3CPXA

Crystal structure of putative m42 glutamyl aminopeptidase (yp_676701.1) from cytophaga hutchinsonii atcc 33406 at 2.39 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
309
Chain Sequence
ENLYFQGMQLLKELCSIHAPSGNEEPLKDFILEYIRSNAGSWSYQPVIYADNDLQDCIVLVFGNPRTAVFAHMDSIGFTVSYNNHLHPIGSPSAKEGYRLVGKDSNGDIEGVLKIVDEEWMLETDRLIDRGTEVTFKPDFREEGDFILTPYLDDRLGVWTALELAKTLEHGIIAFTCWEEHGGGSVAYLARWIYETFHVKQSLICDITWVTEGVEAGKGVAISMRDRMIPRKKYVNRIIELARQTDIPFQLEVEGAGASDGRELQLSPYPWDWCFIGAPEKDAHTPNECVHKKDIESMVGLYKYLMEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase, M42 family
publication title Crystal structure of putative M42 glutamyl aminopeptidase (YP_676701.1) from Cytophaga hutchinsonii ATCC 33406 at 2.39 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Hydrolase
total genus 95
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 3cpxA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3cpxA01
3TC8A 3D7FA 2ZOFA 4FAIA 3B7IA 4R8FA 4NGSA 3D7GA 4GM5A 3IWWA 5LYIA 2PE3A 2ZEHA 1JQGA 4OC4A 3ISZA 2VL1A 4P10A 1LCPA 3WC7A 4R76A 5I4MA 1YSJA 3DGVA 4YU9A 3SJFA 4B6ZA 3PBBA 3K2KA 4CPAA 4PPZA 1ARMA 3B3VA 3FX6A 2QYVA 3KR5A 2PCUA 1ZG7A 1DE4C 2V8GA 4FBEA 4P4BA 4AXVA 4P6YA 4NJRA 1TXRA 3KQXA 4NGTA 1LFWA 4ZY0A 5THWA 2DEAA 1CBXA 3FEDA 1Z5RA 1BPNA 1BAVA 2I3CA 3GUXA 5LYFA 5JGFA 5LYLA 3IO1A 2Q51A 3D7HA 3I1UA 2AFSA 2PVWA 2PJ5A 1DTDA 4R6TA 4WJBA 5K8PA 1CP7A 2XEGA 1R3NA 3B35A 4P4FA 2JEWA 1LANA 2V8DA 4WWVA 4W9YA 4A38A 4TWEA 4O23A 1NSAA 2IJZA 5F09A 4P45A 5JM6A 4R7MA 1HDUA 1EE3P 3BHXA 1PCAA 3N5FA 4PXBA 4IAVA 3PEIA 4MHNA 1CPXA 2AFZA 3RBUA 4JZ0A 4FUUA 1HDQA 4OIDA 4OC1A 3KL9A 2GU2A 4H2KA 3LMSA 5D8NA 4ZY2A 1LAPA 1VGYA 2V8VA 2RFHA 1ZG8A 1YW4A 1VIXA 2AFWA 2EK9A 4A37A 5JH9A 1Y7EA 4F9VA 4A94A 4EMEA 2ZEPA 2PVVA 2AFOA 2ZELA 3IEHA 1ELMP 2PRQA 2ZEFA 3NH4A 3SJEA 1VHEA 4UIBA 3PFEA 1H8LA 4K3NA 4NGQA 1PYTB 2CF4A 4UIAA 4Q7AA 1GYTA 3DLJA 1BLLE 3FJUA 1ZG9A 3FEEA 1CG2A 3PB9X 4P4IA 4UF4A 2IQ6A 2GLFA 3CT9A 1TKHA 4ZY1A 3S9LA 4JYWA 1F2PA 4NFRA 2PJ9A 5K8MA 4TNUA 2PJAA 4MHYA 3CPXA 3PB4X 4MHZA 2PJ8A 3B3WA 4OKOA 5HVFA 3PRTA 3IFEA 1AMPA 3SJXA 4DJLA 3CDXA 3PBEA 4OC5A 5ELYA 4IK2A 4X3RA 2PIZA 3PB6X 3KR4A 2PJ6A 5LRKA 2ZEGA 3KGQA 3SJGA 2QVPA 1UWYA 3MRUA 3FH4A 4A39A 4F9UA 1LAMA 6CPAA 2PJ3A 1AYEA 3KHZA 1CP6A 3GLJA 3RAMA 2ZEMA 2O53A 3H8GA 4MHPA 4IHMA 3NFZA 3D67A 4MCQA 4P44A 3NH8A 2HB6A 2Q4ZA 2AFMA 3PB8X 4DYOA 2ZOGA 1XRYA 4NGRA 3FVLA 3H8FA 4OIWA 4MCSA 4KSIA 1BPMA 4PXDA 1F57A 3L2NA 3VATA 3K9TA 1Y0YA 3FF3A 4OC0A 3MN8A 1FT7A 4DUKA 5J1QA 5CBMA 3D68A 3KQZA 3BXMA 4F8ZA 4Z65A 3CPAA 3WABA 1XBUA 2F8HA 2AFUA 2F7VA 2ANPA 2CIJA 4MRIA 3H8EA 3GB0A 3ISXA 4RUHA 3PB7X 2CTCA 2OR4A 3KZWA 1QMUA 2WYRA 2OOTA 3HLPA 3IJ3A 5DS0A 3TX8A 4X8IA 1ZLHA 4ZYQA 1Y0RA 4MCPA 2HC9A 2Q43A 3BI0A 3B3CA 3T8WA 3WT4A 4NJQA 2PJ1A 2V8HA 3SI2A 5HVHA 2G9DA 4PXEA 2JBJA 2PIYA 1RTQA 3VARA 3SI1A 3BI1A 2ZEDA 1ELLP 5HVGA 3QNVA 4OC3A 2POKA 2J9AA 4LQGA 3VH9A 2XEIA 2AFXA 5D29A 2XEJA 3WC5A 2GLJA 4FWUA 2PJBA 4MCRA 2GREA 4MXUA 3KI9A 3V7ZA 1ARLA 3B2YA 5CPAA 2O4HA 2PJCA 4UEZA 2PJ4A 4UEFA 2BCOA 1IY7A 5LYDA 2ZEEA 3D4UA 4NGPA 7CPAA 3IC1A 1ZLIA 3LWUA 2JBKA 2WZNA 3V38A 4ONWA 4P4JA 4NGMA 2ZEOA 4X2TA 2NSMA 1KWMA 4OC2A 1OBRA 2PJ7A 3S9NA 2C1CA 2XEFA 4MMOA 5K8OA 3HUVA 2QJ8A 1Z2LA 3KASA 4OMEA 4YWYA 1TF8A 2C6CA 3B3TA 5LRGA 1LOKA 3S9MA 4P4EA 4OP4A 4PQAA 1YW6A 4UEEA 4ZX8A 1IGBA 3FMCA 1TKFA 3RZAA 2ZENA 3NH5A 4PXCA 3PFOA 2EWBA 4ZX9A 4EFDA 5HXDA 4NGNA 4BD9A 3KHXA 1TKJA 2PJ0A 2RB7A 2EK8A 3D66A 2CTBA 1TF9A 4P4DA 3NA6A 3IIBA 2V77A 4G1PA 5LRJA 8CPAA 3SI0A 2PJ2A 1F2OA 1M4LA 1VHOA 1QQ9A 2NYQA 2C6GA 1YLOA 2BOAA 4ZI6A 2ABZA 1Q7LA 2IMOA 1FNOA 3WC6A 5K8NA 4EWTA 1XFOA 1Z8LA 1CPSA 1R43A 3D7DA 3JRUA 1HEEA 1XMBA 2C6PA 5IB9A 2FVGA 2BO9A 1CX8A 3FECA 3B3SA 1YMEA 1XJOA
chains in the Genus database with same CATH superfamily
1HZEA 2ARHA 2ZZEA 3D26A 4PC3A 3D7GA 1BOBA 4MFPA 4N3NA 2PQ8A 2DF5A 2C4TA 4AG7A 4UFXA 2KVOA 4A95A 4R76A 3FPPA 1KUYA 2GK6A 2VZYA 1S7LA 3OE7A 4YEJA 5FO0A 1G7CA 4ONUA 4PPZA 1IIDA 1E1RA 5AG4A 3CD6B 2X3UA 4XLEA 1DE4C 3RO0A 2B5GA 2VNIA 4CGPA 2PMDA 1W0KA 5TRDA 2VBSA 4P26A 2I3CA 5LYFA 4UA3A 4Z4UA 3IO1A 2Q51A 3T51B 2EIXA 3D7HA 2F4NA 1PU9A 1XQBA 2DIEA 5G21A 4XPLA 4MYTA 1PJ7A 4WJBA 4B48A 1IB0A 2XEGA 2CC2A 4P4FA 2JEWA 1LANA 2R98A 2XNCA 3TCVA 1WSRA 4O23A 3CCSB 2AE6A 5FNZA 4R87A 5JM6A 1N05A 3BHXA 3SJPA 4DQKA 1BO4A 4FD4A 1M90D 3WQZA 5ISVA 1OGJA 4PXBA 4IAVA 1N0UA 4FD5A 2C78A 4MHNA 4JZ0A 1DG1G 4I49A 3BH4A 4PC6A 4MBUA 1E63A 4KVXA 1HDQA 3LODA 2HDNB 4XNFA 3IWEA 3PA2A 2X7BA 4OIDA 1J9ZA 4X5KA 4H2KA 3ONYA 5D8NA 4ZY2A 4HE5A 1VGYA 2PSWA 3QFTA 1Q2CA 1ZG8A 1I7PA 1YW4A 4C2ZA 1YITB 3P2HA 5A27A 2H5MA 4UWIA 3LO8A 2XZPA 3W2EA 2AFOA 2WUUA 3VR6A 1ZM9A 3SJEA 2DETA 4PK3A 3PFEA 1PJ6A 1XB2A 4UIAA 3ZC3A 4Q7AA 1GYTA 4PK2A 1BLLE 1CJWA 2OYNA 4KLVA 3OJWA 3PB9X 4UCMA 2B7CA 4JLYA 2GLFA 3OKXA 2CW5A 1TKHA 3ZZ0A 3P2FA 4NFRA 2PJ9A 3CMMA 2PJAA 4NBSA 3CPXA 2CRVA 2EBJA 2GJPA 3CCJB 2QN6A 4Z4RA 1AMPA 2YNCA 3IFEA 3SJXA 1MRZA 5A88A 2GQFA 1J4JA 5ELYA 4X3RA 4XL9A 2QA4B 4RDLA 2PDOA 2W6IA 1V0FA 1RQRA 4CGOA 4KSAA 4XR6A 4A39A 1AYEA 2OZHA 1P4NA 1M1KD 1I1DA 2RC4A 3NFZA 4MCQA 4CYNA 5B6IA 2Q4ZA 4KKTA 4U9UA 3FVLA 3IGRA 1UD5A 4MCSA 3ZBTA 1VLOA 4TSFA 2REFA 2GFQA 1RXTA 3L2NA 3VATA 4NCNA 3T56B 4CYOA 1FT7A 5HXBA 5J1QA 1WK4A 4ORFA 3SHPA 5DWMA 3W5UA 3I56B 3BXMA 4F8ZA 2HUZA 4DNRB 1Z4RA 4Z65A 3CPAA 1CM0A 2ANPA 5KTCA 4HPSA 4MRIA 3D2PA 1VQ9B 3ISXA 4ZCIA 1QSMA 3PB7X 3KZWA 1QMUA 1NB9A 3P27A 3CCUB 4DNCA 4G5GA 1ZLHA 4N3GA 4AC9A 4ZYQA 3WXMA 3LACA 5E96A 2BPOA 1BPLA 1NB0A 