3CQ9A

Crystal structure of the lp_1622 protein from lactobacillus plantarum. northeast structural genomics consortium target lpr114
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
202
Chain Sequence
TIVNLLVGGPTANYPADLTTIPGPWVGADRGALRLVKRGIQPVMVVGDFTVKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGRLDHLLANMWLVLDPVFRQWAPQIKLIDKQNSVRFFLPGDYQITKEADKRYLAFVPLMPMHLTLPDEKYQLDAAYNAYPISWASNEFSGNTGHFSFDAGVLAVIQSRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein lp_1622
publication title Crystal structure of the lp_1622 protein from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Transferase
total genus 44
structure length 202
sequence length 211
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 3cq9A00
3LM8A 3IHKA 3CQ9A 2G9ZA 1IG0A 3K94A 2F17A 3MELA 2OMKA 3L8MA 1IG3A 2HH9A 3S4YA
chains in the Genus database with same CATH superfamily
5C53B 4JGBA 4CKEA 3F3MA 2CL0X 2D7JA 3BE8A 3OSUA 3ENZA 3T4EA 1K5PA 3BIOA 3BGSA 2WVAA 2EJTA 1SBTA 2R8BA 4HVAA 2DP4E 2WF7A 4BMPB 1NP7A 3SHVA 2EQBA 3QEAZ 5AJWA 4F72A 2VATA 1SU4A 3KKMA 3JXEA 3QE0A 4WNIA 5L7WA 4RX1A 3JZDA 3N2YA 1ETHA 4Q1CA 1N1MA 4UEKA 4F6LA 3ZDZB 1L5RA 3O38A 1WVGA 2ATEA 2FG6C 3CONA 3HXKA 4M9CA 2XLCA 3RWBA 2AZMA 3PRJA 1PYGA 1UK8A 4M4SA 5B1IA 4EPVA 5HJEA 4FC7A 2BGGA 4JL8A 5LA6F 4R5HA 4PE5B 1OFUA 3JQAB 3R24A 2RBKA 3ELUA 5FYDA 4IHQA 3LX6A 2ZJBA 5IHPA 1SR8A 4LJ7A 3IH5A 3SKVA 5B30A 5M7EA 3ETHA 4RADA 5EJ2A 1NW8A 2Y76A 3DZFA 3NBQA 5CA0A 3BTOA 2WHEA 2Q4TA 2Z4SA 3RIHA 2EKQA 2VZ0A 3PFFA 3OU6A 3W3AA 4MGYR 3P27A 2AFIE 1LVGA 4XVHA 1KERA 5IFKA 4REMA 4L6CA 4CLXA 2XWPA 1XTRA 3SXJA 3ZU2A 4RDCA 3WLJA 1H4VB 3PHHA 1P17A 4HX9A 4YYZA 5IXSA 1WV1A 3G0HA 4WKGA 2CEKA 3RRJA 4PYNA 4Q47A 4YLEA 5F4BA 5LBUA 2D00A 4HO1X 1CR1A 4Y6RA 5AQEA 3VKUA 1BDHA 5H5JA 2IODA 1SRRA 1FMCA 4HRXA 1I5OA 3JATB 1Y3CE 2X23A 3W7BA 1HXHA 1PYDA 1Y9ZA 2GCEA 3D3WA 5KHLB 2CJXA 3MLEA 2GJ8A 1PKXA 5FL7D 4DDTA 5CPBA 2OAQ1 1LLQA 4CM4A 4RHXA 2XAUA 3R9XA 4OIMA 4EJ2A 4B74A 4IFBA 3MMZA 1Y9DA 4LOLA 4MAFA 2B1RA 4FDVA 4KZPA 2XOXA 3DD1A 1KAHA 2AC4A 4FW9A 2RAVA 3K1AA 3N7AA 2QMEA 3ELWA 1CUBA 1SRQA 2G7ZA 2Q7DA 2QQEA 2Z5VA 3UG7A 4XPIA 5L3SA 3USZA 3V2HA 1EUCB 5U4XA 2HUPA 4JVOA 1S02A 3N39C 3VUFA 2RBGA 5M2QA 5BW8A 5JPIA 1CY7A 4U7GA 3AO0B 5IAEA 5DYYA 5DM60 5BNIA 2AOUA 4QFDA 1UINA 3PQ8A 4LJ6A 1IHXA 1KBOA 1ZGZA 3A4IA 1KY3A 2W2LA 4LOJA 1TK9A 5CIYA 1DAFA 3RUHA 4LBVA 3A9CA 3KQVA 3HY6A 1E3TA 2ZM6B 4BMCA 2C5SA 4OIFA 4ZYYA 1MF7A 4MAMA 2ZRDA 1BG6A 2GN0A 1ZJ4A 2Q2NA 1J42A 5DYIA 1DRUA 4YRLA 3WHKA 4DY4A 2W98A 3HJNA 2ORED 4ZJPA 2VNIA 5KAMA 2C7BA 4N18A 1QPGA 1II0A 3ZVNA 3DUFB 3OP1A 3SIRA 5LQMA 1S2DA 2CKMA 4R51A 3A6LA 2YXDA 4MUEA 5I7VA 1UXKA 5EJEA 1NN0A 3MK31 3KU1A 3VDXA 2OQIA 2FX3A 4G0OA 5BNZA 3TSOA 3NIGB 5TNXA 1FSFA 2OENG 4U5QA 3GCZA 2IVZA 3HCBA 3LIIA 1FTWA 3P5BA 2XB9A 3L0DA 1NG1A 4IH1A 4W8HA 4YC7A 4DCGA 3HTXA 4BNIA 1SHTX 3QUSA 4HH3C 4J16C 4BP1A 1DCTA 3NAMA 4WDRA 2OQRA 3ONDA 3VR3D 1T0PA 2C0CA 4PO9A 3HJHA 4G5HA 1PK9A 2JAWA 2KI5A 3R7BA 2PUDA 3WQRA 2GB4A 2OECA 1YFZA 3EDQA 5ENZA 5GJVC 3GXBA 3OT1A 1RRMA 2B8NA 3JVVA 2FSIA 2XZDA 3DT6A 1U5BA 3C24A 2CXQA 3PPWA 3RC3A 1WR8A 2DPMA 8ABPA 1JEOA 4WI1A 1RQRA 1FC0A 4YJHA 3MZ0A 1WX1A 1DTWA 2YS6A 5FAXA 2WTUA 2JAXA 1DADA 5GPBA 4R8MA 3P97A 1DEKA 2PUAA 1NI5A 5C0OE 4QULA 2ZR8A 3BG5A 3PF8A 5HS6A 3T9CA 5C7YA 4EQ6A 1JJ7A 2YZ2A 3DCNA 2DPGA 1V1MA 3FH0A 3NT2A 1D2MA 3TXAA 1K6EA 2ISCA 3I45A 3IT2A 