3CQ5A

Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
364
structure length
364
Chain Sequence
KITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol-phosphate aminotransferase
publication title Insights into the structural basis of substrate recognition by histidinol-phosphate aminotransferase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 128
structure length 364
sequence length 364
chains with identical sequence B, C
ec nomenclature ec 2.6.1.9: Histidinol-phosphate transaminase.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3cq5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3cq5A01
1QGNA 3A9XA 3LV2A 3MC6A 3NUBA 3DODA 3E2ZB 1AKAA 4A0RA 4RLGA 1TOKA 4ATPA 1PMOA 3CQ5A 3ELPA 2HOXA 4LNJA 4XJMA 2QB3A 1ASMA 1O4SA 2W7LA 2W7MA 1ELUA 2YHKA 4BMKA 4F5GA 5BJ4A 5HXXA 1GD9A 1N8PA 1XI9A 3PA9A 3QGUA 4EU1A 2ZUKA 4R8DA 3MADA 4ZDOA 1YJSA 4DGTA 4DQ6A 3RCHA 1RV4A 3QBOA 2C0RA 4IXOA 4ATQA 2W7KA 3DXWA 1DKAA 2X5FA 2PB0A 2Z67A 1V2FA 2HZPA 3L44A 4W1VA 1CS1A 3GZDA 1SZKA 3AENA 2ZJGA 1AHGA 3L8AA 2R2NA 4E77A 4PFFA 2YRIA 1SFFA 1DTYA 1D2FA 2E7JA 3FFRA 1I48A 1WYTA 3QPGA 4ZASA 2EO5A 1GC4A 3HMUA 4MSOA 3FVUA 4A6RA 1GEWA 2VMVA 3FQ7A 5EAAA 4XJLA 3VOMA 1IBJA 2VLFA 2VLHA 4IXSA 2CH1A 3FKDA 1AY8A 4ZDPA 5DJ9A 2AY6A 1YJYA 2R0TA 4GDYA 2BIEA 2HUIA 1I41A 3NYSA 4QGRA 1OHVA 3GR9A 4IYOA 4UQVA 3RCHB 1AMSA 2AY3A 5E3KA 2VMTA 3FDDA 2OATA 2VMRA 3AEOA 1OATA 4W5KA 1X0MA 3AENB 5G2QA 3FVXA 3JWBA 4WD2A 4WYGA 1CL2A 3E2FA 3RUYA 2DR1A 2R5CA 1BJOA 1D7RA 3P1TA 2VMNA 3E6GA 1X28A 1ASGA 3AV7A 5EUNA 3KKIA 2W7IA 4ZWMA 1E5FA 4JEZA 1SF2A 2PO3A 3WGCA 3ACZA 1G7WA 3JWAA 4MKKA 4MY5A 2D61A 4A0HA 1S08A 3BC8A 1IAYA 1BW0A 3F9TA 4N0WA 2GMUA 3GJUA 2EPJA 5EUDA 5G0AA 1TOEA 2AY2A 3GZCA 3G8MA 3EI7A 3WKRA 3EZ1A 3CAIA 1AKBA 4IYOB 4F5IA 4F5KA 5AX8A 4FL0A 5TF5A 2ZY5A 2D5YA 1H1CA 2FM1A 2JISA 3JW9A 1ARIA 1VEFA 4LW4A 1YIYA 2YCTA 1W7LA 3A2BA 1BJOB 2ZY2A 1I43A 2ZP7A 4RIZA 3ASAA 1ASFA 4BA4A 1GC3A 4KYOA 1C0NA 1AMAA 2WK9A 4L0OA 5LH9A 4J8LA 4RJ0A 1C4KA 3AEPA 1OHWA 1YJZA 1YOOA 4F4EA 3HDOA 4OCAA 2DGKA 4M2MA 2ZSLA 2ORDA 4WXFA 1AIBA 3FZ6A 4P3MA 4WB0A 2Z1ZA 3NX3A 2DGLA 8AATA 1ASLA 2C44A 4RKCA 2W8JA 2CY8A 3FD0A 1B4XA 1X2AA 4ZDLA 2YOBA 4AH3A 4E1OA 1X29A 2G6WA 3H14A 2WK7A 1LW5A 1O61A 2FYFA 1ARHA 3EIAA 1IAXA 3LG0A 2AY1A 3KGXA 3R4TA 5I92A 4GSAA 2BHXA 2YKUA 4K2IA 3AOVA 4PIWA 1D7SA 1VJOA 3EI6A 2OGAA 4CXRA 5EAVA 1ZOBA 2YRRA 3PD6A 3RBFA 3WKSA 1ASAA 3FSLA 4A6TA 4RKDA 3N5MA 2CTZA 1EQBA 1EG5A 3MKJA 2VMQA 2VMUA 3FTBA 3EUCA 4I8AA 3AOWA 1JS6A 4MQQA 4WB0B 5FT8A 2BI1A 4TN4A 4E3RA 2EZ2A 2YCPA 3BCBA 1M0NA 3NU7A 4WYAA 3GWPA 1BS0A 2D65A 2JG2A 1LKCA 3JZLA 3VK4A 4AZKA 3BS8A 1W7NA 2W7FA 5LHAA 4W91A 3WLXA 5K8BA 2ZY3A 4JE5A 1FC4A 4OBUA 4E3QA 3COGA 1AJRA 4WLJA 3LVMA 3E9KA 1QISA 3WGBA 5E5IA 4AOAA 1E5EA 1MDZA 2AY7A 1GCKA 1AIAA 1Z7DA 2VI9A 3ZRRA 2DOUA 1IVRA 3PD6B 2X3LA 4PFNA 3ATHA 4ADEA 1AY4A 1CZCA 1SPAA 1WKGA 1M0QA 1S09A 3AATA 1D7VA 3PIUA 5F9SA 2OKKA 3UAKA 4R5ZA 4EFFA 3EI8A 4ZM3A 2EH6A 3ISLA 4FFCA 2AY5A 1S06A 2OKJA 4UOYA 4UHMA 3UWCA 1AKCA 4OYTA 4Q75A 3HLMA 3OKSA 2W8VA 3JU7A 4GE4A 1DFOA 1QIRA 2FNUA 2VIBA 4ISYA 4OT8A 4GE9A 4TV7A 1ASEA 3PPLA 4XEWA 5G4JA 4HVKA 1KMKA 5G2PA 4WXBA 5JAYA 2QBTA 5BJ3A 3USFA 5DX5A 3II0A 1B9HA 3B8XA 2FN6A 3B46A 1XEYA 3KE3A 4XJPA 2O7CA 1JF9A 3BCXA 3P6KA 5J8QA 3NNKA 1TOJA 1ASBA 2W7GA 2HOZA 4PVFA 4WXGA 4ZM4A 4B98A 3FDBA 2DGMA 4J5UA 2XBNA 2YKXA 3MEBA 3TCMA 2VI8A 1GDEA 4A0GA 3F0HA 2JJHA 1SVVA 1TARA 3FZ8A 3FZ7A 4LNLA 2GMSA 2HUFA 3NTJA 4WLHA 2AATA 2HUUA 2VMZA 3I16A 1M4NA 2CJHA 3CQ6A 2W7EA 1ASNA 3DR4A 1AX4A 1AHEA 4JEWA 1KKJA 3DXVA 3N0LA 2Z61A 9AATA 1WYTB 1B5OA 2BI3A 3AEMC 1AHYA 5G09A 5E4ZA 4WBTA 4RITA 1BJNA 2Z20A 2DKBA 2CSTA 1DGEA 1PMMA 1BJ4A 2XH1A 2AY9A 3HQTA 2WKAA 4ITGA 1KMJA 2ZC0A 1OHYA 4A00A 5EQCA 5HHYA 4CBRA 2ZY4A 4U2HA 3DU4A 4A6UA 4OTLA 5EIGA 4OC9A 1RVYA 3TQXA 1GEYA 4B9BA 1J32A 4ZSWA 4KXKA 3LVLB 4MQRA 3G7QA 5FT4A 3VK3A 3RQ1A 1V2DA 1S0AA 2CFBA 4OBVA 2OGEA 1JS3A 1LC7A 2VGWA 2YKVA 1MDOA 5EUEA 2HP2A 2HORA 3VP6A 5IWQA 2VGUA 3VAXA 3I5TA 2R5CB 4JE5D 3NYUA 4UHNA 4W1WA 3EIBA 2Z1YA 1CZEA 3QHXA 3PDBA 2W7DA 2W8TA 4ZSYA 3IHJA 4RAEA 1VP4A 2GQNA 3BWNC 4EB5A 5M4DA 3ZZJA 4F5JA 2ZSMA 4WYFA 4ZAHA 5D95A 1JG8A 2BIGA 1SZSA 5F8VA 3NU8A 2FQ6A 2QB2A 2Z9UA 1T3IA 4GE7A 4M2JA 4MKJA 4A72A 1UU0A 1ELQA 5EIGB 4OMAA 1LW4A 4JEXA 1V72A 2BYLA 2JJEA 1ARGA 1WSTA 2CB1A 3W1HA 2VMYA 3ECDA 4ZLVA 1U08A 3DR7A 3FFHA 4BHDA 1LK9A 2E7UA 1AY5A 3W1JA 3B1EA 1GEXA 3ZZKA 2PB2A 4WYEA 1N2TA 4K2MA 2JJGA 2Z9XA 1RVUA 2CJGA 2AEVA 3AEJC 3WX9A 2VIAA 2BIAA 2VGZA 1TATA 3PDBB 3Q8NA 4WYDA 1BJWA 2D63A 1PFFA 2Z9WA 2RFVA 1ARSA 1M6SA 4Y0DA 3R9AA 1CQ6A 2BKWA 4RJYA 1YIZA 1MGVA 2E54A 2GSAA 1KL2A 3EI5A 2CINA 1DJ9A 2YKYA 3A9YA 3TFUA 1J04A 3I4JA 3HT4A 1MDXA 1LC8A 1ARTA 2JJFA 3KGWA 1GC0A 1AMQA 4XJOA 1SZUA 1TASA 4ADCA 4AZJA 3EZSA 1KL1A 4CVQA 2EGYA 3GETA 3E77A 2YCNA 3NYTA 4XQ2A 1EJIA 2VGTA 2W8UA 3DYDA 4EMYA 2D7YA 1O69A 2E7IA 1QZ9A 1MLYA 3RBLA 1BQAA 2O0RA 1FG7A 4F5FA 1Z3ZA 1DJUA 1D7UA 3LVJA 4JEYA 1UU2A 4CXQA 3AEMA 4JEVA 1BKGA 3MAFA 5M4BA 5C6UA 3OP7A 1LS3A 4LNMA 1S07A 2VYCA 1GBNA 4W8IA 2Q7WA 2F8JA 4R2NA 1AJSA 3EI9A 4P7YA 4F5HA 3A8UX 1DGDA 3A9ZA 4LC3A 4W1XA 1I29A 2CANA 2V1PA 2QMAA 2VMWA 3WCNA 3FQ8A 3ASBA 1WYVA 1V2EA 1PG8A 5M49A 3W1IA 4N0BA 4JF1A 4Q31A 3ZRPA 1UU1A 2CJDA 3MAFB 2BI2A 1C7NA 5M46A 1M0OA 1ZODA 3BWNA 1P3WA 3QI6A 4Q76A 1WYUA 1LC5A 3DRDA 3NRAA 1N31A 2CH2A 5FT6A 2O1BA 1WKHA 3HBXA 4NOGA 4ADDA 1AJSB 4F5LA 1W23A 1ASDA 2WK8A 1MAPA 3FQAA 5DJ1A 4AO9A 3PGYA 3QN6A 1BQDA 1MLZA 1IX7A 3B1CA 3HL2A 1YAAA 1H0CA 4IX8A 3NUIA 3GBXA 3MAUA 2W7JA 1YNUA 3DC1A 3BB8A 4H51A 2BI5A 2X8UA 5DB5A 1WYVB 1IX6A 3BCAA 3F6TA 1TPLA 4CBSA 2V0YA 3LWSA 3D6KA 1M7YA 1MAQA 3AEJA 2D64A 3BN1A 3GSBA 3PJ0A 4ZWVA 3K28A 3MC6C 4HF8A 4Y0IA 3WCOA 1ZC9A 3FVSA 4WP0A 1WYUB 1FG3A 3N75A 1ASCA 5G4IA 3QM2A 4LW2A 5EFSA 3AELA 3G0TA 3JTXA 2BWOA 1AHXA 4MQPA 3K40A 4Y0HA 3BWOA 2HOYA 1AMRA 3PDXA 2X5DA 4A0FA 4ADBA 4UHOA 2GB3A 4M2KA 1B5PA 1O62A 1B8GA 3PAAA 3T32A 1CQ8A 1Y4IA 3FCRA 2W7HA 2ZYJA 3B1DA 4AO4A 3GZDC 2HP1A 1BT4A 1CJ0A 2BYJA 1IX8A 2DKJA 4R5FA 2QLRA 3CBFA 3K7YA 4IXZA 1CQ7A 3RI6A 4XAUA 2VGVA 3LY1A 1IUGA 2D66A 3BV0A 1DJEA 1CL1A 3WY7A 1B9IA 3DZZA 1AAMA 2NMPA 2BI9A 4BQ0A 1G7XA 1QJ5A 1W3UA 2VGSA 4K2BA 4JF0A 1C7GA 1ECXA 2R5EA 4MGRA 5HDMA 3H7FA 1ORDA 4GRXA 1G4VA 3HVYA 4BA5A 3IF2A 2EZ1A 5D5SA 3FRKA 1IJIA 2JGTA 1C9CA 4O6ZA 4EB7A 1AICA 3M5UA 3VK2A 1OXPA 7AATA 1RV3A 3ZRQA 1KKPA 1AAWA 1W7MA 2FNIA 2VMXA 4DBCA 2OQXA 1AHFA 2VMPA 2Z9VA 3E2YA 4WYCA 3E2ZA 4U1TA 1M32A 5FT5A 4KAMA 1G4XA 2TPLA 3LVKA 2VMOA 2AEUA 2AY8A 2C7TA 1C7OA 4ITXA 1M0PA 1TOGA 4IY7A 4RM1A 2VMSA 3ELEA 2AY4A 3CQ4A 3TATA 2BWNA 3TFTA 4F5MA 1UKJA 1GC2A 1QJ3A 1OXOA 4IW7A 3NDNA 3WZFA 4Q6RA 2C81A 4TMRA 4GEBA 1QITA 2D7ZA 2QA3A 4XK1A 1TOIA 3UE8A 3MBBA 2BWPA 2W8WA