3G05A 3W2HA 2ZZQA 4B5OA 3T8WA 4KVME 4TMWA 1Y9KA 4OAEA 3R1KA 3SI2A 1B6BA 2PIYA 1S0UA 3VARA 4JMQA 3VO1A 3BI1A 5HVGA 4PGOA 1D1NA 4QB9A 2R7HA 3VH9A 2AFXA 1YGHA 1VJSA 2GLJA 3GVJA 4FWUA 1W34A 4XLAA 4MCRA 4CAXA 2GREA 4IF5A 2DXQA 4GQNA 3KI9A 1E79A 5H59A 2V7XA 4UEFA 2YWHA 4UEZA 3CZXA 1IY7A 3JVNA 2JDDA 4QFMA 3Q39A 4CAEA 5GV7A 1M4IA 3IC1A 3Q38A 2FX3A 3LWUA 3P26A 3A3GA 4NSQA 3V38A 4ONWA 4NGMA 3TOBA 4X2TA 2NSMA 1KWMA 4OC2A 1OGIA 3CB4A 3NE8A 1OBRA 2PJ7A 4OPOA 2XEFA 4Z4TA 2QEXB 2HCJB 4R57A 5H84A 3QFCA 3KASA 4WZEA 4YWYA 3V76A 4J0QA 3B3TA 5JBQA 4PAAA 3PGPA 4B14A 4F0YA 4QVTA 4UEEA 3GVLA 3CC2B 1SKYB 1Q81D 2VNKA 3AVVA 5AGEA 1Q82D 5HXDA 1FNBA 1N06A 1VQKB 2X6XA 1GAQA 3DSBA 2EK8A 5F49A 2CTBA 4XNHC 2C2WA 5F4OA 2NPFA 2CK3A 4P4DA 4TN1A 2CNTA 2DY1A 4G1PA 8CPAA 1WDTA 1YJNB 4UAJA 1T5EA 3FBUA 4HIZA 3G4SB 4UWJA 4KKUA 3B82A 4NF1A 3W91A 5K8NA 3B8GA 4Y49C 1Z8TA 3A35A 3QFSA 3QFRA 1XMBA 3FYNA 5IB9A 3CCVB 2BO9A 1OB0A 3QE2A 1VKCA 2FL4A 1Q2DA 4LX9A 2PR8A 5HKKA 4MHDA 1NDHA 4PSWA 2J8MA 1QVGB 5LYIA 2PE3A 4A31A 4OC4A 3ISZA 2DPTA 3DR6A 2Z10A 4U5YA 1LCPA 5I4MA 1YSJA 4KSFA 2Z11A 4C68A 4YU9A 4Y9UA 1M44A 5J8CA 3K2KA 4CPAA 4XORA 1G7TA 2XZLA 3FXTA 3KR5A 4RN7A 4FBEA 5KNLA 2XZOA 4P6YA 4NJRA 4F6AA 3KQXA 4ZY0A 3TFYA 1E3ZA 2GE3A 5THWA 1CBXA 2E1BA 4AVAA 1AIPA 2OK8A 1Z5RA 1R5BA 2EVNA 1WP6A 3I1UA 2PVWA 3TO7A 1DTDA 3PP9A 4R6TA 1Y9WA 2B4BA 2F43A 3MGDA 4OOXA 3R9FA 3ASRA 3JQQA 1V0CA 4X7FA 4WWVA 3CCLB 4A38A 1T6XA 2ZL7A 1XF8A 4QBJA 2IJZA 2HV2A 4A32A 5J8FA 1HDUA 1WOSA 5TV2A 1QG0A 3N5FA 2BSAA 1QGZA 3WNCA 4XOTA 4BBHA 3A9LA 2FCKA 4XLHA 2B4DA 1CQXA 1YVKA 4PC7A 1KK1A 2Z3PA 2XEXA 2QTZA 1Z8XA 2OK7A 4G7WA 2OZGA 5A28A 4ROXA 3IU2A 4K1XA 4F9VA 1NE9A 4A94A 1EXMA 4KS9A 5TR9A 4M53A 1ELMP 2DCUA 3G3SA 1D2EA 4KOYA 5F4JA 4B10A 4UIBA 4ACBA 4MYUA 3GQBA 1L0CA 2FIWA 1QH0A 4RI1A 3DLJA 3T90A 2P0WA 5HH1A 1EFCA 1ZG9A 2Q44A 1CG2A 4JWPA 4P4IA 1EP2B 1S7FA 2JJ2A 2IQ6A 2BUEA 2OU2A 3CC7B 1Q7YD 4ZBGA 3S9LA 3G6EB 5JQ4A 2EUIA 4TNUA 4MHZA 4OKOA 3CMEB 1QFZA 2WSAA 3PRTA 5DWNA 4G7XA 1FNMA 1VQ8B 3CDXA 1SQHA 4OC5A 4RDKA 2ZL6A 4IK2A 4JJXA 2PJ6A 5LRKA 1IJEA 3ZZIA 4G1BA 1H42A 3KEWA 1I12A 4L8AA 3SJGA 2VYQA 1Z8WA 3MRUA 4UBRA 1EFRA 5IX3A 2ZBVA 3Q3AA 4NCZA 5E6TA 4MY3A 1CP6A 3GLJA 1N0VC 2O53A 3DDDA 5IYRA 3W2IA 2Q6LA 4KKSA 2YNCC 2FT0A 2VJJA 4P44A 2WZPP 2HB6A 1XOVA 2AFMA 4DYOA 1FY7A 1S3ZA 4NGRA 1Q9SA 4P2NA 4OIWA 3D3SA 4QC6A 4KSIA 1K73D 1JB9A 4B4DA 3TTHA 1NJID 4LBWA 4XPKA 4TKOB 1N8RD 5KTDA 1IYLA 1QSNA 2C27A 1VQ7B 1OZPA 2VBTA 3D68A 1GO2A 2ZL5A 4KORA 4Q7JB 3W6SA 2PLFA 2BF4A 1XBUA 2AFUA 2F7VA 3OEHA 3FKSA 4G6IA 3H8EA 5H5JA 2CTCA 2OR4A 2WYRA 1D8TA 2OOTA 1F20A 3V7AA 2YGWA 3S6KA 2K5TA 2V7TA 1QX4A 5HMNA 3F5BA 4UCNA 1A2ZA 1Y0RA 3SJZA 1M4DA 1RQPA 4RM0A 5FL7A 3LQ6A 3OEEA 1Q86D 3BI0A 3FJOA 3B3CA 2Z0ZA 2ZXIA 4KZTA 2V8HA 1N08A 4J3GA 1RTQA 3SI1A 1U2RA 1WSVA 1S60A 4X7EA 4OC3A 2POKA 1UD2A 2J9AA 2AHOA 1KQSB 3TO9A 5EMNA 5BWAB 4BPRA 2ZPAA 4YELA 1ARLA 4X0CA 2GJKA 2O4HA 2XNJA 2P6EA 4Y9RA 1IOIA 4P3IA 2PJ4A 1B2RA 4R3LA 4UFVA 2CBXA 1OB2A 4XKVA 4XPDB 3H5ZA 5DN6A 3JQPA 3JU4A 4KOUA 2ZEOA 3KKWA 1S72B 2FSRA 1R5NA 1S5KA 5KSWB 3S9NA 4II9A 4PSXA 4RD1A 2VNJA 3V8IA 2BGIA 1UD6A 4KUAA 5A8AA 2QJ8A 4Z4YA 1EFUA 1Z2LA 3CCEB 5BSYA 1B23P 1TF8A 3R6KA 5LRGA 4YRHA 5G1ZA 1KUVA 3S9MA 1VLYA 2D74A 4HE6A 4PQAA 1YW6A 4ZX8A 4P22A 2ZENA 4PXCA 3OOCA 1G7RA 4XD7A 1IU8A 2I79A 2P6GA 2QGGA 4NGNA 1VQNB 4FWTA 5F48A 4OPSA 4BD9A 1UD8A 1TKJA 2PJ0A 2RB7A 3D66A 2QDXA 2WPWA 4TMTA 4Z4VA 2Z3NA 2ZXVA 3SLDA 2OTJB 5I0CA 3J81k 2I1LA 2A4NA 1FNCA 4MFKA 4KOXA 4XPDC 1UMKA 3NA6A 3IIBA 2WJYA 3W2GA 3NE7A 2PJ2A 3CXCB 1F2OA 1M4LA 2WPXA 3ZZUA 3I3GA 1YQEA 3B8HA 1WOPA 2ABZA 2IMOA 3G8WA 3FB3A 2D3NA 3ONUA 1YX2A 4E2AA 4EWTA 1PKVA 1E62A 1XFOA 2VI7A 3QB8A 3D7DA 2ZXHA 1OHHA 1VQ6B 4M6IA 1KMHA 4P25A 1IYKA 5J35A 3ZIAA 1H8HA 5TY0A 4B3XA 5IYPA 2BM0A 2J7KA 3B7IA 4GM5A 4CAFA 2BMWA 1ELOA 1JQGA 3WBKA 4F0XA 2OBTA 5F4MA 4XNHB 2VL1A 5KW9A 4CAWA 3JUWA 3QSYA 4TMZA 3WC7A 3DGVA 4X7CA 4RCZA 3JTKA 2B3VA 4JD6A 3SJFA 4B5PB 4B6ZA 2IL4A 1VHSA 3OP1A 4YXWA 5C82A 2OTLB 1QSRA 3B78A 3FX6A 2D3LA 3WNDA 3AVXA 4Z1MA 3SEJA 4UZUA 2V8GA 2ZITA 2F5IA 4IUSA 2VBUA 2R9VA 5AN9A 3CC4B 4RD6A 2VBVA 4Y49B 1TXRA 5CNPA 1ZUNB 3OZWA 2EFGA 2Q6OA 4CGMA 2DEAA 1JNYA 2Z6BD 4H6ZA 2Z3LA 1BPNA 4FN5A 1BAVA 1W87A 4CRZB 2PR1A 4WQMA 3GUXA 5JGFA 2B4DB 4Q36A 4L8JA 4XMYA 2R8VA 3MCAA 3CMAB 2PJ5A 3BY1A 3OZUA 4HKFA 5K8PA 1CP7A 2P3MA 1HVXA 5F46A 3GYAA 2JLMA 3IWGA 4M0LA 2ATRA 2REEA 3K9UA 3GY9A 1QSTA 2VBQA 4R7MA 3U2QA 1TLLA 1W0JA 2BEIA 1E3XA 2ZBUA 3A8IA 1PCAA 4YAWA 3CXSA 4YALA 2C5HA 1KUXA 4DNTB 3EXNA 2AFZA 4C2XA 1FRQA 3R6JA 4CGNA 3QAHA 4TMVA 2X85A 4EVYA 5JPHA 4WZTA 1VQ5B 4M85A 2GU2A 1IB1E 3LMSA 3AVTA 1QGYA 1F60A 3H9NA 2GPJA 4MFLA 1GJRA 3N7ZA 3RYOA 2RFHA 4NEXA 1V0EA 4Z4WA 1DDGA 5JH9A 2CNMA 3EFAA 5F47A 1TUIA 3ZUGA 3ASPA 4TT3A 4H6UA 4EMEA 2X6WA 1K8AD 1MJAA 4FD6A 3IEHA 5FO1A 2B5GB 3HAGA 2ZEFA 1ZM4A 4LQ6A 4E0AA 2WPDA 2VZZA 4K30A 3DR8A 1H8LA 4NGQA 2RC6A 3TO6A 1PYTB 4QHYA 1KTVA 1P0HA 3FJUA 2V7UA 3VMFA 3I9SA 2VNHA 4UF4A 3SLNA 1IHMA 1VQ4B 4ZY1A 4JYWA 4PABA 2Z3MA 3AGQA 3ZBUA 2B5OA 2VEZA 3PB4X 3CRZA 5HVFA 4LC0A 4U9ZA 4XM3A 4G1VA 2BGJA 2WJVA 1P4MA 4RDJA 2PIZA 4C0SA 1I21A 3KR4A 1X10A 2GJRA 2QVPA 4XKWA 4RS2A 1DARA 1TIQA 2XNDA 3CPWB 1I18A 2V7VA 1K28D 1LAMA 6CPAA 2QMUA 2FIAA 2ZEMA 1NBMA 4NNJA 1AMOA 3H8GA 4P9SA 3FNCA 4IHMA 1YJWB 3W5VA 2Z3OA 2ZW6A 2EO8A 3SXNA 3NH8A 4Y7CA 4B11A 1K9MD 3PB8X 1NMTA 4R3KA 3H8FA 1YIJB 1QFJA 2VXKA 4AF7A 1KK0A 2Q6KA 4PXDA 4AVZA 5AG7A 1R5OA 1T6ZA 3K9TA 3CESA 4II3A 3W2FA 3FF3A 1W35A 3MN8A 5HZAA 3R96A 3SKBA 