5K4AA 3U3MA 1JDTA 1KBZA 2ZIEA 3HU3A 4GYWA 4PG6A 4WLNA 1N32B 1A8PA 2H07A 5DT2A 1ZH0A 3OM0A 5IH7A 4FCVA 4UU1A 2HN9A 1J9GA 3I2GA 3WDLA 5JIBA 4RVDA 1YUBA 5IVIA 3VAZA 4DQXA 1JJIA 3AHDA 4N47A 3VX4A 2I4OA 4WXEA 4C88A 2A0KA 4PQEA 4ETMA 1N6IA 3ECCA 4REQB 3B60A 4ISBA 1A71A 5EKXA 3S5JA 4XLLA 2YNMD 1LDYA 5K0TA 2NZJA 1DZIA 2HWXA 2UZ0A 4BLSA 2XITA 3B13B 1EGQA 4IVRA 5HKLA 2RH4A 5F7JA 3RRYA 4D5EA 1YRYE 1D4OA 4GI2A 3HJRA 1QC5B 3RS4A 4WAUA 3MT9A 4X24A 3TUIC 1V96A 1VHDA 2FOLA 2ZREA 1Z6ZA 2QR3A 3BSFA 5E6SA 1PSZA 3X1WA 2IZ6A 2RHRA 1JIJA 1HG1A 4K6OA 2GM9A 1OYYA 1JKJB 2YZGA 3OBBA 4JJ6A 5JALA 1ZM9A 3OH8A 3NJ8A 5KCMA 5JH7F 2A8YA 4DG9A 2L19A 3BB3A 4F45A 2RCNA 4GQIA 1N0UA 2WK1A 3D54D 4A2CA 1NX9A 2HNAA 2Q07A 1OHHA 5F78A 1ONNA 5DHTA 3G2MA 3CNOA 1CSEE 1DBWA 3MCUA 4E0BA 1VGQA 1NPTO 3N86A 4MGHA 1RKUA 3EEYA 1UBKS 4WN3A 3QLTA 1VG9B 4G63A 1A9RA 1Z56C 1QIFA 4P7JA 1ELOA 4JA2A 4LRSB 4B6EA 1RXVA 4WZZA 4R68A 4U9HS 3UPDA 4LDQA 2ZIGA 4RZUA 1ADGA 1VLMA 5FUMA 2HO5A 4F21A 3KQQA 1J2RA 4OJNA 1L2TA 3L1JA 1DBVO 4PIMA 4AG5A 5B1YA 2DBRA 5IPFA 4GEGA 5IKXA 4G2NA 1T8PA 3IDFA 4N7JA 3E05A 3C3MA 4HH0A 3E0XA 4Q4AA 1IXRC 1J9ZA 2XNHA 1T36A 2AYZA 3L40A 4LXTA 3EF3A 1NKSA 3U7EB 4AJKA 1W8DA 1TA0A 1UK9A 1WCWA 3DVLA 4G2TA 2I8LA 3OP4A 1LPOA 3A1CA 3PC8A 3VHQA 3DMFA 3T5TA 1VHTA 1N9GA 4IH4A 3OTQA 2XRFA 1JLHA 1KY5A 3EXAA 3LTEA 4XM2A 4KQ1A 3T3EA 1G5FA 1GR0A 2X14A 5EP4A 5KKNB 2QLNA 3O4RA 2OK7A 3VMMA 4FHFA 2BW0A 2R4QA 4I9NA 4S1NA 4WLVA 4X1YA 5F64A 4D9FA 4TTSA 2IHTA 2COKA 3KFLA 4HGOA 1WKVA 3TFWA 4RETA 4BP3A 1UKVY 5L3QB 4KUHA 1W36C 4S1TA 2MT9A 3GIWA 3MCZA 4J9VA 3CX3A 4OAQA 5HM6A 4JMPA 2JCXA 3WWDA 2FSFA 4O63O 4I08A 1X1SA 3F6YA 5ALXA 3OETA 4TYMA 2C78A 3A4TA 4PTYA 1H0SA 2K7FA 2ZJ0A 5EIWA 1GKUB 3IKTA 4DILA 3KWLA 3CZPA 1FFXA 1QVVA 4BFTA 1ORVA 1GKKA 3NX4A 4G1BA 2WTEA 4M1YA 4TT8A 1J8QA 1F48A 4W5JA 3RFTA 5BVHB 5L45A 4TLAA 2Q6LA 1ILEA 3MMPA 2B8EA 2J5RA 1DKMA 4XUGB 4CDRA 5KOHB 5IWAB 3ZWVA 4Z3OA 4NWIA 1PP4A 2D54A 4DEXA 2GRAA 3VR4H 1GNQA 2YY5A 2HGSA 3K73O 1ZA1A 4FCCA 4K87A 1AQYA 4WKCA 4IUDS 2V3VA 4I3GA 4DMUB 5AQ1A 4NMMA 1SD5A 2PUFA 1CFZA 3TRFA 2Y05A 4G0MA 4JLMA 5LDDC 3ZDAA 3OY2A 1U4NA 3WGKA 1UKAA 5KU1A 2P9TA 2QUZA 3B6MA 1DHTA 4MQ5A 4G4JA 4QL3A 1RNLA 3FXAA 4L0DA 4S1VA 2FPGA 3ZHUA 4DCJA 5KSOA 3LECA 4XSVA 1R9GA 1XAIA 2K6GA 1H6AA 3PIIA 5DXAA 3TCXB 2HQOA 3BMXA 5ES3A 5FUQA 5TB5A 1DFGA 3RAEC 4X90A 4A2WA 2GEBA 3HNRA 3R23A 1LJUA 4AU1A 1FW6A 1B8NA 1JZTA 2H5IA 2XMGA 2W2TA 3ZW8A 2RC6A 3NANA 2CWDA 1F4LA 4NE2A 4YASA 4Z9YA 1KZYC 2E4XA 4TRJA 3O3OB 3S4YA 2R1VA 4GSKA 2B83A 5HK8A 4JJZA 1RAGA 2V4ZA 2YJ5A 5ELLA 3ZNPA 3EZ9A 4UD2A 4PG8A 4B71A 2SKEA 2CNDA 4LI0A 4YBZA 3D0RA 2Q21A 3BMOA 4MUHA 2W2KA 3HE3A 5K0NA 3FPLA 3MLBA 3PUYA 4I7EA 3THYA 2X4GA 2ZUVA 4AROA 2OY0A 5DNEA 2HV9A 4E15A 1XALA 2IYVA 4RYDA 1ORIA 3TZKA 5E6RB 3QW4B 3G02A 3BL6A 4PONA 4DLAA 2WTMA 2EGGA 3PHBE 5GINE 1LBQA 2WG0A 1QDUA 4J3FA 1E99A 2JGRA 3GEHA 5DBFA 4GT1A 1NRJB 4MINA 1XYVA 4L8YA 1JDBB 3DP9A 1ZM7A 4Z2AA 1JXQA 3RJ9A 3TIXB 3TE6A 3UAXA 2I3AA 5MFPA 2H4ZA 5EMNA 4CEJB 1ZYUA 3MW8A 2VDPB 3P7MA 3UH1A 5DN6D 3QFRA 3GHHA 2XVAA 3LFHA 4IS3A 1IWBB 1OAOA 4YV0A 3LBNA 4KHZA 4F60A 2RONA 1L6RA 5JS6A 3DXFA 3OHPA 2P6RA 2GPWA 2NUTA 4QX6A 1F06A 1Q1EA 4X6XA 3CURA 2FRDC 2WMYA 3QU4A 1T9KA 4WCFC 3W9SA 4YT4A 1FZQA 2R751 4W8OA 1Q92A 1LJLA 2CFTA 5CM2Z 4D97A 1HYHA 2C5AA 3LCJA 1HQDA 2E85A 8OHMA 2QJRA 2YKGA 2OC9A 2J0SA 3I9OA 1PJ8A 2MSEB 1OMOA 4Q15A 2AFIA 4BVGA 