3CQ4A

Histidinol-phosphate aminotransferase from corynebacterium glutamicum
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
357
Chain Sequence
KITLSDLPLREELRVDIRLNTNENPYPPSEALVADLVATVDKIATELRDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNLSAWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol-phosphate aminotransferase
publication title Insights into the structural basis of substrate recognition by histidinol-phosphate aminotransferase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 122
structure length 357
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.6.1.9: Histidinol-phosphate transaminase.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3cq4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3cq4A01
2XH1A 3FQ7A 4MY5A 4ZM4A 1JF9A 1D2FA 2Z9VA 2D61A 3II0A 5E4ZA 3UE8A 4LW2A 1LK9A 2FNIA 3QM2A 5BJ3A 3GZDA 2BHXA 5K8BA 3JWBA 4KAMA 2OKJA 3B46A 4CXRA 4LC3A 4LNJA 2HOYA 4A0HA 5FT4A 2BWPA 2AY1A 4N0WA 3RCHA 4ZDOA 5EAAA 2Z9WA 4U1TA 3R9AA 3AEPA 1RV3A 3GZDC 3OP7A 4U2HA 2OATA 1E5FA 4JEYA 2HUUA 2JGTA 3TATA 4CVQA 5M49A 4FL0A 1AMRA 3E77A 4EB7A 1G7XA 1QITA 1LC8A 1T3IA 5G0AA 4F5IA 3WKRA 4GRXA 3LVMA 2VI8A 4UOYA 4DQ6A 4OBUA 2D66A 3PAAA 2AY8A 2JISA 2YRIA 1RVYA 3B1DA 5EUDA 2EO5A 1IJIA 2VLHA 3BWNA 3KE3A 4IYOA 1AHFA 3WZFA 4GE9A 3WLXA 2YCTA 1AY8A 1QJ3A 2X5DA 2R5EA 3FFRA 4WB0A 3EUCA 1ZODA 3I5TA 3D6KA 3BWNC 2W8VA 3F0HA 1AHYA 3QN6A 1WKGA 1SVVA 2W8TA 2AY7A 3AEJA 1AKCA 2CJDA 3BWOA 3BV0A 2HUFA 3F6TA 4BHDA 2Q7WA 5AX8A 1GDEA 4XJOA 1TPLA 2C0RA 3NRAA 2EH6A 1DJ9A 3A2BA 3A9XA 4JE5D 5FT5A 4EMYA 2CANA 3A8UX 4K2MA 4F4EA 2C44A 3EI8A 2C81A 5HXXA 3HT4A 4XAUA 1MGVA 1ASLA 2VIAA 2VGTA 2YKVA 1EQBA 1XEYA 2D5YA 2VMXA 2WK8A 4F5KA 3N75A 1ARSA 3FKDA 3IHJA 1TOJA 1Y4IA 1Z3ZA 2CB1A 2GMUA 2JJEA 4EU1A 3AENB 3GJUA 2W7LA 3EI9A 1UU0A 2R2NA 1CZCA 3PDBA 2BI3A 3P1TA 1ASFA 3OKSA 1U08A 4MQQA 4PFNA 1OHYA 1AIAA 2YHKA 2DKBA 2VYCA 3GSBA 4M2JA 3WGBA 4A6UA 2X5FA 4RJYA 4BQ0A 5M46A 4XJPA 2VGVA 3FZ6A 5LH9A 3A9YA 4TMRA 4FFCA 3H7FA 4JE5A 5EIGA 3EI6A 5G2PA 1M0PA 1QISA 4NOGA 3LVLB 1M32A 2BYLA 2DGKA 2JJHA 2O0RA 4Q75A 1TOGA 2FYFA 4BA4A 1DGDA 1O69A 4EB5A 2DOUA 3G7QA 5EUNA 3BCAA 4XJMA 1D7VA 2VMYA 1IUGA 8AATA 2BYJA 2E7IA 4WBTA 2CJHA 1BT4A 4B9BA 3COGA 4IY7A 1X2AA 4ITGA 4P3MA 5BJ4A 2BWOA 3E2YA 3DODA 1LS3A 4IXZA 1XI9A 3DU4A 4PIWA 4WYCA 2W7EA 7AATA 3AOVA 2X3LA 1M0OA 1SFFA 3NU7A 3KGWA 2VI9A 3VK2A 2NMPA 4ZLVA 1SZSA 2XBNA 3DXWA 4IXOA 2R5CA 2PO3A 1WYVB 1MDXA 2ZY2A 3FVXA 4E1OA 4ATPA 1SZUA 4F5JA 1JS3A 1W23A 3E2ZB 3RBLA 2FNUA 4GE4A 4WLHA 4WYFA 4LW4A 3AATA 2AY5A 4WLJA 1BJOA 4GSAA 1TOKA 3W1HA 9AATA 3LG0A 5D5SA 1CQ6A 1GC4A 3EIAA 3QI6A 4F5LA 2VMNA 3I4JA 3K40A 1LKCA 4R2NA 1BJNA 2DGLA 1QIRA 1MLYA 1ELUA 3AV7A 1ARHA 2OQXA 4WD2A 2X8UA 4B98A 1TASA 1YJZA 2W8UA 1FC4A 3CQ4A 4OYTA 4EFFA 2G6WA 4PVFA 1ZC9A 3ATHA 2E7UA 3FQ8A 1D7UA 4Q76A 2BIGA 3ASAA 1N2TA 1YJYA 5D95A 1W7LA 1H0CA 1AY4A 1OHVA 4WYGA 4XJLA 1AMSA 1ASCA 1X0MA 2ZJGA 4MGRA 3MADA 3HBXA 3MKJA 3MAFB 3BB8A 3MBBA 1TARA 3PD6B 2OKKA 4XK1A 1C7GA 2VMZA 2VMWA 2GSAA 3FSLA 3FRKA 1H1CA 5F8VA 3GZCA 4WYEA 2BKWA 3H14A 4ADEA 1UKJA 2GMSA 1MLZA 2JG2A 1QGNA 4WXGA 4MSOA 2QLRA 4E3RA 2Z61A 1V2EA 3T32A 3WY7A 4CXQA 3WCOA 1IVRA 1ZOBA 2O7CA 1C7OA 3RCHB 3K7YA 4H51A 1AHEA 4F5GA 3PJ0A 1P3WA 1ASBA 1BJ4A 2HP1A 2QB3A 4ZSWA 1BKGA 1GC3A 1M4NA 3NUBA 1CJ0A 1MDOA 5C6UA 3FQAA 1DKAA 1X28A 4L0OA 2E7JA 4AH3A 3DZZA 3TFTA 1O4SA 4K2IA 1AAWA 1WYUA 1GEWA 3FTBA 4OBVA 2HP2A 3L8AA 3FZ7A 2AY2A 3ISLA 4IYOB 1B9IA 1DJEA 3NNKA 2VMTA 1S07A 2VGSA 4ZASA 1BS0A 4AZJA 1KKJA 4WYAA 3MEBA 2YCNA 1B8GA 2YOBA 2W7KA 4WB0B 4LNMA 1CZEA 2WKAA 1AY5A 2D64A 1WSTA 4JF1A 4MKKA 4RKCA 3NTJA 5G4IA 5DB5A 1CQ7A 1C9CA 1I48A 1QJ5A 1IX7A 4K2BA 4Y0DA 2EGYA 4F5MA 1UU2A 4Y0HA 4ZWVA 4WYDA 3QPGA 3RQ1A 2ZSMA 3FVSA 1Z7DA 5IWQA 1G4VA 4R5ZA 1I43A 3HQTA 4ZWMA 1IAXA 1ASGA 1M6SA 3BC8A 3NYUA 1C0NA 4TV7A 2CH1A 3WKSA 5E5IA 4HVKA 2YCPA 1X29A 1OXOA 3LV2A 2YKUA 2W7HA 1ORDA 2BIAA 2Z1YA 3FCRA 1TOIA 1BQDA 1KKPA 5DJ9A 2JJFA 5EFSA 4A6TA 1N31A 1AICA 2VMPA 1GBNA 1OATA 4JEXA 1ASEA 2GB3A 1J04A 3EI7A 3LVJA 2D7ZA 3VK4A 1B4XA 1IX8A 1KMKA 3HDOA 3NYSA 3FD0A 3PA9A 2PB0A 3G8MA 4O6ZA 1EG5A 3PDBB 1LW4A 4UHMA 3LVKA 3N5MA 3ECDA 1ARGA 3TQXA 1OHWA 2BI1A 2YRRA 4OT8A 1KL1A 1GEYA 2Z9UA 3ZZJA 1MDZA 1N8PA 2VMOA 3DR4A 5G2QA 1JS6A 3AOWA 3G0TA 1D7RA 3NDNA 5EAVA 1GD9A 2CSTA 5EIGB 1CL2A 3RI6A 3MC6A 1TATA 3JW9A 4RITA 1C7NA 1IAYA 1WKHA 3ZZKA 1AMAA 4GE7A 4HF8A 3CQ6A 1D7SA 1W7NA 4CBSA 3MC6C 1ARTA 2CFBA 3QHXA 1YJSA 4W91A 1B9HA 5G4JA 5JAYA 1AKBA 1GEXA 1I29A 3W1IA 3NU8A 3NX3A 5F9SA 2VMUA 3JZLA 4JEZA 3JU7A 2Z67A 3BCXA 3EI5A 1ASMA 3FZ8A 3ZRPA 3L44A 4RAEA 3UWCA 3DC1A 2W7JA 3AEMA 1WYTB 1FG7A 3HMUA 2CJGA 3ASBA 4DBCA 3EZ1A 1SPAA 3HL2A 3K28A 1OXPA 2BI5A 4ADDA 2BWNA 3LWSA 3R4TA 5E3KA 4A00A 4CBRA 2AY3A 2D63A 3AEMC 4WXFA 1AJSB 2O1BA 5HDMA 4ISYA 1M0QA 3UAKA 4WP0A 1KMJA 4Q31A 4RKDA 1PFFA 3P6KA 4XEWA 1O61A 2AY6A 1MAQA 5I92A 1VP4A 4RM1A 1ASAA 2YKXA 5FT6A 2W7DA 2RFVA 4PFFA 4N0BA 1B5OA 1V2DA 2AATA 3QBOA 1M7YA 4ZDPA 2ZUKA 3ELPA 3PDXA 4Q6RA 3ZRQA 3TFUA 3GETA 2DR1A 5M4BA 1AMQA 1ARIA 3IF2A 2W7MA 2VLFA 2ZC0A 5EQCA 1S0AA 2Z1ZA 4RJ0A 2DKJA 1DJUA 4IX8A 4ZAHA 4R8DA 3F9TA 1O62A 3MAUA 3PPLA 4J5UA 3KKIA 1V72A 3B1EA 1AX4A 3GR9A 2EZ2A 2W7GA 2ZY5A 3NUIA 4IW7A 3CQ5A 3JTXA 2CINA 3GWPA 4P7YA 3ELEA 4I8AA 2AEVA 1AHGA 2VMRA 4A6RA 4W5KA 1M0NA 1ASNA 1IBJA 2OGEA 2PB2A 3CBFA 3PGYA 5G09A 2ZYJA 3ACZA 3NYTA 4TN4A 3BCBA 3FFHA 1DFOA 2Z20A 1YAAA 1VJOA 3EIBA 2ZY3A 5LHAA 1UU1A 4OTLA 3BS8A 4Y0IA 1J32A 2ZSLA 1CS1A 3N0LA 5M4DA 3TCMA 2C7TA 3A9ZA 3AELA 2HOZA 4ZDLA 4UHNA 3RUYA 3VP6A 2GQNA 4E77A 4BMKA 4GDYA 1B5PA 4AZKA 2CH2A 5TF5A 4AOAA 2WK9A 3DRDA 3FVUA 3KGXA 1G4XA 3VK3A 3DR7A 4AO9A 3BN1A 1ELQA 2HORA 2DGMA 5J8QA 4QGRA 4KYOA 3AENA 5EUEA 2Z9XA 3DXVA 4F5HA 2BI9A 1MAPA 1YOOA 2JJGA 3AEJC 2OGAA 1BW0A 3ZRRA 1I41A 2BIEA 2CTZA 1SZKA 1S06A 1WYUB 3E6GA 4ITXA 3E9KA 1DTYA 3RBFA 1AJRA 1IX6A 1LC5A 3Q8NA 2AEUA 1BJWA 2R0TA 3B8XA 1JG8A 1GCKA 