1QGAA 1YX0A 3WABA 3AVUA 2QECA 4XOPA 2OBSA 4YFJA 1MABA 3GB0A 3PUMA 1WU8A 1EP1B 2V7QA 1NSLA 4FD7A 3F0AA 3EC4A 3HLPA 3IJ3A 3OJXA 5DS0A 4BINA 3GSIA 5HZBA 2D4PA 1EP3B 2B7BA 4XN3A 3PA1A 2GANA 1WORA 3PVDA 2Q0YA 1UD3A 4NJQA 4F7DA 2HQYA 5HVHA 4PXEA 1S4MA 3A8KA 1CNEA 2CY2A 4RPDA 1ELLP 1N71A 4CS0B 3LQEA 3QNVA 1EWYA 4AVCA 3ZZTA 3QAYA 4B47A 2XEIA 5D29A 2XEJA 1YLEA 5EC4A 2FXFA 4P1VA 2BV3A 4MY0A 2WR8A 3V7ZA 3FPKA 4YHBA 4B12A 3CTAA 5LYDA 2ZEEA 1VQOB 3H4QA 3D4UA 4QVJA 4NGPA 1XE1A 4B44A 2OBRA 5J3OA 4PC1A 2C5BA 4IW3B 2VQYA 4C7IA 2JBKA 3Q6QA 4XLFA 4JXRA 4ZGYB 4P4JA 3U6KA 1UFHA 1ZO0A 4X05A 3ASTA 2ZW4A 3A1PA 1YR0A 3CXQA 1BLIA 4E0FA 1QFYA 5BSXA 2OH1A 2C1CA 3TE4A 5C88A 2J8RA 4XONA 3ASQA 2Q6IA 1QUFA 2Q04A 2G3AA 3PUNA 3T9YA 2X8KA 4OMEA 2F1LA 1XMTA 1W9XA 2JEVA 5EBVA 3TT2A 1VQPB 1PJ5A 4OP4A 3CW2A 2XGJA 2Q7BA 1IGBA 4X06A 3RZAA 3NH5A 1W2BB 4KOSA 4MFQA 3TOAA 3PFOA 2EWBA 4ZX9A 4EFDA 4WZLA 4A33A 3KHXA 1LRZA 2Q7SA 2QE7A 4KOWA 1FX0A 4ZV4A 3LNNA 1COWA 4OP7A 1TF9A 1JWQA 5KTAA 4M6GA 3R9EA 5AG5A 3VNUA 2V31A 1KC8D 1NRKA 2ZW5A 2V77A 3LVBA 1VHOA 1VQLB 4B43A 3LD2A 5GV8A 1V5VA 2C6GA 4DK0A 1YLOA 4X07A 4UZFA 1Q7LA 4KUBA 5THXA 1FNOA 3UY5A 3VWEA 2QIRA 1I8DA 1Z8LA 1E1QA 1CPSA 1R43A 1OB5A 2RC5A 4LBVA 1YVOA 2DPSA 4NXYA 3RY8A 5L46A 4H9GA 3OPOA 2B58A 2BM1A 5FIUA 3CCRB 1XJOA 3TC8A 3ZPNA 3U6BA 4C7HA 5CDFA 2YNDA 3D7FA 2ZOFA 4LUAA 4FAIA 1WOOA 1S7KA 4R8FA 2B3UA 1Y7RA 4NGSA 4YGOA 1N07A 3G71B 4YAOA 3IWWA 3R9GA 2ZEHA 4P12A 5IK2A 4AB7A 4P10A 1YREA 4R71A 2I00A 1HA3A 4M2LA 4A30A 4P6VF 2PRBA 1A8PA 3PBBA 3BY2A 2DEUA 1ARMA 5FA6A 3B3VA 4H89A 2QYVA 4B3GA 2PCUA 1ZG7A 1DDIA 2ZW7A 3F8KA 1WWZA 4P4BA 4AXVA 4MJ8A 2KCWA 2YWFA 3W6XA 3WBJA 4NGTA 2R1IA 4OPVA 1LFWA 4A2ZA 2DERA 5A89A 3FEDA 4RJLA 3MMPA 5LYLA 1M1DA 2AFSA 1IJFA 2BN4A 1R3NA 3B35A 2V8DA 4AG9A 4W9YA 4TWEA 4RD4A 3A3BA 1YK3A 1QVFB 1NSAA 5F09A 4P45A 3Q6RA 1MK4A 4XQFA 2F1MA 1EE3P 3FRMA 2BSWA 2D4OA 3OW7A 4QV2A 2BVNA 3WNBA 4KVOE 2YWGA 4P3YA 5IV0A 3GVKA 1T6YA 3ASSA 3PEIA 3GIRA 3BLNA 1CPXA 3RBUA 2X6YA 2CXAA 2ZZFA 4FUUA 4GXHA 2BL1A 4MFJA 4OC1A 3KL9A 2YNEA 2Z3KA 1LAPA 4QUSA 4XN0A 3PENA 2V8VA 1KRHA 1Z4EA 3BCDA 1VIXA 2AFWA 2EK9A 4A37A 2J8NA 1Y7EA 1VF7A 1E43A 2ZEPA 1SM4A 2PVVA 2CNSA 3OAAA 2ZELA 2G0BA 3CCMB 5G20A 4E8OA 4HNWB 3D8PA 2PRQA 4LBYA 1IICA 3NH4A 1VHEA 4CRYB 2Y0MA 4K3NA 2CF4A 4CQJA 1XEBA 3VWDA 2HLDA 4L89A 1KK2A 3OFNA 3S6FA 3SXOA 4RLZA 1GVHA 4HNYB 1QSOA 4RD2A 3WR7A 4ZCLA 2XOKA 3FEEA 4ZGQB 3JQRA 4CGLA 4M3SA 3CT9A 3R95A 2YWEA 4X7DA 2LZJA 1F2PA 5K8MA 4MHYA 2PJ8A 3B3WA 1KZLA 3IU1A 4DJLA 1YJ9B 1BQEA 4M1KA 3OZVA 3PBEA 2P6FA 4PC2A 3PB6X 4MFZA 4CYQA 3S6HA 3BNWA 4KOVA 4YAFA 2ZEGA 3KGQA 3T53B 1UWYA 3GKRA 1YHQB 3ZJ0A 4RD0A 3FH4A 3WYAA 2ZZGA 4F9UA 1JA1A 2PJ3A 3KHZA 1AUGA 3W5HA 3RAMA 4FK8A 4MHPA 3FIXA 5GCNA 3D67A 4KOTA 2D9RA 1EFTA 1BX1A 4C2YA 2ZOGA 1XRYA 1BMFA 4TMXA 4M6HA 1BPMA 2GK7A 2DYIA 1F57A 3CP2A 4UZEA 1B87A 1Y0YA 3NE5B 4OC0A 4RPBA 4DUKA 2ODFA 1IOFA 4UFWA 1KJZA 5CBMA 3KQZA 2HMAA 1ZM2A 2Q4VA 2X53S 2F8HA 4DQLA 3OW2B 5EMIA 2GIVA 2CIJA 4QVAA 1GR1A 1VQMB 2NV4A 5FVJA 3DNSA 3EO4A 1KD1D 4RUHA 4JXQA 5AG6A 2PIAA 4ZGNB 3TX8A 4X8IA 3I55B 4ACAA 2ZTGA 5IYWA 4XLCA 3AVYA 4MCPA 4CYPA 4WZKA 1TTTA 2HC9A 2Q43A 4M4SA 1YI2B 5H86A 1K4JA 2JJ1A 3WT4A 2PJ1A 2C4UA 3BCFA 3EY5A 1KK3A 2G9DA 2JBJA 3PZJA 2E1RA 3E1YE 1H85A 2ZEDA 1WTHD 4Q38A 2JDIA 4LQGA 2C77A 2FE7A 3RNZA 1S7NA 3VNVA 1BJKA 1BX0A 3WC5A 3S6GA 2PJBA 1U6MA 3GIUA 2QTLA 4MXUA 1Z9UA 1M4GA 1GAWA 5DSZA 4RD3A 1KZFA 4Z4SA 2V7WA 5G22A 4II2A 4EH1A 3B2YA 3CCQB 5CPAA 2JIZA 2PJCA 2BCOA 4QUZA 4B3FX 2X0KA 4YAUA 2V4DA 3OWCA 7CPAA 2OZUA 1FDRA 1ZLIA 1FRNA 1XIXA 2O28A 2ZTNA 1JJ2B 2WZNA 1H8EA 3A8JA 2G3TA 3E20A 1E64A 1MJ9A 3ES9A 2QMLA 4HNXB 4OADA 1ON0A 4ASUA 4B13A 4MMOA 1PUAA 3I1FA 4CAVA 4LBZA 5IB0A 4RCYA 5K8OA 3H94A 2PC1A 3HUVA 1Q2YA 4OOSA 2FS5A 1WPCA 2C6CA 4R9MA 2OB0A 2DOGA 3DDYA 2CNDA 3BJ7A 2W6JA 1LOKA 1ZM3A 1FNDA 4P4EA 3C26A 1GHEA 1QUEA 4OOVA 4DK1A 3CP8A 3WY9A 3FMCA 1TKFA 3D2MA 4GS4A 1G7SA 4B5PA 2JDCA 1MJBA 2VJIA 2R6HA 4KLWA 2WSSA 3BQJA 3BC9A 1TVCA 2M5SA 2AJ6A 4U9YA 4AF6A 1RO5A 4MI4A 1XE4A 3AVWA 5LRJA 3SI0A 1CNFA 4BMHA 1QQ9A 2NYQA 5IYQA 4UCPA 2BOAA 4ZI6A 5LMZA 3WC6A 4OLLA 5IYNA 4PV6A 4C43A 3AGPA 4ZCMA 2VZLA 3JRUA 2JN9A 3VO2A 1HEEA 2Q4YA 3MHPA 2C6PA 1X12A 4AVBA 2FVGA 3CXPA 1CX8A 1R57A 3E0KA 3FECA 1UD4A 1JA0A 4FXUA 4Z4ZA 2NMTA 3B3SA 3BJ8A 1YMEA 1SKQA
chains in the Genus database with same CATH topology
3TC8A 3D7FA 2ZOFA 4FAIA 3B7IA 4R8FA 4NGSA 3D7GA 4GM5A 3IWWA 5LYIA 2PE3A 2ZEHA 1JQGA 4OC4A 3ISZA 2VL1A 4P10A 1LCPA 3WC7A 4R76A 5I4MA 1YSJA 3DGVA 4YU9A 3SJFA 4B6ZA 3PBBA 3K2KA 4CPAA 4PPZA 1ARMA 3B3VA 3FX6A 2QYVA 3KR5A 2PCUA 1ZG7A 1DE4C 2V8GA 4FBEA 4P4BA 4AXVA 4P6YA 4NJRA 1TXRA 3KQXA 4NGTA 1LFWA 4ZY0A 5THWA 2DEAA 1CBXA 3FEDA 1Z5RA 1BPNA 1BAVA 2I3CA 3GUXA 5LYFA 5JGFA 5LYLA 3IO1A 2Q51A 3D7HA 3I1UA 2AFSA 2PVWA 2PJ5A 1DTDA 4R6TA 4WJBA 5K8PA 1CP7A 2XEGA 1R3NA 3B35A 4P4FA 2JEWA 1LANA 2V8DA 4WWVA 4W9YA 4A38A 4TWEA 4O23A 1NSAA 2IJZA 5F09A 4P45A 5JM6A 4R7MA 1HDUA 1EE3P 3BHXA 1PCAA 3N5FA 4PXBA 4IAVA 3PEIA 4MHNA 1CPXA 2AFZA 3RBUA 4JZ0A 4FUUA 1HDQA 4OIDA 4OC1A 3KL9A 2GU2A 4H2KA 3LMSA 5D8NA 4ZY2A 1LAPA 1VGYA 2V8VA 2RFHA 1ZG8A 1YW4A 1VIXA 2AFWA 2EK9A 4A37A 5JH9A 1Y7EA 4F9VA 4A94A 4EMEA 2ZEPA 2PVVA 2AFOA 2ZELA 3IEHA 1ELMP 2PRQA 2ZEFA 3NH4A 3SJEA 1VHEA 4UIBA 3PFEA 1H8LA 4K3NA 4NGQA 1PYTB 2CF4A 4UIAA 4Q7AA 1GYTA 3DLJA 1BLLE 3FJUA 1ZG9A 3FEEA 1CG2A 3PB9X 4P4IA 4UF4A 2IQ6A 2GLFA 3CT9A 1TKHA 4ZY1A 3S9LA 4JYWA 1F2PA 4NFRA 2PJ9A 5K8MA 4TNUA 2PJAA 4MHYA 3CPXA 3PB4X 4MHZA 2PJ8A 3B3WA 4OKOA 5HVFA 