2G09A 5TGDA 4BOYA 1GQOA 1Q3KA 2DLNA 2PKYX 3RDPA 4LF8B 3BILA 2C82A 2DFKB 4HJRA 1VM6A 1DL5A 3NHWA 3NVAA 4WOPA 1ECJA 1NC1A 2XADA 1OD6A 2JIPA 2QLTA 1NFRA 2MSDB 3HZOA 4MRNA 4BNKA 1NQAO 1QE5A 4AICA 2FCAA 1TA9A 2FSHA 4R2MA 1MA0A 1THGA 2QRHA 4LYHA 4YH1A 5I9MA 1P29A 1FSSA 2Y1EA 4GAEA 2JD1A 2JLAA 3KOOA 1YS2X 3VU8A 5I3CA 1JLSA 4ZT7A 2GDZA 2RSLA 4DIDA 3X44A 3LLVA 4OXNA 1E98A 2GERA 3BFVA 4Q7MB 4WY5A 3MHPA 4JI3B 1G8GA 3LQKA 1VG1A 3AR2A 3WGHA 3QTLA 4UBOA 1LSUA 1K68A 3UA4A 3HACA 2Q62A 1L7QA 4GP9A 1U7WA 4FYXA 4PAMA 2B34A 3BD7A 3GQVA 1N4AA 4O4LA 1UJ6A 4HAUA 3FMGA 1W30A 1ZCAA 4LRTB 2O8CB 3L0OA 1VP3A 4E22A 2C9MA 7GPBA 1RXCA 4V2IA 2H59A 4BE7B 5IMSA 3MD9A 4K3UA 3KG2A 3H5LA 1H1TA 3IHWA 4KYVA 4LY9A 2CJWB 1A77A 2YHAA 5EAIA 2JGKA 4GF5A 4CM9A 1Q6YA 4LJ9A 3GGOA 2HNBA 4DR2B 1PKEA 1XEWX 3FZYA 5COBA 2WKRA 5CYPA 4LA4A 3KYDA 2H9IA 2NU7A 1JHDA 2C3MA 1NV8A 1UJ2A 1ZFNA 3OF2A 3ZGOA 3LYAA 3MJFA 1SUFA 3QGMA 1ZGAA 2VJYA 3EEFA 3PSHA 4AKHA 1TIKA 4EGJA 1MT3A 1W1IA 1J20A 2R1TB 1TMOA 4LXYA 2FUCA 1P6UA 4GPIB 2Y1WA 1PFWA 4H1UA 2NX2A 4JEMA 1P5ZB 4LG1A 4ZHSA 1XEAA 3C5HA 4MJ3A 5ENVA 1NOKA 5B58T 5C4MA 1JR2A 1U28A 4L6IA 5E9AA 4OHXA 4YR7A 3IOEA 2P8JA 3SI7A 5M34A 2QJFA 4TT3D 4BRWA 4JLNA 2PMKA 1J6UA 4RK7A 1Y4UA 1GEGA 3KKNA 3NBFA 4GHWA 1CY6A 1E6KA 3ETLA 3K2EA 3GLGB 3H11A 1FTNA 3GUVA 3PNYA 2OPBA 1IE3A 2KPOA 3PUVA 3B2EA 3OWXA 1O96B 4Y2GA 2QMQA 2I67A 2IBTA 4MGIR 1F0PA 2ZYRA 1EDEA 3TOSA 1FX0A 1Y6FA 4B4UA 2I22A 4H6PA 4D43A 4BMOB 2JJ1D 3I28A 3HXQA 3LUGA 4MS1B 2CNOA 4JQYA 1TZJA 1TF7A 2P6MA 4D0NA 2ASVA 4LGMA 3DEHA 3BWCA 1MC1A 2NZXA 2X15A 3HL0A 4G1VA 1G8KA 1NONA 1THMA 1GRNA 2IWHA 2QBYB 3ZWQA 4MZDA 4PLFA 1ZD1A 4HVTA 3RVQA 4BO9A 3AHEA 4MYTA 4URFA 3OJCA 4F2PA 4NENB 4J1TA 2B30A 1RXEA 4S1WA 3UJ6A 1BDBA 2OK8A 3FF4A 3G0IA 4FR5A 2WWYA 4CCYA 1JU3A 1ZM3A 5ALJA 3QE2A 3PZBA 1E6UA 1ULSA 1IY9A 2OA0A 3TDKA 3WLKX 1UF9A 1XD2B 5JYDA 2AJLI 5H3HA 2B7BA 1II9A 1OASA 2F67A 2KM1A 1VPTA 4BNNA 1A9XB 4IWYA 4DM4A 4DJDC 3NDBB 1VKRA 5ALHA 3VNVA 4GOLD 2MINA 1PG0A 3PIRA 1Z18A 2O3TA 4J07A 3I0NA 1BMQA 4TV9F 1AMNA 5DM2A 1PD1A 2AFHA 3WKAA 5IKEA 2PJZA 2SECE 1QK3A 1E20A 4Z7OB 1D8TA 1Y7TA 4KR0A 5ICSA 4LVOA 5CR9A 5JZSA 5EZ5A 4F5DA 1YL7A 5A5EA 2YDYA 3BRSA 4AF8A 1ZMXA 2OL4A 5HZMA 1J8YF 4MPDA 3ESDA 3A2LA 3TVTA 2PLWA 2PGNA 4I55A 1IHOA 2R7MA 3GAFA 4WGFA 4DS3A 1CVLA 1XGKA 3RIXA 5I9BA 3R7AA 2H2HA 2IPNA 1LPBB 5COAA 5ALRA 3ZU3A 4PRYA 3TIFA 1BXRB 3N70A 2PPLA 4WNCA 1EFLA 3KEOA 2CLOB 3QFTA 3DTNA 4TV9B 1H0KA 4Y9SA 1VSBA 3ZHSA 1QONA 4KJZA 1MNAA 1WU7A 2VJDA 3GRUA 4XIGS 5AVJA 4F4DA 3OAAA 2WPDA 3FRJA 4FXOA 4AXXA 1ULBA 1XDZA 1NFQA 4UXIA 2AW3A 3Q6NA 5KWVA 2X6RA 5KSZA 2EC5A 4A03A 3AW9A 2WJHA 1XVVA 1SM4A 5CNKA 1GQ2A 5DTJA 4CLHA 4DMFA 3DBLA 3EE6A 3N0WA 1IMOA 1GAQA 1A7AA 3DZ8A 1SBCA 2BGJA 2CXHA 1UAYA 3CPEA 3CWZA 3IP9A 4WJZA 2EHJA 3PNKA 3QMPA 5FFNA 1W46A 3PB3A 2OKCA 4IUBS 5FOSA 1K3TA 2OV8A 4X3CA 3LKVA 3R7DA 1N7JA 5LQUA 3NDJA 5FCDA 5EJ9A 2IIQA 3LDHA 3R8FA 3FGOA 4K6MA 3U7JA 2J30A 2Y0CA 5EE5B 5F3RA 2PTHA 4LF6B 4ZZ1A 4Q5IA 3EZXA 1RRGA 3TLYA 3VC1A 4YS6A 3WQBA 2R4TA 4QGFA 1QF9A 4L9WA 2VQEB 3V7FA 3I2YX 4PXSA 1G4AE 3HYNA 3FPCA 1SHUX 1DI0A 3LZCA 4WBSA 5CIQA 4ZGGA 2XNJA 4NCIA 5JBQA 3U5ZB 1J49A 3K2QA 4Z9BA 1RCUA 3W5VA 4F38A 5LWHA 2PLRA 1T4CB 3EDMA 1U65A 3AUJB 2P30A 4ODIA 2ZI7A 2JJMA 6AT1A 1FOEB 1ESDA 1YZLA 2YFYA 3GNQA 3FTCA 4DCNA 1NBHA 2QZJA 1XAGA 2JLBA 3DW3X 3P19A 1L5QA 3N7TA 4RNCA 2JI6A 5KDLA 2X9NA 1CY4A 1PJQA 3DHWC 