPR A;  2HCJ B;  1M4I A;  1KUV A;  4TKO B;  1NDH A;  1R43 A;  4Z4V A;  2OB0 A;  1PJ7 A;  3ZZU A;  3GVJ A;  3SHP A;  2DOG A;  3TX8 A;  4P4D A;  4KLW A;  2OTL B;  2ZEN A;  2Q4Z A;  2AFU A;  4KS9 A;  1UWY A;  4PC6 A;  4RLZ A;  4YAL A;  4KOX A;  3FVL A;  4ZY2 A;  4MFJ A;  1YI2 B;  1N05 A;  3WC6 A;  4TMV A;  1UMK A;  2EK9 A;  3PVD A;  1WOO A;  5H84 A;  1GAW A;  2OBR A;  4PC7 A;  5H59 A;  1PUA A;  4N3G A;  3SKB A;  3W6X A;  3SEJ A;  4M6G A;  1QG0 A;  2X53 S;  4KVO E;  4IK2 A;  1VLO A;  4G7X A;  2V8D A;  3FEC A;  1Q2C A;  2ZOF A;  3CCV B;  2ZZE A;  4XOT A;  1CM0 A;  1WOR A;  3D3S A;  1RXT A;  1Y9W A;  4YEL A;  4KLV A;  4F0X A;  3CES A;  1QH0 A;  4Y49 B;  3W2E A;  2NV4 A;  4RUH A;  2QJ8 A;  5HZB A;  4HPS A;  4F9V A;  4LBW A;  3KQZ A;  4OC2 A;  4B48 A;  2AFO A;  3WAB A;  3WT4 A;  5IYR A;  1XF8 A;  8CPA A;  4PSX A;  1GYT A;  2PLF A;  4TNU A;  4PK2 A;  3OW2 B;  1YIJ B;  1M1D A;  4ZX9 A;  3OOC A;  4P25 A;  2CRV A;  1Q7Y D;  4MYT A;  4EWT A;  2CNT A;  3GLJ A;  4KZT A;  3RBU A;  3PP9 A;  1T6Z A;  3AGP A;  4RCZ A;  3S9M A;  3BY1 A;  4TMZ A;  2ZOG A;  2PJ2 A;  1GO2 A;  2V7X A;  4P6V F;  4OPS A;  2ZXI A;  4AF6 A;  2J8N A;  3WBJ A;  4RN7 A;  1ZG8 A;  4P4F A;  2GFQ A;  1I1D A;  4DYO A;  4NXY A;  4M0L A;  3A8K A;  1UD5 A;  4XR6 A;  3KHX A;  2DCU A;  4WQM A;  2G3T A;  4ROX A;  1W9X A;  4KOW A;  1S7N A;  1DAR A;  4XN0 A;  4R7M A;  4YRH A;  5LRK A;  1KZF A;  3KHZ A;  5IYP A;  3W5V A;  2R1I A;  1W0J A;  3D26 A;  5JH9 A;  1IY7 A;  5FO1 A;  1F2P A;  2CY2 A;  4HE6 A;  1RTQ A;  2C6P A;  4R3L A;  2PC1 A;  3RY8 A;  4R71 A;  1BLI A;  4B5P B;  3Q38 A;  1QGY A;  2GRE A;  3MGD A;  4XN3 A;  2ZW5 A; 
#chains in the Genus database with same CATH homology