chains in the Genus database with same CATH superfamily
1QGNA 3A9XA 3LV2A 3MC6A 3NUBA 3DODA 3E2ZB 1AKAA 4A0RA 4RLGA 1TOKA 4ATPA 1PMOA 3CQ5A 3ELPA 2HOXA 4LNJA 4XJMA 2QB3A 1ASMA 1O4SA 2W7LA 2W7MA 1ELUA 2YHKA 4BMKA 4F5GA 5BJ4A 5HXXA 1GD9A 1N8PA 1XI9A 3PA9A 3QGUA 4EU1A 2ZUKA 4R8DA 3MADA 4ZDOA 1YJSA 4DGTA 4DQ6A 3RCHA 1RV4A 3QBOA 2C0RA 4IXOA 4ATQA 2W7KA 3DXWA 1DKAA 2X5FA 2PB0A 2Z67A 1V2FA 2HZPA 3L44A 4W1VA 1CS1A 3GZDA 1SZKA 3AENA 2ZJGA 1AHGA 3L8AA 2R2NA 4E77A 3H9XA 4PFFA 2YRIA 1SFFA 1DTYA 1D2FA 2E7JA 3FFRA 1I48A 1WYTA 3QPGA 4ZASA 2EO5A 1GC4A 3HMUA 4MSOA 3FVUA 4A6RA 1GEWA 2VMVA 2QSRA 3FQ7A 5EAAA 4XJLA 3VOMA 1IBJA 2VLFA 2VLHA 4IXSA 2CH1A 3FKDA 1AY8A 4ZDPA 5DJ9A 2AY6A 1YJYA 2R0TA 4GDYA 2BIEA 2HUIA 1I41A 3NYSA 4QGRA 1OHVA 3GR9A 4IYOA 4UQVA 3RCHB 1AMSA 2AY3A 5E3KA 2VMTA 3FDDA 2OATA 2VMRA 3AEOA 1OATA 4W5KA 1X0MA 3AENB 5G2QA 3FVXA 3JWBA 4WD2A 4WYGA 1CL2A 3E2FA 3RUYA 2DR1A 2R5CA 1BJOA 1D7RA 3P1TA 2VMNA 3E6GA 1X28A 1ASGA 3AV7A 5EUNA 3KKIA 2W7IA 4ZWMA 1E5FA 4JEZA 1SF2A 2PO3A 3WGCA 3ACZA 1G7WA 3JWAA 4MKKA 4MY5A 2D61A 4A0HA 1S08A 3BC8A 1IAYA 1BW0A 3F9TA 4N0WA 2GMUA 3GJUA 2EPJA 5EUDA 5G0AA 1TOEA 2AY2A 3GZCA 3G8MA 3EI7A 3WKRA 3EZ1A 3CAIA 1AKBA 4IYOB 4F5IA 4F5KA 5AX8A 4FL0A 5TF5A 2ZY5A 2D5YA 1H1CA 2FM1A 2JISA 3JW9A 1ARIA 1VEFA 4LW4A 1YIYA 2YCTA 1W7LA 3A2BA 1BJOB 2ZY2A 1I43A 2ZP7A 4RIZA 3ASAA 1ASFA 4BA4A 1GC3A 4KYOA 1C0NA 1AMAA 2WK9A 4L0OA 5LH9A 4J8LA 4RJ0A 1C4KA 3AEPA 1OHWA 1YJZA 1YOOA 4F4EA 3HDOA 4OCAA 2DGKA 4M2MA 2ZSLA 2ORDA 4WXFA 1AIBA 3FZ6A 4P3MA 4WB0A 2Z1ZA 3NX3A 2DGLA 8AATA 1ASLA 2C44A 4RKCA 2W8JA 2CY8A 3FD0A 1B4XA 1X2AA 4ZDLA 2YOBA 4AH3A 3N4XA 4E1OA 1X29A 2G6WA 3H14A 2WK7A 1LW5A 1O61A 2FYFA 1ARHA 3EIAA 1IAXA 3LG0A 2AY1A 3KGXA 3R4TA 5I92A 4GSAA 2BHXA 2YKUA 4K2IA 3AOVA 4PIWA 1D7SA 1VJOA 3EI6A 2OGAA 4CXRA 5EAVA 1ZOBA 2YRRA 3PD6A 3RBFA 3WKSA 1ASAA 3FSLA 4A6TA 4RKDA 3N5MA 2CTZA 1EQBA 1EG5A 3MKJA 2VMQA 2VMUA 3FTBA 3EUCA 4I8AA 3AOWA 1JS6A 4MQQA 4WB0B 5FT8A 2BI1A 4TN4A 4E3RA 4K05A 2EZ2A 2YCPA 3BCBA 1M0NA 3NU7A 4WYAA 3GWPA 1BS0A 2D65A 2JG2A 1LKCA 3JZLA 3VK4A 4AZKA 3BS8A 1W7NA 2W7FA 5LHAA 4W91A 3WLXA 5K8BA 2ZY3A 4JE5A 1FC4A 4OBUA 4E3QA 3COGA 1AJRA 4WLJA 3LVMA 3E9KA 1QISA 3WGBA 5E5IA 4AOAA 1E5EA 1MDZA 2AY7A 1GCKA 1AIAA 1Z7DA 2VI9A 3ZRRA 2DOUA 1IVRA 3PD6B 2X3LA 4PFNA 3ATHA 4ADEA 1AY4A 1CZCA 1SPAA 1WKGA 1M0QA 1S09A 3AATA 1D7VA 3PIUA 5F9SA 2OKKA 3UAKA 4R5ZA 4EFFA 3EI8A 4ZM3A 2EH6A 3ISLA 4FFCA 2AY5A 1S06A 2OKJA 4UOYA 4UHMA 3UWCA 1AKCA 4OYTA 4Q75A 3HLMA 3OKSA 2W8VA 3JU7A 4GE4A 1DFOA 1QIRA 2FNUA 2VIBA 4ISYA 4OT8A 4GE9A 4TV7A 1ASEA 3PPLA 4XEWA 5G4JA 4HVKA 1KMKA 5G2PA 4WXBA 5JAYA 2QBTA 5BJ3A 3USFA 5DX5A 3II0A 1B9HA 3B8XA 2FN6A 3B46A 1XEYA 3KE3A 4XJPA 2O7CA 1JF9A 3BCXA 3P6KA 5J8QA 3NNKA 1TOJA 1ASBA 2W7GA 2HOZA 4PVFA 4WXGA 4ZM4A 4B98A 3FDBA 2DGMA 4J5UA 2XBNA 2YKXA 3MEBA 3TCMA 2VI8A 1GDEA 4A0GA 3F0HA 2JJHA 1SVVA 1TARA 3FZ8A 3FZ7A 4LNLA 2GMSA 2HUFA 3NTJA 4WLHA 2AATA 2HUUA 2VMZA 3I16A 1M4NA 2CJHA 3CQ6A 2W7EA 1ASNA 3DR4A 1AX4A 1AHEA 4JEWA 1KKJA 3DXVA 3N0LA 2Z61A 9AATA 1WYTB 1B5OA 2BI3A 3AEMC 1AHYA 5G09A 5E4ZA 4WBTA 4RITA 1BJNA 2Z20A 2DKBA 2CSTA 1DGEA 1PMMA 1BJ4A 2XH1A 2AY9A 3HQTA 2WKAA 4ITGA 1KMJA 2ZC0A 1OHYA 4A00A 5EQCA 5HHYA 4CBRA 2ZY4A 4U2HA 3DU4A 4A6UA 4OTLA 5EIGA 4OC9A 1RVYA 3TQXA 1GEYA 4B9BA 1J32A 4ZSWA 4KXKA 3LVLB 4MQRA 3G7QA 5FT4A 3VK3A 3RQ1A 1V2DA 1S0AA 2CFBA 4OBVA 2OGEA 1JS3A 1LC7A 2VGWA 2YKVA 1MDOA 5EUEA 2HP2A 2HORA 3VP6A 5IWQA 2VGUA 3VAXA 3I5TA 2R5CB 4JE5D 3NYUA 4UHNA 4W1WA 3EIBA 2Z1YA 1CZEA 3QHXA 3PDBA 2W7DA 2W8TA 4ZSYA 3IHJA 4RAEA 1VP4A 4H63Q 2GQNA 3BWNC 4EB5A 5M4DA 3ZZJA 4F5JA 2ZSMA 4WYFA 4ZAHA 5D95A 1JG8A 2BIGA 2KFPA 1SZSA 5F8VA 3NU8A 2FQ6A 2QB2A 2Z9UA 1T3IA 4GE7A 4M2JA 4MKJA 4A72A 1UU0A 1ELQA 5EIGB 4OMAA 1LW4A 4JEXA 1V72A 2BYLA 2JJEA 1ARGA 1WSTA 2CB1A 3W1HA 2VMYA 3ECDA 4ZLVA 1U08A 3DR7A 3FFHA 4BHDA 1LK9A 2E7UA 1AY5A 3W1JA 3B1EA 1GEXA 3ZZKA 2PB2A 4WYEA 1N2TA 4K2MA 2JJGA 2Z9XA 1RVUA 2CJGA 2AEVA 3AEJC 3WX9A 2VIAA 2BIAA 2VGZA 1TATA 3PDBB 3Q8NA 4WYDA 1BJWA 2D63A 1PFFA 2Z9WA 2RFVA 1ARSA 1M6SA 4Y0DA 3R9AA 1CQ6A 2BKWA 4RJYA 1YIZA 1MGVA 2E54A 2GSAA 1KL2A 3EI5A 2CINA 1DJ9A 2YKYA 3A9YA 3TFUA 1J04A 3I4JA 3HT4A 1MDXA 1LC8A 1ARTA 2JJFA 3KGWA 1GC0A 1AMQA 4XJOA 1SZUA 1TASA 4ADCA 4AZJA 3EZSA 1KL1A 4CVQA 2EGYA 3GETA 3E77A 3N4RA 2YCNA 3NYTA 4XQ2A 1EJIA 2VGTA 2W8UA 3DYDA 4EMYA 2D7YA 1O69A 2E7IA 1QZ9A 1MLYA 3RBLA 1BQAA 2O0RA 1FG7A 4F5FA 2EYQA 1Z3ZA 1DJUA 1D7UA 3LVJA 4JEYA 1UU2A 4CXQA 3AEMA 4JEVA 1BKGA 3MAFA 5M4BA 5C6UA 3OP7A 1LS3A 4LNMA 1S07A 2VYCA 1GBNA 4W8IA 3N4SA 2Q7WA 2F8JA 4R2NA 1AJSA 3EI9A 4P7YA 4F5HA 3A8UX 1DGDA 3A9ZA 4LC3A 4W1XA 1I29A 2CANA 2V1PA 2QMAA 2VMWA 3WCNA 3FQ8A 3ASBA 1WYVA 1V2EA 1PG8A 5M49A 3W1IA 4N0BA 4JF1A 4Q31A 3ZRPA 1UU1A 2CJDA 3MAFB 2BI2A 1C7NA 5M46A 1M0OA 1ZODA 3BWNA 1P3WA 3QI6A 4Q76A 1WYUA 1LC5A 3DRDA 3NRAA 1N31A 2CH2A 5FT6A 2O1BA 1WKHA 3HBXA 4NOGA 4ADDA 1AJSB 4F5LA 1W23A 1ASDA 2WK8A 1MAPA 3FQAA 5DJ1A 4AO9A 3PGYA 3QN6A 1KAFA 1BQDA 1MLZA 1IX7A 3B1CA 3HL2A 1YAAA 1H0CA 4IX8A 3NUIA 3GBXA 3MAUA 2W7JA 1YNUA 3DC1A 3BB8A 4H51A 2BI5A 