1TOEA 1VEFA 4OCAA 4XQ2A 3QGUA 2D65A 1GC0A 2QMAA 3DYDA 1BQAA 1RV4A 2CY8A 1FG3A 1ASDA 2W8JA 5DX5A 3PIUA 1GC2A 4OMAA 1KL2A 1AIBA 2BI2A 2VMVA 4ADBA 2V0YA 3HVYA 2FN6A 2ZY4A 3E2FA 1DGEA 4UHOA 1S09A 2AY4A 1AKAA 1ECXA 1EJIA 1LW5A 1PMMA 2QB2A 4A0RA 1G7WA 1YNUA 2QA3A 2ZP7A 4UQVA 3VOMA 4DGTA 1S08A 1W7MA 3B1CA 4MKJA 2QBTA 4BA5A 4JEWA 3VAXA 4A0GA 1E5EA 1WYVA 3CAIA 3W1JA 4ZM3A 4MQRA 4A72A 3E2ZA 4KXKA 4R5FA 3LY1A 4WXBA 1CL1A 4JEVA 3GBXA 4W1VA 4ADCA 2VGUA 2EPJA 1AAMA 2VGZA 4LNLA 1YIZA 2HOXA 4GEBA 3JWAA 1PG8A 1SF2A 2W8WA 1RVUA 3USFA 1CQ8A 5HHYA 2AY9A 3FDDA 4E3QA 4ZSYA 5DJ1A 1W3UA 4A0FA 2HUIA 4J8LA 2TPLA 2EZ1A 3FDBA 1YIYA 1LC7A 1WYTA 4OC9A 1PMOA 2R5CB 2VIBA 2FQ6A 4JF0A 2WK7A 3AEOA 3EZSA 2VMSA 2W7FA 3WGCA 1QZ9A 4M2MA 2VMQA 4W8IA 2V1PA 4AO4A 1AJSA 1V2FA 3I16A 4M2KA 2F8JA 1BJOB 2HZPA 1C4KA 3M5UA 4RIZA 5FT8A 3WX9A 4W1XA 4ATQA 2VGWA 2YKYA 4F5FA 3MAFA 2FM1A 4IXSA 4RLGA 2D7YA 3WCNA 3PD6A 2W7IA 3HLMA 4MQPA 1AHXA 4W1WA 2E54A 2ORDA
chains in the Genus database with same CATH superfamily
2XH1A 3FQ7A 4MY5A 4ZM4A 1JF9A 1D2FA 2Z9VA 2D61A 3II0A 5E4ZA 3UE8A 4LW2A 1LK9A 2FNIA 3QM2A 5BJ3A 3GZDA 2BHXA 5K8BA 3JWBA 4KAMA 2OKJA 3B46A 4CXRA 4LC3A 4LNJA 2HOYA 4A0HA 5FT4A 2BWPA 2AY1A 4N0WA 3RCHA 4ZDOA 5EAAA 2Z9WA 4U1TA 3R9AA 3AEPA 1RV3A 3GZDC 3OP7A 4U2HA 2OATA 1E5FA 4JEYA 2HUUA 2JGTA 3TATA 4CVQA 5M49A 4FL0A 1AMRA 3E77A 4EB7A 1G7XA 1QITA 1LC8A 1T3IA 5G0AA 4F5IA 3WKRA 4GRXA 3LVMA 2VI8A 4UOYA 4DQ6A 4OBUA 2D66A 2QSRA 3PAAA 2AY8A 2JISA 2YRIA 1RVYA 3B1DA 5EUDA 2EO5A 1IJIA 2VLHA 3BWNA 3KE3A 4IYOA 1AHFA 3WZFA 4GE9A 3WLXA 2YCTA 1AY8A 1QJ3A 2X5DA 2R5EA 3FFRA 4WB0A 3EUCA 1ZODA 3I5TA 3D6KA 3BWNC 2W8VA 3F0HA 1AHYA 3QN6A 1WKGA 1SVVA 2W8TA 2AY7A 3AEJA 1AKCA 2CJDA 3BWOA 3BV0A 2HUFA 3F6TA 4BHDA 2Q7WA 5AX8A 1GDEA 4XJOA 1TPLA 2C0RA 3NRAA 2EH6A 1DJ9A 3A2BA 3A9XA 4JE5D 5FT5A 4EMYA 2CANA 3A8UX 4K2MA 4F4EA 2C44A 3EI8A 2C81A 5HXXA 3HT4A 4XAUA 1MGVA 1ASLA 2VIAA 2VGTA 2YKVA 1EQBA 1XEYA 2D5YA 2VMXA 2WK8A 4F5KA 3N75A 1ARSA 3FKDA 3IHJA 1TOJA 1Y4IA 1Z3ZA 2CB1A 2GMUA 2JJEA 4EU1A 3AENB 3GJUA 2W7LA 3EI9A 1UU0A 2R2NA 1CZCA 3PDBA 2BI3A 3P1TA 1ASFA 3OKSA 1U08A 4MQQA 4PFNA 1OHYA 1AIAA 2YHKA 2DKBA 2VYCA 3GSBA 4M2JA 3WGBA 4A6UA 2X5FA 4RJYA 4BQ0A 5M46A 4XJPA 2VGVA 3FZ6A 5LH9A 3A9YA 4TMRA 4FFCA 3H7FA 4JE5A 5EIGA 3EI6A 5G2PA 1M0PA 1QISA 4NOGA 3LVLB 1M32A 2BYLA 2DGKA 2JJHA 2O0RA 4Q75A 1TOGA 2FYFA 4BA4A 1DGDA 1O69A 4EB5A 2DOUA 3G7QA 5EUNA 3BCAA 3H9XA 4XJMA 1D7VA 2VMYA 1IUGA 8AATA 2BYJA 2E7IA 4WBTA 2CJHA 1BT4A 4B9BA 3COGA 4IY7A 1X2AA 4ITGA 4P3MA 5BJ4A 2BWOA 3E2YA 3DODA 1LS3A 4IXZA 1XI9A 3DU4A 4PIWA 4WYCA 2W7EA 7AATA 3AOVA 2X3LA 1M0OA 1SFFA 3NU7A 3KGWA 2VI9A 3VK2A 2NMPA 4ZLVA 1SZSA 2XBNA 3DXWA 4IXOA 2R5CA 2PO3A 1WYVB 1MDXA 2ZY2A 3FVXA 4E1OA 2WB6A 4ATPA 1SZUA 4F5JA 1JS3A 1W23A 3E2ZB 3RBLA 2FNUA 4GE4A 4WLHA 4WYFA 4LW4A 3AATA 2AY5A 4WLJA 1BJOA 4GSAA 1TOKA 3W1HA 9AATA 3LG0A 5D5SA 1CQ6A 1GC4A 3EIAA 3QI6A 4F5LA 2VMNA 3I4JA 3K40A 1LKCA 4R2NA 1BJNA 2DGLA 1QIRA 1MLYA 1ELUA 3AV7A 1ARHA 2OQXA 4WD2A 2X8UA 4B98A 1TASA 1YJZA 2W8UA 1FC4A 3CQ4A 4OYTA 4EFFA 2G6WA 4PVFA 1ZC9A 3ATHA 2E7UA 3FQ8A 1D7UA 4Q76A 2BIGA 3ASAA 1N2TA 1YJYA 5D95A 1W7LA 1H0CA 1AY4A 1OHVA 4WYGA 4XJLA 1AMSA 1ASCA 1X0MA 2ZJGA 4MGRA 3MADA 3HBXA 3MKJA 3MAFB 3BB8A 3MBBA 1TARA 3PD6B 2OKKA 4XK1A 1C7GA 2VMZA 2VMWA 2GSAA 3FSLA 3FRKA 1H1CA 5F8VA 3GZCA 4WYEA 2BKWA 3H14A 4ADEA 1UKJA 2GMSA 1MLZA 2JG2A 1QGNA 4WXGA 4MSOA 2QLRA 4E3RA 2Z61A 1V2EA 3T32A 3WY7A 4CXQA 3WCOA 1IVRA 1ZOBA 2O7CA 1C7OA 3RCHB 3K7YA 4H51A 1AHEA 4F5GA 3PJ0A 1P3WA 1ASBA 1BJ4A 2HP1A 2QB3A 4ZSWA 1BKGA 1GC3A 1M4NA 3NUBA 1CJ0A 1MDOA 5C6UA 2G7JA 3FQAA 1DKAA 1X28A 4L0OA 2E7JA 4AH3A 3DZZA 3TFTA 1O4SA 4K2IA 1AAWA 1WYUA 1GEWA 3FTBA 4OBVA 2HP2A 3L8AA 3FZ7A 2AY2A 3ISLA 4IYOB 1B9IA 1DJEA 3NNKA 2VMTA 1S07A 2VGSA 4ZASA 1BS0A 4AZJA 1KKJA 4WYAA 3MEBA 2YCNA 1B8GA 2YOBA 2W7KA 4WB0B 4LNMA 1CZEA 2WKAA 1AY5A 2D64A 1WSTA 4JF1A 4MKKA 4RKCA 3NTJA 5G4IA 5DB5A 1CQ7A 1C9CA 1I48A 1QJ5A 1IX7A 4K2BA 4Y0DA 2EGYA 4F5MA 1UU2A 4Y0HA 4ZWVA 4WYDA 3QPGA 3RQ1A 2ZSMA 3FVSA 1Z7DA 5IWQA 1G4VA 4R5ZA 1I43A 3HQTA 4ZWMA 1IAXA 1ASGA 1M6SA 3BC8A 3NYUA 1C0NA 4TV7A 2CH1A 3WKSA 5E5IA 4HVKA 2YCPA 1X29A 1OXOA 3LV2A 2YKUA 2W7HA 1ORDA 2BIAA 2Z1YA 3FCRA 1TOIA 1BQDA 1KKPA 5DJ9A 2JJFA 5EFSA 4A6TA 1N31A 1AICA 2VMPA 1GBNA 1OATA 4JEXA 1ASEA 2GB3A 1J04A 3EI7A 3LVJA 2D7ZA 3VK4A 1B4XA 1IX8A 1KMKA 3HDOA 3NYSA 3FD0A 3PA9A 2PB0A 3G8MA 4O6ZA 1EG5A 3PDBB 1LW4A 4UHMA 3LVKA 3N5MA 3ECDA 1ARGA 3TQXA 1OHWA 2BI1A 2YRRA 4OT8A 1KL1A 1GEYA 2Z9UA 3ZZJA 1MDZA 1N8PA 2VMOA 3DR4A 5G2QA 1JS6A 3AOWA 3G0TA 1D7RA 3NDNA 5EAVA 1GD9A 2CSTA 5EIGB 1CL2A 3RI6A 3MC6A 1TATA 3JW9A 4RITA 1C7NA 1IAYA 1WKHA 3ZZKA 1AMAA 4GE7A 4HF8A 3CQ6A 1D7SA 1W7NA 4CBSA 3MC6C 1ARTA 2CFBA 3QHXA 1KAFA 1YJSA 4W91A 1B9HA 3N4XA 5G4JA 5JAYA 1AKBA 1GEXA 1I29A 3W1IA 3NU8A 3NX3A 5F9SA 2VMUA 3JZLA 4JEZA 3JU7A 2Z67A 3BCXA 3EI5A 1ASMA 3FZ8A 3ZRPA 3L44A 4RAEA 3UWCA 3DC1A 2W7JA 3AEMA 1WYTB 1FG7A 3HMUA 2CJGA 3ASBA 4DBCA 3EZ1A 1SPAA 3HL2A 3K28A 1OXPA 2BI5A 4ADDA 2BWNA 3LWSA 3R4TA 5E3KA 4A00A 4CBRA 2AY3A 2D63A 3AEMC 4WXFA 1AJSB 2O1BA 5HDMA 4ISYA 1M0QA 3UAKA 4WP0A 1KMJA 4Q31A 4RKDA 1PFFA 3P6KA 4XEWA 1O61A 2AY6A 1MAQA 5I92A 1VP4A 4RM1A 1ASAA 2YKXA 5FT6A 2W7DA 2RFVA 4PFFA 4N0BA 1B5OA 1V2DA 2AATA 3QBOA 1M7YA 4ZDPA 2ZUKA 3ELPA 3PDXA 4Q6RA 3ZRQA 3TFUA 3GETA 2DR1A 5M4BA 1AMQA 1ARIA 3IF2A 2W7MA 2VLFA 2ZC0A 5EQCA 1S0AA 2Z1ZA 4RJ0A 2DKJA 1DJUA 4IX8A 4ZAHA 3N7NA 4R8DA 3F9TA 1O62A 3MAUA 3PPLA 4J5UA 3KKIA 1V72A 3B1EA 1AX4A 3GR9A 2EZ2A 2W7GA 2ZY5A 3NUIA 4IW7A 3CQ5A 3JTXA 2CINA 3GWPA 4P7YA 3ELEA 4I8AA 2AEVA 1AHGA 2VMRA 4A6RA 4W5KA 1M0NA 1ASNA 1IBJA 2OGEA 2PB2A 3CBFA 3PGYA 5KTBA 5G09A 2ZYJA 3ACZA 3NYTA 4TN4A 3BCBA 3FFHA 1DFOA 2Z20A 1YAAA 1VJOA 3EIBA 2ZY3A 5LHAA 1UU1A 4OTLA 3BS8A 4Y0IA 3N4RA 1J32A 2ZSLA 1CS1A 3N0LA 5M4DA 3TCMA 2C7TA 3A9ZA 3AELA 2HOZA 4ZDLA 4UHNA 3RUYA 3VP6A 2GQNA 4E77A 4BMKA 4GDYA 1B5PA 4AZKA 2CH2A 5TF5A 4AOAA 2WK9A 3DRDA 