3PRTA 3IFEA 1AMPA 3SJXA 4DJLA 3CDXA 3PBEA 4OC5A 5ELYA 4IK2A 4X3RA 2PIZA 3PB6X 3KR4A 2PJ6A 5LRKA 2ZEGA 3KGQA 3SJGA 2QVPA 1UWYA 3MRUA 3FH4A 4A39A 4F9UA 1LAMA 6CPAA 2PJ3A 1AYEA 3KHZA 1CP6A 3GLJA 3RAMA 2ZEMA 2O53A 3H8GA 4MHPA 4IHMA 3NFZA 3D67A 4MCQA 4P44A 3NH8A 2HB6A 2Q4ZA 2AFMA 3PB8X 4DYOA 2ZOGA 1XRYA 4NGRA 3FVLA 3H8FA 4OIWA 4MCSA 4KSIA 1BPMA 4PXDA 1F57A 3L2NA 3VATA 3K9TA 1Y0YA 3FF3A 4OC0A 3MN8A 1FT7A 4DUKA 5J1QA 5CBMA 3D68A 3KQZA 3BXMA 4F8ZA 4Z65A 3CPAA 3WABA 1XBUA 2F8HA 2AFUA 2F7VA 2ANPA 2CIJA 4MRIA 3H8EA 3GB0A 3ISXA 4RUHA 3PB7X 2CTCA 2OR4A 3KZWA 1QMUA 2WYRA 2OOTA 3HLPA 3IJ3A 5DS0A 3TX8A 4X8IA 1ZLHA 4ZYQA 1Y0RA 4MCPA 2HC9A 2Q43A 3BI0A 3B3CA 3T8WA 3WT4A 4NJQA 2PJ1A 2V8HA 3SI2A 5HVHA 2G9DA 4PXEA 2JBJA 2PIYA 1RTQA 3VARA 3SI1A 3BI1A 2ZEDA 1ELLP 5HVGA 3QNVA 4OC3A 2POKA 2J9AA 4LQGA 3VH9A 2XEIA 2AFXA 5D29A 2XEJA 3WC5A 2GLJA 4FWUA 2PJBA 4MCRA 2GREA 4MXUA 3KI9A 3V7ZA 1ARLA 3B2YA 5CPAA 2O4HA 2PJCA 4UEZA 2PJ4A 4UEFA 2BCOA 1IY7A 5LYDA 2ZEEA 3D4UA 4NGPA 7CPAA 3IC1A 1ZLIA 3LWUA 2JBKA 2WZNA 3V38A 4ONWA 4P4JA 4NGMA 2ZEOA 4X2TA 2NSMA 1KWMA 4OC2A 1OBRA 2PJ7A 3S9NA 2C1CA 2XEFA 4MMOA 5K8OA 3HUVA 2QJ8A 1Z2LA 3KASA 4OMEA 4YWYA 1TF8A 2C6CA 3B3TA 5LRGA 1LOKA 3S9MA 4P4EA 4OP4A 4PQAA 1YW6A 4UEEA 4ZX8A 1IGBA 3FMCA 1TKFA 3RZAA 2ZENA 3NH5A 4PXCA 3PFOA 2EWBA 4ZX9A 4EFDA 5HXDA 4NGNA 4BD9A 3KHXA 1TKJA 2PJ0A 2RB7A 2EK8A 3D66A 2CTBA 1TF9A 4P4DA 3NA6A 3IIBA 2V77A 4G1PA 5LRJA 8CPAA 3SI0A 2PJ2A 1F2OA 1M4LA 1VHOA 1QQ9A 2NYQA 2C6GA 1YLOA 2BOAA 4ZI6A 2ABZA 1Q7LA 2IMOA 1FNOA 3WC6A 5K8NA 4EWTA 1XFOA 1Z8LA 1CPSA 1R43A 3D7DA 3JRUA 1HEEA 1XMBA 2C6PA 5IB9A 2FVGA 2BO9A 1CX8A 3FECA 3B3SA 1YMEA 1XJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC8 A;  3D7F A;  2ZOF A;  4FAI A;  3B7I A;  4R8F A;  4NGS A;  3D7G A;  4GM5 A;  3IWW A;  5LYI A;  2PE3 A;  2ZEH A;  1JQG A;  4OC4 A;  3ISZ A;  2VL1 A;  4P10 A;  1LCP A;  3WC7 A;  4R76 A;  5I4M A;  1YSJ A;  3DGV A;  4YU9 A;  3SJF A;  4B6Z A;  3PBB A;  3K2K A;  4CPA A;  4PPZ A;  1ARM A;  3B3V A;  3FX6 A;  2QYV A;  3KR5 A;  2PCU A;  1ZG7 A;  1DE4 C;  2V8G A;  4FBE A;  4P4B A;  4AXV A;  4P6Y A;  4NJR A;  1TXR A;  3KQX A;  4NGT A;  1LFW A;  4ZY0 A;  5THW A;  2DEA A;  1CBX A;  3FED A;  1Z5R A;  1BPN A;  1BAV A;  2I3C A;  3GUX A;  5LYF A;  5JGF A;  5LYL A;  3IO1 A;  2Q51 A;  3D7H A;  3I1U A;  2AFS A;  2PVW A;  2PJ5 A;  1DTD A;  4R6T A;  4WJB A;  5K8P A;  1CP7 A;  2XEG A;  1R3N A;  3B35 A;  4P4F A;  2JEW A;  1LAN A;  2V8D A;  4WWV A;  4W9Y A;  4A38 A;  4TWE A;  4O23 A;  1NSA A;  2IJZ A;  5F09 A;  4P45 A;  5JM6 A;  4R7M A;  1HDU A;  1EE3 P;  3BHX A;  1PCA A;  3N5F A;  4PXB A;  4IAV A;  3PEI A;  4MHN A;  1CPX A;  2AFZ A;  3RBU A;  4JZ0 A;  4FUU A;  1HDQ A;  4OID A;  4OC1 A;  3KL9 A;  2GU2 A;  4H2K A;  3LMS A;  5D8N A;  4ZY2 A;  1LAP A;  1VGY A;  2V8V A;  2RFH A;  1ZG8 A;  1YW4 A;  1VIX A;  2AFW A;  2EK9 A;  4A37 A;  5JH9 A;  1Y7E A;  4F9V A;  4A94 A;  4EME A;  2ZEP A;  2PVV A;  2AFO A;  2ZEL A;  3IEH A;  1ELM P;  2PRQ A;  2ZEF A;  3NH4 A;  3SJE A;  1VHE A;  4UIB A;  3PFE A;  1H8L A;  4K3N A;  4NGQ A;  1PYT B;  2CF4 A;  4UIA A;  4Q7A A;  1GYT A;  3DLJ A;  1BLL E;  3FJU A;  1ZG9 A;  3FEE A;  1CG2 A;  3PB9 X;  4P4I A;  4UF4 A;  2IQ6 A;  2GLF A;  3CT9 A;  1TKH A;  4ZY1 A;  3S9L A;  4JYW A;  1F2P A;  4NFR A;  2PJ9 A;  5K8M A;  4TNU A;  2PJA A;  4MHY A;  3CPX A;  3PB4 X;  4MHZ A;  2PJ8 A;  3B3W A;  4OKO A;  5HVF A;  3PRT A;  3IFE A;  1AMP A;  3SJX A;  4DJL A;  3CDX A;  3PBE A;  4OC5 A;  5ELY A;  4IK2 A;  4X3R A;  2PIZ A;  3PB6 X;  3KR4 A;  2PJ6 A;  5LRK A;  2ZEG A;  3KGQ A;  3SJG A;  2QVP A;  1UWY A;  3MRU A;  3FH4 A;  4A39 A;  4F9U A;  1LAM A;  6CPA A;  2PJ3 A;  1AYE A;  3KHZ A;  1CP6 A;  3GLJ A;  3RAM A;  2ZEM A;  2O53 A;  3H8G A;  4MHP A;  4IHM A;  3NFZ A;  3D67 A;  4MCQ A;  4P44 A;  3NH8 A;  2HB6 A;  2Q4Z A;  2AFM A;  3PB8 X;  4DYO A;  2ZOG A;  1XRY A;  4NGR A;  3FVL A;  3H8F A;  4OIW A;  4MCS A;  4KSI A;  1BPM A;  4PXD A;  1F57 A;  3L2N A;  3VAT A;  3K9T A;  1Y0Y A;  3FF3 A;  4OC0 A;  3MN8 A;  1FT7 A;  4DUK A;  5J1Q A;  5CBM A;  3D68 A;  3KQZ A;  3BXM A;  4F8Z A;  4Z65 A;  3CPA A;  3WAB A;  1XBU A;  2F8H A;  2AFU A;  2F7V A;  2ANP A;  2CIJ A;  4MRI A;  3H8E A;  3GB0 A;  3ISX A;  4RUH A;  3PB7 X;  2CTC A;  2OR4 A;  3KZW A;  1QMU A;  2WYR A;  2OOT A;  3HLP A;  3IJ3 A;  5DS0 A;  3TX8 A;  4X8I A;  1ZLH A;  4ZYQ A;  1Y0R A;  4MCP A;  2HC9 A;  2Q43 A;  3BI0 A;  3B3C A;  3T8W A;  3WT4 A;  4NJQ A;  2PJ1 A;  2V8H A;  3SI2 A;  5HVH A;  2G9D A;  4PXE A;  2JBJ A;  2PIY A;  1RTQ A;  3VAR A;  3SI1 A;  3BI1 A;  2ZED A;  1ELL P;  5HVG A;  3QNV A;  4OC3 A;  2POK A;  2J9A A;  4LQG A;  3VH9 A;  2XEI A;  2AFX A;  5D29 A;  2XEJ A;  3WC5 A;  2GLJ A;  4FWU A;  2PJB A;  4MCR A;  2GRE A;  4MXU A;  3KI9 A;  3V7Z A;  1ARL A;  3B2Y A;  5CPA A;  2O4H A;  2PJC A;  4UEZ A;  2PJ4 A;  4UEF A;  2BCO A;  1IY7 A;  5LYD A;  2ZEE A;  3D4U A;  4NGP A;  7CPA A;  3IC1 A;  1ZLI A;  3LWU A;  2JBK A;  2WZN A;  3V38 A;  4ONW A;  4P4J A;  4NGM A;  2ZEO A;  4X2T A;  2NSM A;  1KWM A;  4OC2 A;  1OBR A;  2PJ7 A;  3S9N A;  2C1C A;  2XEF A;  4MMO A;  5K8O A;  3HUV A;  2QJ8 A;  1Z2L A;  3KAS A;  4OME A;  4YWY A;  1TF8 A;  2C6C A;  3B3T A;  5LRG A;  1LOK A;  3S9M A;  4P4E A;  4OP4 A;  4PQA A;  1YW6 A;  4UEE A;  4ZX8 A;  1IGB A;  3FMC A;  1TKF A;  3RZA A;  2ZEN A;  3NH5 A;  4PXC A;  3PFO A;  2EWB A;  4ZX9 A;  4EFD A;  5HXD A;  4NGN A;  4BD9 A;  3KHX A;  1TKJ A;  2PJ0 A;  2RB7 A;  2EK8 A;  3D66 A;  2CTB A;  1TF9 A;  4P4D A;  3NA6 A;  3IIB A;  2V77 A;  4G1P A;  5LRJ A;  8CPA A;  3SI0 A;  2PJ2 A;  1F2O A;  1M4L A;  1VHO A;  1QQ9 A;  2NYQ A;  2C6G A;  1YLO A;  2BOA A;  4ZI6 A;  2ABZ A;  1Q7L A;  2IMO A;  1FNO A;  3WC6 A;  5K8N A;  4EWT A;  1XFO A;  1Z8L A;  1CPS A;  1R43 A;  3D7D A;  3JRU A;  1HEE A;  1XMB A;  2C6P A;  5IB9 A;  2FVG A;  2BO9 A;  1CX8 A;  3FEC A;  3B3S A;  1YME A;  1XJO A; 