2X8UA 5DB5A 1WYVB 1IX6A 3BCAA 3F6TA 1TPLA 4CBSA 2V0YA 3LWSA 3D6KA 1M7YA 2A1VA 1MAQA 3AEJA 2D64A 3BN1A 3GSBA 3PJ0A 4ZWVA 3K28A 3MC6C 4HF8A 4Y0IA 3WCOA 1ZC9A 3FVSA 4WP0A 3N7NA 1WYUB 2FKIA 1FG3A 5KTBA 3N75A 1ASCA 5G4IA 3QM2A 4LW2A 5EFSA 3AELA 3G0TA 3JTXA 2G7JA 2BWOA 1AHXA 4MQPA 3K40A 4Y0HA 3BWOA 2HOYA 1AMRA 3PDXA 2X5DA 4A0FA 4ADBA 4UHOA 2GB3A 4M2KA 1B5PA 1O62A 1B8GA 3PAAA 3T32A 1CQ8A 1Y4IA 3FCRA 2W7HA 2ZYJA 3B1DA 4AO4A 3GZDC 2HP1A 1BT4A 1CJ0A 2BYJA 1IX8A 2DKJA 4R5FA 2QLRA 3CBFA 3K7YA 4IXZA 1CQ7A 3RI6A 4XAUA 2VGVA 3LY1A 1IUGA 2D66A 3BV0A 1DJEA 1CL1A 3WY7A 1B9IA 3DZZA 1AAMA 2NMPA 2BI9A 4BQ0A 1G7XA 1QJ5A 1W3UA 2VGSA 4K2BA 4JF0A 1C7GA 1ECXA 2R5EA 4MGRA 5HDMA 3H7FA 1ORDA 4GRXA 1G4VA 3HVYA 4BA5A 3IF2A 2EZ1A 5D5SA 3FRKA 1IJIA 2JGTA 1C9CA 4O6ZA 4EB7A 1AICA 3M5UA 3VK2A 1OXPA 7AATA 1RV3A 3ZRQA 1KKPA 1AAWA 1W7MA 2FNIA 2VMXA 2WB6A 4DBCA 2OQXA 1AHFA 2VMPA 2Z9VA 3E2YA 4WYCA 3E2ZA 4U1TA 1M32A 5FT5A 4KAMA 1G4XA 2TPLA 3LVKA 2VMOA 2AEUA 2AY8A 2C7TA 1C7OA 4ITXA 1M0PA 1TOGA 4IY7A 4RM1A 2VMSA 3ELEA 2AY4A 3CQ4A 3TATA 2BWNA 3TFTA 4F5MA 1UKJA 1GC2A 1QJ3A 1OXOA 4IW7A 3NDNA 3WZFA 4Q6RA 2C81A 4TMRA 4GEBA 1QITA 2D7ZA 2QA3A 4XK1A 1TOIA 3UE8A 3MBBA 2BWPA 2W8WA
chains in the Genus database with same CATH topology
1QGNA 3A9XA 3LV2A 3MC6A 3NUBA 3DODA 3E2ZB 1AKAA 4A0RA 4RLGA 1TOKA 4ATPA 1PMOA 3CQ5A 3ELPA 2HOXA 4LNJA 4XJMA 2QB3A 1ASMA 1O4SA 2W7LA 2W7MA 1ELUA 2YHKA 4BMKA 4F5GA 5BJ4A 5HXXA 1GD9A 1N8PA 1XI9A 3PA9A 3QGUA 4EU1A 2ZUKA 4R8DA 3MADA 4ZDOA 1YJSA 4DGTA 4DQ6A 3RCHA 1RV4A 3QBOA 2C0RA 4IXOA 4ATQA 2W7KA 3DXWA 1DKAA 2X5FA 2PB0A 2Z67A 1V2FA 2HZPA 3L44A 4W1VA 1CS1A 3GZDA 1SZKA 3AENA 2ZJGA 1AHGA 3L8AA 2R2NA 4E77A 3H9XA 4PFFA 2YRIA 1SFFA 1DTYA 1D2FA 2E7JA 3FFRA 1I48A 1WYTA 3QPGA 4ZASA 2EO5A 1GC4A 3HMUA 4MSOA 3FVUA 4A6RA 1GEWA 2VMVA 2QSRA 3FQ7A 5EAAA 4XJLA 3VOMA 1IBJA 2VLFA 2VLHA 4IXSA 2CH1A 3FKDA 1AY8A 4ZDPA 5DJ9A 2AY6A 1YJYA 2R0TA 4GDYA 2BIEA 2HUIA 1I41A 3NYSA 4QGRA 1OHVA 3GR9A 4IYOA 4UQVA 3RCHB 1AMSA 2AY3A 5E3KA 2VMTA 3FDDA 2OATA 2VMRA 3AEOA 1OATA 4W5KA 1X0MA 3AENB 5G2QA 3FVXA 3JWBA 4WD2A 4WYGA 1CL2A 3E2FA 3RUYA 2DR1A 2R5CA 1BJOA 1D7RA 3P1TA 2VMNA 3E6GA 1X28A 1ASGA 3AV7A 5EUNA 3KKIA 2W7IA 4ZWMA 1E5FA 4JEZA 1SF2A 2PO3A 3WGCA 3ACZA 1G7WA 3JWAA 4MKKA 4MY5A 2D61A 4A0HA 1S08A 3BC8A 1IAYA 1BW0A 3F9TA 4N0WA 2GMUA 3GJUA 2EPJA 5EUDA 5G0AA 1TOEA 2AY2A 3GZCA 3G8MA 3EI7A 3WKRA 3EZ1A 3CAIA 1AKBA 4IYOB 4F5IA 4F5KA 5AX8A 4FL0A 5TF5A 2ZY5A 2D5YA 1H1CA 2FM1A 2JISA 3JW9A 1ARIA 1VEFA 4LW4A 1YIYA 2YCTA 1W7LA 3A2BA 1BJOB 2ZY2A 1I43A 2ZP7A 4RIZA 3ASAA 1ASFA 4BA4A 1GC3A 4KYOA 1C0NA 1AMAA 2WK9A 4L0OA 5LH9A 4J8LA 4RJ0A 1C4KA 3AEPA 1OHWA 1YJZA 1YOOA 4F4EA 3HDOA 4OCAA 2DGKA 4M2MA 2ZSLA 2ORDA 4WXFA 1AIBA 3FZ6A 4P3MA 4WB0A 2Z1ZA 3NX3A 2DGLA 8AATA 1ASLA 2C44A 4RKCA 2W8JA 2CY8A 3FD0A 1B4XA 1X2AA 4ZDLA 2YOBA 4AH3A 3N4XA 4E1OA 1X29A 2G6WA 3H14A 2WK7A 1LW5A 1O61A 2FYFA 1ARHA 3EIAA 1IAXA 3LG0A 2AY1A 3KGXA 3R4TA 5I92A 4GSAA 2BHXA 2YKUA 4K2IA 3AOVA 4PIWA 1D7SA 1VJOA 3EI6A 2OGAA 4CXRA 5EAVA 1ZOBA 2YRRA 3PD6A 3RBFA 3WKSA 1ASAA 3FSLA 4A6TA 4RKDA 3N5MA 2CTZA 1EQBA 1EG5A 3MKJA 2VMQA 2VMUA 3FTBA 3EUCA 4I8AA 3AOWA 1JS6A 4MQQA 4WB0B 5FT8A 2BI1A 4TN4A 4E3RA 4K05A 2EZ2A 2YCPA 3BCBA 1M0NA 3NU7A 4WYAA 3GWPA 1BS0A 2D65A 2JG2A 1LKCA 3JZLA 3VK4A 4AZKA 3BS8A 1W7NA 2W7FA 5LHAA 4W91A 3WLXA 5K8BA 2ZY3A 4JE5A 1FC4A 4OBUA 4E3QA 3COGA 1AJRA 4WLJA 3LVMA 3E9KA 1QISA 3WGBA 5E5IA 4AOAA 1E5EA 1MDZA 2AY7A 1GCKA 1AIAA 1Z7DA 2VI9A 3ZRRA 2DOUA 1IVRA 3PD6B 2X3LA 4PFNA 3ATHA 4ADEA 1AY4A 1CZCA 1SPAA 1WKGA 1M0QA 1S09A 3AATA 1D7VA 3PIUA 5F9SA 2OKKA 3UAKA 4R5ZA 4EFFA 3EI8A 4ZM3A 2EH6A 3ISLA 4FFCA 2AY5A 1S06A 2OKJA 4UOYA 4UHMA 3UWCA 1AKCA 4OYTA 4Q75A 3HLMA 3OKSA 2W8VA 3JU7A 4GE4A 1DFOA 1QIRA 2FNUA 2VIBA 4ISYA 4OT8A 4GE9A 4TV7A 1ASEA 3PPLA 4XEWA 5G4JA 4HVKA 1KMKA 5G2PA 4WXBA 5JAYA 2QBTA 5BJ3A 3USFA 5DX5A 3II0A 1B9HA 3B8XA 2FN6A 3B46A 1XEYA 3KE3A 4XJPA 2O7CA 1JF9A 3BCXA 3P6KA 5J8QA 3NNKA 1TOJA 1ASBA 2W7GA 2HOZA 4PVFA 4WXGA 4ZM4A 4B98A 3FDBA 2DGMA 4J5UA 2XBNA 2YKXA 3MEBA 3TCMA 2VI8A 1GDEA 4A0GA 3F0HA 2JJHA 1SVVA 1TARA 3FZ8A 3FZ7A 4LNLA 2GMSA 2HUFA 3NTJA 4WLHA 2AATA 2HUUA 2VMZA 3I16A 1M4NA 2CJHA 3CQ6A 2W7EA 1ASNA 3DR4A 1AX4A 1AHEA 4JEWA 1KKJA 3DXVA 3N0LA 2Z61A 9AATA 1WYTB 1B5OA 2BI3A 3AEMC 1AHYA 5G09A 5E4ZA 4WBTA 4RITA 1BJNA 2Z20A 2DKBA 2CSTA 1DGEA 1PMMA 1BJ4A 2XH1A 2AY9A 3HQTA 2WKAA 4ITGA 1KMJA 2ZC0A 1OHYA 4A00A 5EQCA 5HHYA 4CBRA 2ZY4A 4U2HA 3DU4A 4A6UA 4OTLA 5EIGA 4OC9A 1RVYA 3TQXA 1GEYA 4B9BA 1J32A 4ZSWA 4KXKA 3LVLB 4MQRA 3G7QA 5FT4A 3VK3A 3RQ1A 1V2DA 1S0AA 2CFBA 4OBVA 2OGEA 1JS3A 1LC7A 2VGWA 2YKVA 1MDOA 5EUEA 2HP2A 2HORA 3VP6A 5IWQA 2VGUA 3VAXA 3I5TA 2R5CB 4JE5D 3NYUA 4UHNA 4W1WA 3EIBA 2Z1YA 1CZEA 3QHXA 3PDBA 2W7DA 2W8TA 4ZSYA 3IHJA 4RAEA 1VP4A 4H63Q 2GQNA 3BWNC 4EB5A 5M4DA 3ZZJA 4F5JA 2ZSMA 4WYFA 4ZAHA 5D95A 1JG8A 2BIGA 2KFPA 1SZSA 5F8VA 3NU8A 2FQ6A 2QB2A 2Z9UA 1T3IA 4GE7A 4M2JA 4MKJA 4A72A 1UU0A 1ELQA 5EIGB 4OMAA 1LW4A 4JEXA 1V72A 2BYLA 2JJEA 1ARGA 1WSTA 2CB1A 3W1HA 2VMYA 3ECDA 4ZLVA 1U08A 3DR7A 3FFHA 4BHDA 1LK9A 2E7UA 1AY5A 3W1JA 3B1EA 1GEXA 3ZZKA 2PB2A 4WYEA 1N2TA 4K2MA 2JJGA 2Z9XA 1RVUA 2CJGA 2AEVA 3AEJC 3WX9A 2VIAA 2BIAA 2VGZA 1TATA 3PDBB 3Q8NA 4WYDA 1BJWA 2D63A 1PFFA 2Z9WA 2RFVA 1ARSA 1M6SA 4Y0DA 3R9AA 1CQ6A 2BKWA 4RJYA 1YIZA 1MGVA 2E54A 2GSAA 1KL2A 3EI5A 2CINA 1DJ9A 2YKYA 3A9YA 3TFUA 1J04A 3I4JA 3HT4A 1MDXA 1LC8A 1ARTA 2JJFA 3KGWA 1GC0A 1AMQA 4XJOA 1SZUA 1TASA 4ADCA 4AZJA 3EZSA 1KL1A 4CVQA 2EGYA 3GETA 3E77A 3N4RA 2YCNA 3NYTA 4XQ2A 1EJIA 2VGTA 2W8UA 3DYDA 4EMYA 2D7YA 1O69A 2E7IA 1QZ9A 1MLYA 3RBLA 1BQAA 2O0RA 1FG7A 4F5FA 2EYQA 1Z3ZA 1DJUA 1D7UA 3LVJA 4JEYA 1UU2A 4CXQA 3AEMA 4JEVA 1BKGA 3MAFA 5M4BA 5C6UA 3OP7A 1LS3A 4LNMA 1S07A 2VYCA 1GBNA 4W8IA 3N4SA 2Q7WA 2F8JA 4R2NA 1AJSA 3EI9A 4P7YA 4F5HA 3A8UX 1DGDA 3A9ZA 4LC3A 4W1XA 1I29A 2CANA 2V1PA 2QMAA 2VMWA 3WCNA 3FQ8A 3ASBA 1WYVA 1V2EA 1PG8A 5M49A 3W1IA 4N0BA 