 5IB9 A;  2I3C A;  1CBX A;  4PXE A;  1R3N A;  4R8F A;  1Z2L A;  3CT9 A;  1AYE A;  4ZY0 A;  1LAP A;  3V7Z A;  4B6Z A;  2OR4 A;  1DE4 C;  2DEA A;  2CTB A;  3LWU A;  4UF4 A;  4OID A;  4YWY A;  2QVP A;  5K8P A;  2F7V A;  4TWE A;  3HUV A;  4YU9 A;  6CPA A;  1PYT B;  4F9U A;  4A38 A;  4MXU A;  3B3V A;  3IEH A;  2O53 A;  2Q51 A;  5HXD A;  4H2K A;  2HC9 A;  3SJE A;  4IAV A;  3D7F A;  1Z5R A;  3SI2 A;  3D66 A;  3SJX A;  2HB6 A;  5LYD A;  1LAN A;  7CPA A;  3IO1 A;  1LAM A;  4NGN A;  3IIB A;  2F8H A;  2POK A;  3TC8 A;  2C6G A;  3JRU A;  3IJ3 A;  4BD9 A;  3H8F A;  4MHZ A;  3MN8 A;  3B3C A;  1BAV A;  2ANP A;  2PJ4 A;  1QQ9 A;  4ONW A;  2PJ8 A;  3D7H A;  5JM6 A;  1ZG9 A;  3B3T A;  3NFZ A;  4UIA A;  1TKJ A;  5DS0 A;  2XEI A;  4X3R A;  1Y0R A;  4AXV A;  1Z8L A;  4MHY A;  3KGQ A;  3RZA A;  2PVV A;  3T8W A;  1HDU A;  3H8G A;  2PCU A;  1BLL E;  1H8L A;  4MCS A;  3IWW A;  4PXB A;  4CPA A;  2QYV A;  5LRG A;  3GB0 A;  1F2O A;  2XEJ A;  2AFX A;  3PB8 X;  4PPZ A;  2AFS A;  3K2K A;  5D29 A;  2JBJ A;  4NGQ A;  4JYW A;  5K8M A;  2CTC A;  2ZEO A;  2C1C A;  3SI0 A;  3IFE A;  2RFH A;  2WZN A;  2OOT A;  1XFO A;  4FUU A;  1CX8 A;  1NSA A;  1HDQ A;  3BI0 A;  3FF3 A;  2V8H A;  4A39 A;  1XJO A;  2PJ1 A;  3SI1 A;  5K8N A;  2G9D A;  3NA6 A;  4ZY1 A;  2NSM A;  3S9N A;  2AFZ A;  1Y0Y A;  4NGP A;  3N5F A;  5JGF A;  4EME A;  3KZW A;  1PCA A;  3WC7 A;  3DLJ A;  4NGR A;  4MRI A;  4PQA A;  3VAT A;  2PJ0 A;  5CPA A;  2PE3 A;  3PEI A;  2EK8 A;  1ARM A;  3CDX A;  3IC1 A;  4W9Y A;  2ABZ A;  2RB7 A;  1CP7 A;  2WYR A;  3PB7 X;  3PFO A;  3PB6 X;  4P44 A;  2EWB A;  4FAI A;  5HVG A;  2GLJ A;  3B7I A;  4NGS A;  2PJ9 A;  2ZEF A;  3KQX A;  3GUX A;  4P4I A;  3KR5 A;  3H8E A;  4P4E A;  4R6T A;  1ZLI A;  3SJF A;  4OP4 A;  5LYL A;  2ZED A;  3FMC A;  2FVG A;  1VGY A;  4NJR A;  4MCQ A;  4EFD A;  4Q7A A;  4DUK A;  4IHM A;  1VHO A;  2O4H A;  3LMS A;  5HVH A;  1DTD A;  3QNV A;  3B2Y A;  4OC5 A;  2GU2 A;  2XEG A;  1CG2 A;  1LFW A;  3FH4 A;  2XEF A;  4OC1 A;  1YW6 A;  5I4M A;  3KL9 A;  4MHP A;  1YSJ A;  1FT7 A;  2BOA A;  4Z65 A;  1XMB A;  4P10 A;  2IJZ A;  2Q43 A;  2ZEH A;  2PIZ A;  3CPX A;  4K3N A;  3NH5 A;  1FNO A;  5K8O A;  2JBK A;  5THW A;  2ZEM A;  2PJC A;  2BCO A;  2ZEP A;  