3FVUA 3KGXA 1G4XA 3VK3A 3DR7A 4AO9A 3N4SA 2KFPA 3BN1A 1ELQA 2HORA 2DGMA 5J8QA 2EYQA 4QGRA 4K05A 4KYOA 3AENA 5EUEA 2Z9XA 3DXVA 4F5HA 2BI9A 1MAPA 1YOOA 2JJGA 3AEJC 2OGAA 1BW0A 3ZRRA 1I41A 2BIEA 2CTZA 1SZKA 1S06A 1WYUB 3E6GA 4ITXA 3E9KA 1DTYA 3RBFA 1AJRA 1IX6A 4H63Q 1LC5A 3Q8NA 2AEUA 1BJWA 2R0TA 3B8XA 1JG8A 1GCKA 1TOEA 1VEFA 4OCAA 4XQ2A 3QGUA 2D65A 1GC0A 2QMAA 3DYDA 1BQAA 1RV4A 2CY8A 1FG3A 1ASDA 2W8JA 5DX5A 3PIUA 1GC2A 4OMAA 1KL2A 1AIBA 2BI2A 2VMVA 4ADBA 2V0YA 3HVYA 2FN6A 2ZY4A 3E2FA 1DGEA 4UHOA 1S09A 2AY4A 1AKAA 1ECXA 1EJIA 1LW5A 1PMMA 2QB2A 4A0RA 1G7WA 1YNUA 2QA3A 2ZP7A 4UQVA 3VOMA 4DGTA 1S08A 1W7MA 3B1CA 4MKJA 2QBTA 4BA5A 4JEWA 3VAXA 4A0GA 1E5EA 1WYVA 3CAIA 3W1JA 4ZM3A 4MQRA 4A72A 3E2ZA 4KXKA 4R5FA 3LY1A 4WXBA 1CL1A 4JEVA 3GBXA 4W1VA 4ADCA 2VGUA 2EPJA 1AAMA 2VGZA 4LNLA 1YIZA 2HOXA 4GEBA 3JWAA 1PG8A 1SF2A 2W8WA 2A1VA 1RVUA 3USFA 1CQ8A 5HHYA 2AY9A 3FDDA 4E3QA 4ZSYA 5DJ1A 1W3UA 4A0FA 2HUIA 4J8LA 2TPLA 2EZ1A 3FDBA 1YIYA 1LC7A 1WYTA 4OC9A 1PMOA 2R5CB 2VIBA 2FQ6A 4JF0A 2WK7A 3AEOA 3EZSA 2VMSA 2W7FA 3WGCA 1QZ9A 4M2MA 2VMQA 4W8IA 2V1PA 4AO4A 1AJSA 1V2FA 3I16A 4M2KA 2F8JA 1BJOB 2HZPA 1C4KA 3M5UA 4RIZA 5FT8A 3WX9A 4W1XA 4ATQA 2VGWA 2YKYA 4F5FA 3MAFA 2FM1A 4IXSA 4RLGA 2D7YA 3WCNA 3PD6A 2W7IA 3HLMA 4MQPA 1AHXA 2FKIA 4W1WA 2E54A 2ORDA
chains in the Genus database with same CATH topology
2XH1A 3FQ7A 4MY5A 4ZM4A 1JF9A 1D2FA 2Z9VA 2D61A 3II0A 5E4ZA 3UE8A 4LW2A 1LK9A 2FNIA 3QM2A 5BJ3A 3GZDA 2BHXA 5K8BA 3JWBA 4KAMA 2OKJA 3B46A 4CXRA 4LC3A 4LNJA 2HOYA 4A0HA 5FT4A 2BWPA 2AY1A 4N0WA 3RCHA 4ZDOA 5EAAA 2Z9WA 4U1TA 3R9AA 3AEPA 1RV3A 3GZDC 3OP7A 4U2HA 2OATA 1E5FA 4JEYA 2HUUA 2JGTA 3TATA 4CVQA 5M49A 4FL0A 1AMRA 3E77A 4EB7A 1G7XA 1QITA 1LC8A 1T3IA 5G0AA 4F5IA 3WKRA 4GRXA 3LVMA 2VI8A 4UOYA 4DQ6A 4OBUA 2D66A 2QSRA 3PAAA 2AY8A 2JISA 2YRIA 1RVYA 3B1DA 5EUDA 2EO5A 1IJIA 2VLHA 3BWNA 3KE3A 4IYOA 1AHFA 3WZFA 4GE9A 3WLXA 2YCTA 1AY8A 1QJ3A 2X5DA 2R5EA 3FFRA 4WB0A 3EUCA 1ZODA 3I5TA 3D6KA 3BWNC 2W8VA 3F0HA 1AHYA 3QN6A 1WKGA 1SVVA 2W8TA 2AY7A 3AEJA 1AKCA 2CJDA 3BWOA 3BV0A 2HUFA 3F6TA 4BHDA 2Q7WA 5AX8A 1GDEA 4XJOA 1TPLA 2C0RA 3NRAA 2EH6A 1DJ9A 3A2BA 3A9XA 4JE5D 5FT5A 4EMYA 2CANA 3A8UX 4K2MA 4F4EA 2C44A 3EI8A 2C81A 5HXXA 3HT4A 4XAUA 1MGVA 1ASLA 2VIAA 2VGTA 2YKVA 1EQBA 1XEYA 2D5YA 2VMXA 2WK8A 4F5KA 3N75A 1ARSA 3FKDA 3IHJA 1TOJA 1Y4IA 1Z3ZA 2CB1A 2GMUA 2JJEA 4EU1A 3AENB 3GJUA 2W7LA 3EI9A 1UU0A 2R2NA 1CZCA 3PDBA 2BI3A 3P1TA 1ASFA 3OKSA 1U08A 4MQQA 4PFNA 1OHYA 1AIAA 2YHKA 2DKBA 2VYCA 3GSBA 4M2JA 3WGBA 4A6UA 2X5FA 4RJYA 4BQ0A 5M46A 4XJPA 2VGVA 3FZ6A 5LH9A 3A9YA 4TMRA 4FFCA 3H7FA 4JE5A 5EIGA 3EI6A 5G2PA 1M0PA 1QISA 4NOGA 3LVLB 1M32A 2BYLA 2DGKA 2JJHA 2O0RA 4Q75A 1TOGA 2FYFA 4BA4A 1DGDA 1O69A 4EB5A 2DOUA 3G7QA 5EUNA 3BCAA 3H9XA 4XJMA 1D7VA 2VMYA 1IUGA 8AATA 2BYJA 2E7IA 4WBTA 2CJHA 1BT4A 4B9BA 3COGA 4IY7A 1X2AA 4ITGA 4P3MA 5BJ4A 2BWOA 3E2YA 3DODA 1LS3A 4IXZA 1XI9A 3DU4A 4PIWA 4WYCA 2W7EA 7AATA 3AOVA 2X3LA 1M0OA 1SFFA 3NU7A 3KGWA 2VI9A 3VK2A 2NMPA 4ZLVA 1SZSA 2XBNA 3DXWA 4IXOA 2R5CA 2PO3A 1WYVB 1MDXA 2ZY2A 3FVXA 4E1OA 2WB6A 4ATPA 1SZUA 4F5JA 1JS3A 1W23A 3E2ZB 3RBLA 2FNUA 4GE4A 4WLHA 4WYFA 4LW4A 3AATA 2AY5A 4WLJA 1BJOA 4GSAA 1TOKA 3W1HA 9AATA 3LG0A 5D5SA 1CQ6A 1GC4A 3EIAA 3QI6A 4F5LA 2VMNA 3I4JA 3K40A 1LKCA 4R2NA 1BJNA 2DGLA 1QIRA 1MLYA 1ELUA 3AV7A 1ARHA 2OQXA 4WD2A 2X8UA 4B98A 1TASA 1YJZA 2W8UA 1FC4A 3CQ4A 4OYTA 4EFFA 2G6WA 4PVFA 1ZC9A 3ATHA 2E7UA 3FQ8A 1D7UA 4Q76A 2BIGA 3ASAA 1N2TA 1YJYA 5D95A 1W7LA 1H0CA 1AY4A 1OHVA 4WYGA 4XJLA 1AMSA 1ASCA 1X0MA 2ZJGA 4MGRA 3MADA 3HBXA 3MKJA 3MAFB 3BB8A 3MBBA 1TARA 3PD6B 2OKKA 4XK1A 1C7GA 2VMZA 2VMWA 2GSAA 3FSLA 3FRKA 1H1CA 5F8VA 3GZCA 4WYEA 2BKWA 3H14A 4ADEA 1UKJA 2GMSA 1MLZA 2JG2A 1QGNA 4WXGA 4MSOA 2QLRA 4E3RA 2Z61A 1V2EA 3T32A 3WY7A 4CXQA 3WCOA 1IVRA 1ZOBA 2O7CA 1C7OA 3RCHB 3K7YA 4H51A 1AHEA 4F5GA 3PJ0A 1P3WA 1ASBA 1BJ4A 2HP1A 2QB3A 4ZSWA 1BKGA 1GC3A 1M4NA 3NUBA 1CJ0A 1MDOA 5C6UA 2G7JA 3FQAA 1DKAA 1X28A 4L0OA 2E7JA 4AH3A 3DZZA 3TFTA 1O4SA 4K2IA 1AAWA 1WYUA 1GEWA 3FTBA 4OBVA 2HP2A 3L8AA 3FZ7A 2AY2A 3ISLA 4IYOB 1B9IA 1DJEA 3NNKA 2VMTA 1S07A 2VGSA 4ZASA 1BS0A 4AZJA 1KKJA 4WYAA 3MEBA 2YCNA 1B8GA 2YOBA 2W7KA 4WB0B 4LNMA 1CZEA 2WKAA 1AY5A 2D64A 1WSTA 4JF1A 4MKKA 4RKCA 3NTJA 5G4IA 5DB5A 1CQ7A 1C9CA 1I48A 1QJ5A 1IX7A 4K2BA 4Y0DA 2EGYA 4F5MA 1UU2A 4Y0HA 4ZWVA 4WYDA 3QPGA 3RQ1A 2ZSMA 3FVSA 1Z7DA 5IWQA 1G4VA 4R5ZA 1I43A 3HQTA 4ZWMA 1IAXA 1ASGA 1M6SA 3BC8A 3NYUA 1C0NA 4TV7A 2CH1A 3WKSA 5E5IA 4HVKA 2YCPA 1X29A 1OXOA 3LV2A 2YKUA 2W7HA 1ORDA 2BIAA 2Z1YA 3FCRA 1TOIA 1BQDA 1KKPA 5DJ9A 2JJFA 5EFSA 4A6TA 1N31A 1AICA 2VMPA 1GBNA 1OATA 4JEXA 1ASEA 2GB3A 1J04A 3EI7A 3LVJA 2D7ZA 3VK4A 1B4XA 1IX8A 1KMKA 3HDOA 3NYSA 3FD0A 3PA9A 2PB0A 3G8MA 4O6ZA 1EG5A 3PDBB 1LW4A 4UHMA 3LVKA 3N5MA 3ECDA 1ARGA 3TQXA 1OHWA 2BI1A 2YRRA 4OT8A 1KL1A 1GEYA 2Z9UA 3ZZJA 1MDZA 1N8PA 2VMOA 3DR4A 5G2QA 1JS6A 3AOWA 3G0TA 1D7RA 3NDNA 5EAVA 1GD9A 2CSTA 5EIGB 1CL2A 3RI6A 3MC6A 1TATA 3JW9A 4RITA 1C7NA 1IAYA 1WKHA 3ZZKA 1AMAA 4GE7A 4HF8A 3CQ6A 1D7SA 1W7NA 4CBSA 3MC6C 1ARTA 2CFBA 3QHXA 1YJSA 4W91A 1B9HA 3N4XA 5G4JA 5JAYA 1AKBA 1GEXA 1I29A 3W1IA 3NU8A 3NX3A 5F9SA 2VMUA 3JZLA 4JEZA 3JU7A 2Z67A 3BCXA 3EI5A 1ASMA 3FZ8A 3ZRPA 3L44A 4RAEA 3UWCA 3DC1A 2W7JA 3AEMA 1WYTB 1FG7A 3HMUA 2CJGA 3ASBA 4DBCA 3EZ1A 1SPAA 3HL2A 3K28A 1OXPA 2BI5A 4ADDA 2BWNA 3LWSA 3R4TA 5E3KA 4A00A 4CBRA 2AY3A 2D63A 3AEMC 4WXFA 1AJSB 2O1BA 5HDMA 4ISYA 1M0QA 3UAKA 4WP0A 1KMJA 4Q31A 4RKDA 1PFFA 3P6KA 4XEWA 1O61A 2AY6A 1MAQA 5I92A 1VP4A 4RM1A 1ASAA 2YKXA 5FT6A 2W7DA 2RFVA 4PFFA 4N0BA 1B5OA 1V2DA 2AATA 3QBOA 1M7YA 4ZDPA 2ZUKA 3ELPA 3PDXA 4Q6RA 3ZRQA 3TFUA 3GETA 2DR1A 5M4BA 1AMQA 1ARIA 3IF2A 2W7MA 2VLFA 2ZC0A 5EQCA 1S0AA 2Z1ZA 4RJ0A 2DKJA 1DJUA 4IX8A 4ZAHA 3N7NA 4R8DA 3F9TA 1O62A 3MAUA 3PPLA 4J5UA 3KKIA 1V72A 3B1EA 1AX4A 3GR9A 2EZ2A 2W7GA 2ZY5A 3NUIA 4IW7A 3CQ5A 3JTXA 2CINA 3GWPA 4P7YA 3ELEA 4I8AA 2AEVA 1AHGA 2VMRA 4A6RA 4W5KA 