4JF1A 4Q31A 3ZRPA 1UU1A 2CJDA 3MAFB 2BI2A 1C7NA 5M46A 1M0OA 1ZODA 3BWNA 1P3WA 3QI6A 4Q76A 1WYUA 1LC5A 3DRDA 3NRAA 1N31A 2CH2A 5FT6A 2O1BA 1WKHA 3HBXA 4NOGA 4ADDA 1AJSB 4F5LA 1W23A 1ASDA 2WK8A 1MAPA 3FQAA 5DJ1A 4AO9A 3PGYA 3QN6A 1BQDA 1MLZA 1IX7A 3B1CA 3HL2A 1YAAA 1H0CA 4IX8A 3NUIA 3GBXA 3MAUA 2W7JA 1YNUA 3DC1A 3BB8A 4H51A 2BI5A 2X8UA 5DB5A 1WYVB 1IX6A 3BCAA 3F6TA 1TPLA 4CBSA 2V0YA 3LWSA 3D6KA 1M7YA 2A1VA 1MAQA 3AEJA 2D64A 3BN1A 3GSBA 3PJ0A 4ZWVA 3K28A 3MC6C 4HF8A 4Y0IA 3WCOA 1ZC9A 3FVSA 4WP0A 3N7NA 1WYUB 2FKIA 1FG3A 5KTBA 3N75A 1ASCA 5G4IA 3QM2A 4LW2A 5EFSA 3AELA 3G0TA 3JTXA 2G7JA 2BWOA 1AHXA 4MQPA 3K40A 4Y0HA 3BWOA 2HOYA 1AMRA 3PDXA 2X5DA 4A0FA 4ADBA 4UHOA 2GB3A 4M2KA 1B5PA 1O62A 1B8GA 3PAAA 3T32A 1CQ8A 1Y4IA 3FCRA 2W7HA 2ZYJA 3B1DA 4AO4A 3GZDC 2HP1A 1BT4A 1CJ0A 2BYJA 1IX8A 2DKJA 4R5FA 2QLRA 3CBFA 3K7YA 4IXZA 1CQ7A 3RI6A 4XAUA 2VGVA 3LY1A 1IUGA 2D66A 3BV0A 1DJEA 1CL1A 3WY7A 1B9IA 3DZZA 1AAMA 2NMPA 2BI9A 4BQ0A 1G7XA 1QJ5A 1W3UA 2VGSA 4K2BA 4JF0A 1C7GA 1ECXA 2R5EA 4MGRA 5HDMA 3H7FA 1ORDA 4GRXA 1G4VA 3HVYA 4BA5A 3IF2A 2EZ1A 5D5SA 3FRKA 1IJIA 2JGTA 1C9CA 4O6ZA 4EB7A 1AICA 3M5UA 3VK2A 1OXPA 7AATA 1RV3A 3ZRQA 1KKPA 1AAWA 1W7MA 2FNIA 2VMXA 2WB6A 4DBCA 2OQXA 1AHFA 2VMPA 2Z9VA 3E2YA 4WYCA 3E2ZA 4U1TA 1M32A 5FT5A 4KAMA 1G4XA 2TPLA 3LVKA 2VMOA 2AEUA 2AY8A 2C7TA 1C7OA 4ITXA 1M0PA 1TOGA 4IY7A 4RM1A 2VMSA 3ELEA 2AY4A 3CQ4A 3TATA 2BWNA 3TFTA 4F5MA 1UKJA 1GC2A 1QJ3A 1OXOA 4IW7A 3NDNA 3WZFA 4Q6RA 2C81A 4TMRA 4GEBA 1QITA 2D7ZA 2QA3A 4XK1A 1TOIA 3UE8A 3MBBA 2BWPA 2W8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGN A;  3A9X A;  3LV2 A;  3MC6 A;  3NUB A;  3DOD A;  3E2Z B;  1AKA A;  4A0R A;  4RLG A;  1TOK A;  4ATP A;  1PMO A;  3CQ5 A;  3ELP A;  2HOX A;  4LNJ A;  4XJM A;  2QB3 A;  1ASM A;  1O4S A;  2W7L A;  2W7M A;  1ELU A;  2YHK A;  4BMK A;  4F5G A;  5BJ4 A;  5HXX A;  1GD9 A;  1N8P A;  1XI9 A;  3PA9 A;  3QGU A;  4EU1 A;  2ZUK A;  4R8D A;  3MAD A;  4ZDO A;  1YJS A;  4DGT A;  4DQ6 A;  3RCH A;  1RV4 A;  3QBO A;  2C0R A;  4IXO A;  4ATQ A;  2W7K A;  3DXW A;  1DKA A;  2X5F A;  2PB0 A;  2Z67 A;  1V2F A;  2HZP A;  3L44 A;  4W1V A;  1CS1 A;  3GZD A;  1SZK A;  3AEN A;  2ZJG A;  1AHG A;  3L8A A;  2R2N A;  4E77 A;  4PFF A;  2YRI A;  1SFF A;  1DTY A;  1D2F A;  2E7J A;  3FFR A;  1I48 A;  1WYT A;  3QPG A;  4ZAS A;  2EO5 A;  1GC4 A;  3HMU A;  4MSO A;  3FVU A;  4A6R A;  1GEW A;  2VMV A;  3FQ7 A;  5EAA A;  4XJL A;  3VOM A;  1IBJ A;  2VLF A;  2VLH A;  4IXS A;  2CH1 A;  3FKD A;  1AY8 A;  4ZDP A;  5DJ9 A;  2AY6 A;  1YJY A;  2R0T A;  4GDY A;  2BIE A;  2HUI A;  1I41 A;  3NYS A;  4QGR A;  1OHV A;  3GR9 A;  4IYO A;  4UQV A;  3RCH B;  1AMS A;  2AY3 A;  5E3K A;  2VMT A;  3FDD A;  2OAT A;  2VMR A;  3AEO A;  1OAT A;  4W5K A;  1X0M A;  3AEN B;  5G2Q A;  3FVX A;  3JWB A;  4WD2 A;  4WYG A;  1CL2 A;  3E2F A;  3RUY A;  2DR1 A;  2R5C A;  1BJO A;  1D7R A;  3P1T A;  2VMN A;  3E6G A;  1X28 A;  1ASG A;  3AV7 A;  5EUN A;  3KKI A;  2W7I A;  4ZWM A;  1E5F A;  4JEZ A;  1SF2 A;  2PO3 A;  3WGC A;  3ACZ A;  1G7W A;  3JWA A;  4MKK A;  4MY5 A;  2D61 A;  4A0H A;  1S08 A;  3BC8 A;  1IAY A;  1BW0 A;  3F9T A;  4N0W A;  2GMU A;  3GJU A;  2EPJ A;  5EUD A;  5G0A A;  1TOE A;  2AY2 A;  3GZC A;  3G8M A;  3EI7 A;  3WKR A;  3EZ1 A;  3CAI A;  1AKB A;  4IYO B;  4F5I A;  4F5K A;  5AX8 A;  4FL0 A;  5TF5 A;  2ZY5 A;  2D5Y A;  1H1C A;  2FM1 A;  2JIS A;  3JW9 A;  1ARI A;  1VEF A;  4LW4 A;  1YIY A;  2YCT A;  1W7L A;  3A2B A;  1BJO B;  2ZY2 A;  1I43 A;  2ZP7 A;  4RIZ A;  3ASA A;  1ASF A;  4BA4 A;  1GC3 A;  4KYO A;  1C0N A;  1AMA A;  2WK9 A;  4L0O A;  5LH9 A;  4J8L A;  4RJ0 A;  1C4K A;  3AEP A;  1OHW A;  1YJZ A;  1YOO A;  4F4E A;  3HDO A;  4OCA A;  2DGK A;  4M2M A;  2ZSL A;  2ORD A;  4WXF A;  1AIB A;  3FZ6 A;  4P3M A;  4WB0 A;  2Z1Z A;  3NX3 A;  2DGL A;  8AAT A;  1ASL A;  2C44 A;  4RKC A;  2W8J A;  2CY8 A;  3FD0 A;  1B4X A;  1X2A A;  4ZDL A;  2YOB A;  4AH3 A;  4E1O A;  1X29 A;  2G6W A;  3H14 A;  2WK7 A;  1LW5 A;  1O61 A;  2FYF A;  1ARH A;  3EIA A;  1IAX A;  3LG0 A;  2AY1 A;  3KGX A;  3R4T A;  5I92 A;  4GSA A;  2BHX A;  2YKU A;  4K2I A;  3AOV A;  4PIW A;  1D7S A;  1VJO A;  3EI6 A;  2OGA A;  4CXR A;  5EAV A;  1ZOB A;  2YRR A;  3PD6 A;  3RBF A;  3WKS A;  1ASA A;  3FSL A;  4A6T A;  4RKD A;  3N5M A;  2CTZ A;  1EQB A;  1EG5 A;  3MKJ A;  2VMQ A;  2VMU A;  3FTB A;  3EUC A;  4I8A A;  3AOW A;  1JS6 A;  4MQQ A;  4WB0 B;  5FT8 A;  2BI1 A;  4TN4 A;  4E3R A;  2EZ2 A;  2YCP A;  3BCB A;  1M0N A;  3NU7 A;  4WYA A;  3GWP A;  1BS0 A;  2D65 A;  2JG2 A;  1LKC A;  3JZL A;  3VK4 A;  4AZK A;  3BS8 A;  1W7N A;  2W7F A;  5LHA A;  4W91 A;  3WLX A;  5K8B A;  2ZY3 A;  4JE5 A;  1FC4 A;  4OBU A;  4E3Q A;  3COG A;  1AJR A;  4WLJ A;  3LVM A;  3E9K A;  1QIS A;  3WGB A;  5E5I A;  4AOA A;  1E5E A;  1MDZ A;  2AY7 A;  1GCK A;  1AIA A;  1Z7D A;  2VI9 A;  3ZRR A;  2DOU A;  1IVR A;  3PD6 B;  2X3L A;  4PFN A;  3ATH A;  4ADE A;  1AY4 A;  1CZC A;  1SPA A;  1WKG A;  1M0Q A;  1S09 A;  3AAT A;  1D7V A;  3PIU A;  5F9S A;  2OKK A;  3UAK A;  4R5Z A;  4EFF A;  3EI8 A;  4ZM3 A;  2EH6 A;  3ISL A;  4FFC A;  2AY5 A;  1S06 A;  2OKJ A;  4UOY A;  4UHM A;  3UWC A;  1AKC A;  4OYT A;  4Q75 A;  3HLM A;  3OKS A;  2W8V A;  3JU7 A;  4GE4 A;  1DFO A;  1QIR A;  2FNU A;  2VIB A;  4ISY A;  4OT8 A;  4GE9 A;  4TV7 A;  1ASE A;  3PPL A;  4XEW A;  5G4J A;  4HVK A;  1KMK A;  5G2P A;  4WXB A;  5JAY A;  2QBT A;  5BJ3 A;  3USF A;  5DX5 A;  3II0 A;  1B9H A;  3B8X A;  2FN6 A;  3B46 A;  1XEY A;  3KE3 A;  4XJP A;  2O7C A;  1JF9 A;  3BCX A;  3P6K A;  5J8Q A;  3NNK A;  1TOJ A;  1ASB A;  2W7G A;  2HOZ A;  4PVF A;  4WXG A;  4ZM4 A;  4B98 A;  3FDB A;  2DGM A;  4J5U A;  2XBN A;  2YKX A;  3MEB A;  3TCM A;  2VI8 A;  1GDE A;  4A0G A;  3F0H A;  2JJH A;  1SVV A;  1TAR A;  3FZ8 A;  3FZ7 A;  4LNL A;  2GMS A;  2HUF A;  3NTJ A;  4WLH A;  2AAT A;  2HUU A;  2VMZ A;  3I16 A;  1M4N