#chains in the Genus database with same CATH topology
 1HZE A;  2ARH A;  2ZZE A;  3D26 A;  4PC3 A;  3D7G A;  1BOB A;  4MFP A;  4N3N A;  2PQ8 A;  2DF5 A;  2C4T A;  4AG7 A;  4UFX A;  2KVO A;  4A95 A;  4R76 A;  3FPP A;  1KUY A;  2GK6 A;  2VZY A;  1S7L A;  3OE7 A;  4YEJ A;  5FO0 A;  1G7C A;  4ONU A;  4PPZ A;  1IID A;  1E1R A;  5AG4 A;  3CD6 B;  2X3U A;  4XLE A;  1DE4 C;  3RO0 A;  2B5G A;  2VNI A;  4CGP A;  2PMD A;  1W0K A;  5TRD A;  2VBS A;  4P26 A;  2I3C A;  5LYF A;  4UA3 A;  4Z4U A;  3IO1 A;  2Q51 A;  3T51 B;  2EIX A;  3D7H A;  2F4N A;  1PU9 A;  1XQB A;  2DIE A;  5G21 A;  4XPL A;  4MYT A;  1PJ7 A;  4WJB A;  4B48 A;  1IB0 A;  2XEG A;  2CC2 A;  4P4F A;  2JEW A;  1LAN A;  2R98 A;  2XNC A;  3TCV A;  1WSR A;  4O23 A;  3CCS B;  2AE6 A;  5FNZ A;  4R87 A;  5JM6 A;  1N05 A;  3BHX A;  3SJP A;  4DQK A;  1BO4 A;  4FD4 A;  1M90 D;  3WQZ A;  5ISV A;  1OGJ A;  4PXB A;  4IAV A;  1N0U A;  4FD5 A;  2C78 A;  4MHN A;  4JZ0 A;  1DG1 G;  4I49 A;  3BH4 A;  4PC6 A;  4MBU A;  1E63 A;  4KVX A;  1HDQ A;  3LOD A;  2HDN B;  4XNF A;  3IWE A;  3PA2 A;  2X7B A;  4OID A;  1J9Z A;  4X5K A;  4H2K A;  3ONY A;  5D8N A;  4ZY2 A;  4HE5 A;  1VGY A;  2PSW A;  3QFT A;  1Q2C A;  1ZG8 A;  1I7P A;  1YW4 A;  4C2Z A;  1YIT B;  3P2H A;  5A27 A;  2H5M A;  4UWI A;  3LO8 A;  2XZP A;  3W2E A;  2AFO A;  2WUU A;  3VR6 A;  1ZM9 A;  3SJE A;  2DET A;  4PK3 A;  3PFE A;  1PJ6 A;  1XB2 A;  4UIA A;  3ZC3 A;  4Q7A A;  1GYT A;  4PK2 A;  1BLL E;  1CJW A;  2OYN A;  4KLV A;  3OJW A;  3PB9 X;  4UCM A;  2B7C A;  4JLY A;  2GLF A;  3OKX A;  2CW5 A;  1TKH A;  3ZZ0 A;  3P2F A;  4NFR A;  2PJ9 A;  3CMM A;  2PJA A;  4NBS A;  3CPX A;  2CRV A;  2EBJ A;  2GJP A;  3CCJ B;  2QN6 A;  4Z4R A;  1AMP A;  2YNC A;  3IFE A;  3SJX A;  1MRZ A;  5A88 A;  2GQF A;  1J4J A;  5ELY A;  4X3R A;  4XL9 A;  2QA4 B;  4RDL A;  2PDO A;  2W6I A;  1V0F A;  1RQR A;  4CGO A;  4KSA A;  4XR6 A;  4A39 A;  1AYE A;  2OZH A;  1P4N A;  1M1K D;  1I1D A;  2RC4 A;  3NFZ A;  4MCQ A;  4CYN A;  5B6I A;  2Q4Z A;  4KKT A;  4U9U A;  3FVL A;  3IGR A;  1UD5 A;  4MCS A;  3ZBT A;  1VLO A;  4TSF A;  2REF A;  2GFQ A;  1RXT A;  3L2N A;  3VAT A;  4NCN A;  3T56 B;  4CYO A;  1FT7 A;  5HXB A;  5J1Q A;  1WK4 A;  4ORF A;  3SHP A;  5DWM A;  3W5U A;  3I56 B;  3BXM A;  4F8Z A;  2HUZ A;  4DNR B;  1Z4R A;  4Z65 A;  3CPA A;  1CM0 A;  2ANP A;  5KTC A;  4HPS A;  4MRI A;  3D2P A;  1VQ9 B;  3ISX A;  4ZCI A;  1QSM A;  3PB7 X;  3KZW A;  1QMU A;  1NB9 A;  3P27 A;  3CCU B;  4DNC A;  4G5G A;  1ZLH A;  4N3G A;  4AC9 A;  4ZYQ A;  3WXM A;  3LAC A;  5E96 A;  2BPO A;  1BPL A;  1NB0 A;  3G05 A;  3W2H A;  2ZZQ A;  4B5O A;  3T8W A;  4KVM E;  4TMW A;  1Y9K A;  4OAE A;  3R1K A;  3SI2 A;  1B6B A;  2PIY A;  1S0U A;  3VAR A;  4JMQ A;  3VO1 A;  3BI1 A;  5HVG A;  4PGO A;  1D1N A;  4QB9 A;  2R7H A;  3VH9 A;  2AFX A;  1YGH A;  1VJS A;  2GLJ A;  3GVJ A;  4FWU A;  1W34 A;  4XLA A;  4MCR A;  4CAX A;  2GRE A;  4IF5 A;  2DXQ A;  4GQN A;  3KI9 A;  1E79 A;  5H59 A;  2V7X A;  4UEF A;  2YWH A;  4UEZ A;  3CZX A;  1IY7 A;  3JVN A;  2JDD A;  4QFM A;  3Q39 A;  4CAE A;  5GV7 A;  1M4I A;  3IC1 A;  3Q38 A;  2FX3 A;  3LWU A;  3P26 A;  3A3G A;  4NSQ A;  3V38 A;  4ONW A;  4NGM A;  3TOB A;  4X2T A;  2NSM A;  1KWM A;  4OC2 A;  1OGI A;  3CB4 A;  3NE8 A;  1OBR A;  2PJ7 A;  4OPO A;  2XEF A;  4Z4T A;  2QEX B;  2HCJ B;  4R57 A;  5H84 A;  3QFC A;  3KAS A;  4WZE A;  4YWY A;  3V76 A;  4J0Q A;  3B3T A;  5JBQ A;  4PAA A;  3PGP A;  4B14 A;  4F0Y A;  4QVT A;  4UEE A;  3GVL A;  3CC2 B;  1SKY B;  1Q81 D;  2VNK A;  3AVV A;  5AGE A;  1Q82 D;  5HXD A;  1FNB A;  1N06 A;  1VQK B;  2X6X A;  1GAQ A;  3DSB A;  2EK8 A;  5F49 A;  2CTB A;  4XNH C;  2C2W A;  5F4O A;  2NPF A;  2CK3 A;  4P4D A;  4TN1 A;  2CNT A;  2DY1 A;  4G1P A;  8CPA A;  1WDT A;  1YJN B;  4UAJ A;  1T5E A;  3FBU A;  4HIZ A;  3G4S B;  4UWJ A;  4KKU A;  3B82 A;  4NF1 A;  3W91 A;  5K8N A;  3B8G A;  4Y49 C;  1Z8T A;  3A35 A;  3QFS A;  3QFR A;  1XMB A;  3FYN A;  5IB9 A;  3CCV B;  2BO9 A;  1OB0 A;  3QE2 A;  1VKC A;  2FL4 A;  1Q2D A;  4LX9 A;  2PR8 A;  5HKK A;  4MHD A;  1NDH A;  4PSW A;  2J8M A;  1QVG B;  5LYI A;  2PE3 A;  4A31 A;  4OC4 A;  3ISZ A;  2DPT A;  3DR6 A;  2Z10 A;  4U5Y A;  1LCP A;  5I4M A;  1YSJ A;  4KSF A;  2Z11 A;  4C68 A;  4YU9 A;  4Y9U A;  1M44 A;  5J8C A;  3K2K A;  4CPA A;  4XOR A;  1G7T A;  2XZL A;  3FXT A;  3KR5 A;  4RN7 A;  4FBE A;  5KNL A;  2XZO A;  4P6Y A;  4NJR A;  4F6A A;  3KQX A;  4ZY0 A;  3TFY A;  1E3Z A;  2GE3 A;  5THW A;  1CBX A;  2E1B A;  4AVA A;  1AIP A;  2OK8 A;  1Z5R A;  1R5B A;  2EVN A;  1WP6 A;  3I1U A;  2PVW A;  3TO7 A;  1DTD A;  3PP9 A;  4R6T A;  1Y9W A;  2B4B A;  2F43 A;  3MGD A;  4OOX A;  3R9F A;  3ASR A;  3JQQ A;  1V0C A;  4X7F A;  4WWV A;  3CCL B;  4A38 A;  1T6X A;  2ZL7 A;  1XF8 A;  4QBJ A;  2IJZ A;  2HV2 A;  4A32 A;  5J8F A;  1HDU A;  1WOS A;  5TV2 A;  1QG0 A;  3N5F A;  2BSA A;  1QGZ A;  3WNC A;  4XOT A;  4BBH A;  3A9L A;  2FCK A;  4XLH A;  2B4D A;  1CQX A;  1YVK A;  4PC7 A;  1KK1 A;  2Z3P A;  2XEX A;  2QTZ A;  1Z8X A;  2OK7 A;  4G7W A;  2OZG A;  5A28 A;  4ROX A;  3IU2 A;  4K1X A;  4F9V