1M0NA 1ASNA 1IBJA 2OGEA 2PB2A 3CBFA 3PGYA 5KTBA 5G09A 2ZYJA 3ACZA 3NYTA 4TN4A 3BCBA 3FFHA 1DFOA 2Z20A 1YAAA 1VJOA 3EIBA 2ZY3A 5LHAA 1UU1A 4OTLA 3BS8A 4Y0IA 3N4RA 1J32A 2ZSLA 1CS1A 3N0LA 5M4DA 3TCMA 2C7TA 3A9ZA 3AELA 2HOZA 4ZDLA 4UHNA 3RUYA 3VP6A 2GQNA 4E77A 4BMKA 4GDYA 1B5PA 4AZKA 2CH2A 5TF5A 4AOAA 2WK9A 3DRDA 3FVUA 3KGXA 1G4XA 3VK3A 3DR7A 4AO9A 3N4SA 2KFPA 3BN1A 1ELQA 2HORA 2DGMA 5J8QA 2EYQA 4QGRA 4K05A 4KYOA 3AENA 5EUEA 2Z9XA 3DXVA 4F5HA 2BI9A 1MAPA 1YOOA 2JJGA 3AEJC 2OGAA 1BW0A 3ZRRA 1I41A 2BIEA 2CTZA 1SZKA 1S06A 1WYUB 3E6GA 4ITXA 3E9KA 1DTYA 3RBFA 1AJRA 1IX6A 4H63Q 1LC5A 3Q8NA 2AEUA 1BJWA 2R0TA 3B8XA 1JG8A 1GCKA 1TOEA 1VEFA 4OCAA 4XQ2A 3QGUA 2D65A 1GC0A 2QMAA 3DYDA 1BQAA 1RV4A 2CY8A 1FG3A 1ASDA 2W8JA 5DX5A 3PIUA 1GC2A 4OMAA 1KL2A 1AIBA 2BI2A 2VMVA 4ADBA 2V0YA 3HVYA 2FN6A 2ZY4A 3E2FA 1DGEA 4UHOA 1S09A 2AY4A 1AKAA 1ECXA 1EJIA 1LW5A 1PMMA 2QB2A 4A0RA 1G7WA 1YNUA 2QA3A 2ZP7A 4UQVA 3VOMA 4DGTA 1S08A 1W7MA 3B1CA 4MKJA 2QBTA 4BA5A 4JEWA 3VAXA 4A0GA 1E5EA 1WYVA 3CAIA 3W1JA 4ZM3A 4MQRA 4A72A 3E2ZA 4KXKA 4R5FA 3LY1A 4WXBA 1CL1A 4JEVA 3GBXA 4W1VA 4ADCA 2VGUA 2EPJA 1AAMA 2VGZA 4LNLA 1YIZA 2HOXA 4GEBA 3JWAA 1PG8A 1SF2A 2W8WA 2A1VA 1RVUA 3USFA 1CQ8A 5HHYA 2AY9A 3FDDA 4E3QA 4ZSYA 5DJ1A 1W3UA 4A0FA 2HUIA 4J8LA 2TPLA 2EZ1A 3FDBA 1YIYA 1LC7A 1WYTA 4OC9A 1PMOA 2R5CB 2VIBA 2FQ6A 4JF0A 2WK7A 3AEOA 3EZSA 2VMSA 2W7FA 3WGCA 1QZ9A 4M2MA 2VMQA 4W8IA 2V1PA 4AO4A 1AJSA 1V2FA 3I16A 4M2KA 2F8JA 1BJOB 2HZPA 1C4KA 3M5UA 4RIZA 5FT8A 3WX9A 4W1XA 4ATQA 2VGWA 2YKYA 4F5FA 3MAFA 2FM1A 4IXSA 4RLGA 2D7YA 3WCNA 3PD6A 2W7IA 3HLMA 4MQPA 1AHXA 2FKIA 4W1WA 2E54A 2ORDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XH1 A;  3FQ7 A;  4MY5 A;  4ZM4 A;  1JF9 A;  1D2F A;  2Z9V A;  2D61 A;  3II0 A;  5E4Z A;  3UE8 A;  4LW2 A;  1LK9 A;  2FNI A;  3QM2 A;  5BJ3 A;  3GZD A;  2BHX A;  5K8B A;  3JWB A;  4KAM A;  2OKJ A;  3B46 A;  4CXR A;  4LC3 A;  4LNJ A;  2HOY A;  4A0H A;  5FT4 A;  2BWP A;  2AY1 A;  4N0W A;  3RCH A;  4ZDO A;  5EAA A;  2Z9W A;  4U1T A;  3R9A A;  3AEP A;  1RV3 A;  3GZD C;  3OP7 A;  4U2H A;  2OAT A;  1E5F A;  4JEY A;  2HUU A;  2JGT A;  3TAT A;  4CVQ A;  5M49 A;  4FL0 A;  1AMR A;  3E77 A;  4EB7 A;  1G7X A;  1QIT A;  1LC8 A;  1T3I A;  5G0A A;  4F5I A;  3WKR A;  4GRX A;  3LVM A;  2VI8 A;  4UOY A;  4DQ6 A;  4OBU A;  2D66 A;  3PAA A;  2AY8 A;  2JIS A;  2YRI A;  1RVY A;  3B1D A;  5EUD A;  2EO5 A;  1IJI A;  2VLH A;  3BWN A;  3KE3 A;  4IYO A;  1AHF A;  3WZF A;  4GE9 A;  3WLX A;  2YCT A;  1AY8 A;  1QJ3 A;  2X5D A;  2R5E A;  3FFR A;  4WB0 A;  3EUC A;  1ZOD A;  3I5T A;  3D6K A;  3BWN C;  2W8V A;  3F0H A;  1AHY A;  3QN6 A;  1WKG A;  1SVV A;  2W8T A;  2AY7 A;  3AEJ A;  1AKC A;  2CJD A;  3BWO A;  3BV0 A;  2HUF A;  3F6T A;  4BHD A;  2Q7W A;  5AX8 A;  1GDE A;  4XJO A;  1TPL A;  2C0R A;  3NRA A;  2EH6 A;  1DJ9 A;  3A2B A;  3A9X A;  4JE5 D;  5FT5 A;  4EMY A;  2CAN A;  3A8U X;  4K2M A;  4F4E A;  2C44 A;  3EI8 A;  2C81 A;  5HXX A;  3HT4 A;  4XAU A;  1MGV A;  1ASL A;  2VIA A;  2VGT A;  2YKV A;  1EQB A;  1XEY A;  2D5Y A;  2VMX A;  2WK8 A;  4F5K A;  3N75 A;  1ARS A;  3FKD A;  3IHJ A;  1TOJ A;  1Y4I A;  1Z3Z A;  2CB1 A;  2GMU A;  2JJE A;  4EU1 A;  3AEN B;  3GJU A;  2W7L A;  3EI9 A;  1UU0 A;  2R2N A;  1CZC A;  3PDB A;  2BI3 A;  3P1T A;  1ASF A;  3OKS A;  1U08 A;  4MQQ A;  4PFN A;  1OHY A;  1AIA A;  2YHK A;  2DKB A;  2VYC A;  3GSB A;  4M2J A;  3WGB A;  4A6U A;  2X5F A;  4RJY A;  4BQ0 A;  5M46 A;  4XJP A;  2VGV A;  3FZ6 A;  5LH9 A;  3A9Y A;  4TMR A;  4FFC A;  3H7F A;  4JE5 A;  5EIG A;  3EI6 A;  5G2P A;  1M0P A;  1QIS A;  4NOG A;  3LVL B;  1M32 A;  2BYL A;  2DGK A;  2JJH A;  2O0R A;  4Q75 A;  1TOG A;  2FYF A;  4BA4 A;  1DGD A;  1O69 A;  4EB5 A;  2DOU A;  3G7Q A;  5EUN A;  3BCA A;  4XJM A;  1D7V A;  2VMY A;  1IUG A;  8AAT A;  2BYJ A;  2E7I A;  4WBT A;  2CJH A;  1BT4 A;  4B9B A;  3COG A;  4IY7 A;  1X2A A;  4ITG A;  4P3M A;  5BJ4 A;  2BWO A;  3E2Y A;  3DOD A;  1LS3 A;  4IXZ A;  1XI9 A;  3DU4 A;  4PIW A;  4WYC A;  2W7E A;  7AAT A;  3AOV A;  2X3L A;  1M0O A;  1SFF A;  3NU7 A;  3KGW A;  2VI9 A;  3VK2 A;  2NMP A;  4ZLV A;  1SZS A;  2XBN A;  3DXW A;  4IXO A;  2R5C A;  2PO3 A;  1WYV B;  1MDX A;  2ZY2 A;  3FVX A;  4E1O A;  4ATP A;  1SZU A;  4F5J A;  1JS3 A;  1W23 A;  3E2Z B;  3RBL A;  2FNU A;  4GE4 A;  4WLH A;  4WYF A;  4LW4 A;  3AAT A;  2AY5 A;  4WLJ A;  1BJO A;  4GSA A;  1TOK A;  3W1H A;  9AAT A;  3LG0 A;  5D5S A;  1CQ6 A;  1GC4 A;  3EIA A;  3QI6 A;  4F5L A;  2VMN A;  3I4J A;  3K40 A;  1LKC A;  4R2N A;  1BJN A;  2DGL A;  1QIR A;  1MLY A;  1ELU A;  3AV7 A;  1ARH A;  2OQX A;  4WD2 A;  2X8U A;  4B98 A;  1TAS A;  1YJZ A;  2W8U A;  1FC4 A;  3CQ4 A;  4OYT A;  4EFF A;  2G6W A;  4PVF A;  1ZC9 A;  3ATH A;  2E7U A;  3FQ8 A;  1D7U A;  4Q76 A;  2BIG A;  3ASA A;  1N2T A;  1YJY A;  5D95 A;  1W7L A;  1H0C A;  1AY4 A;  1OHV A;  4WYG A;  4XJL A;  1AMS A;  1ASC A;  1X0M A;  2ZJG A;  4MGR A;  3MAD A;  3HBX A;  3MKJ A;  3MAF B;  3BB8 A;  3MBB A;  1TAR A;  3PD6 B;  2OKK A;  4XK1 A;  1C7G A;  2VMZ A;  2VMW A;  2GSA A;  3FSL A;  3FRK A;  1H1C A;  5F8V A;  3GZC A;  4WYE A;  2BKW A;  3H14 A;  4ADE A;  1UKJ A;  2GMS A;  1MLZ A;  2JG2 A;  1QGN A;  4WXG A;  4MSO A;  2QLR A;  4E3R A;  2Z61 A;  1V2E A;  3T32 A;  3WY7 A;  4CXQ A;  3WCO A;  1IVR A;  1ZOB A;  2O7C A;  1C7O A;  3RCH B;  3K7Y A;  4H51 A;  1AHE A;  4F5G A;  3PJ0 A;  1P3W A;  1ASB A;  1BJ4 A;  2HP1 A;  2QB3 A;  4ZSW A;  1BKG A;  1GC3 A;  1M4N A;  3NUB A;  1CJ0 A;  1MDO A;  5C6U A;  3FQA A;  1DKA A;  1X28 A;  4L0O A;  2E7J A;  4AH3 A;  3DZZ A;  3TFT A;  1O4S A;  4K2I A;  1AAW A;  1WYU A;  1GEW A;  3FTB A;  4OBV A;  2HP2 A;  3L8A A;  3FZ7 A;  2AY2 A;  3ISL A;  4IYO B;  1B9I A;  1DJE A;  3NNK A;  2VMT A;  1S07 A;  2VGS A;  4ZAS A;  1BS0 A;  4AZJ A;  1KKJ A;  4WYA A;  3MEB A;  2YCN A;  1B8G A;  2YOB A;  2W7K A;  4WB0 B;  4LNM A;  1CZE A;  2WKA A;  1AY5 A;  