A;  2CJH A;  3CQ6 A;  2W7E A;  1ASN A;  3DR4 A;  1AX4 A;  1AHE A;  4JEW A;  1KKJ A;  3DXV A;  3N0L A;  2Z61 A;  9AAT A;  1WYT B;  1B5O A;  2BI3 A;  3AEM C;  1AHY A;  5G09 A;  5E4Z A;  4WBT A;  4RIT A;  1BJN A;  2Z20 A;  2DKB A;  2CST A;  1DGE A;  1PMM A;  1BJ4 A;  2XH1 A;  2AY9 A;  3HQT A;  2WKA A;  4ITG A;  1KMJ A;  2ZC0 A;  1OHY A;  4A00 A;  5EQC A;  5HHY A;  4CBR A;  2ZY4 A;  4U2H A;  3DU4 A;  4A6U A;  4OTL A;  5EIG A;  4OC9 A;  1RVY A;  3TQX A;  1GEY A;  4B9B A;  1J32 A;  4ZSW A;  4KXK A;  3LVL B;  4MQR A;  3G7Q A;  5FT4 A;  3VK3 A;  3RQ1 A;  1V2D A;  1S0A A;  2CFB A;  4OBV A;  2OGE A;  1JS3 A;  1LC7 A;  2VGW A;  2YKV A;  1MDO A;  5EUE A;  2HP2 A;  2HOR A;  3VP6 A;  5IWQ A;  2VGU A;  3VAX A;  3I5T A;  2R5C B;  4JE5 D;  3NYU A;  4UHN A;  4W1W A;  3EIB A;  2Z1Y A;  1CZE A;  3QHX A;  3PDB A;  2W7D A;  2W8T A;  4ZSY A;  3IHJ A;  4RAE A;  1VP4 A;  2GQN A;  3BWN C;  4EB5 A;  5M4D A;  3ZZJ A;  4F5J A;  2ZSM A;  4WYF A;  4ZAH A;  5D95 A;  1JG8 A;  2BIG A;  1SZS A;  5F8V A;  3NU8 A;  2FQ6 A;  2QB2 A;  2Z9U A;  1T3I A;  4GE7 A;  4M2J A;  4MKJ A;  4A72 A;  1UU0 A;  1ELQ A;  5EIG B;  4OMA A;  1LW4 A;  4JEX A;  1V72 A;  2BYL A;  2JJE A;  1ARG A;  1WST A;  2CB1 A;  3W1H A;  2VMY A;  3ECD A;  4ZLV A;  1U08 A;  3DR7 A;  3FFH A;  4BHD A;  1LK9 A;  2E7U A;  1AY5 A;  3W1J A;  3B1E A;  1GEX A;  3ZZK A;  2PB2 A;  4WYE A;  1N2T A;  4K2M A;  2JJG A;  2Z9X A;  1RVU A;  2CJG A;  2AEV A;  3AEJ C;  3WX9 A;  2VIA A;  2BIA A;  2VGZ A;  1TAT A;  3PDB B;  3Q8N A;  4WYD A;  1BJW A;  2D63 A;  1PFF A;  2Z9W A;  2RFV A;  1ARS A;  1M6S A;  4Y0D A;  3R9A A;  1CQ6 A;  2BKW A;  4RJY A;  1YIZ A;  1MGV A;  2E54 A;  2GSA A;  1KL2 A;  3EI5 A;  2CIN A;  1DJ9 A;  2YKY A;  3A9Y A;  3TFU A;  1J04 A;  3I4J A;  3HT4 A;  1MDX A;  1LC8 A;  1ART A;  2JJF A;  3KGW A;  1GC0 A;  1AMQ A;  4XJO A;  1SZU A;  1TAS A;  4ADC A;  4AZJ A;  3EZS A;  1KL1 A;  4CVQ A;  2EGY A;  3GET A;  3E77 A;  2YCN A;  3NYT A;  4XQ2 A;  1EJI A;  2VGT A;  2W8U A;  3DYD A;  4EMY A;  2D7Y A;  1O69 A;  2E7I A;  1QZ9 A;  1MLY A;  3RBL A;  1BQA A;  2O0R A;  1FG7 A;  4F5F A;  1Z3Z A;  1DJU A;  1D7U A;  3LVJ A;  4JEY A;  1UU2 A;  4CXQ A;  3AEM A;  4JEV A;  1BKG A;  3MAF A;  5M4B A;  5C6U A;  3OP7 A;  1LS3 A;  4LNM A;  1S07 A;  2VYC A;  1GBN A;  4W8I A;  2Q7W A;  2F8J A;  4R2N A;  1AJS A;  3EI9 A;  4P7Y A;  4F5H A;  3A8U X;  1DGD A;  3A9Z A;  4LC3 A;  4W1X A;  1I29 A;  2CAN A;  2V1P A;  2QMA A;  2VMW A;  3WCN A;  3FQ8 A;  3ASB A;  1WYV A;  1V2E A;  1PG8 A;  5M49 A;  3W1I A;  4N0B A;  4JF1 A;  4Q31 A;  3ZRP A;  1UU1 A;  2CJD A;  3MAF B;  2BI2 A;  1C7N A;  5M46 A;  1M0O A;  1ZOD A;  3BWN A;  1P3W A;  3QI6 A;  4Q76 A;  1WYU A;  1LC5 A;  3DRD A;  3NRA A;  1N31 A;  2CH2 A;  5FT6 A;  2O1B A;  1WKH A;  3HBX A;  4NOG A;  4ADD A;  1AJS B;  4F5L A;  1W23 A;  1ASD A;  2WK8 A;  1MAP A;  3FQA A;  5DJ1 A;  4AO9 A;  3PGY A;  3QN6 A;  1BQD A;  1MLZ A;  1IX7 A;  3B1C A;  3HL2 A;  1YAA A;  1H0C A;  4IX8 A;  3NUI A;  3GBX A;  3MAU A;  2W7J A;  1YNU A;  3DC1 A;  3BB8 A;  4H51 A;  2BI5 A;  2X8U A;  5DB5 A;  1WYV B;  1IX6 A;  3BCA A;  3F6T A;  1TPL A;  4CBS A;  2V0Y A;  3LWS A;  3D6K A;  1M7Y A;  1MAQ A;  3AEJ A;  2D64 A;  3BN1 A;  3GSB A;  3PJ0 A;  4ZWV A;  3K28 A;  3MC6 C;  4HF8 A;  4Y0I A;  3WCO A;  1ZC9 A;  3FVS A;  4WP0 A;  1WYU B;  1FG3 A;  3N75 A;  1ASC A;  5G4I A;  3QM2 A;  4LW2 A;  5EFS A;  3AEL A;  3G0T A;  3JTX A;  2BWO A;  1AHX A;  4MQP A;  3K40 A;  4Y0H A;  3BWO A;  2HOY A;  1AMR A;  3PDX A;  2X5D A;  4A0F A;  4ADB A;  4UHO A;  2GB3 A;  4M2K A;  1B5P A;  1O62 A;  1B8G A;  3PAA A;  3T32 A;  1CQ8 A;  1Y4I A;  3FCR A;  2W7H A;  2ZYJ A;  3B1D A;  4AO4 A;  3GZD C;  2HP1 A;  1BT4 A;  1CJ0 A;  2BYJ A;  1IX8 A;  2DKJ A;  4R5F A;  2QLR A;  3CBF A;  3K7Y A;  4IXZ A;  1CQ7 A;  3RI6 A;  4XAU A;  2VGV A;  3LY1 A;  1IUG A;  2D66 A;  3BV0 A;  1DJE A;  1CL1 A;  3WY7 A;  1B9I A;  3DZZ A;  1AAM A;  2NMP A;  2BI9 A;  4BQ0 A;  1G7X A;  1QJ5 A;  1W3U A;  2VGS A;  4K2B A;  4JF0 A;  1C7G A;  1ECX A;  2R5E A;  4MGR A;  5HDM A;  3H7F A;  1ORD A;  4GRX A;  1G4V A;  3HVY A;  4BA5 A;  3IF2 A;  2EZ1 A;  5D5S A;  3FRK A;  1IJI A;  2JGT A;  1C9C A;  4O6Z A;  4EB7 A;  1AIC A;  3M5U A;  3VK2 A;  1OXP A;  7AAT A;  1RV3 A;  3ZRQ A;  1KKP A;  1AAW A;  1W7M A;  2FNI A;  2VMX A;  4DBC A;  2OQX A;  1AHF A;  2VMP A;  2Z9V A;  3E2Y A;  4WYC A;  3E2Z A;  4U1T A;  1M32 A;  5FT5 A;  4KAM A;  1G4X A;  2TPL A;  3LVK A;  2VMO A;  2AEU A;  2AY8 A;  2C7T A;  1C7O A;  4ITX A;  1M0P A;  1TOG A;  4IY7 A;  4RM1 A;  2VMS A;  3ELE A;  2AY4 A;  3CQ4 A;  3TAT A;  2BWN A;  3TFT A;  4F5M A;  1UKJ A;  1GC2 A;  1QJ3 A;  1OXO A;  4IW7 A;  3NDN A;  3WZF A;  4Q6R A;  2C81 A;  4TMR A;  4GEB A;  1QIT A;  2D7Z A;  2QA3 A;  4XK1 A;  1TOI A;  3UE8 A;  3MBB A;  2BWP A;  2W8W A; 
#chains in the Genus database with same CATH topology
 1QGN A;  3A9X A;  3LV2 A;  3MC6 A;  3NUB A;  3DOD A;  3E2Z B;  1AKA A;  4A0R A;  4RLG A;  1TOK A;  4ATP A;  1PMO A;  3CQ5 A;  3ELP A;  2HOX A;  4LNJ A;  4XJM A;  2QB3 A;  1ASM A;  1O4S A;  2W7L A;  2W7M A;  1ELU A;  2YHK A;  4BMK A;  4F5G A;  5BJ4 A;  5HXX A;  1GD9 A;  1N8P A;  1XI9 A;  3PA9 A;  3QGU A;  4EU1 A;  2ZUK A;  4R8D A;  3MAD A;  4ZDO A;  1YJS A;  4DGT A;  4DQ6 A;  3RCH A;  1RV4 A;  3QBO A;  2C0R A;  4IXO A;  4ATQ A;  2W7K A;  3DXW A;  1DKA A;  2X5F A;  2PB0 A;  2Z67 A;  1V2F A;  2HZP A;  3L44 A;  4W1V A;  1CS1 A;  3GZD A;  1SZK A;  3AEN A;  2ZJG A;  1AHG A;  3L8A A;  2R2N A;  4E77 A;  3H9X A;  4PFF A;  2YRI A;  1SFF A;  1DTY A;  1D2F A;  2E7J A;  3FFR A;  1I48 A;  1WYT A;  3QPG A;  4ZAS A;  2EO5 A;  1GC4 A;  3HMU A;  4MSO A;  3FVU A;  4A6R A;  1GEW A;  2VMV A;  2QSR A;  3FQ7 A;  5EAA A;  4XJL A;  3VOM A;  1IBJ A;  2VLF A;  2VLH A;  4IXS A;  2CH1 A;  3FKD A;  1AY8 A;  4ZDP A;  5DJ9 A;  2AY6 A;  1YJY A;  2R0T A;  4GDY A;  