A;  1NE9 A;  4A94 A;  1EXM A;  4KS9 A;  5TR9 A;  4M53 A;  1ELM P;  2DCU A;  3G3S A;  1D2E A;  4KOY A;  5F4J A;  4B10 A;  4UIB A;  4ACB A;  4MYU A;  3GQB A;  1L0C A;  2FIW A;  1QH0 A;  4RI1 A;  3DLJ A;  3T90 A;  2P0W A;  5HH1 A;  1EFC A;  1ZG9 A;  2Q44 A;  1CG2 A;  4JWP A;  4P4I A;  1EP2 B;  1S7F A;  2JJ2 A;  2IQ6 A;  2BUE A;  2OU2 A;  3CC7 B;  1Q7Y D;  4ZBG A;  3S9L A;  3G6E B;  5JQ4 A;  2EUI A;  4TNU A;  4MHZ A;  4OKO A;  3CME B;  1QFZ A;  2WSA A;  3PRT A;  5DWN A;  4G7X A;  1FNM A;  1VQ8 B;  3CDX A;  1SQH A;  4OC5 A;  4RDK A;  2ZL6 A;  4IK2 A;  4JJX A;  2PJ6 A;  5LRK A;  1IJE A;  3ZZI A;  4G1B A;  1H42 A;  3KEW A;  1I12 A;  4L8A A;  3SJG A;  2VYQ A;  1Z8W A;  3MRU A;  4UBR A;  1EFR A;  5IX3 A;  2ZBV A;  3Q3A A;  4NCZ A;  5E6T A;  4MY3 A;  1CP6 A;  3GLJ A;  1N0V C;  2O53 A;  3DDD A;  5IYR A;  3W2I A;  2Q6L A;  4KKS A;  2YNC C;  2FT0 A;  2VJJ A;  4P44 A;  2WZP P;  2HB6 A;  1XOV A;  2AFM A;  4DYO A;  1FY7 A;  1S3Z A;  4NGR A;  1Q9S A;  4P2N A;  4OIW A;  3D3S A;  4QC6 A;  4KSI A;  1K73 D;  1JB9 A;  4B4D A;  3TTH A;  1NJI D;  4LBW A;  4XPK A;  4TKO B;  1N8R D;  5KTD A;  1IYL A;  1QSN A;  2C27 A;  1VQ7 B;  1OZP A;  2VBT A;  3D68 A;  1GO2 A;  2ZL5 A;  4KOR A;  4Q7J B;  3W6S A;  2PLF A;  2BF4 A;  1XBU A;  2AFU A;  2F7V A;  3OEH A;  3FKS A;  4G6I A;  3H8E A;  5H5J A;  2CTC A;  2OR4 A;  2WYR A;  1D8T A;  2OOT A;  1F20 A;  3V7A A;  2YGW A;  3S6K A;  2K5T A;  2V7T A;  1QX4 A;  5HMN A;  3F5B A;  4UCN A;  1A2Z A;  1Y0R A;  3SJZ A;  1M4D A;  1RQP A;  4RM0 A;  5FL7 A;  3LQ6 A;  3OEE A;  1Q86 D;  3BI0 A;  3FJO A;  3B3C A;  2Z0Z A;  2ZXI A;  4KZT A;  2V8H A;  1N08 A;  4J3G A;  1RTQ A;  3SI1 A;  1U2R A;  1WSV A;  1S60 A;  4X7E A;  4OC3 A;  2POK A;  1UD2 A;  2J9A A;  2AHO A;  1KQS B;  3TO9 A;  5EMN A;  5BWA B;  4BPR A;  2ZPA A;  4YEL A;  1ARL A;  4X0C A;  2GJK A;  2O4H A;  2XNJ A;  2P6E A;  4Y9R A;  1IOI A;  4P3I A;  2PJ4 A;  1B2R A;  4R3L A;  4UFV A;  2CBX A;  1OB2 A;  4XKV A;  4XPD B;  3H5Z A;  5DN6 A;  3JQP A;  3JU4 A;  4KOU A;  2ZEO A;  3KKW A;  1S72 B;  2FSR A;  1R5N A;  1S5K A;  5KSW B;  3S9N A;  4II9 A;  4PSX A;  4RD1 A;  2VNJ A;  3V8I A;  2BGI A;  1UD6 A;  4KUA A;  5A8A A;  2QJ8 A;  4Z4Y A;  1EFU A;  1Z2L A;  3CCE B;  5BSY A;  1B23 P;  1TF8 A;  3R6K A;  5LRG A;  4YRH A;  5G1Z A;  1KUV A;  3S9M A;  1VLY A;  2D74 A;  4HE6 A;  4PQA A;  1YW6 A;  4ZX8 A;  4P22 A;  2ZEN A;  4PXC A;  3OOC A;  1G7R A;  4XD7 A;  1IU8 A;  2I79 A;  2P6G A;  2QGG A;  4NGN A;  1VQN B;  4FWT A;  5F48 A;  4OPS A;  4BD9 A;  1UD8 A;  1TKJ A;  2PJ0 A;  2RB7 A;  3D66 A;  2QDX A;  2WPW A;  4TMT A;  4Z4V A;  2Z3N A;  2ZXV A;  3SLD A;  2OTJ B;  5I0C A;  3J81 k;  2I1L A;  2A4N A;  1FNC A;  4MFK A;  4KOX A;  4XPD C;  1UMK A;  3NA6 A;  3IIB A;  2WJY A;  3W2G A;  3NE7 A;  2PJ2 A;  3CXC B;  1F2O A;  1M4L A;  2WPX A;  3ZZU A;  3I3G A;  1YQE A;  3B8H A;  1WOP A;  2ABZ A;  2IMO A;  3G8W A;  3FB3 A;  2D3N A;  3ONU A;  1YX2 A;  4E2A A;  4EWT A;  1PKV A;  1E62 A;  1XFO A;  2VI7 A;  3QB8 A;  3D7D A;  2ZXH A;  1OHH A;  1VQ6 B;  4M6I A;  1KMH A;  4P25 A;  1IYK A;  5J35 A;  3ZIA A;  1H8H A;  5TY0 A;  4B3X A;  5IYP A;  2BM0 A;  2J7K A;  3B7I A;  4GM5 A;  4CAF A;  2BMW A;  1ELO A;  1JQG A;  3WBK A;  4F0X A;  2OBT A;  5F4M A;  4XNH B;  2VL1 A;  5KW9 A;  4CAW A;  3JUW A;  3QSY A;  4TMZ A;  3WC7 A;  3DGV A;  4X7C A;  4RCZ A;  3JTK A;  2B3V A;  4JD6 A;  3SJF A;  4B5P B;  4B6Z A;  2IL4 A;  1VHS A;  3OP1 A;  4YXW A;  5C82 A;  2OTL B;  1QSR A;  3B78 A;  3FX6 A;  2D3L A;  3WND A;  3AVX A;  4Z1M A;  3SEJ A;  4UZU A;  2V8G A;  2ZIT A;  2F5I A;  4IUS A;  2VBU A;  2R9V A;  5AN9 A;  3CC4 B;  4RD6 A;  2VBV A;  4Y49 B;  1TXR A;  5CNP A;  1ZUN B;  3OZW A;  2EFG A;  2Q6O A;  4CGM A;  2DEA A;  1JNY A;  2Z6B D;  4H6Z A;  2Z3L A;  1BPN A;  4FN5 A;  1BAV A;  1W87 A;  4CRZ B;  2PR1 A;  4WQM A;  3GUX A;  5JGF A;  2B4D B;  4Q36 A;  4L8J A;  4XMY A;  2R8V A;  3MCA A;  3CMA B;  2PJ5 A;  3BY1 A;  3OZU A;  4HKF A;  5K8P A;  1CP7 A;  2P3M A;  1HVX A;  5F46 A;  3GYA A;  2JLM A;  3IWG A;  4M0L A;  2ATR A;  2REE A;  3K9U A;  3GY9 A;  1QST A;  2VBQ A;  4R7M A;  3U2Q A;  1TLL A;  1W0J A;  2BEI A;  1E3X A;  2ZBU A;  3A8I A;  1PCA A;  4YAW A;  3CXS A;  4YAL A;  2C5H A;  1KUX A;  4DNT B;  3EXN A;  2AFZ A;  4C2X A;  1FRQ A;  3R6J A;  4CGN A;  3QAH A;  4TMV A;  2X85 A;  4EVY A;  5JPH A;  4WZT A;  1VQ5 B;  4M85 A;  2GU2 A;  1IB1 E;  3LMS A;  3AVT A;  1QGY A;  1F60 A;  3H9N A;  2GPJ A;  4MFL A;  1GJR A;  3N7Z A;  3RYO A;  2RFH A;  4NEX A;  1V0E A;  4Z4W A;  1DDG A;  5JH9 A;  2CNM A;  3EFA A;  5F47 A;  1TUI A;  3ZUG A;  3ASP A;  4TT3 A;  4H6U A;  4EME A;  2X6W A;  1K8A D;  1MJA A;  4FD6 A;  3IEH A;  5FO1 A;  2B5G B;  3HAG A;  2ZEF A;  1ZM4 A;  4LQ6 A;  4E0A A;  2WPD A;  2VZZ A;  4K30 A;  3DR8 A;  1H8L A;  4NGQ A;  2RC6 A;  3TO6 A;  1PYT B;  4QHY A;  1KTV A;  1P0H A;  3FJU A;  2V7U A;  3VMF A;  3I9S A;  2VNH A;  4UF4 A;  3SLN A;  1IHM A;  1VQ4 B;  4ZY1 A;  4JYW A;  4PAB A;  2Z3M A;  3AGQ A;  3ZBU A;  2B5O A;  2VEZ A;  3PB4 X;  3CRZ A;  5HVF A;  4LC0 A;  4U9Z A;  4XM3 A;  4G1V A;  2BGJ A;  2WJV A;  1P4M A;  4RDJ A;  2PIZ A;  4C0S A;  1I21 A;  3KR4 A;  1X10 A;  2GJR A;  2QVP A;  4XKW A;  4RS2 A;  1DAR A;  1TIQ A;  2XND A;  3CPW B;  1I18 A;  2V7V A;  1K28 D;  1LAM A;  6CPA A;  2QMU A;  2FIA A;  2ZEM A;  1NBM A;  4NNJ A;  1AMO A;  3H8G A;  4P9S A;  3FNC A;  4IHM A;  1YJW B;  3W5V A;  2Z3O A;  2ZW6 A;  2EO8 A;  3SXN A;  3NH8 A;  4Y7C A;  4B11 A;  1K9M