2D64 A;  1WST A;  4JF1 A;  4MKK A;  4RKC A;  3NTJ A;  5G4I A;  5DB5 A;  1CQ7 A;  1C9C A;  1I48 A;  1QJ5 A;  1IX7 A;  4K2B A;  4Y0D A;  2EGY A;  4F5M A;  1UU2 A;  4Y0H A;  4ZWV A;  4WYD A;  3QPG A;  3RQ1 A;  2ZSM A;  3FVS A;  1Z7D A;  5IWQ A;  1G4V A;  4R5Z A;  1I43 A;  3HQT A;  4ZWM A;  1IAX A;  1ASG A;  1M6S A;  3BC8 A;  3NYU A;  1C0N A;  4TV7 A;  2CH1 A;  3WKS A;  5E5I A;  4HVK A;  2YCP A;  1X29 A;  1OXO A;  3LV2 A;  2YKU A;  2W7H A;  1ORD A;  2BIA A;  2Z1Y A;  3FCR A;  1TOI A;  1BQD A;  1KKP A;  5DJ9 A;  2JJF A;  5EFS A;  4A6T A;  1N31 A;  1AIC A;  2VMP A;  1GBN A;  1OAT A;  4JEX A;  1ASE A;  2GB3 A;  1J04 A;  3EI7 A;  3LVJ A;  2D7Z A;  3VK4 A;  1B4X A;  1IX8 A;  1KMK A;  3HDO A;  3NYS A;  3FD0 A;  3PA9 A;  2PB0 A;  3G8M A;  4O6Z A;  1EG5 A;  3PDB B;  1LW4 A;  4UHM A;  3LVK A;  3N5M A;  3ECD A;  1ARG A;  3TQX A;  1OHW A;  2BI1 A;  2YRR A;  4OT8 A;  1KL1 A;  1GEY A;  2Z9U A;  3ZZJ A;  1MDZ A;  1N8P A;  2VMO A;  3DR4 A;  5G2Q A;  1JS6 A;  3AOW A;  3G0T A;  1D7R A;  3NDN A;  5EAV A;  1GD9 A;  2CST A;  5EIG B;  1CL2 A;  3RI6 A;  3MC6 A;  1TAT A;  3JW9 A;  4RIT A;  1C7N A;  1IAY A;  1WKH A;  3ZZK A;  1AMA A;  4GE7 A;  4HF8 A;  3CQ6 A;  1D7S A;  1W7N A;  4CBS A;  3MC6 C;  1ART A;  2CFB A;  3QHX A;  1YJS A;  4W91 A;  1B9H A;  5G4J A;  5JAY A;  1AKB A;  1GEX A;  1I29 A;  3W1I A;  3NU8 A;  3NX3 A;  5F9S A;  2VMU A;  3JZL A;  4JEZ A;  3JU7 A;  2Z67 A;  3BCX A;  3EI5 A;  1ASM A;  3FZ8 A;  3ZRP A;  3L44 A;  4RAE A;  3UWC A;  3DC1 A;  2W7J A;  3AEM A;  1WYT B;  1FG7 A;  3HMU A;  2CJG A;  3ASB A;  4DBC A;  3EZ1 A;  1SPA A;  3HL2 A;  3K28 A;  1OXP A;  2BI5 A;  4ADD A;  2BWN A;  3LWS A;  3R4T A;  5E3K A;  4A00 A;  4CBR A;  2AY3 A;  2D63 A;  3AEM C;  4WXF A;  1AJS B;  2O1B A;  5HDM A;  4ISY A;  1M0Q A;  3UAK A;  4WP0 A;  1KMJ A;  4Q31 A;  4RKD A;  1PFF A;  3P6K A;  4XEW A;  1O61 A;  2AY6 A;  1MAQ A;  5I92 A;  1VP4 A;  4RM1 A;  1ASA A;  2YKX A;  5FT6 A;  2W7D A;  2RFV A;  4PFF A;  4N0B A;  1B5O A;  1V2D A;  2AAT A;  3QBO A;  1M7Y A;  4ZDP A;  2ZUK A;  3ELP A;  3PDX A;  4Q6R A;  3ZRQ A;  3TFU A;  3GET A;  2DR1 A;  5M4B A;  1AMQ A;  1ARI A;  3IF2 A;  2W7M A;  2VLF A;  2ZC0 A;  5EQC A;  1S0A A;  2Z1Z A;  4RJ0 A;  2DKJ A;  1DJU A;  4IX8 A;  4ZAH A;  4R8D A;  3F9T A;  1O62 A;  3MAU A;  3PPL A;  4J5U A;  3KKI A;  1V72 A;  3B1E A;  1AX4 A;  3GR9 A;  2EZ2 A;  2W7G A;  2ZY5 A;  3NUI A;  4IW7 A;  3CQ5 A;  3JTX A;  2CIN A;  3GWP A;  4P7Y A;  3ELE A;  4I8A A;  2AEV A;  1AHG A;  2VMR A;  4A6R A;  4W5K A;  1M0N A;  1ASN A;  1IBJ A;  2OGE A;  2PB2 A;  3CBF A;  3PGY A;  5G09 A;  2ZYJ A;  3ACZ A;  3NYT A;  4TN4 A;  3BCB A;  3FFH A;  1DFO A;  2Z20 A;  1YAA A;  1VJO A;  3EIB A;  2ZY3 A;  5LHA A;  1UU1 A;  4OTL A;  3BS8 A;  4Y0I A;  1J32 A;  2ZSL A;  1CS1 A;  3N0L A;  5M4D A;  3TCM A;  2C7T A;  3A9Z A;  3AEL A;  2HOZ A;  4ZDL A;  4UHN A;  3RUY A;  3VP6 A;  2GQN A;  4E77 A;  4BMK A;  4GDY A;  1B5P A;  4AZK A;  2CH2 A;  5TF5 A;  4AOA A;  2WK9 A;  3DRD A;  3FVU A;  3KGX A;  1G4X A;  3VK3 A;  3DR7 A;  4AO9 A;  3BN1 A;  1ELQ A;  2HOR A;  2DGM A;  5J8Q A;  4QGR A;  4KYO A;  3AEN A;  5EUE A;  2Z9X A;  3DXV A;  4F5H A;  2BI9 A;  1MAP A;  1YOO A;  2JJG A;  3AEJ C;  2OGA A;  1BW0 A;  3ZRR A;  1I41 A;  2BIE A;  2CTZ A;  1SZK A;  1S06 A;  1WYU B;  3E6G A;  4ITX A;  3E9K A;  1DTY A;  3RBF A;  1AJR A;  1IX6 A;  1LC5 A;  3Q8N A;  2AEU A;  1BJW A;  2R0T A;  3B8X A;  1JG8 A;  1GCK A;  1TOE A;  1VEF A;  4OCA A;  4XQ2 A;  3QGU A;  2D65 A;  1GC0 A;  2QMA A;  3DYD A;  1BQA A;  1RV4 A;  2CY8 A;  1FG3 A;  1ASD A;  2W8J A;  5DX5 A;  3PIU A;  1GC2 A;  4OMA A;  1KL2 A;  1AIB A;  2BI2 A;  2VMV A;  4ADB A;  2V0Y A;  3HVY A;  2FN6 A;  2ZY4 A;  3E2F A;  1DGE A;  4UHO A;  1S09 A;  2AY4 A;  1AKA A;  1ECX A;  1EJI A;  1LW5 A;  1PMM A;  2QB2 A;  4A0R A;  1G7W A;  1YNU A;  2QA3 A;  2ZP7 A;  4UQV A;  3VOM A;  4DGT A;  1S08 A;  1W7M A;  3B1C A;  4MKJ A;  2QBT A;  4BA5 A;  4JEW A;  3VAX A;  4A0G A;  1E5E A;  1WYV A;  3CAI A;  3W1J A;  4ZM3 A;  4MQR A;  4A72 A;  3E2Z A;  4KXK A;  4R5F A;  3LY1 A;  4WXB A;  1CL1 A;  4JEV A;  3GBX A;  4W1V A;  4ADC A;  2VGU A;  2EPJ A;  1AAM A;  2VGZ A;  4LNL A;  1YIZ A;  2HOX A;  4GEB A;  3JWA A;  1PG8 A;  1SF2 A;  2W8W A;  1RVU A;  3USF A;  1CQ8 A;  5HHY A;  2AY9 A;  3FDD A;  4E3Q A;  4ZSY A;  5DJ1 A;  1W3U A;  4A0F A;  2HUI A;  4J8L A;  2TPL A;  2EZ1 A;  3FDB A;  1YIY A;  1LC7 A;  1WYT A;  4OC9 A;  1PMO A;  2R5C B;  2VIB A;  2FQ6 A;  4JF0 A;  2WK7 A;  3AEO A;  3EZS A;  2VMS A;  2W7F A;  3WGC A;  1QZ9 A;  4M2M A;  2VMQ A;  4W8I A;  2V1P A;  4AO4 A;  1AJS A;  1V2F A;  3I16 A;  4M2K A;  2F8J A;  1BJO B;  2HZP A;  1C4K A;  3M5U A;  4RIZ A;  5FT8 A;  3WX9 A;  4W1X A;  4ATQ A;  2VGW A;  2YKY A;  4F5F A;  3MAF A;  2FM1 A;  4IXS A;  4RLG A;  2D7Y A;  3WCN A;  3PD6 A;  2W7I A;  3HLM A;  4MQP A;  1AHX A;  4W1W A;  2E54 A;  2ORD A; 
#chains in the Genus database with same CATH topology
 2XH1 A;  3FQ7 A;  4MY5 A;  4ZM4 A;  1JF9 A;  1D2F A;  2Z9V A;  2D61 A;  3II0 A;  5E4Z A;  3UE8 A;  4LW2 A;  1LK9 A;  2FNI A;  3QM2 A;  5BJ3 A;  3GZD A;  2BHX A;  5K8B A;  3JWB A;  4KAM A;  2OKJ A;  3B46 A;  4CXR A;  4LC3 A;  4LNJ A;  2HOY A;  4A0H A;  5FT4 A;  2BWP A;  2AY1 A;  4N0W A;  3RCH A;  4ZDO A;  5EAA A;  2Z9W A;  4U1T A;  3R9A A;  3AEP A;  1RV3 A;  3GZD C;  3OP7 A;  4U2H A;  2OAT A;  1E5F A;  4JEY A;  2HUU A;  2JGT A;  3TAT A;  4CVQ A;  5M49 A;  4FL0 A;  1AMR A;  3E77 A;  4EB7 A;  1G7X A;  1QIT A;  1LC8 A;  1T3I A;  5G0A A;  4F5I A;  3WKR A;  4GRX A;  3LVM A;  2VI8 A;  4UOY A;  4DQ6 A;  4OBU A;  2D66 A;  2QSR A;  3PAA A;  2AY8 A;  2JIS A;  2YRI A;  1RVY A;  3B1D A;  5EUD A;  2EO5 A;  1IJI A;  2VLH A;  3BWN A;  3KE3 A;  4IYO A;  1AHF A;  3WZF A;  4GE9 A;  3WLX A;  2YCT A;  1AY8 A;  1QJ3 A;  2X5D A;  2R5E A;  3FFR A;  4WB0 A;  3EUC A;  1ZOD A;  3I5T A;  3D6K A;  3BWN C;  2W8V