2BIE A;  2HUI A;  1I41 A;  3NYS A;  4QGR A;  1OHV A;  3GR9 A;  4IYO A;  4UQV A;  3RCH B;  1AMS A;  2AY3 A;  5E3K A;  2VMT A;  3FDD A;  2OAT A;  2VMR A;  3AEO A;  1OAT A;  4W5K A;  1X0M A;  3AEN B;  5G2Q A;  3FVX A;  3JWB A;  4WD2 A;  4WYG A;  1CL2 A;  3E2F A;  3RUY A;  2DR1 A;  2R5C A;  1BJO A;  1D7R A;  3P1T A;  2VMN A;  3E6G A;  1X28 A;  1ASG A;  3AV7 A;  5EUN A;  3KKI A;  2W7I A;  4ZWM A;  1E5F A;  4JEZ A;  1SF2 A;  2PO3 A;  3WGC A;  3ACZ A;  1G7W A;  3JWA A;  4MKK A;  4MY5 A;  2D61 A;  4A0H A;  1S08 A;  3BC8 A;  1IAY A;  1BW0 A;  3F9T A;  4N0W A;  2GMU A;  3GJU A;  2EPJ A;  5EUD A;  5G0A A;  1TOE A;  2AY2 A;  3GZC A;  3G8M A;  3EI7 A;  3WKR A;  3EZ1 A;  3CAI A;  1AKB A;  4IYO B;  4F5I A;  4F5K A;  5AX8 A;  4FL0 A;  5TF5 A;  2ZY5 A;  2D5Y A;  1H1C A;  2FM1 A;  2JIS A;  3JW9 A;  1ARI A;  1VEF A;  4LW4 A;  1YIY A;  2YCT A;  1W7L A;  3A2B A;  1BJO B;  2ZY2 A;  1I43 A;  2ZP7 A;  4RIZ A;  3ASA A;  1ASF A;  4BA4 A;  1GC3 A;  4KYO A;  1C0N A;  1AMA A;  2WK9 A;  4L0O A;  5LH9 A;  4J8L A;  4RJ0 A;  1C4K A;  3AEP A;  1OHW A;  1YJZ A;  1YOO A;  4F4E A;  3HDO A;  4OCA A;  2DGK A;  4M2M A;  2ZSL A;  2ORD A;  4WXF A;  1AIB A;  3FZ6 A;  4P3M A;  4WB0 A;  2Z1Z A;  3NX3 A;  2DGL A;  8AAT A;  1ASL A;  2C44 A;  4RKC A;  2W8J A;  2CY8 A;  3FD0 A;  1B4X A;  1X2A A;  4ZDL A;  2YOB A;  4AH3 A;  3N4X A;  4E1O A;  1X29 A;  2G6W A;  3H14 A;  2WK7 A;  1LW5 A;  1O61 A;  2FYF A;  1ARH A;  3EIA A;  1IAX A;  3LG0 A;  2AY1 A;  3KGX A;  3R4T A;  5I92 A;  4GSA A;  2BHX A;  2YKU A;  4K2I A;  3AOV A;  4PIW A;  1D7S A;  1VJO A;  3EI6 A;  2OGA A;  4CXR A;  5EAV A;  1ZOB A;  2YRR A;  3PD6 A;  3RBF A;  3WKS A;  1ASA A;  3FSL A;  4A6T A;  4RKD A;  3N5M A;  2CTZ A;  1EQB A;  1EG5 A;  3MKJ A;  2VMQ A;  2VMU A;  3FTB A;  3EUC A;  4I8A A;  3AOW A;  1JS6 A;  4MQQ A;  4WB0 B;  5FT8 A;  2BI1 A;  4TN4 A;  4E3R A;  4K05 A;  2EZ2 A;  2YCP A;  3BCB A;  1M0N A;  3NU7 A;  4WYA A;  3GWP A;  1BS0 A;  2D65 A;  2JG2 A;  1LKC A;  3JZL A;  3VK4 A;  4AZK A;  3BS8 A;  1W7N A;  2W7F A;  5LHA A;  4W91 A;  3WLX A;  5K8B A;  2ZY3 A;  4JE5 A;  1FC4 A;  4OBU A;  4E3Q A;  3COG A;  1AJR A;  4WLJ A;  3LVM A;  3E9K A;  1QIS A;  3WGB A;  5E5I A;  4AOA A;  1E5E A;  1MDZ A;  2AY7 A;  1GCK A;  1AIA A;  1Z7D A;  2VI9 A;  3ZRR A;  2DOU A;  1IVR A;  3PD6 B;  2X3L A;  4PFN A;  3ATH A;  4ADE A;  1AY4 A;  1CZC A;  1SPA A;  1WKG A;  1M0Q A;  1S09 A;  3AAT A;  1D7V A;  3PIU A;  5F9S A;  2OKK A;  3UAK A;  4R5Z A;  4EFF A;  3EI8 A;  4ZM3 A;  2EH6 A;  3ISL A;  4FFC A;  2AY5 A;  1S06 A;  2OKJ A;  4UOY A;  4UHM A;  3UWC A;  1AKC A;  4OYT A;  4Q75 A;  3HLM A;  3OKS A;  2W8V A;  3JU7 A;  4GE4 A;  1DFO A;  1QIR A;  2FNU A;  2VIB A;  4ISY A;  4OT8 A;  4GE9 A;  4TV7 A;  1ASE A;  3PPL A;  4XEW A;  5G4J A;  4HVK A;  1KMK A;  5G2P A;  4WXB A;  5JAY A;  2QBT A;  5BJ3 A;  3USF A;  5DX5 A;  3II0 A;  1B9H A;  3B8X A;  2FN6 A;  3B46 A;  1XEY A;  3KE3 A;  4XJP A;  2O7C A;  1JF9 A;  3BCX A;  3P6K A;  5J8Q A;  3NNK A;  1TOJ A;  1ASB A;  2W7G A;  2HOZ A;  4PVF A;  4WXG A;  4ZM4 A;  4B98 A;  3FDB A;  2DGM A;  4J5U A;  2XBN A;  2YKX A;  3MEB A;  3TCM A;  2VI8 A;  1GDE A;  4A0G A;  3F0H A;  2JJH A;  1SVV A;  1TAR A;  3FZ8 A;  3FZ7 A;  4LNL A;  2GMS A;  2HUF A;  3NTJ A;  4WLH A;  2AAT A;  2HUU A;  2VMZ A;  3I16 A;  1M4N A;  2CJH A;  3CQ6 A;  2W7E A;  1ASN A;  3DR4 A;  1AX4 A;  1AHE A;  4JEW A;  1KKJ A;  3DXV A;  3N0L A;  2Z61 A;  9AAT A;  1WYT B;  1B5O A;  2BI3 A;  3AEM C;  1AHY A;  5G09 A;  5E4Z A;  4WBT A;  4RIT A;  1BJN A;  2Z20 A;  2DKB A;  2CST A;  1DGE A;  1PMM A;  1BJ4 A;  2XH1 A;  2AY9 A;  3HQT A;  2WKA A;  4ITG A;  1KMJ A;  2ZC0 A;  1OHY A;  4A00 A;  5EQC A;  5HHY A;  4CBR A;  2ZY4 A;  4U2H A;  3DU4 A;  4A6U A;  4OTL A;  5EIG A;  4OC9 A;  1RVY A;  3TQX A;  1GEY A;  4B9B A;  1J32 A;  4ZSW A;  4KXK A;  3LVL B;  4MQR A;  3G7Q A;  5FT4 A;  3VK3 A;  3RQ1 A;  1V2D A;  1S0A A;  2CFB A;  4OBV A;  2OGE A;  1JS3 A;  1LC7 A;  2VGW A;  2YKV A;  1MDO A;  5EUE A;  2HP2 A;  2HOR A;  3VP6 A;  5IWQ A;  2VGU A;  3VAX A;  3I5T A;  2R5C B;  4JE5 D;  3NYU A;  4UHN A;  4W1W A;  3EIB A;  2Z1Y A;  1CZE A;  3QHX A;  3PDB A;  2W7D A;  2W8T A;  4ZSY A;  3IHJ A;  4RAE A;  1VP4 A;  4H63 Q;  2GQN A;  3BWN C;  4EB5 A;  5M4D A;  3ZZJ A;  4F5J A;  2ZSM A;  4WYF A;  4ZAH A;  5D95 A;  1JG8 A;  2BIG A;  2KFP A;  1SZS A;  5F8V A;  3NU8 A;  2FQ6 A;  2QB2 A;  2Z9U A;  1T3I A;  4GE7 A;  4M2J A;  4MKJ A;  4A72 A;  1UU0 A;  1ELQ A;  5EIG B;  4OMA A;  1LW4 A;  4JEX A;  1V72 A;  2BYL A;  2JJE A;  1ARG A;  1WST A;  2CB1 A;  3W1H A;  2VMY A;  3ECD A;  4ZLV A;  1U08 A;  3DR7 A;  3FFH A;  4BHD A;  1LK9 A;  2E7U A;  1AY5 A;  3W1J A;  3B1E A;  1GEX A;  3ZZK A;  2PB2 A;  4WYE A;  1N2T A;  4K2M A;  2JJG A;  2Z9X A;  1RVU A;  2CJG A;  2AEV A;  3AEJ C;  3WX9 A;  2VIA A;  2BIA A;  2VGZ A;  1TAT A;  3PDB B;  3Q8N A;  4WYD A;  1BJW A;  2D63 A;  1PFF A;  2Z9W A;  2RFV A;  1ARS A;  1M6S A;  4Y0D A;  3R9A A;  1CQ6 A;  2BKW A;  4RJY A;  1YIZ A;  1MGV A;  2E54 A;  2GSA A;  1KL2 A;  3EI5 A;  2CIN A;  1DJ9 A;  2YKY A;  3A9Y A;  3TFU A;  1J04 A;  3I4J A;  3HT4 A;  1MDX A;  1LC8 A;  1ART A;  2JJF A;  3KGW A;  1GC0 A;  1AMQ A;  4XJO A;  1SZU A;  1TAS A;  4ADC A;  4AZJ A;  3EZS A;  1KL1 A;  4CVQ A;  2EGY A;  3GET A;  3E77 A;  3N4R A;  2YCN A;  3NYT A;  4XQ2 A;  1EJI A;  2VGT A;  2W8U A;  3DYD A;  4EMY A;  2D7Y A;  1O69 A;  2E7I A;  1QZ9 A;  1MLY A;  3RBL A;  1BQA A;  2O0R A;  1FG7 A;  4F5F A;  2EYQ A;  1Z3Z A;  1DJU A;  1D7U A;  3LVJ A;  4JEY A;  1UU2 A;  4CXQ A;  3AEM A;  4JEV A;  1BKG A;  3MAF A;  5M4B A;  5C6U A;  3OP7 A;  1LS3 A;  4LNM A;  1S07 A;  2VYC A;  1GBN A;  4W8I A;  3N4S A;  2Q7W A;  2F8J A;  4R2N A;  1AJS A;  3EI9 A;  4P7Y A;  4F5H A;  3A8U X;  1DGD A;  3A9Z A;  4LC3 A;  4W1X A;  1I29 A;  2CAN A;  2V1P A;  2QMA A;  2VMW A;  3WCN A;  3FQ8 A;  3ASB