3FX6 A;  1ZLH A;  2JEW A;  4UEE A;  4FBE A;  4OME A;  3I1U A;  4P4J A;  5J1Q A;  3DGV A;  1TKH A;  4JZ0 A;  4MCP A;  4OC0 A;  2ZEG A;  2GLF A;  3VH9 A;  3B3W A;  2IMO A;  1YLO A;  1Q7L A;  5LYI A;  4NGT A;  4OIW A;  2PJ5 A;  1IGB A;  5ELY A;  2CIJ A;  1R43 A;  3PFE A;  5LRJ A;  3ISX A;  1TF8 A;  1QMU A;  2ZEL A;  4ZYQ A;  4KSI A;  3TX8 A;  4P4D A;  2PVW A;  3NH8 A;  4X2T A;  5D8N A;  2ZEN A;  2Q4Z A;  2AFU A;  1TKF A;  1UWY A;  4X8I A;  3D4U A;  3VAR A;  4ZY2 A;  3FVL A;  2V8G A;  2PJB A;  1CPS A;  1YW4 A;  3WC6 A;  3BI1 A;  2EK9 A;  3BHX A;  3CPA A;  5CBM A;  3RAM A;  1VHE A;  4P45 A;  5HVF A;  3PRT A;  4NJQ A;  2V77 A;  2PJ6 A;  2PJA A;  4IK2 A;  4R76 A;  1CP6 A;  2V8D A;  2PJ3 A;  3FEC A;  4A37 A;  2ZOF A;  4FWU A;  4UEF A;  2V8V A;  4OC4 A;  4GM5 A;  4MMO A;  4ZI6 A;  2PIY A;  2C6C A;  3SJG A;  1JQG A;  1Y7E A;  4UEZ A;  3BXM A;  1ELM P;  3PBB A;  4RUH A;  3WC5 A;  2QJ8 A;  3B35 A;  3D7D A;  3KAS A;  3NH4 A;  4F9V A;  3KQZ A;  3D7G A;  4OC2 A;  3PB9 X;  2AFO A;  3PB4 X;  3WAB A;  3WT4 A;  3L2N A;  3D67 A;  3ISZ A;  4LQG A;  4A94 A;  1LOK A;  1AMP A;  1ZG7 A;  8CPA A;  3FEE A;  1GYT A;  4MCR A;  4TNU A;  4P6Y A;  2BO9 A;  4ZX9 A;  3B3S A;  4PXD A;  1F57 A;  3MRU A;  4MHN A;  4OC3 A;  4UIB A;  2NYQ A;  4EWT A;  3GLJ A;  2ZEE A;  3RBU A;  3HLP A;  4NFR A;  1YME A;  1TF9 A;  1M4L A;  3S9L A;  4ZX8 A;  3S9M A;  3K9T A;  2AFW A;  1ARL A;  2ZOG A;  2PJ2 A;  2AFM A;  1LCP A;  2PRQ A;  5LYF A;  1TXR A;  1OBR A;  4F8Z A;  1ZG8 A;  2IQ6 A;  4P4F A;  4DYO A;  4WWV A;  3KHX A;  2VL1 A;  1XRY A;  1ELL P;  1KWM A;  3KI9 A;  1CPX A;  4WJB A;  3FED A;  3PBE A;  4NGM A;  4R7M A;  1BPM A;  2CF4 A;  4OKO A;  5LRK A;  3KHZ A;  3FJU A;  3D68 A;  5JH9 A;  4P4B A;  1IY7 A;  4G1P A;  5F09 A;  1BPN A;  1F2P A;  4PXC A;  3KR4 A;  4DJL A;  1RTQ A;  2C6P A;  1XBU A;  1VIX A;  2PJ7 A;  4O23 A;  2GRE A;  2J9A A;  1HEE A;  3V38 A;  1EE3 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...