A;  3F0H A;  1AHY A;  3QN6 A;  1WKG A;  1SVV A;  2W8T A;  2AY7 A;  3AEJ A;  1AKC A;  2CJD A;  3BWO A;  3BV0 A;  2HUF A;  3F6T A;  4BHD A;  2Q7W A;  5AX8 A;  1GDE A;  4XJO A;  1TPL A;  2C0R A;  3NRA A;  2EH6 A;  1DJ9 A;  3A2B A;  3A9X A;  4JE5 D;  5FT5 A;  4EMY A;  2CAN A;  3A8U X;  4K2M A;  4F4E A;  2C44 A;  3EI8 A;  2C81 A;  5HXX A;  3HT4 A;  4XAU A;  1MGV A;  1ASL A;  2VIA A;  2VGT A;  2YKV A;  1EQB A;  1XEY A;  2D5Y A;  2VMX A;  2WK8 A;  4F5K A;  3N75 A;  1ARS A;  3FKD A;  3IHJ A;  1TOJ A;  1Y4I A;  1Z3Z A;  2CB1 A;  2GMU A;  2JJE A;  4EU1 A;  3AEN B;  3GJU A;  2W7L A;  3EI9 A;  1UU0 A;  2R2N A;  1CZC A;  3PDB A;  2BI3 A;  3P1T A;  1ASF A;  3OKS A;  1U08 A;  4MQQ A;  4PFN A;  1OHY A;  1AIA A;  2YHK A;  2DKB A;  2VYC A;  3GSB A;  4M2J A;  3WGB A;  4A6U A;  2X5F A;  4RJY A;  4BQ0 A;  5M46 A;  4XJP A;  2VGV A;  3FZ6 A;  5LH9 A;  3A9Y A;  4TMR A;  4FFC A;  3H7F A;  4JE5 A;  5EIG A;  3EI6 A;  5G2P A;  1M0P A;  1QIS A;  4NOG A;  3LVL B;  1M32 A;  2BYL A;  2DGK A;  2JJH A;  2O0R A;  4Q75 A;  1TOG A;  2FYF A;  4BA4 A;  1DGD A;  1O69 A;  4EB5 A;  2DOU A;  3G7Q A;  5EUN A;  3BCA A;  3H9X A;  4XJM A;  1D7V A;  2VMY A;  1IUG A;  8AAT A;  2BYJ A;  2E7I A;  4WBT A;  2CJH A;  1BT4 A;  4B9B A;  3COG A;  4IY7 A;  1X2A A;  4ITG A;  4P3M A;  5BJ4 A;  2BWO A;  3E2Y A;  3DOD A;  1LS3 A;  4IXZ A;  1XI9 A;  3DU4 A;  4PIW A;  4WYC A;  2W7E A;  7AAT A;  3AOV A;  2X3L A;  1M0O A;  1SFF A;  3NU7 A;  3KGW A;  2VI9 A;  3VK2 A;  2NMP A;  4ZLV A;  1SZS A;  2XBN A;  3DXW A;  4IXO A;  2R5C A;  2PO3 A;  1WYV B;  1MDX A;  2ZY2 A;  3FVX A;  4E1O A;  2WB6 A;  4ATP A;  1SZU A;  4F5J A;  1JS3 A;  1W23 A;  3E2Z B;  3RBL A;  2FNU A;  4GE4 A;  4WLH A;  4WYF A;  4LW4 A;  3AAT A;  2AY5 A;  4WLJ A;  1BJO A;  4GSA A;  1TOK A;  3W1H A;  9AAT A;  3LG0 A;  5D5S A;  1CQ6 A;  1GC4 A;  3EIA A;  3QI6 A;  4F5L A;  2VMN A;  3I4J A;  3K40 A;  1LKC A;  4R2N A;  1BJN A;  2DGL A;  1QIR A;  1MLY A;  1ELU A;  3AV7 A;  1ARH A;  2OQX A;  4WD2 A;  2X8U A;  4B98 A;  1TAS A;  1YJZ A;  2W8U A;  1FC4 A;  3CQ4 A;  4OYT A;  4EFF A;  2G6W A;  4PVF A;  1ZC9 A;  3ATH A;  2E7U A;  3FQ8 A;  1D7U A;  4Q76 A;  2BIG A;  3ASA A;  1N2T A;  1YJY A;  5D95 A;  1W7L A;  1H0C A;  1AY4 A;  1OHV A;  4WYG A;  4XJL A;  1AMS A;  1ASC A;  1X0M A;  2ZJG A;  4MGR A;  3MAD A;  3HBX A;  3MKJ A;  3MAF B;  3BB8 A;  3MBB A;  1TAR A;  3PD6 B;  2OKK A;  4XK1 A;  1C7G A;  2VMZ A;  2VMW A;  2GSA A;  3FSL A;  3FRK A;  1H1C A;  5F8V A;  3GZC A;  4WYE A;  2BKW A;  3H14 A;  4ADE A;  1UKJ A;  2GMS A;  1MLZ A;  2JG2 A;  1QGN A;  4WXG A;  4MSO A;  2QLR A;  4E3R A;  2Z61 A;  1V2E A;  3T32 A;  3WY7 A;  4CXQ A;  3WCO A;  1IVR A;  1ZOB A;  2O7C A;  1C7O A;  3RCH B;  3K7Y A;  4H51 A;  1AHE A;  4F5G A;  3PJ0 A;  1P3W A;  1ASB A;  1BJ4 A;  2HP1 A;  2QB3 A;  4ZSW A;  1BKG A;  1GC3 A;  1M4N A;  3NUB A;  1CJ0 A;  1MDO A;  5C6U A;  2G7J A;  3FQA A;  1DKA A;  1X28 A;  4L0O A;  2E7J A;  4AH3 A;  3DZZ A;  3TFT A;  1O4S A;  4K2I A;  1AAW A;  1WYU A;  1GEW A;  3FTB A;  4OBV A;  2HP2 A;  3L8A A;  3FZ7 A;  2AY2 A;  3ISL A;  4IYO B;  1B9I A;  1DJE A;  3NNK A;  2VMT A;  1S07 A;  2VGS A;  4ZAS A;  1BS0 A;  4AZJ A;  1KKJ A;  4WYA A;  3MEB A;  2YCN A;  1B8G A;  2YOB A;  2W7K A;  4WB0 B;  4LNM A;  1CZE A;  2WKA A;  1AY5 A;  2D64 A;  1WST A;  4JF1 A;  4MKK A;  4RKC A;  3NTJ A;  5G4I A;  5DB5 A;  1CQ7 A;  1C9C A;  1I48 A;  1QJ5 A;  1IX7 A;  4K2B A;  4Y0D A;  2EGY A;  4F5M A;  1UU2 A;  4Y0H A;  4ZWV A;  4WYD A;  3QPG A;  3RQ1 A;  2ZSM A;  3FVS A;  1Z7D A;  5IWQ A;  1G4V A;  4R5Z A;  1I43 A;  3HQT A;  4ZWM A;  1IAX A;  1ASG A;  1M6S A;  3BC8 A;  3NYU A;  1C0N A;  4TV7 A;  2CH1 A;  3WKS A;  5E5I A;  4HVK A;  2YCP A;  1X29 A;  1OXO A;  3LV2 A;  2YKU A;  2W7H A;  1ORD A;  2BIA A;  2Z1Y A;  3FCR A;  1TOI A;  1BQD A;  1KKP A;  5DJ9 A;  2JJF A;  5EFS A;  4A6T A;  1N31 A;  1AIC A;  2VMP A;  1GBN A;  1OAT A;  4JEX A;  1ASE A;  2GB3 A;  1J04 A;  3EI7 A;  3LVJ A;  2D7Z A;  3VK4 A;  1B4X A;  1IX8 A;  1KMK A;  3HDO A;  3NYS A;  3FD0 A;  3PA9 A;  2PB0 A;  3G8M A;  4O6Z A;  1EG5 A;  3PDB B;  1LW4 A;  4UHM A;  3LVK A;  3N5M A;  3ECD A;  1ARG A;  3TQX A;  1OHW A;  2BI1 A;  2YRR A;  4OT8 A;  1KL1 A;  1GEY A;  2Z9U A;  3ZZJ A;  1MDZ A;  1N8P A;  2VMO A;  3DR4 A;  5G2Q A;  1JS6 A;  3AOW A;  3G0T A;  1D7R A;  3NDN A;  5EAV A;  1GD9 A;  2CST A;  5EIG B;  1CL2 A;  3RI6 A;  3MC6 A;  1TAT A;  3JW9 A;  4RIT A;  1C7N A;  1IAY A;  1WKH A;  3ZZK A;  1AMA A;  4GE7 A;  4HF8 A;  3CQ6 A;  1D7S A;  1W7N A;  4CBS A;  3MC6 C;  1ART A;  2CFB A;  3QHX A;  1KAF A;  1YJS A;  4W91 A;  1B9H A;  3N4X A;  5G4J A;  5JAY A;  1AKB A;  1GEX A;  1I29 A;  3W1I A;  3NU8 A;  3NX3 A;  5F9S A;  2VMU A;  3JZL A;  4JEZ A;  3JU7 A;  2Z67 A;  3BCX A;  3EI5 A;  1ASM A;  3FZ8 A;  3ZRP A;  3L44 A;  4RAE A;  3UWC A;  3DC1 A;  2W7J A;  3AEM A;  1WYT B;  1FG7 A;  3HMU A;  2CJG A;  3ASB A;  4DBC A;  3EZ1 A;  1SPA A;  3HL2 A;  3K28 A;  1OXP A;  2BI5 A;  4ADD A;  2BWN A;  3LWS A;  3R4T A;  5E3K A;  4A00 A;  4CBR A;  2AY3 A;  2D63 A;  3AEM C;  4WXF A;  1AJS B;  2O1B A;  5HDM A;  4ISY A;  1M0Q A;  3UAK A;  4WP0 A;  1KMJ A;  4Q31 A;  4RKD A;  1PFF A;  3P6K A;  4XEW A;  1O61 A;  2AY6 A;  1MAQ A;  5I92 A;  1VP4 A;  4RM1 A;  1ASA A;  2YKX A;  5FT6 A;  2W7D A;  2RFV A;  4PFF A;  4N0B A;  1B5O A;  1V2D A;  2AAT A;  3QBO A;  1M7Y A;  4ZDP A;  2ZUK A;  3ELP A;  3PDX A;  4Q6R A;  3ZRQ A;  3TFU A;  3GET A;  2DR1 A;  5M4B A;  1AMQ A;  1ARI A;  3IF2 A;  2W7M A;  2VLF A;  2ZC0 A;  5EQC A;  1S0A A;  2Z1Z A;  4RJ0 A;  2DKJ A;  1DJU A;  4IX8 A;  4ZAH A;  3N7N A;  4R8D A;  3F9T A;  1O62 A;  3MAU A;  3PPL A;  4J5U A;  3KKI A;  1V72 A;  3B1E A;  1AX4 A;  3GR9 A;  2EZ2 A;  2W7G A;  2ZY5 A;  3NUI A;  4IW7 A;  3CQ5 A;  3JTX A;  2CIN A;  3GWP A;  4P7Y A;  3ELE A;  4I8A A;  2AEV A;  1AHG A;  2VMR A;  4A6R A;  4W5K A;  1M0N A;  1ASN A;  