A;  1WYV A;  1V2E A;  1PG8 A;  5M49 A;  3W1I A;  4N0B A;  4JF1 A;  4Q31 A;  3ZRP A;  1UU1 A;  2CJD A;  3MAF B;  2BI2 A;  1C7N A;  5M46 A;  1M0O A;  1ZOD A;  3BWN A;  1P3W A;  3QI6 A;  4Q76 A;  1WYU A;  1LC5 A;  3DRD A;  3NRA A;  1N31 A;  2CH2 A;  5FT6 A;  2O1B A;  1WKH A;  3HBX A;  4NOG A;  4ADD A;  1AJS B;  4F5L A;  1W23 A;  1ASD A;  2WK8 A;  1MAP A;  3FQA A;  5DJ1 A;  4AO9 A;  3PGY A;  3QN6 A;  1KAF A;  1BQD A;  1MLZ A;  1IX7 A;  3B1C A;  3HL2 A;  1YAA A;  1H0C A;  4IX8 A;  3NUI A;  3GBX A;  3MAU A;  2W7J A;  1YNU A;  3DC1 A;  3BB8 A;  4H51 A;  2BI5 A;  2X8U A;  5DB5 A;  1WYV B;  1IX6 A;  3BCA A;  3F6T A;  1TPL A;  4CBS A;  2V0Y A;  3LWS A;  3D6K A;  1M7Y A;  2A1V A;  1MAQ A;  3AEJ A;  2D64 A;  3BN1 A;  3GSB A;  3PJ0 A;  4ZWV A;  3K28 A;  3MC6 C;  4HF8 A;  4Y0I A;  3WCO A;  1ZC9 A;  3FVS A;  4WP0 A;  3N7N A;  1WYU B;  2FKI A;  1FG3 A;  5KTB A;  3N75 A;  1ASC A;  5G4I A;  3QM2 A;  4LW2 A;  5EFS A;  3AEL A;  3G0T A;  3JTX A;  2G7J A;  2BWO A;  1AHX A;  4MQP A;  3K40 A;  4Y0H A;  3BWO A;  2HOY A;  1AMR A;  3PDX A;  2X5D A;  4A0F A;  4ADB A;  4UHO A;  2GB3 A;  4M2K A;  1B5P A;  1O62 A;  1B8G A;  3PAA A;  3T32 A;  1CQ8 A;  1Y4I A;  3FCR A;  2W7H A;  2ZYJ A;  3B1D A;  4AO4 A;  3GZD C;  2HP1 A;  1BT4 A;  1CJ0 A;  2BYJ A;  1IX8 A;  2DKJ A;  4R5F A;  2QLR A;  3CBF A;  3K7Y A;  4IXZ A;  1CQ7 A;  3RI6 A;  4XAU A;  2VGV A;  3LY1 A;  1IUG A;  2D66 A;  3BV0 A;  1DJE A;  1CL1 A;  3WY7 A;  1B9I A;  3DZZ A;  1AAM A;  2NMP A;  2BI9 A;  4BQ0 A;  1G7X A;  1QJ5 A;  1W3U A;  2VGS A;  4K2B A;  4JF0 A;  1C7G A;  1ECX A;  2R5E A;  4MGR A;  5HDM A;  3H7F A;  1ORD A;  4GRX A;  1G4V A;  3HVY A;  4BA5 A;  3IF2 A;  2EZ1 A;  5D5S A;  3FRK A;  1IJI A;  2JGT A;  1C9C A;  4O6Z A;  4EB7 A;  1AIC A;  3M5U A;  3VK2 A;  1OXP A;  7AAT A;  1RV3 A;  3ZRQ A;  1KKP A;  1AAW A;  1W7M A;  2FNI A;  2VMX A;  2WB6 A;  4DBC A;  2OQX A;  1AHF A;  2VMP A;  2Z9V A;  3E2Y A;  4WYC A;  3E2Z A;  4U1T A;  1M32 A;  5FT5 A;  4KAM A;  1G4X A;  2TPL A;  3LVK A;  2VMO A;  2AEU A;  2AY8 A;  2C7T A;  1C7O A;  4ITX A;  1M0P A;  1TOG A;  4IY7 A;  4RM1 A;  2VMS A;  3ELE A;  2AY4 A;  3CQ4 A;  3TAT A;  2BWN A;  3TFT A;  4F5M A;  1UKJ A;  1GC2 A;  1QJ3 A;  1OXO A;  4IW7 A;  3NDN A;  3WZF A;  4Q6R A;  2C81 A;  4TMR A;  4GEB A;  1QIT A;  2D7Z A;  2QA3 A;  4XK1 A;  1TOI A;  3UE8 A;  3MBB A;  2BWP A;  2W8W A; 
#chains in the Genus database with same CATH homology
 1QGN A;  3A9X A;  3LV2 A;  3MC6 A;  3NUB A;  3DOD A;  3E2Z B;  1AKA A;  4A0R A;  4RLG A;  1TOK A;  4ATP A;  1PMO A;  3CQ5 A;  3ELP A;  2HOX A;  4LNJ A;  4XJM A;  2QB3 A;  1ASM A;  1O4S A;  2W7L A;  2W7M A;  1ELU A;  2YHK A;  4BMK A;  4F5G A;  5BJ4 A;  5HXX A;  1GD9 A;  1N8P A;  1XI9 A;  3PA9 A;  3QGU A;  4EU1 A;  2ZUK A;  4R8D A;  3MAD A;  4ZDO A;  1YJS A;  4DGT A;  4DQ6 A;  3RCH A;  1RV4 A;  3QBO A;  2C0R A;  4IXO A;  4ATQ A;  2W7K A;  3DXW A;  1DKA A;  2X5F A;  2PB0 A;  2Z67 A;  1V2F A;  2HZP A;  3L44 A;  4W1V A;  1CS1 A;  3GZD A;  1SZK A;  3AEN A;  2ZJG A;  1AHG A;  3L8A A;  2R2N A;  4E77 A;  3H9X A;  4PFF A;  2YRI A;  1SFF A;  1DTY A;  1D2F A;  2E7J A;  3FFR A;  1I48 A;  1WYT A;  3QPG A;  4ZAS A;  2EO5 A;  1GC4 A;  3HMU A;  4MSO A;  3FVU A;  4A6R A;  1GEW A;  2VMV A;  2QSR A;  3FQ7 A;  5EAA A;  4XJL A;  3VOM A;  1IBJ A;  2VLF A;  2VLH A;  4IXS A;  2CH1 A;  3FKD A;  1AY8 A;  4ZDP A;  5DJ9 A;  2AY6 A;  1YJY A;  2R0T A;  4GDY A;  2BIE A;  2HUI A;  1I41 A;  3NYS A;  4QGR A;  1OHV A;  3GR9 A;  4IYO A;  4UQV A;  3RCH B;  1AMS A;  2AY3 A;  5E3K A;  2VMT A;  3FDD A;  2OAT A;  2VMR A;  3AEO A;  1OAT A;  4W5K A;  1X0M A;  3AEN B;  5G2Q A;  3FVX A;  3JWB A;  4WD2 A;  4WYG A;  1CL2 A;  3E2F A;  3RUY A;  2DR1 A;  2R5C A;  1BJO A;  1D7R A;  3P1T A;  2VMN A;  3E6G A;  1X28 A;  1ASG A;  3AV7 A;  5EUN A;  3KKI A;  2W7I A;  4ZWM A;  1E5F A;  4JEZ A;  1SF2 A;  2PO3 A;  3WGC A;  3ACZ A;  1G7W A;  3JWA A;  4MKK A;  4MY5 A;  2D61 A;  4A0H A;  1S08 A;  3BC8 A;  1IAY A;  1BW0 A;  3F9T A;  4N0W A;  2GMU A;  3GJU A;  2EPJ A;  5EUD A;  5G0A A;  1TOE A;  2AY2 A;  3GZC A;  3G8M A;  3EI7 A;  3WKR A;  3EZ1 A;  3CAI A;  1AKB A;  4IYO B;  4F5I A;  4F5K A;  5AX8 A;  4FL0 A;  5TF5 A;  2ZY5 A;  2D5Y A;  1H1C A;  2FM1 A;  2JIS A;  3JW9 A;  1ARI A;  1VEF A;  4LW4 A;  1YIY A;  2YCT A;  1W7L A;  3A2B A;  1BJO B;  2ZY2 A;  1I43 A;  2ZP7 A;  4RIZ A;  3ASA A;  1ASF A;  4BA4 A;  1GC3 A;  4KYO A;  1C0N A;  1AMA A;  2WK9 A;  4L0O A;  5LH9 A;  4J8L A;  4RJ0 A;  1C4K A;  3AEP A;  1OHW A;  1YJZ A;  1YOO A;  4F4E A;  3HDO A;  4OCA A;  2DGK A;  4M2M A;  2ZSL A;  2ORD A;  4WXF A;  1AIB A;  3FZ6 A;  4P3M A;  4WB0 A;  2Z1Z A;  3NX3 A;  2DGL A;  8AAT A;  1ASL A;  2C44 A;  4RKC A;  2W8J A;  2CY8 A;  3FD0 A;  1B4X A;  1X2A A;  4ZDL A;  2YOB A;  4AH3 A;  3N4X A;  4E1O A;  1X29 A;  2G6W A;  3H14 A;  2WK7 A;  1LW5 A;  1O61 A;  2FYF A;  1ARH A;  3EIA A;  1IAX A;  3LG0 A;  2AY1 A;  3KGX A;  3R4T A;  5I92 A;  4GSA A;  2BHX A;  2YKU A;  4K2I A;  3AOV A;  4PIW A;  1D7S A;  1VJO A;  3EI6 A;  2OGA A;  4CXR A;  5EAV A;  1ZOB A;  2YRR A;  3PD6 A;  3RBF A;  3WKS A;  1ASA A;  3FSL A;  4A6T A;  4RKD A;  3N5M A;  2CTZ A;  1EQB A;  1EG5 A;  3MKJ A;  2VMQ A;  2VMU A;  3FTB A;  3EUC A;  4I8A A;  3AOW A;  1JS6 A;  4MQQ A;  4WB0 B;  5FT8 A;  2BI1 A;  4TN4 A;  4E3R A;  4K05 A;  2EZ2 A;  2YCP A;  3BCB A;  1M0N A;  3NU7 A;  4WYA A;  3GWP A;  1BS0 A;  2D65 A;  2JG2 A;  1LKC A;  3JZL A;  3VK4 A;  4AZK A;  3BS8 A;  1W7N A;  2W7F A;  5LHA A;  4W91 A;  3WLX A;  5K8B A;  2ZY3 A;  4JE5 A;  1FC4 A;  4OBU A;  4E3Q A;  3COG A;  1AJR A;  4WLJ A;  3LVM A;  3E9K A;  1QIS A;  3WGB A;  5E5I A;  4AOA A;  1E5E A;  1MDZ A;  2AY7 A;  1GCK A;  1AIA A;  1Z7D A;  2VI9 A;  3ZRR A;  2DOU A;  1IVR A;  3PD6 B;  2X3L A;  4PFN A;  3ATH A;  4ADE A;  1AY4 A;  1CZC A;  1SPA A;  1WKG A;  1M0Q A;  1S09 A;  3AAT A;  