4F2WA 5B12A 4U02A 1CULC 1SXJE 3WNDA 1M7HA 1P7PA 3AFMA 5T4HA 3PXDA 5D85A 1N0HA 1MHPA 4EHNA 2ZRKA 4PTLA 2B1GA 4RXMA 2VIIA 4CT4B 1HT3A 5CP8A 1JU4A 4EGSA 3O8LA 2MCFA 2NM0A 3NETA 1GNLA 1JWAB 1KI6B 4FYYA 3ZCPA 1KY2A 2W43A 1AMOA 3B78A 3OMLA 1QP4A 2DRIA 3BJEA 4L08A 1CRWG 3ZDDA 3OZ7A 3U1TA 3CZ4A 4W7HA 2ZE8A 4RDIA 3Q7EA 3OJOA 4MKZA 3BWVA 2H2FA 5HJ5A 1Y82A 1BN7A 2JEYA 3IP3A 3ZCXA 3VBEA 2O14A 4KO1S 1G2OA 1NBMD 4AWXA 2GPNA 2PA0A 4KE9A 4YRJA 4A6EA 5JV5A 2FUKA 2NV2B 5BSWA 3S2FA 3O8QB 1SU7A 5DNVA 4F1JA 3SZGA 1U0SY 4ISCA 2AT1A 3AEXA 4OK6A 2BH9A 4JL5A 2VJLA 4Q02A 2H0QA 1YQXA 2NO4A 1DBRA 1OFTA 3WHIA 1D6JA 1XQ9A 5FWXA 2OBLA 1BCSB 4IW3B 3G23A 3L46A 2FGKA 2WAXA 1JDPA 3ESYA 2FE4A 5H8WA 1UM8A 2JGMA 2XEDA 3EWSA 3ZGLA 3GLIB 1WNTA 2ORIA 5BMVA 1M2OB 4QWWA 1CE8A 3Q40A 2ZUDA 4BNHA 1QMGA 1L7EA 4MHOA 3UXYA 1I4EB 3H8SA 1NUHA 1AK1A 1TU0A 2NT3A 2OGWA 2OHVA 4GWLA 4MZXA 4ZVRA 1A95A 3O9ZA 4G9BA 4TZKA 1GZSA 2CBGA 2NZ2A 2ODEA 3KYBA 3PDUA 3PNLA 1LRKA 4XD7A 1AVTA 1PFGA 1DX4A 3SS8A 4BB0A 1B8PA 5K3FB 4OQDA 3C3BA 3LO8A 5BUZA 3O5AA 2C8LA 1QXSA 2G28A 3OQIB 2A33A 3KT6A 2CFCA 2WKQA 1J90A 3DMYA 4FFOA 4HZGA 5CTJA 5TARA 1KQNA 2QTLA 1M1YB 3URKA 1Z33A 2GLXA 3RIMA 2AEFA 4U6NA 4AO8A 2BJWA 1JDZA 2OHFA 1HQCA 4LV6A 4N4AA 3RS5A 2ZUEA 2CDCA 5AXCA 3PX2A 3VPFA 3JRXA 4LHXA 3U09A 1CDEA 3JQ8B 16PKA 2C4VA 2Q4DA 2WP8J 2O8BA 3GZJA 1IPHA 2GN4A 2J9XB 3CEJA 4Y2UA 1SZCA 1DKOA 1XO1A 1FVFA 2HRBA 2OXFA 3EJ6A 3B52X 3L1KA 3OHSX 3U4GA 4GC9A 2PS3A 3VR5D 1FUEA 5I8ZA 1V37A 3EVFA 3EVEA 2PEZA 3INNA 1SCBA 2MYPA 1M2WA 4LF9B 5AK3A 3SNHA 3L93A 2PSFA 2D5AA 2I3ZA 1Y1QA 2W58A 2VZ9A 3NHFA 4JH0A 4RVNA 3D3EA 3NKFA 4RTSA 2C5HA 2K87A 4E11A 3AEUA 2XBLA 3AL3A 5DU2A 2XTAA 3G9UA 1J9EA 2VZEA 4FB4A 4Q82A 3TJZA 5JD6A 1M73E 4MTCA 1RWBA 4MP8A 2ZXUA 5TQ0A 3EXHB 3COYA 1GTJ1 1GA1A 1Q57A 1SEVA 1U99A 2ICAA 4I1RA 3OA0A 4QNNA 5F1PA 3U37A 4MWTA 3FTNA 3F6SA 5CDFA 3ZGYA 5DBIA 1XEFA 4EAQA 4OO3A 4X9XA 4G0NA 5IKMA 2D1RA 4ZZ2A 3WLEA 3KAKA 4UFOA 1XZHA 1G66A 2NW6A 3L0SA 4JBNA 4O02B 4YCSA 3T8YA 4J7CA 4RQBA 1QRUA 4L8FA 1XX6A 1OZGA 1ENZA 1KZ6A 1R4NA 4MW2A 5EUBA 1DKPA 1JFSA 3AFIA 1HFEL 3P96A 2HOQA 4UPDA 2AUNA 1BHO1 3V33A 3KSRA 5BWBA 3B5JA 3EGDA 5B1SA 1ULAA 1KJIA 4BMNA 4BNDB 4NARA 4C7VA 4LRYA 2CHGA 4R01A 2SKDA 3MMNA 1KP3A 1NVBA 5L3ZA 4NAUA 3GUUA 4M7WA 2IDJA 4XWAA 5FL7A 2R44A 1OW3B 4ZT2A 1EEHA 2OB2A 1WMDA 4M60A 5JI2E 4P81A 5HEKA 3S7ZA 4V1CA 1HT0A 3PFWO 3RYFA 3NU1A 4YUXA 5ALVA 2H52A 2JGIA 2PGDA 4I6JA 2PUBA 2VWQA 3QI2A 2OYRA 2GM4A 4IM7A 1PFVA 4J0QA 2HW8A 2BC9A 1UQUA 3N75A 4ZOLA 3ZWBA 4EX6A 4IXDA 3VJKA 1JQ5A 3GLUA 4ECEA 1G5PA 2H1VA 2X3YA 4L6AA 4EJMA 3M9WA 4PNEA 4MUXA 4NYJQ 3AG6A 3UNXA 4KAAA 1GAEO 1ZHFA 3LPCA 4OXKA 4RH0A 3TNDA 1FFGA 5LBIA 5IARA 1HBJA 1CEQA 4NJMA 1K3UB 2IPMA 3LDGA 3NHLA 4XYBA 1Q44A 3CINA 3LFTA 3LZ6A 1X7ZB 3AJEA 2J0QA 3MCTA 4QSMA 1PWZA 1LLCA 1YB6A 2QIOA 2FMUA 3CNLA 3GZNB 3QBEA 5EYPA 1IN4A 4J03A 3OLYA 4EELA 1AOXA 1XKXA 5D3MA 2V3WA 1P5JA 3UQZA 3WWPA 1W2WB 3G59A 4FUQA 4JMLA 4ZZ3A 3ITEA 1ZEJA 2P3QA 1TRKA 2ZXFA 3M5DA 5KVAA 4XWWA 1MZPA 3EMBA 4KRYA 4JI2B 4EI7A 3AI3A 2XCUA 3H04A 1BQ4A 3AYXB 4R2IA 3UK7A 4JBHA 4UVIA 2D5LA 4D4MA 3W1WA 1NVWQ 4O0LA 2QRQA 3BF7A 3ZW7A 4ZXPA 2FFQA 2IH2A 3FB4A 1G3RA 5FQNA 4FMPA 5DOVA 3T3HA 4RGYA 1XZAA 2F3PA 3MTEA 1RE1A 2C1ZA 4IJ6A 5JT1A 2HIGA 4NLLA 4KDCA 3S27A 3KKZA 3SE7A 3U3XA 4L4YA 2HDHA 1GTSA 3HKBB 1OU4A 2IQ5A 3ZI7A 1V3QE 4HXEB 4EA7A 1BSVA 1CZOA 2QRLA 2BKVA 2IUYA 1GNTA 4M87A 