D;  3PB8 X;  1NMT A;  4R3K A;  3H8F A;  1YIJ B;  1QFJ A;  2VXK A;  4AF7 A;  1KK0 A;  2Q6K A;  4PXD A;  4AVZ A;  5AG7 A;  1R5O A;  1T6Z A;  3K9T A;  3CES A;  4II3 A;  3W2F A;  3FF3 A;  1W35 A;  3MN8 A;  5HZA A;  3R96 A;  3SKB A;  1QGA A;  1YX0 A;  3WAB A;  3AVU A;  2QEC A;  4XOP A;  2OBS A;  4YFJ A;  1MAB A;  3GB0 A;  3PUM A;  1WU8 A;  1EP1 B;  2V7Q A;  1NSL A;  4FD7 A;  3F0A A;  3EC4 A;  3HLP A;  3IJ3 A;  3OJX A;  5DS0 A;  4BIN A;  3GSI A;  5HZB A;  2D4P A;  1EP3 B;  2B7B A;  4XN3 A;  3PA1 A;  2GAN A;  1WOR A;  3PVD A;  2Q0Y A;  1UD3 A;  4NJQ A;  4F7D A;  2HQY A;  5HVH A;  4PXE A;  1S4M A;  3A8K A;  1CNE A;  2CY2 A;  4RPD A;  1ELL P;  1N71 A;  4CS0 B;  3LQE A;  3QNV A;  1EWY A;  4AVC A;  3ZZT A;  3QAY A;  4B47 A;  2XEI A;  5D29 A;  2XEJ A;  1YLE A;  5EC4 A;  2FXF A;  4P1V A;  2BV3 A;  4MY0 A;  2WR8 A;  3V7Z A;  3FPK A;  4YHB A;  4B12 A;  3CTA A;  5LYD A;  2ZEE A;  1VQO B;  3H4Q A;  3D4U A;  4QVJ A;  4NGP A;  1XE1 A;  4B44 A;  2OBR A;  5J3O A;  4PC1 A;  2C5B A;  4IW3 B;  2VQY A;  4C7I A;  2JBK A;  3Q6Q A;  4XLF A;  4JXR A;  4ZGY B;  4P4J A;  3U6K A;  1UFH A;  1ZO0 A;  4X05 A;  3AST A;  2ZW4 A;  3A1P A;  1YR0 A;  3CXQ A;  1BLI A;  4E0F A;  1QFY A;  5BSX A;  2OH1 A;  2C1C A;  3TE4 A;  5C88 A;  2J8R A;  4XON A;  3ASQ A;  2Q6I A;  1QUF A;  2Q04 A;  2G3A A;  3PUN A;  3T9Y A;  2X8K A;  4OME A;  2F1L A;  1XMT A;  1W9X A;  2JEV A;  5EBV A;  3TT2 A;  1VQP B;  1PJ5 A;  4OP4 A;  3CW2 A;  2XGJ A;  2Q7B A;  1IGB A;  4X06 A;  3RZA A;  3NH5 A;  1W2B B;  4KOS A;  4MFQ A;  3TOA A;  3PFO A;  2EWB A;  4ZX9 A;  4EFD A;  4WZL A;  4A33 A;  3KHX A;  1LRZ A;  2Q7S A;  2QE7 A;  4KOW A;  1FX0 A;  4ZV4 A;  3LNN A;  1COW A;  4OP7 A;  1TF9 A;  1JWQ A;  5KTA A;  4M6G A;  3R9E A;  5AG5 A;  3VNU A;  2V31 A;  1KC8 D;  1NRK A;  2ZW5 A;  2V77 A;  3LVB A;  1VHO A;  1VQL B;  4B43 A;  3LD2 A;  5GV8 A;  1V5V A;  2C6G A;  4DK0 A;  1YLO A;  4X07 A;  4UZF A;  1Q7L A;  4KUB A;  5THX A;  1FNO A;  3UY5 A;  3VWE A;  2QIR A;  1I8D A;  1Z8L A;  1E1Q A;  1CPS A;  1R43 A;  1OB5 A;  2RC5 A;  4LBV A;  1YVO A;  2DPS A;  4NXY A;  3RY8 A;  5L46 A;  4H9G A;  3OPO A;  2B58 A;  2BM1 A;  5FIU A;  3CCR B;  1XJO A;  3TC8 A;  3ZPN A;  3U6B A;  4C7H A;  5CDF A;  2YND A;  3D7F A;  2ZOF A;  4LUA A;  4FAI A;  1WOO A;  1S7K A;  4R8F A;  2B3U A;  1Y7R A;  4NGS A;  4YGO A;  1N07 A;  3G71 B;  4YAO A;  3IWW A;  3R9G A;  2ZEH A;  4P12 A;  5IK2 A;  4AB7 A;  4P10 A;  1YRE A;  4R71 A;  2I00 A;  1HA3 A;  4M2L A;  4A30 A;  4P6V F;  2PRB A;  1A8P A;  3PBB A;  3BY2 A;  2DEU A;  1ARM A;  5FA6 A;  3B3V A;  4H89 A;  2QYV A;  4B3G A;  2PCU A;  1ZG7 A;  1DDI A;  2ZW7 A;  3F8K A;  1WWZ A;  4P4B A;  4AXV A;  4MJ8 A;  2KCW A;  2YWF A;  3W6X A;  3WBJ A;  4NGT A;  2R1I A;  4OPV A;  1LFW A;  4A2Z A;  2DER A;  5A89 A;  3FED A;  4RJL A;  3MMP A;  5LYL A;  1M1D A;  2AFS A;  1IJF A;  2BN4 A;  1R3N A;  3B35 A;  2V8D A;  4AG9 A;  4W9Y A;  4TWE A;  4RD4 A;  3A3B A;  1YK3 A;  1QVF B;  1NSA A;  5F09 A;  4P45 A;  3Q6R A;  1MK4 A;  4XQF A;  2F1M A;  1EE3 P;  3FRM A;  2BSW A;  2D4O A;  3OW7 A;  4QV2 A;  2BVN A;  3WNB A;  4KVO E;  2YWG A;  4P3Y A;  5IV0 A;  3GVK A;  1T6Y A;  3ASS A;  3PEI A;  3GIR A;  3BLN A;  1CPX A;  3RBU A;  2X6Y A;  2CXA A;  2ZZF A;  4FUU A;  4GXH A;  2BL1 A;  4MFJ A;  4OC1 A;  3KL9 A;  2YNE A;  2Z3K A;  1LAP A;  4QUS A;  4XN0 A;  3PEN A;  2V8V A;  1KRH A;  1Z4E A;  3BCD A;  1VIX A;  2AFW A;  2EK9 A;  4A37 A;  2J8N A;  1Y7E A;  1VF7 A;  1E43 A;  2ZEP A;  1SM4 A;  2PVV A;  2CNS A;  3OAA A;  2ZEL A;  2G0B A;  3CCM B;  5G20 A;  4E8O A;  4HNW B;  3D8P A;  2PRQ A;  4LBY A;  1IIC A;  3NH4 A;  1VHE A;  4CRY B;  2Y0M A;  4K3N A;  2CF4 A;  4CQJ A;  1XEB A;  3VWD A;  2HLD A;  4L89 A;  1KK2 A;  3OFN A;  3S6F A;  3SXO A;  4RLZ A;  1GVH A;  4HNY B;  1QSO A;  4RD2 A;  3WR7 A;  4ZCL A;  2XOK A;  3FEE A;  4ZGQ B;  3JQR A;  4CGL A;  4M3S A;  3CT9 A;  3R95 A;  2YWE A;  4X7D A;  2LZJ A;  1F2P A;  5K8M A;  4MHY A;  2PJ8 A;  3B3W A;  1KZL A;  3IU1 A;  4DJL A;  1YJ9 B;  1BQE A;  4M1K A;  3OZV A;  3PBE A;  2P6F A;  4PC2 A;  3PB6 X;  4MFZ A;  4CYQ A;  3S6H A;  3BNW A;  4KOV A;  4YAF A;  2ZEG A;  3KGQ A;  3T53 B;  1UWY A;  3GKR A;  1YHQ B;  3ZJ0 A;  4RD0 A;  3FH4 A;  3WYA A;  2ZZG A;  4F9U A;  1JA1 A;  2PJ3 A;  3KHZ A;  1AUG A;  3W5H A;  3RAM A;  4FK8 A;  4MHP A;  3FIX A;  5GCN A;  3D67 A;  4KOT A;  2D9R A;  1EFT A;  1BX1 A;  4C2Y A;  2ZOG A;  1XRY A;  1BMF A;  4TMX A;  4M6H A;  1BPM A;  2GK7 A;  2DYI A;  1F57 A;  3CP2 A;  4UZE A;  1B87 A;  1Y0Y A;  3NE5 B;  4OC0 A;  4RPB A;  4DUK A;  2ODF A;  1IOF A;  4UFW A;  1KJZ A;  5CBM A;  3KQZ A;  2HMA A;  1ZM2 A;  2Q4V A;  2X53 S;  2F8H A;  4DQL A;  3OW2 B;  5EMI A;  2GIV A;  2CIJ A;  4QVA A;  1GR1 A;  1VQM B;  2NV4 A;  5FVJ A;  3DNS A;  3EO4 A;  1KD1 D;  4RUH A;  4JXQ A;  5AG6 A;  2PIA A;  4ZGN B;  3TX8 A;  4X8I A;  3I55 B;  4ACA A;  2ZTG A;  5IYW A;  4XLC A;  3AVY A;  4MCP A;  4CYP A;  4WZK A;  1TTT A;  2HC9 A;  2Q43 A;  4M4S A;  1YI2 B;  5H86 A;  1K4J A;  2JJ1 A;  3WT4 A;  2PJ1 A;  2C4U A;  3BCF A;  3EY5 A;  1KK3 A;  2G9D A;  2JBJ A;  3PZJ A;  2E1R A;  3E1Y E;  1H85 A;  2ZED A;  1WTH D;  4Q38 A;  2JDI A;  4LQG A;  2C77 A;  2FE7 A;  3RNZ A;  1S7N A;  3VNV A;  1BJK A;  1BX0 A;  3WC5 A;  3S6G A;  2PJB A;  1U6M A;  3GIU A;  2QTL A;  4MXU A;  1Z9U A;  1M4G A;  1GAW A;  5DSZ A;  4RD3 A;  1KZF A;  4Z4S A;  2V7W A;  5G22 A;  4II2 A;  4EH1 A;  3B2Y A;  3CCQ B;  5CPA A;  2JIZ A;  2PJC A;  2BCO A;  4QUZ A;  4B3F X;  