1D7V A;  3PIU A;  5F9S A;  2OKK A;  3UAK A;  4R5Z A;  4EFF A;  3EI8 A;  4ZM3 A;  2EH6 A;  3ISL A;  4FFC A;  2AY5 A;  1S06 A;  2OKJ A;  4UOY A;  4UHM A;  3UWC A;  1AKC A;  4OYT A;  4Q75 A;  3HLM A;  3OKS A;  2W8V A;  3JU7 A;  4GE4 A;  1DFO A;  1QIR A;  2FNU A;  2VIB A;  4ISY A;  4OT8 A;  4GE9 A;  4TV7 A;  1ASE A;  3PPL A;  4XEW A;  5G4J A;  4HVK A;  1KMK A;  5G2P A;  4WXB A;  5JAY A;  2QBT A;  5BJ3 A;  3USF A;  5DX5 A;  3II0 A;  1B9H A;  3B8X A;  2FN6 A;  3B46 A;  1XEY A;  3KE3 A;  4XJP A;  2O7C A;  1JF9 A;  3BCX A;  3P6K A;  5J8Q A;  3NNK A;  1TOJ A;  1ASB A;  2W7G A;  2HOZ A;  4PVF A;  4WXG A;  4ZM4 A;  4B98 A;  3FDB A;  2DGM A;  4J5U A;  2XBN A;  2YKX A;  3MEB A;  3TCM A;  2VI8 A;  1GDE A;  4A0G A;  3F0H A;  2JJH A;  1SVV A;  1TAR A;  3FZ8 A;  3FZ7 A;  4LNL A;  2GMS A;  2HUF A;  3NTJ A;  4WLH A;  2AAT A;  2HUU A;  2VMZ A;  3I16 A;  1M4N A;  2CJH A;  3CQ6 A;  2W7E A;  1ASN A;  3DR4 A;  1AX4 A;  1AHE A;  4JEW A;  1KKJ A;  3DXV A;  3N0L A;  2Z61 A;  9AAT A;  1WYT B;  1B5O A;  2BI3 A;  3AEM C;  1AHY A;  5G09 A;  5E4Z A;  4WBT A;  4RIT A;  1BJN A;  2Z20 A;  2DKB A;  2CST A;  1DGE A;  1PMM A;  1BJ4 A;  2XH1 A;  2AY9 A;  3HQT A;  2WKA A;  4ITG A;  1KMJ A;  2ZC0 A;  1OHY A;  4A00 A;  5EQC A;  5HHY A;  4CBR A;  2ZY4 A;  4U2H A;  3DU4 A;  4A6U A;  4OTL A;  5EIG A;  4OC9 A;  1RVY A;  3TQX A;  1GEY A;  4B9B A;  1J32 A;  4ZSW A;  4KXK A;  3LVL B;  4MQR A;  3G7Q A;  5FT4 A;  3VK3 A;  3RQ1 A;  1V2D A;  1S0A A;  2CFB A;  4OBV A;  2OGE A;  1JS3 A;  1LC7 A;  2VGW A;  2YKV A;  1MDO A;  5EUE A;  2HP2 A;  2HOR A;  3VP6 A;  5IWQ A;  2VGU A;  3VAX A;  3I5T A;  2R5C B;  4JE5 D;  3NYU A;  4UHN A;  4W1W A;  3EIB A;  2Z1Y A;  1CZE A;  3QHX A;  3PDB A;  2W7D A;  2W8T A;  4ZSY A;  3IHJ A;  4RAE A;  1VP4 A;  4H63 Q;  2GQN A;  3BWN C;  4EB5 A;  5M4D A;  3ZZJ A;  4F5J A;  2ZSM A;  4WYF A;  4ZAH A;  5D95 A;  1JG8 A;  2BIG A;  2KFP A;  1SZS A;  5F8V A;  3NU8 A;  2FQ6 A;  2QB2 A;  2Z9U A;  1T3I A;  4GE7 A;  4M2J A;  4MKJ A;  4A72 A;  1UU0 A;  1ELQ A;  5EIG B;  4OMA A;  1LW4 A;  4JEX A;  1V72 A;  2BYL A;  2JJE A;  1ARG A;  1WST A;  2CB1 A;  3W1H A;  2VMY A;  3ECD A;  4ZLV A;  1U08 A;  3DR7 A;  3FFH A;  4BHD A;  1LK9 A;  2E7U A;  1AY5 A;  3W1J A;  3B1E A;  1GEX A;  3ZZK A;  2PB2 A;  4WYE A;  1N2T A;  4K2M A;  2JJG A;  2Z9X A;  1RVU A;  2CJG A;  2AEV A;  3AEJ C;  3WX9 A;  2VIA A;  2BIA A;  2VGZ A;  1TAT A;  3PDB B;  3Q8N A;  4WYD A;  1BJW A;  2D63 A;  1PFF A;  2Z9W A;  2RFV A;  1ARS A;  1M6S A;  4Y0D A;  3R9A A;  1CQ6 A;  2BKW A;  4RJY A;  1YIZ A;  1MGV A;  2E54 A;  2GSA A;  1KL2 A;  3EI5 A;  2CIN A;  1DJ9 A;  2YKY A;  3A9Y A;  3TFU A;  1J04 A;  3I4J A;  3HT4 A;  1MDX A;  1LC8 A;  1ART A;  2JJF A;  3KGW A;  1GC0 A;  1AMQ A;  4XJO A;  1SZU A;  1TAS A;  4ADC A;  4AZJ A;  3EZS A;  1KL1 A;  4CVQ A;  2EGY A;  3GET A;  3E77 A;  3N4R A;  2YCN A;  3NYT A;  4XQ2 A;  1EJI A;  2VGT A;  2W8U A;  3DYD A;  4EMY A;  2D7Y A;  1O69 A;  2E7I A;  1QZ9 A;  1MLY A;  3RBL A;  1BQA A;  2O0R A;  1FG7 A;  4F5F A;  2EYQ A;  1Z3Z A;  1DJU A;  1D7U A;  3LVJ A;  4JEY A;  1UU2 A;  4CXQ A;  3AEM A;  4JEV A;  1BKG A;  3MAF A;  5M4B A;  5C6U A;  3OP7 A;  1LS3 A;  4LNM A;  1S07 A;  2VYC A;  1GBN A;  4W8I A;  3N4S A;  2Q7W A;  2F8J A;  4R2N A;  1AJS A;  3EI9 A;  4P7Y A;  4F5H A;  3A8U X;  1DGD A;  3A9Z A;  4LC3 A;  4W1X A;  1I29 A;  2CAN A;  2V1P A;  2QMA A;  2VMW A;  3WCN A;  3FQ8 A;  3ASB A;  1WYV A;  1V2E A;  1PG8 A;  5M49 A;  3W1I A;  4N0B A;  4JF1 A;  4Q31 A;  3ZRP A;  1UU1 A;  2CJD A;  3MAF B;  2BI2 A;  1C7N A;  5M46 A;  1M0O A;  1ZOD A;  3BWN A;  1P3W A;  3QI6 A;  4Q76 A;  1WYU A;  1LC5 A;  3DRD A;  3NRA A;  1N31 A;  2CH2 A;  5FT6 A;  2O1B A;  1WKH A;  3HBX A;  4NOG A;  4ADD A;  1AJS B;  4F5L A;  1W23 A;  1ASD A;  2WK8 A;  1MAP A;  3FQA A;  5DJ1 A;  4AO9 A;  3PGY A;  3QN6 A;  1BQD A;  1MLZ A;  1IX7 A;  3B1C A;  3HL2 A;  1YAA A;  1H0C A;  4IX8 A;  3NUI A;  3GBX A;  3MAU A;  2W7J A;  1YNU A;  3DC1 A;  3BB8 A;  4H51 A;  2BI5 A;  2X8U A;  5DB5 A;  1WYV B;  1IX6 A;  3BCA A;  3F6T A;  1TPL A;  4CBS A;  2V0Y A;  3LWS A;  3D6K A;  1M7Y A;  2A1V A;  1MAQ A;  3AEJ A;  2D64 A;  3BN1 A;  3GSB A;  3PJ0 A;  4ZWV A;  3K28 A;  3MC6 C;  4HF8 A;  4Y0I A;  3WCO A;  1ZC9 A;  3FVS A;  4WP0 A;  3N7N A;  1WYU B;  2FKI A;  1FG3 A;  5KTB A;  3N75 A;  1ASC A;  5G4I A;  3QM2 A;  4LW2 A;  5EFS A;  3AEL A;  3G0T A;  3JTX A;  2G7J A;  2BWO A;  1AHX A;  4MQP A;  3K40 A;  4Y0H A;  3BWO A;  2HOY A;  1AMR A;  3PDX A;  2X5D A;  4A0F A;  4ADB A;  4UHO A;  2GB3 A;  4M2K A;  1B5P A;  1O62 A;  1B8G A;  3PAA A;  3T32 A;  1CQ8 A;  1Y4I A;  3FCR A;  2W7H A;  2ZYJ A;  3B1D A;  4AO4 A;  3GZD C;  2HP1 A;  1BT4 A;  1CJ0 A;  2BYJ A;  1IX8 A;  2DKJ A;  4R5F A;  2QLR A;  3CBF A;  3K7Y A;  4IXZ A;  1CQ7 A;  3RI6 A;  4XAU A;  2VGV A;  3LY1 A;  1IUG A;  2D66 A;  3BV0 A;  1DJE A;  1CL1 A;  3WY7 A;  1B9I A;  3DZZ A;  1AAM A;  2NMP A;  2BI9 A;  4BQ0 A;  1G7X A;  1QJ5 A;  1W3U A;  2VGS A;  4K2B A;  4JF0 A;  1C7G A;  1ECX A;  2R5E A;  4MGR A;  5HDM A;  3H7F A;  1ORD A;  4GRX A;  1G4V A;  3HVY A;  4BA5 A;  3IF2 A;  2EZ1 A;  5D5S A;  3FRK A;  1IJI A;  2JGT A;  1C9C A;  4O6Z A;  4EB7 A;  1AIC A;  3M5U A;  3VK2 A;  1OXP A;  7AAT A;  1RV3 A;  3ZRQ A;  1KKP A;  1AAW A;  1W7M A;  2FNI A;  2VMX A;  2WB6 A;  4DBC A;  2OQX A;  1AHF A;  2VMP A;  2Z9V A;  3E2Y A;  4WYC A;  3E2Z A;  4U1T A;  1M32 A;  5FT5 A;  4KAM A;  1G4X A;  2TPL A;  3LVK A;  2VMO A;  2AEU A;  2AY8 A;  2C7T A;  1C7O A;  4ITX A;  1M0P A;  1TOG A;  4IY7 A;  4RM1 A;  2VMS A;  3ELE A;  2AY4 A;  3CQ4 A;  3TAT A;  2BWN A;  3TFT A;  4F5M A;  1UKJ A;  1GC2 A;  1QJ3 A;  1OXO A;  4IW7 A;  3NDN A;  3WZF A;  4Q6R A;  2C81 A;  4TMR A;  4GEB A;  1QIT A;  2D7Z A;  2QA3 A;  4XK1 A;  1TOI A;  3UE8 A;  3MBB A;  2BWP A;  2W8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...