4RFSA 4ZAZA 5HJ2A 5IAJA 3TAUA 3VR3A 4MVXA 4DADA 2G7MC 1U1DA 3CKYA 3VTKA 1E1NA 5A0TA 1RHKA 3OCYA 4EF6A 4EY6A 4B0PA 2WZQA 3MPOA 4E21A 3DBIA 2QHXA 4DCMA 2BGIA 3ILXA 4ES6A 1W44A 1WCIA 2ZIAA 3TG2A 3LUFA 3RVBA 2DPLA 2O5RA 3H42B 1X70A 1GFSA 4E08A 4OGFA 3M7IA 2I2CA 4P3XA 2FW0A 3VVLA 4MR8B 2FAXA 4LCJA 2V6BA 2A59A 1JQBA 2Q1TA 1J0BA 2D0IA 1YZNA 3GLHA 3KEGA 4C4XA 3NP7A 4NG5A 1T4GA 2JI7A 2B7LA 5KJ6A 2VK1A 5CVTA 5CGQB 3G2IA 3B2NA 3W9YA 1USIA 2J46A 3KPJA 3FR7A 2FR1A 2FFAA 3H87A 4YAEA 5B3JA 4M89A 2Z3VA 3GCWA 1EBFA 4WOBA 2O59A 4K0RA 3CE6A 1O95C 4YCBA 5IKOA 1EB8A 1PNTA 1V8ZA 5JE8A 1U2GC 3RWMB 3SZOA 2A9OA 4DJFC 4XX0A 2YZ7A 4QGSA 3K7EA 4GPTA 3FHCB 1JJFA 4CVNA 2QTCA 1M2HA 2WYIA 1N5KA 1EWRA 2CBXA 4HLCA 4ZVNA 4O2BA 3WB1A 4CEHB 4YAUA 4C2UA 4NCJA 4NNJA 1SU6A 4B82A 1K0UA 3N3AC 4XOUA 3UCFA 3I1JA 1TRHA 5CK5A 1I4WA 1MCZA 1QS0B 4XYGA 3COZA 5AK4A 4QOJA 3WLTA 1W36B 2WUFA 1EFKA 1PD0A 1GDHA 2QZ9A 3PI6A 1T8WA 1SBNE 3BB4A 1NVDA 4NRDA 1MGOA 2AXQA 4IO0A 4MVCA 2QXTA 1JHXA 1HSZA 2OZKA 3H65A 4NC9A 5AVZA 2JA1A 3OPNA 5AOAA 1E8NA 3LF2A 3RS8A 4R0MA 1VKHA 3SVTA 3TLGB 4G86A 4IIEA 4BAZA 4CLEA 2JI9A 3F4LA 3W34A 4HV4A 5JZBA 3KDAA 2JFHA 5KSPA 4YJ2F 2W6QA 1L3CA 4BO4A 2H16A 4J0EA 1CUUA 2GAJA 1KDZA 1EMDA 2WKSA 3STHA 4RZSA 4BVBA 2VNJA 1NP3A 1TVKA 4OA5A 1ZXBA 4GR9A 1UBUS 2C0PA 2MSKA 5BSGA 3WB2A 4WFJA 5HBGA 4DQKA 4MCHA 4C5BA 4B6OA 4UXHA 4HDRB 4EMTA 1NUUA 1SNYA 3NM5A 5SICE 4RWEA 3CVVA 1KKMA 3I2IA 1CS4C 4G0YA 5ALWA 1NJ8A 1ETUA 3N8NA 3ND5A 5EIEA 4M21A 2PGAA 4J1SA 3KZVA 3SS9X 5EIBC 2PT9A 2ZU0C 3ETNA 4D41A 1CQJA 2PJDA 4AULA 5GJBA 2OVBA 1J5XA 3IC5A 1SXJA 2A5JA 3QKWA 4PGMA 3CNHA 4HPWA 3LI2A 3RRXA 4DSZA 3CC8A 1B42A 2VAPA 3EOAI 2HK6A 2UYGA 2PBFA 1CDOA 3DA8A 4TLBA 1V6CA 4YJ2B 1SVSA 2IZ7A 1YMUA 4Y2RA 4D44A 4RS4A 2D8AA 1XRLA 2O8NA 1V8FA 3EZLA 1ZD8A 3FOWA 4LXGA 4DM3A 3CU5A 7MHTA 3D6HA 1TQDA 4RZXA 1MFPA 3RUIA 2R6ZA 1R6UA 1W75A 4R8RA 3WWEA 8ADHA 3SAJA 1OA1A 4HGRA 1GTVA 1B8OA 4EFLA 2FN7A 1A2BA 3R7LA 5BWOA 1AKEA 3QPAA 2AKAB 3BPSA 3DZIA 4R31A 3QSGA 5T8KA 1ZESA 3N07A 4NEGA 2YHIB 5B2EA 1ZBQA 2WMDA 3P2OA 1ZJ6A 1Q84A 1SKYE 3B1YA 1U7XA 4YPFA 4V03A 3EPHA 2PANA 3KBBA 4BNXA 5BSTA 3STXA 2DX7A 2ECQA 3N9IA 2Q0QA 5DCWA 1ZXXA 3TX6A 1OJ7A 2P9FA 1RRFA 1OY1A 1ZBDA 4Q16A 5J1TB 5KS2A 1D1TA 4AZ3B 4JXZA 2HPHA 4RVCA 5DX1A 3ICPA 4RF2A 4AJ1A 4PQRA 2HRQA 4EJSA 1E0KA 4CEIB 2IP4A 4TL6A 3K72B 3I01M 2RGRA 1SKMA 3RAPR 4ZIRA 1REQB 1PQPA 4ICIA 2XI4A 3LGAA 5FUVA 3CPJB 1BN6A 1R6DA 3O3MB 3V8BA 1Y42X 1R0KA 2QAGB 3IQIX 3KPUA 3PLRA 4FZJA 3FZEA 1T2UA 2QIPA 1QE3A 2ZKLA 4O33A 5GOTA 5TGZA 4NYJR 4AKEA 3ZYZA 5B5SA 1JLMA 3W0LB 3SC2A 3I6IA 4BX3A 1YKSA 4JJ8A 4BO8A 4HKTA 1Z73A 3R9KA 5E0OA 1E2JA 3N58A 4HMQA 2ZB8A 3LVFO 3Q72A 1HEIA 4PAGA 3FMVA 4AO7A 3QWIA 5D6OA 4BLRA 5LL6P 1XTVA 2DXIA 4UUAA 3TD2A 2M1XA 4PHHA 1NVXQ 1G21E 1U0TA 1C1YA 2PL1A 3B9BA 2PX3A 1PZGA 1XD8A 4L3WA 3S81A 3NVMB 4FQ5A 4GMXA 3UMGA 3WJ7A 2C42A 4LC1A 1UEXC 5PGMA 4HWRA 3UM9A 4C06A 3O90A 1SELA 1SMKA 4PZAA 4GOMD 1YB1A 4C4ZA 1Y1RA 5FYQA 1NTOA 2NU9B 3GLKA 1DJNA 3IPCA 5ARDA 3W2TA 4CTOA 4ENQA 1BU5A 2PZFA 1WQ4A 2XMPA 4FHZA 4GLOA 1Y8RA 3Q9SA 4BC0A 1L4FA 2WAOA 2HMAA 4MQUA 4P86A 3SC3A 4INAA 3AR7A 4PY2A 5FADA 5G0TA 1NL3A 3MJCA 3ROKA 4PO1A 5A2QA 3LLUA 1G7SA 1ZICA 2W8ZA 1RRCA 4JKOA 5FI5A 1X2BA 3B1KA 2JFUA 2EX0A 3LUBA 2HJSA 5E4YA 3VO2A 4C7MA 1DC5A 2P90A 3HKEA 1SZJG 1UZUA 4HAWA 4Y3UA 1NMSA 3TZBA 5FJIA 3VZDA 4CI0B 3AIKA 4LRUA 3RQSA 3V42A 4OEHA 4EI8A 4OLJA 