1IBJ A;  2OGE A;  2PB2 A;  3CBF A;  3PGY A;  5KTB A;  5G09 A;  2ZYJ A;  3ACZ A;  3NYT A;  4TN4 A;  3BCB A;  3FFH A;  1DFO A;  2Z20 A;  1YAA A;  1VJO A;  3EIB A;  2ZY3 A;  5LHA A;  1UU1 A;  4OTL A;  3BS8 A;  4Y0I A;  3N4R A;  1J32 A;  2ZSL A;  1CS1 A;  3N0L A;  5M4D A;  3TCM A;  2C7T A;  3A9Z A;  3AEL A;  2HOZ A;  4ZDL A;  4UHN A;  3RUY A;  3VP6 A;  2GQN A;  4E77 A;  4BMK A;  4GDY A;  1B5P A;  4AZK A;  2CH2 A;  5TF5 A;  4AOA A;  2WK9 A;  3DRD A;  3FVU A;  3KGX A;  1G4X A;  3VK3 A;  3DR7 A;  4AO9 A;  3N4S A;  2KFP A;  3BN1 A;  1ELQ A;  2HOR A;  2DGM A;  5J8Q A;  2EYQ A;  4QGR A;  4K05 A;  4KYO A;  3AEN A;  5EUE A;  2Z9X A;  3DXV A;  4F5H A;  2BI9 A;  1MAP A;  1YOO A;  2JJG A;  3AEJ C;  2OGA A;  1BW0 A;  3ZRR A;  1I41 A;  2BIE A;  2CTZ A;  1SZK A;  1S06 A;  1WYU B;  3E6G A;  4ITX A;  3E9K A;  1DTY A;  3RBF A;  1AJR A;  1IX6 A;  4H63 Q;  1LC5 A;  3Q8N A;  2AEU A;  1BJW A;  2R0T A;  3B8X A;  1JG8 A;  1GCK A;  1TOE A;  1VEF A;  4OCA A;  4XQ2 A;  3QGU A;  2D65 A;  1GC0 A;  2QMA A;  3DYD A;  1BQA A;  1RV4 A;  2CY8 A;  1FG3 A;  1ASD A;  2W8J A;  5DX5 A;  3PIU A;  1GC2 A;  4OMA A;  1KL2 A;  1AIB A;  2BI2 A;  2VMV A;  4ADB A;  2V0Y A;  3HVY A;  2FN6 A;  2ZY4 A;  3E2F A;  1DGE A;  4UHO A;  1S09 A;  2AY4 A;  1AKA A;  1ECX A;  1EJI A;  1LW5 A;  1PMM A;  2QB2 A;  4A0R A;  1G7W A;  1YNU A;  2QA3 A;  2ZP7 A;  4UQV A;  3VOM A;  4DGT A;  1S08 A;  1W7M A;  3B1C A;  4MKJ A;  2QBT A;  4BA5 A;  4JEW A;  3VAX A;  4A0G A;  1E5E A;  1WYV A;  3CAI A;  3W1J A;  4ZM3 A;  4MQR A;  4A72 A;  3E2Z A;  4KXK A;  4R5F A;  3LY1 A;  4WXB A;  1CL1 A;  4JEV A;  3GBX A;  4W1V A;  4ADC A;  2VGU A;  2EPJ A;  1AAM A;  2VGZ A;  4LNL A;  1YIZ A;  2HOX A;  4GEB A;  3JWA A;  1PG8 A;  1SF2 A;  2W8W A;  2A1V A;  1RVU A;  3USF A;  1CQ8 A;  5HHY A;  2AY9 A;  3FDD A;  4E3Q A;  4ZSY A;  5DJ1 A;  1W3U A;  4A0F A;  2HUI A;  4J8L A;  2TPL A;  2EZ1 A;  3FDB A;  1YIY A;  1LC7 A;  1WYT A;  4OC9 A;  1PMO A;  2R5C B;  2VIB A;  2FQ6 A;  4JF0 A;  2WK7 A;  3AEO A;  3EZS A;  2VMS A;  2W7F A;  3WGC A;  1QZ9 A;  4M2M A;  2VMQ A;  4W8I A;  2V1P A;  4AO4 A;  1AJS A;  1V2F A;  3I16 A;  4M2K A;  2F8J A;  1BJO B;  2HZP A;  1C4K A;  3M5U A;  4RIZ A;  5FT8 A;  3WX9 A;  4W1X A;  4ATQ A;  2VGW A;  2YKY A;  4F5F A;  3MAF A;  2FM1 A;  4IXS A;  4RLG A;  2D7Y A;  3WCN A;  3PD6 A;  2W7I A;  3HLM A;  4MQP A;  1AHX A;  2FKI A;  4W1W A;  2E54 A;  2ORD A; 
#chains in the Genus database with same CATH homology
 2XH1 A;  3FQ7 A;  4MY5 A;  4ZM4 A;  1JF9 A;  1D2F A;  2Z9V A;  2D61 A;  3II0 A;  5E4Z A;  3UE8 A;  4LW2 A;  1LK9 A;  2FNI A;  3QM2 A;  5BJ3 A;  3GZD A;  2BHX A;  5K8B A;  3JWB A;  4KAM A;  2OKJ A;  3B46 A;  4CXR A;  4LC3 A;  4LNJ A;  2HOY A;  4A0H A;  5FT4 A;  2BWP A;  2AY1 A;  4N0W A;  3RCH A;  4ZDO A;  5EAA A;  2Z9W A;  4U1T A;  3R9A A;  3AEP A;  1RV3 A;  3GZD C;  3OP7 A;  4U2H A;  2OAT A;  1E5F A;  4JEY A;  2HUU A;  2JGT A;  3TAT A;  4CVQ A;  5M49 A;  4FL0 A;  1AMR A;  3E77 A;  4EB7 A;  1G7X A;  1QIT A;  1LC8 A;  1T3I A;  5G0A A;  4F5I A;  3WKR A;  4GRX A;  3LVM A;  2VI8 A;  4UOY A;  4DQ6 A;  4OBU A;  2D66 A;  2QSR A;  3PAA A;  2AY8 A;  2JIS A;  2YRI A;  1RVY A;  3B1D A;  5EUD A;  2EO5 A;  1IJI A;  2VLH A;  3BWN A;  3KE3 A;  4IYO A;  1AHF A;  3WZF A;  4GE9 A;  3WLX A;  2YCT A;  1AY8 A;  1QJ3 A;  2X5D A;  2R5E A;  3FFR A;  4WB0 A;  3EUC A;  1ZOD A;  3I5T A;  3D6K A;  3BWN C;  2W8V A;  3F0H A;  1AHY A;  3QN6 A;  1WKG A;  1SVV A;  2W8T A;  2AY7 A;  3AEJ A;  1AKC A;  2CJD A;  3BWO A;  3BV0 A;  2HUF A;  3F6T A;  4BHD A;  2Q7W A;  5AX8 A;  1GDE A;  4XJO A;  1TPL A;  2C0R A;  3NRA A;  2EH6 A;  1DJ9 A;  3A2B A;  3A9X A;  4JE5 D;  5FT5 A;  4EMY A;  2CAN A;  3A8U X;  4K2M A;  4F4E A;  2C44 A;  3EI8 A;  2C81 A;  5HXX A;  3HT4 A;  4XAU A;  1MGV A;  1ASL A;  2VIA A;  2VGT A;  2YKV A;  1EQB A;  1XEY A;  2D5Y A;  2VMX A;  2WK8 A;  4F5K A;  3N75 A;  1ARS A;  3FKD A;  3IHJ A;  1TOJ A;  1Y4I A;  1Z3Z A;  2CB1 A;  2GMU A;  2JJE A;  4EU1 A;  3AEN B;  3GJU A;  2W7L A;  3EI9 A;  1UU0 A;  2R2N A;  1CZC A;  3PDB A;  2BI3 A;  3P1T A;  1ASF A;  3OKS A;  1U08 A;  4MQQ A;  4PFN A;  1OHY A;  1AIA A;  2YHK A;  2DKB A;  2VYC A;  3GSB A;  4M2J A;  3WGB A;  4A6U A;  2X5F A;  4RJY A;  4BQ0 A;  5M46 A;  4XJP A;  2VGV A;  3FZ6 A;  5LH9 A;  3A9Y A;  4TMR A;  4FFC A;  3H7F A;  4JE5 A;  5EIG A;  3EI6 A;  5G2P A;  1M0P A;  1QIS A;  4NOG A;  3LVL B;  1M32 A;  2BYL A;  2DGK A;  2JJH A;  2O0R A;  4Q75 A;  1TOG A;  2FYF A;  4BA4 A;  1DGD A;  1O69 A;  4EB5 A;  2DOU A;  3G7Q A;  5EUN A;  3BCA A;  3H9X A;  4XJM A;  1D7V A;  2VMY A;  1IUG A;  8AAT A;  2BYJ A;  2E7I A;  4WBT A;  2CJH A;  1BT4 A;  4B9B A;  3COG A;  4IY7 A;  1X2A A;  4ITG A;  4P3M A;  5BJ4 A;  2BWO A;  3E2Y A;  3DOD A;  1LS3 A;  4IXZ A;  1XI9 A;  3DU4 A;  4PIW A;  4WYC A;  2W7E A;  7AAT A;  3AOV A;  2X3L A;  1M0O A;  1SFF A;  3NU7 A;  3KGW A;  2VI9 A;  3VK2 A;  2NMP A;  4ZLV A;  1SZS A;  2XBN A;  3DXW A;  4IXO A;  2R5C A;  2PO3 A;  1WYV B;  1MDX A;  2ZY2 A;  3FVX A;  4E1O A;  2WB6 A;  4ATP A;  1SZU A;  4F5J A;  1JS3 A;  1W23 A;  3E2Z B;  3RBL A;  2FNU A;  4GE4 A;  4WLH A;  4WYF A;  4LW4 A;  3AAT A;  2AY5 A;  4WLJ A;  1BJO A;  4GSA A;  1TOK A;  3W1H A;  9AAT A;  3LG0 A;  5D5S A;  1CQ6 A;  1GC4 A;  3EIA A;  3QI6 A;  4F5L A;  2VMN A;  3I4J A;  3K40 A;  1LKC A;  4R2N A;  1BJN A;  2DGL A;  1QIR A;  1MLY A;  1ELU A;  3AV7 A;  1ARH A;  2OQX A;  4WD2 A;  2X8U A;  4B98 A;  1TAS A;  1YJZ A;  2W8U A;  1FC4 A;  3CQ4 A;  4OYT A;  4EFF A;  2G6W A;  4PVF A;  1ZC9 A;  3ATH A;  2E7U A;  3FQ8 A;  1D7U A;  4Q76 A;  2BIG A;  3ASA A;  1N2T A;  1YJY A;  5D95 A;  1W7L A;  1H0C A;  1AY4 A;  1OHV A;  4WYG A;  4XJL A;  1AMS A;  1ASC A;  1X0M A;  2ZJG A;  4MGR A;  3MAD A;  3HBX A;  3MKJ A;  3MAF B;  3BB8 A;  3MBB A;  1TAR A;  3PD6 B;  2OKK A;  4XK1 A;  1C7G A;  2VMZ A;  2VMW A;  2GSA A;  3FSL A;  