2X0K A;  4YAU A;  2V4D A;  3OWC A;  7CPA A;  2OZU A;  1FDR A;  1ZLI A;  1FRN A;  1XIX A;  2O28 A;  2ZTN A;  1JJ2 B;  2WZN A;  1H8E A;  3A8J A;  2G3T A;  3E20 A;  1E64 A;  1MJ9 A;  3ES9 A;  2QML A;  4HNX B;  4OAD A;  1ON0 A;  4ASU A;  4B13 A;  4MMO A;  1PUA A;  3I1F A;  4CAV A;  4LBZ A;  5IB0 A;  4RCY A;  5K8O A;  3H94 A;  2PC1 A;  3HUV A;  1Q2Y A;  4OOS A;  2FS5 A;  1WPC A;  2C6C A;  4R9M A;  2OB0 A;  2DOG A;  3DDY A;  2CND A;  3BJ7 A;  2W6J A;  1LOK A;  1ZM3 A;  1FND A;  4P4E A;  3C26 A;  1GHE A;  1QUE A;  4OOV A;  4DK1 A;  3CP8 A;  3WY9 A;  3FMC A;  1TKF A;  3D2M A;  4GS4 A;  1G7S A;  4B5P A;  2JDC A;  1MJB A;  2VJI A;  2R6H A;  4KLW A;  2WSS A;  3BQJ A;  3BC9 A;  1TVC A;  2M5S A;  2AJ6 A;  4U9Y A;  4AF6 A;  1RO5 A;  4MI4 A;  1XE4 A;  3AVW A;  5LRJ A;  3SI0 A;  1CNF A;  4BMH A;  1QQ9 A;  2NYQ A;  5IYQ A;  4UCP A;  2BOA A;  4ZI6 A;  5LMZ A;  3WC6 A;  4OLL A;  5IYN A;  4PV6 A;  4C43 A;  3AGP A;  4ZCM A;  2VZL A;  3JRU A;  2JN9 A;  3VO2 A;  1HEE A;  2Q4Y A;  3MHP A;  2C6P A;  1X12 A;  4AVB A;  2FVG A;  3CXP A;  1CX8 A;  1R57 A;  3E0K A;  3FEC A;  1UD4 A;  1JA0 A;  4FXU A;  4Z4Z A;  2NMT A;  3B3S A;  3BJ8 A;  1YME A;  1SKQ A; 
#chains in the Genus database with same CATH homology
 3TC8 A;  3D7F A;  2ZOF A;  4FAI A;  3B7I A;  4R8F A;  4NGS A;  3D7G A;  4GM5 A;  3IWW A;  5LYI A;  2PE3 A;  2ZEH A;  1JQG A;  4OC4 A;  3ISZ A;  2VL1 A;  4P10 A;  1LCP A;  3WC7 A;  4R76 A;  5I4M A;  1YSJ A;  3DGV A;  4YU9 A;  3SJF A;  4B6Z A;  3PBB A;  3K2K A;  4CPA A;  4PPZ A;  1ARM A;  3B3V A;  3FX6 A;  2QYV A;  3KR5 A;  2PCU A;  1ZG7 A;  1DE4 C;  2V8G A;  4FBE A;  4P4B A;  4AXV A;  4P6Y A;  4NJR A;  1TXR A;  3KQX A;  4NGT A;  1LFW A;  4ZY0 A;  5THW A;  2DEA A;  1CBX A;  3FED A;  1Z5R A;  1BPN A;  1BAV A;  2I3C A;  3GUX A;  5LYF A;  5JGF A;  5LYL A;  3IO1 A;  2Q51 A;  3D7H A;  3I1U A;  2AFS A;  2PVW A;  2PJ5 A;  1DTD A;  4R6T A;  4WJB A;  5K8P A;  1CP7 A;  2XEG A;  1R3N A;  3B35 A;  4P4F A;  2JEW A;  1LAN A;  2V8D A;  4WWV A;  4W9Y A;  4A38 A;  4TWE A;  4O23 A;  1NSA A;  2IJZ A;  5F09 A;  4P45 A;  5JM6 A;  4R7M A;  1HDU A;  1EE3 P;  3BHX A;  1PCA A;  3N5F A;  4PXB A;  4IAV A;  3PEI A;  4MHN A;  1CPX A;  2AFZ A;  3RBU A;  4JZ0 A;  4FUU A;  1HDQ A;  4OID A;  4OC1 A;  3KL9 A;  2GU2 A;  4H2K A;  3LMS A;  5D8N A;  4ZY2 A;  1LAP A;  1VGY A;  2V8V A;  2RFH A;  1ZG8 A;  1YW4 A;  1VIX A;  2AFW A;  2EK9 A;  4A37 A;  5JH9 A;  1Y7E A;  4F9V A;  4A94 A;  4EME A;  2ZEP A;  2PVV A;  2AFO A;  2ZEL A;  3IEH A;  1ELM P;  2PRQ A;  2ZEF A;  3NH4 A;  3SJE A;  1VHE A;  4UIB A;  3PFE A;  1H8L A;  4K3N A;  4NGQ A;  1PYT B;  2CF4 A;  4UIA A;  4Q7A A;  1GYT A;  3DLJ A;  1BLL E;  3FJU A;  1ZG9 A;  3FEE A;  1CG2 A;  3PB9 X;  4P4I A;  4UF4 A;  2IQ6 A;  2GLF A;  3CT9 A;  1TKH A;  4ZY1 A;  3S9L A;  4JYW A;  1F2P A;  4NFR A;  2PJ9 A;  5K8M A;  4TNU A;  2PJA A;  4MHY A;  3CPX A;  3PB4 X;  4MHZ A;  2PJ8 A;  3B3W A;  4OKO A;  5HVF A;  3PRT A;  3IFE A;  1AMP A;  3SJX A;  4DJL A;  3CDX A;  3PBE A;  4OC5 A;  5ELY A;  4IK2 A;  4X3R A;  2PIZ A;  3PB6 X;  3KR4 A;  2PJ6 A;  5LRK A;  2ZEG A;  3KGQ A;  3SJG A;  2QVP A;  1UWY A;  3MRU A;  3FH4 A;  4A39 A;  4F9U A;  1LAM A;  6CPA A;  2PJ3 A;  1AYE A;  3KHZ A;  1CP6 A;  3GLJ A;  3RAM A;  2ZEM A;  2O53 A;  3H8G A;  4MHP A;  4IHM A;  3NFZ A;  3D67 A;  4MCQ A;  4P44 A;  3NH8 A;  2HB6 A;  2Q4Z A;  2AFM A;  3PB8 X;  4DYO A;  2ZOG A;  1XRY A;  4NGR A;  3FVL A;  3H8F A;  4OIW A;  4MCS A;  4KSI A;  1BPM A;  4PXD A;  1F57 A;  3L2N A;  3VAT A;  3K9T A;  1Y0Y A;  3FF3 A;  4OC0 A;  3MN8 A;  1FT7 A;  4DUK A;  5J1Q A;  5CBM A;  3D68 A;  3KQZ A;  3BXM A;  4F8Z A;  4Z65 A;  3CPA A;  3WAB A;  1XBU A;  2F8H A;  2AFU A;  2F7V A;  2ANP A;  2CIJ A;  4MRI A;  3H8E A;  3GB0 A;  3ISX A;  4RUH A;  3PB7 X;  2CTC A;  2OR4 A;  3KZW A;  1QMU A;  2WYR A;  2OOT A;  3HLP A;  3IJ3 A;  5DS0 A;  3TX8 A;  4X8I A;  1ZLH A;  4ZYQ A;  1Y0R A;  4MCP A;  2HC9 A;  2Q43 A;  3BI0 A;  3B3C A;  3T8W A;  3WT4 A;  4NJQ A;  2PJ1 A;  2V8H A;  3SI2 A;  5HVH A;  2G9D A;  4PXE A;  2JBJ A;  2PIY A;  1RTQ A;  3VAR A;  3SI1 A;  3BI1 A;  2ZED A;  1ELL P;  5HVG A;  3QNV A;  4OC3 A;  2POK A;  2J9A A;  4LQG A;  3VH9 A;  2XEI A;  2AFX A;  5D29 A;  2XEJ A;  3WC5 A;  2GLJ A;  4FWU A;  2PJB A;  4MCR A;  2GRE A;  4MXU A;  3KI9 A;  3V7Z A;  1ARL A;  3B2Y A;  5CPA A;  2O4H A;  2PJC A;  4UEZ A;  2PJ4 A;  4UEF A;  2BCO A;  1IY7 A;  5LYD A;  2ZEE A;  3D4U A;  4NGP A;  7CPA A;  3IC1 A;  1ZLI A;  3LWU A;  2JBK A;  2WZN A;  3V38 A;  4ONW A;  4P4J A;  4NGM A;  2ZEO A;  4X2T A;  2NSM A;  1KWM A;  4OC2 A;  1OBR A;  2PJ7 A;  3S9N A;  2C1C A;  2XEF A;  4MMO A;  5K8O A;  3HUV A;  2QJ8 A;  1Z2L A;  3KAS A;  4OME A;  4YWY A;  1TF8 A;  2C6C A;  3B3T A;  5LRG A;  1LOK A;  3S9M A;  4P4E A;  4OP4 A;  4PQA A;  1YW6 A;  4UEE A;  4ZX8 A;  1IGB A;  3FMC A;  1TKF A;  3RZA A;  2ZEN A;  3NH5 A;  4PXC A;  3PFO A;  2EWB A;  4ZX9 A;  4EFD A;  5HXD A;  4NGN A;  4BD9 A;  3KHX A;  1TKJ A;  2PJ0 A;  2RB7 A;  2EK8 A;  3D66 A;  2CTB A;  1TF9 A;  4P4D A;  3NA6 A;  3IIB A;  2V77 A;  4G1P A;  5LRJ A;  8CPA A;  3SI0 A;  2PJ2 A;  1F2O A;  1M4L A;  1VHO A;  1QQ9 A;  2NYQ A;  2C6G A;  1YLO A;  2BOA A;  4ZI6 A;  2ABZ A;  1Q7L A;  2IMO A;  1FNO A;  3WC6 A;  5K8N A;  4EWT A;  1XFO A;  1Z8L A;  1CPS A;  1R43 A;  3D7D A;  3JRU A;  1HEE A;  1XMB A;  2C6P A;  5IB9 A;  2FVG A;  2BO9 A;  1CX8 A;  3FEC A;  3B3S A;  1YME A;  1XJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...