1ZGHA 4Y0AA 4J29A 1Q0SA 2EP8A 3NTVA 3WO0A 1YV9A 4CMJA 1ONSA 3L84A 2Z83A 4QUJA 1MB2A 4B17A 4PM4A 4DT1B 1QGED 2Z9BA 2OV2A 1FVOA 3VV2A 2HSZA 3DDUA 1TTTA 4US1R 2X0NA 3KDSE 1TFRA 3SHTA 2R7LA 4C4AA 5FBLB 3A6GA 4Z4CA 2R87A 4D42A 2I1QA 2JI4A 2HX1A 2GPJA 1EXMA 4U6SA 5D7BA 5K1ZA 3RS9A 2JKZA 3ZGVA 4Q9KA 4DMMA 1QZTA 1GN8A 3F49S 1O1YA 1PGQA 5FOTA 4CIYA 1PF7E 1UAAA 2FPIB 2QLJA 5BOVA 2JA2A 4P33A 5C8DA 1HTWA 1YI0A 3C45A 3CH7A 3D6TB 4D9HA 1BHQ1 3TD6A 4DLLA 3PCXA 1RQ7A 5TSDA 1ZOOA 3RV4A 1NG9A 2D2IA 2AQHA 1V3TA 1PJ3A 1D5WA 1SOUA 1LA2A 5G0WA 4BFUA 4K03A 3WIEA 2HK9A 4N9WA 1W76A 4PLYA 2WT4A 4Q3OA 1EA7A 4DR6B 1FSGA 1AKUA 1IIRA 3P32A 2H1IA 4FSHA 4DHWA 4QLBA 1CQIB 1H6BA 4Y2TA 3EGWA 1VMEA 2GBLA 1UFKA 1WEHA 2GZHA 3L8FA 1GGMA 4V0QA 3EA5A 1UH5A 1ZZGA 1W4RA 2PV0A 2WA1A 2M32A 3ZHCA 5JSYA 1MB9A 3KOWA 4C7XA 3R5SA 1R5JA 2XXBA 3EN0A 2G9VA 3A4VA 1M6EX 2GR9A 1KIMA 1Y3IA 1Y8QA 2FFHA 2BEWB 3H75A 4FYWA 4LCEA 4QXOA 2DLDA 1T3LA 3DO5A 3PHGA 4RIGA 3WIOA 4DF3A 5DYWA 2ZAOA 3V8RA 1BOOA 5I7WA 1EG7A 3P0RA 3HWWA 2V5UA 5K09A 4NOMA 4LZLA 3AY0A 2JIBA 2H2GA 4MQ4A 3GPDG 3EEQA 4WBNF 3WA7A 5KQLA 3EH2A 3X3HA 1LDMA 1ISFA 3L8EA 3OZRA 4MVJF 1V4BA 4TTTS 3OQ6A 1L5FA 5J40A 1YZQA 3C3EA 2G6BA 3VDMA 4FDTA 4WV3A 1YNOA 3VO9A 3UKJA 5IDQA 3P9IA 5KPDA 4IEIA 5JRJA 5C81A 2P4EA 1Q74A 1YA4A 2J87A 4MPTA 4AS3A 1RABA 4N0EA 5JPDA 3DLAA 3Q8KA 5DHUA 5AIBA 2BL4A 4BRZA 4D99A 3OZGA 3HR7A 1WUKS 5F2NA 4FT2A 1KMHA 1X2EA 2HRDA 2J6CA 3A9VA 4J4BA 4TT3A 4BKMA 3GVHA 2R3SA 5GONF 1OIVA 1DE0A 2NU6B 2GSWA 1ESEA 1OFIA 1R5OA 1IL0A 3BZBA 4HEJA 4Q39A 4TLCA 1ZL2A 3ZEIA 1T15A 3QNWA 1OH8A 1KI7A 1Q21A 2EIHA 1II8B 1W0JD 2HSWA 1S3FA 2ZCVA 2TMYA 3M70A 3BL8A 3NHKA 4OP3A 1PTKA 1V5IA 4KAFA 4S0ZA 4W9NA 3U7QB 1RC0A 2A58A 4UHKA 4TGLA 4EYOA 1JEAA 2BCEA 2GT1A 1OXBB 5GIPE 2QY9A 1QR2A 1GLGA 3IV9A 4IV5A 5I48A 1D2EA 2R1ZA 3EW7A 1ZONA 2C3YA 1XEXA 3F71A 3Q8LA 1JAZA 1NGSA 3HRIA 2TS1A 3GP3A 5GONB 1CJVC 2A84A 4HN9A 3ZJ4A 4HDSA 5DX0A 1UDAA 1KZ1A 2GH1A 3FNQA 3LM8A 3T1OA 4DZTA 1M75A 1P9WA 1TKCA 2ZTVA 4O4IA 2JAUA 5E7JA 1V1JA 3EQ6A 3EWNA 3JW8A 3RYCA 4V0SA 3GEGA 4XYEA 3E84A 3GFFA 4XIFA 5GWXA 4UM7A 5K3DA 5BSEA 2BP7B 1S6YA 3MWJA 2GZMA 3QEKA 1G5HA 2ECOA 1W6RA 2GBGA 3GI1A 3A10A 1VJTA 2B5WA 1NQOA 2V1XA 2WV7A 4WXHA 3ZBPA 2MSNA 1V1RA 3C3AA 2I1LA 1ESNA 4JR1A 3ETDA 3GEMA 2ZSBA 3FG9A 4E1VA 1M3SA 2F3SA 1GUZA 1YWGO 3E9YA 4US0R 3FLBA 3F9RA 4ZU1X 3UB3A 3A6JA 4DIKA 1XMQB 2W8BA 3SDBA 4Q9IA 2UUBB 2FWAA 1C9JA 3O2JA 1DCMA 4YCCA 2UUCB 2BWJA 2HMTA 4BYMA 2EV9A 2CHVA 1EX9A 1W47A 3EY4A 4TXLA 1S2OA 1W581 1CQXA 2VP0A 3TJMA 4EG5A 5CEEA 5C3MA 3CMMA 2NXCA 3L8HA 4HZUA 4PU0A 1N2JA 3HNPA 3C8ZA 2IEZA 4MDEA 1YC5A 4K40A 3ZQKA 1KEPA 4TKLA 4NV0A 4TLLB 3VO1A 1QKIA 4FKMA 4N65A 3S55A 3DMRA 2OZVA 3OZCA 4CTKA 3ZWMA 3MJHA 3BSWA 5AKZA 4W7IA 5AUNB 5JAPA 3JRNA 1F0KA 4B79A 4DIFA 1Q11A 1GZ3A 1FYEA 1MORA 4ESOA 4BPRA 3HPQA 4BNWA 3ZWAA 2EW1A 4JLSA 3EGEA 4R41A 5DZSA 3V8QA 3LQ2A 3H1BA 2Y1DA 1B74A 2AF3C 2Y1CA 1DQPA 1KC1A 1I9GA 3HV0A 3K1JA 3MGKA 5IJWA 5LUBA 3MGGA 2HEGA 3TGWA 4KU4A 1H9CA 2RHMA 4INZA 2AIRA 2PVPA 4YMIA 4NZMA 2AJDA 2HSDA 1JGTA 3AEQB 2W4MA 5E2IA 5SZKB 1PX2A 3RC2A 3U49A 4BO0A 4I9HA 4XEUA 4H7JA 3W5DA 1LEHA 5LCXA 1MX1A 1VA4A 1YCFA 3NBKA 3ORRA 4R2JA 5ED4A 4FOOA 2GF9A 2IXDA 1QHXA 5LZ4A 1VXOA 3EXFB 2M6LA 1GV0A 2F00A 1KHTA 2OGSA 2J8ZA 3T54A 4ALMA 3UMSA 3GJQA 1FDWA 4OGKA 1M8PA 2Q8PA 3VZRA 3H4TA 4IDGA 1MABB 2XQJA 3HCCA 3OO1A 5FOUA 2VTBA 1B6GA 5TT0A 5HM8A 2A0FA 