3FRK A;  1H1C A;  5F8V A;  3GZC A;  4WYE A;  2BKW A;  3H14 A;  4ADE A;  1UKJ A;  2GMS A;  1MLZ A;  2JG2 A;  1QGN A;  4WXG A;  4MSO A;  2QLR A;  4E3R A;  2Z61 A;  1V2E A;  3T32 A;  3WY7 A;  4CXQ A;  3WCO A;  1IVR A;  1ZOB A;  2O7C A;  1C7O A;  3RCH B;  3K7Y A;  4H51 A;  1AHE A;  4F5G A;  3PJ0 A;  1P3W A;  1ASB A;  1BJ4 A;  2HP1 A;  2QB3 A;  4ZSW A;  1BKG A;  1GC3 A;  1M4N A;  3NUB A;  1CJ0 A;  1MDO A;  5C6U A;  2G7J A;  3FQA A;  1DKA A;  1X28 A;  4L0O A;  2E7J A;  4AH3 A;  3DZZ A;  3TFT A;  1O4S A;  4K2I A;  1AAW A;  1WYU A;  1GEW A;  3FTB A;  4OBV A;  2HP2 A;  3L8A A;  3FZ7 A;  2AY2 A;  3ISL A;  4IYO B;  1B9I A;  1DJE A;  3NNK A;  2VMT A;  1S07 A;  2VGS A;  4ZAS A;  1BS0 A;  4AZJ A;  1KKJ A;  4WYA A;  3MEB A;  2YCN A;  1B8G A;  2YOB A;  2W7K A;  4WB0 B;  4LNM A;  1CZE A;  2WKA A;  1AY5 A;  2D64 A;  1WST A;  4JF1 A;  4MKK A;  4RKC A;  3NTJ A;  5G4I A;  5DB5 A;  1CQ7 A;  1C9C A;  1I48 A;  1QJ5 A;  1IX7 A;  4K2B A;  4Y0D A;  2EGY A;  4F5M A;  1UU2 A;  4Y0H A;  4ZWV A;  4WYD A;  3QPG A;  3RQ1 A;  2ZSM A;  3FVS A;  1Z7D A;  5IWQ A;  1G4V A;  4R5Z A;  1I43 A;  3HQT A;  4ZWM A;  1IAX A;  1ASG A;  1M6S A;  3BC8 A;  3NYU A;  1C0N A;  4TV7 A;  2CH1 A;  3WKS A;  5E5I A;  4HVK A;  2YCP A;  1X29 A;  1OXO A;  3LV2 A;  2YKU A;  2W7H A;  1ORD A;  2BIA A;  2Z1Y A;  3FCR A;  1TOI A;  1BQD A;  1KKP A;  5DJ9 A;  2JJF A;  5EFS A;  4A6T A;  1N31 A;  1AIC A;  2VMP A;  1GBN A;  1OAT A;  4JEX A;  1ASE A;  2GB3 A;  1J04 A;  3EI7 A;  3LVJ A;  2D7Z A;  3VK4 A;  1B4X A;  1IX8 A;  1KMK A;  3HDO A;  3NYS A;  3FD0 A;  3PA9 A;  2PB0 A;  3G8M A;  4O6Z A;  1EG5 A;  3PDB B;  1LW4 A;  4UHM A;  3LVK A;  3N5M A;  3ECD A;  1ARG A;  3TQX A;  1OHW A;  2BI1 A;  2YRR A;  4OT8 A;  1KL1 A;  1GEY A;  2Z9U A;  3ZZJ A;  1MDZ A;  1N8P A;  2VMO A;  3DR4 A;  5G2Q A;  1JS6 A;  3AOW A;  3G0T A;  1D7R A;  3NDN A;  5EAV A;  1GD9 A;  2CST A;  5EIG B;  1CL2 A;  3RI6 A;  3MC6 A;  1TAT A;  3JW9 A;  4RIT A;  1C7N A;  1IAY A;  1WKH A;  3ZZK A;  1AMA A;  4GE7 A;  4HF8 A;  3CQ6 A;  1D7S A;  1W7N A;  4CBS A;  3MC6 C;  1ART A;  2CFB A;  3QHX A;  1YJS A;  4W91 A;  1B9H A;  3N4X A;  5G4J A;  5JAY A;  1AKB A;  1GEX A;  1I29 A;  3W1I A;  3NU8 A;  3NX3 A;  5F9S A;  2VMU A;  3JZL A;  4JEZ A;  3JU7 A;  2Z67 A;  3BCX A;  3EI5 A;  1ASM A;  3FZ8 A;  3ZRP A;  3L44 A;  4RAE A;  3UWC A;  3DC1 A;  2W7J A;  3AEM A;  1WYT B;  1FG7 A;  3HMU A;  2CJG A;  3ASB A;  4DBC A;  3EZ1 A;  1SPA A;  3HL2 A;  3K28 A;  1OXP A;  2BI5 A;  4ADD A;  2BWN A;  3LWS A;  3R4T A;  5E3K A;  4A00 A;  4CBR A;  2AY3 A;  2D63 A;  3AEM C;  4WXF A;  1AJS B;  2O1B A;  5HDM A;  4ISY A;  1M0Q A;  3UAK A;  4WP0 A;  1KMJ A;  4Q31 A;  4RKD A;  1PFF A;  3P6K A;  4XEW A;  1O61 A;  2AY6 A;  1MAQ A;  5I92 A;  1VP4 A;  4RM1 A;  1ASA A;  2YKX A;  5FT6 A;  2W7D A;  2RFV A;  4PFF A;  4N0B A;  1B5O A;  1V2D A;  2AAT A;  3QBO A;  1M7Y A;  4ZDP A;  2ZUK A;  3ELP A;  3PDX A;  4Q6R A;  3ZRQ A;  3TFU A;  3GET A;  2DR1 A;  5M4B A;  1AMQ A;  1ARI A;  3IF2 A;  2W7M A;  2VLF A;  2ZC0 A;  5EQC A;  1S0A A;  2Z1Z A;  4RJ0 A;  2DKJ A;  1DJU A;  4IX8 A;  4ZAH A;  3N7N A;  4R8D A;  3F9T A;  1O62 A;  3MAU A;  3PPL A;  4J5U A;  3KKI A;  1V72 A;  3B1E A;  1AX4 A;  3GR9 A;  2EZ2 A;  2W7G A;  2ZY5 A;  3NUI A;  4IW7 A;  3CQ5 A;  3JTX A;  2CIN A;  3GWP A;  4P7Y A;  3ELE A;  4I8A A;  2AEV A;  1AHG A;  2VMR A;  4A6R A;  4W5K A;  1M0N A;  1ASN A;  1IBJ A;  2OGE A;  2PB2 A;  3CBF A;  3PGY A;  5KTB A;  5G09 A;  2ZYJ A;  3ACZ A;  3NYT A;  4TN4 A;  3BCB A;  3FFH A;  1DFO A;  2Z20 A;  1YAA A;  1VJO A;  3EIB A;  2ZY3 A;  5LHA A;  1UU1 A;  4OTL A;  3BS8 A;  4Y0I A;  3N4R A;  1J32 A;  2ZSL A;  1CS1 A;  3N0L A;  5M4D A;  3TCM A;  2C7T A;  3A9Z A;  3AEL A;  2HOZ A;  4ZDL A;  4UHN A;  3RUY A;  3VP6 A;  2GQN A;  4E77 A;  4BMK A;  4GDY A;  1B5P A;  4AZK A;  2CH2 A;  5TF5 A;  4AOA A;  2WK9 A;  3DRD A;  3FVU A;  3KGX A;  1G4X A;  3VK3 A;  3DR7 A;  4AO9 A;  3N4S A;  2KFP A;  3BN1 A;  1ELQ A;  2HOR A;  2DGM A;  5J8Q A;  2EYQ A;  4QGR A;  4K05 A;  4KYO A;  3AEN A;  5EUE A;  2Z9X A;  3DXV A;  4F5H A;  2BI9 A;  1MAP A;  1YOO A;  2JJG A;  3AEJ C;  2OGA A;  1BW0 A;  3ZRR A;  1I41 A;  2BIE A;  2CTZ A;  1SZK A;  1S06 A;  1WYU B;  3E6G A;  4ITX A;  3E9K A;  1DTY A;  3RBF A;  1AJR A;  1IX6 A;  4H63 Q;  1LC5 A;  3Q8N A;  2AEU A;  1BJW A;  2R0T A;  3B8X A;  1JG8 A;  1GCK A;  1TOE A;  1VEF A;  4OCA A;  4XQ2 A;  3QGU A;  2D65 A;  1GC0 A;  2QMA A;  3DYD A;  1BQA A;  1RV4 A;  2CY8 A;  1FG3 A;  1ASD A;  2W8J A;  5DX5 A;  3PIU A;  1GC2 A;  4OMA A;  1KL2 A;  1AIB A;  2BI2 A;  2VMV A;  4ADB A;  2V0Y A;  3HVY A;  2FN6 A;  2ZY4 A;  3E2F A;  1DGE A;  4UHO A;  1S09 A;  2AY4 A;  1AKA A;  1ECX A;  1EJI A;  1LW5 A;  1PMM A;  2QB2 A;  4A0R A;  1G7W A;  1YNU A;  2QA3 A;  2ZP7 A;  4UQV A;  3VOM A;  4DGT A;  1S08 A;  1W7M A;  3B1C A;  4MKJ A;  2QBT A;  4BA5 A;  4JEW A;  3VAX A;  4A0G A;  1E5E A;  1WYV A;  3CAI A;  3W1J A;  4ZM3 A;  4MQR A;  4A72 A;  3E2Z A;  4KXK A;  4R5F A;  3LY1 A;  4WXB A;  1CL1 A;  4JEV A;  3GBX A;  4W1V A;  4ADC A;  2VGU A;  2EPJ A;  1AAM A;  2VGZ A;  4LNL A;  1YIZ A;  2HOX A;  4GEB A;  3JWA A;  1PG8 A;  1SF2 A;  2W8W A;  2A1V A;  1RVU A;  3USF A;  1CQ8 A;  5HHY A;  2AY9 A;  3FDD A;  4E3Q A;  4ZSY A;  5DJ1 A;  1W3U A;  4A0F A;  2HUI A;  4J8L A;  2TPL A;  2EZ1 A;  3FDB A;  1YIY A;  1LC7 A;  1WYT A;  4OC9 A;  1PMO A;  2R5C B;  2VIB A;  2FQ6 A;  4JF0 A;  2WK7 A;  3AEO A;  3EZS A;  2VMS A;  2W7F A;  3WGC A;  1QZ9 A;  4M2M A;  2VMQ A;  4W8I A;  2V1P A;  4AO4 A;  1AJS A;  1V2F A;  3I16 A;  4M2K A;  2F8J A;  1BJO B;  2HZP A;  1C4K A;  3M5U A;  4RIZ A;  5FT8 A;  3WX9 A;  4W1X A;  4ATQ A;  2VGW A;  2YKY A;  4F5F A;  3MAF A;  2FM1 A;  4IXS A;  4RLG A;  2D7Y A;  3WCN A;  3PD6 A;  2W7I A;  3HLM A;  4MQP A;  1AHX A;  2FKI A;  4W1W A;  2E54 A;  2ORD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...