2XGJA 5AHOA 1IEQA 1Y7HA 2V6IA 3FN4A 1QIHA 1PR0A 3OZEA 1H42A 4K9LA 4NESA 4YJ3B 3DOHA 1GFZA 4RAQA 3WNVA 3HZZA 4IDAA 4J43A 2RD2A 3F3SA 2ZJOA 2COEA 3N87A 2B6HA 5DBHX 3SS7X 1WF3A 4AZTA 4G97A 5ADUS 2IE8A 2KS6A 3L6OO 1U9CA 2BFPA 5FQOA 2G63A 1XQ1A 2CUTA 3K0AB 3NBAA 4YRRA 2JFNA 4O8ZA 4W5RA 1ECFA 2UYOA 5FWDA 3GBSA 3BJRA 1LVUA 5TPZA 3C4VA 2IF2A 4DW8A 1EGHA 1NVKA 1RZRD 5K0SA 2OP1A 5EJFA 3RLIA 1S2NA 5EZ6B 2OGZA 4MV3A 3QVJA 1FBNA 4KSBA 4HYEA 5DYNA 1POWA 4OI0A 3RWOA 3B8EA 5AVKA 1I7LA 2C7VA 4Y1RA 3DO6A 4U39A 3GAMA 1HZZA 1QU2A 2WTXA 5MN6A 3Q7QA 3BZUA 3JTEA 5J2UF 4AAYA 1QZXA 1UDWA 1IBSA 2W22A 1FP6A 3IVRA 2Z2IA 3NDIA 1YB4A 1GG2A 1T1SA 2ZRJA 3HXLA 2YFHA 3E82A 3R3HA 1RE0A 2FDCA 1A4RA 2IXEA 4KOAA 1NBMA 4C3VA 3TRIA 3Q7SA 2IYSA 4RBNA 4FLMA 1W5TA 1VIMA 5JWHA 4G0PA 4BMXA 1I5EA 1KL7A 2VCYA 4PZLA 4HTFB 1ONOA 3MEQA 2C96A 2PX8A 1QH1A 4XFJA 3W7AA 3SP1A 5IZ4A 5H0IA 2P27A 1JH8A 3W2EA 2ZZMA 5EY5B 4GZLA 1NSFA 1V39A 2CLFB 1KDRA 5CB4A 3T3NA 1G21A 3FDIA 1RTTA 2Y4NA 5J2UB 2CFIA 3AV0B 3PKJA 3VYVA 2WWFA 2G3YA 1S2MA 3K0EA 3BXFA 3JWPA 4I36A 2BTQA 4JC5A 1RRPA 4HAXA 4X92A 4WN9B 4NF2A 3TEJA 2GOYA 3AKYA 3A9TA 4K1XA 4DB2A 4CUZA 1ZXLA 2XYRA 1A04A 3H18A 1NKVA 4WX2B 5G02A 5IJAA 3V46A 1D6MA 1MIHA 1WKCA 2IYNA 3WBBA 1PCXA 4PX3A 2JGDA 2CNBA 4UBMA 1DXHA 2XY4A 1U0LA 4XD2A 3D7MA 2O19A 3KQKA 1KRWA 3JQDA 2WLTA 2JJQA 2QJWA 5JXIA 1TMYA 1J09A 1JEYB 4OQYA 4Q01A 1A9QA 2P0YA 3IPXA 1H2BA 3WLIA 3WJ2A 1SVWA 2WG1A 3AF6A 1M1XB 2EZ4A 3WYDA 2ODAA 4HDKB 3ZHRA 1HEYA 3TWOA 4CWAA 4MW6A 2GDJA 4YAWA 1WPRA 1JHUA 2O1XA 2C7RA 4TMTA 3CNEA 4TWAA 3MJEA 3KJEA 1C7QA 4MI3A 3BA6A 4UAUA 1Z7BA 1CT9A 2PKQO 1ZUIA 3RC8A 4FS3A 4IX1A 5JHGB 2AOTB 3I2HA 5JNRA 3FCUB 3GEIA 4D4JA 5FPPA 3UK2A 3E61A 4KFRA 4BO5A 1YS4A 3BJMA 1EVJA 2WNIA 1JG6A 1M5UA 1YR3A 2FQYA 5LQSA 1M0TA 4R6XA 5HILA 4FFMA 4ZQIA 2WJ4A 1HFJA 3BXHA 2O5EA 1GWNA 3AR8A 2V9CA 3IIEA 2SBTA 4BNVA 3OZUA 3DTVB 2Z6VA 5CEFA 4HWSA 2ZRGA 3LBFA 4WACA 4JI0B 1R12A 1KDVA 2BKEA 3VTFA 1SD2A 1ZPDA 1WMBA 4G0XA 4EY8A 2J41A 2GK7A 3GV0A 4CMGA 1GTMA 4DPMA 4FDAA 1KDPA 5EIOA 3WMEA 5DTRA 4RU1A 2BGTA 4ZAGA 3E1GA 4YP6A 3PYMA 3B2QA 3JWJA 2HXGA 3KP1A 1J2TA 5E4FA 4A0QA 1NE2A 5TQ2B 1Z36A 3JWHA 2A0XA 2X1HA 3U17A 2IV3A 3F3KA 2FI1A 4EZBA 4QHYA 4YIHA 1ZR4A 2MSWA 4FMCF 4ALJA 3JAMA 2OO7A 3ND9A 1DC6A 1Y9JA 4RK5A 3LXXA 4RANA 4N7BA 4YP1A 1RT9A 4PPGA 3DDZX 1G5TA 1QIDA 1GA6A 5DMHA 1DOZA 1NU8A 2CVZA 1YACA 4HAIA 4BE9A 2I7TA 4IDPA 1Z07A 4G26A 2ZAGA 3BUSA 1G8YA 1LNQA 3CLUC 4XGKA 3FOAA 4EGQA 1UPFA 4PINA 3MT8A 2ZZKA 2RHDA 4GX0A 3TLBA 2HIMA 5HP4A 1Z29A 2JFWA 3PFKA 1JR4A 4RTQA 2QM7A 1P0MA 3LT4A 1NOIA 5LOVA 1F3OA 3DMPA 5LD2C 4HF7A 5LIPA 3ET4A 1KSGA 4LHSA 3IP1A 5A3VA 3GFQA 3TSCA 1E77A 4LVNA 3HRHA 5F51A 4ZODA 4DN6A 4OQQA 3CUSA 3JQGB 4B73A 1GGHA 5REQB 2D7CA 2ZANA 1DS6A 4HN4B 2NZVG 2DOKA 1OLUA 4TQUS 1DO0A 3HCOA 1GRRA 4BN4A 1CF4A 1V9SA 4X20A 1S96A 2OP0A 2OD9A 4ZXFA 3R5XA 3QPUA 5BV7A 5JSFA 2CLLB 3DWFA 2HR1A 4ZI7F 5BYKA 4Q4JA 2WSLA 5IC5A 3JU3A 2RHJA 4ZYUA 4H15A 4LJ5A 3JQPA 4P2BA 3FYUC 2ZIZA 3L9XA 4JA0A 1JILA 1W0KD 1I0ZA 3RABA 3JYLA 2DR3A 3M5CA 5JBNA 4KXUA 2DB3A 4OI2A 4RE6A 1PDWA 1X8KA 5FUBA 3S0JA 1U81A 4CMEC 2IYLD 4Y7DA 1BYIA 6CHYA 5I9LA 3U3ZA 4QXQA 2HFJA 3H1PA 4MQFB 1XHEA 5EMLA 5JG7A 4MQEA 3CIOA 4EZIA 1S4QA 5JBIA 3RSZA 1ENYA 1D03A 2CYCA 3K20A 4HWOA 4LVCA 5LQDA 1OJLA 1WCV1 3QVUA 4YAGA 4UASA 2H4XA 4NHOA 2ZRFA 3ONVA 3NALA 3P9ZA 4QUBA 2ZDHA 10MHA 5C2JB 1G64A 1W49A 5TRTA 3TG8A 2LD4A 2PVCA 3LS2A 3SZRA 3TEMA 4ITRC 1Z5UA 4B7CA 3ZDEA 5JD5A 1N1GA 2O8BB 1J06A 3P94A 4BNUA 3JWEA 1PGJA 4RHFA 3UJBA 2AD5A 4L9AA 5IUKC 2O7VA 4YREA 3S5UA 4CMKA 4TV8B 3OLCX 5LZ7A 4EB6A 3WWYA 1VYHA 5CDGA 1E7RA 4QODA 3KZOA 4CHTA 2CL5A 1RBZA 1C0IA 1YZVA 1WPGA 3LL4A 4RY8A 1AHPA 2HA0A 1IBLB 1M34A 2B2CA 1P4AA 2WLSA 3PT5A 1BD4A 2BY4A 3KKKA 3KZMA 3AJ9A 1KJZA 2XGGA 3U44B 2VRNA 3R6DA 5BPHA 2GN6A 1U1GA 3RT7A 3QUQA 2Q28A 4G37A 1MA3A 2X6TA 4NSNA 3DH0A 4KKVA 1LSSA 2X0KA 1VJCA 1O3YA 2FSGA 2AQIA 3CT4A 3L7AA 4QFCA 3ILHA 1T8RA 3GJSA 3HYTA 4ZVUA 3JZIA 4OPMA 4RQUA 4TKZA 5JAMA 2IUUA 2JBHA 3G6WA 4G25A 2IXAA 3A27A 3RVKA 3J7TA 1MKYA 4OQXA 3I73A 5KYXB 2CHFA 1XCOA 5M04A 2F4VB 3HH8A 3KSZO 3OCXA 4YT2A 1WSWA 3OQVA 2HHCA 1RHJA 3EXEA 1TM4E 2BEUA 2NYUA 3QMVA 3GR6A 3Q3EA 4QFMA 1X13A 5EKTA 1VDZA 1SK9A 3VSDA 2A35A 3ZJTA 1GPYA 4TTRA 3ZV7A 3F8TA 5PNTA 3K70D 3NXKA 5B6PA 1D0VA 3PC2A 2PLFA 1FYXA 1ZK1A 2PKXA 3QNUA 4MIKA 3K6SA 1G8AA 2WOJA 5G3YA 2RG1A 1FUYB 3OPYA 2WBLC 4IJQA 4PWZA 3DF9A 3JQ7B 5JS7A 4TXHA 3RW9A 4JJEA 2JLWA 4EA9A 4F4FA 5F98A 5F9FA 1NJGA 1XZLA 5CFOA 3TZLA 3KE9A 4CJXA 1C0EA 1RPJA 2ETXA 3RAJA 4TSKA 3WXMA 5F3WB 2Z2XA 3C41J 3OIUA 4RXTA 4ZO9A 3G1TA 2C7PA 4YN3A 2Q0XA 2OV3A 1YCGA 4LYAA 1VBKA 4IXMA 4JV5B 3AM5A 1A0OA 3NHMA 2JBAB 4BECA 1CB7A 3HLKA 2UZ1A 2SNIE 2FVXA 1K0FA 4E5MA 1QCZA 3A6KA 3E9QA 3HXTA 1KAMA 3ZDFA 4DBVO 3T9AA 2NLOA 3TZCA 2IUEA 3BSYA 1NI4B 2V5AA 4PQGA 5C8VA 4JNCA 1KGSA 5T4EA 4KC0A 3AQIA 4HFRA 5LKAA 1QP7A 4BFCA 2GBPA 4QPDA 3TI9A 4J7UA 1H2AS 2FZVA 2H51A 2BE7A 2NUPA 1KPIA 1C8BA 3LAWA 5AM0A 5CFRA 1JSRA 4C4RA 3PKZA 4ME6A 1I7QB 3A31A 3IT3A 3RSGA 3OE7A 4A8HA 4GKVA 1NUQA 2RKBA 1ORDA 3UA3A 4QOEA 4R40A 4CCSA 4DCTA 2ROQA 1Y48E 2C83A 5JCJD 2AJCA 1KZGB 2VJNA 3KUXA 4PLGA 5I4CA 1EUDA 4F84A 3KSAC 4HBGA 3HBFA 3SXUB 3IBCA 3K9QO 3EODA 2HQBA 5FPHA 4GL4A 3THSA 1YK1A 3DOIA 1GQRA 3LWBA 4JXKA 5EZSA 3EZ6A 3PUZA 2I78A 3USES 4A10A 5DLDA 3DMGA 1FRNA 5CLGA 2OFOA 3SD7A 1ZGGA 3U40A 4JOBA 3SHQA 4BFWA 2HC9A 5FPTA 1QLHA 3DL2A 3DV2A 3N0RA 3Q85A 2IX3A 4UTOA 3WRWA 2HREA 1SC6A 3IS3A 2WVHA 4X0EA 1CF9A 2ZIUB 3AR4A 4OHZA 2VYQA 2VP4A 5IBCA 3V8NA 3G79A 3X2SA 2EYUA 1YBMA 4ZOQI 1AGNA 1UMDB 5CD9A 3J81k 3CLRC 3KYIB 1XYGA 4Q0MA 4MHSA 2HU8A 1AUVA 5BSUA 3AZQA 4HWTA 4RLSA 4DV7B 2XQIA 4YRKA 3DUWA 4UEQA 5L6MB 4PG4A 3QEOA 4Q66C 5GVSA 3CRQA 3GRRA 2Q2WA 3TKAA 4GKBA 2WJ3A 3ANTA 4PCVA 3HVIA 1P4HA 1ZC3A 2QJTA 4X8HA 2AE1A 1BVUA 1RI3A 2RCYA 1VPEA 3G8BA 3ZTTA 4E33A 3D9QX 1HE5A 4ZT4A 5CGZA 4CIXA 3DG9A 1DIHA 4NU5A 4XCVA 4YCNA 4OQLA 4RF4A 1LI4A 3IP6A 1KI8A 3K8YA 2H1CA 4HNRA 4A27A 1ODCA 2OWDA 4H0CA 1OWPA 2P75A 3MBOA 1SOAA 4HLDA 2YXPX 4NV1A 4JZKA 4RPCA 4EF5A 1YS7A 4GP6A 2B20A 2AFRA 3SHFA 4EOGA 4MTLA 4PCAA 4J8PA 1FJHA 4R1NA 2GJAA 3KLPX 2G5PA 3ETEA 4F11A 5I7FA 5L6LB 2CUKA 1DC3A 5BN4B 5KOJA 3LDUA 3W6NA 5CJJA 3ZHVA 2EKDA 5HJ7A 5HCIA 5KSWB 5K2OA 3DPIA 2XZTA 3R44A 5GGXA 1A8HA 1O6GA 2QLFA 3HCAA 4CKCA 2TYSB 1KVQA 1H9AA 1H2HA 1UMBA 3QVSA 4AMZA 1EDDA 3LPAA 1TEHA 1AXGA 2PL9A 3BD6A 3MAJA 4J94A 4MR9A 3MINA 3PX3A 1JPJA 1UBCA 1X7YA 1YHZA 4B84A 2CC2A 1P6XA 4NOKA 5H68A 2ALJA 1YJ8A 4WERA 2YZKA 4OFXA 4G81A 4PIVA 1KOLA 4ZU6X 3R3VA 5A4KA 1XMVA 3JRWA 3FLAA 5JSZA 1UXOA 2Y27A 2PMCA 4UDOA 1T0JB 3T6KA 4ZQEA 1RAFA 5BSRA 4G67A 3UUEA 2DH5A 5ICGA 2E3JA 1UBGA 1P9LA 2JASA 1EFVB 1PTJA 4OX9Y 2H7YA 2VHYA 2R8RA 4JNKA 3VR5H 1I8TA 1Z5PA 4PBRA 3FUVA 3ROMA 4IFEA 1FRQA 1B0UA 3IEPA 3WYAA 1SUSA 3FPEA 1NJSA 3I53A 4JB2A 5DSZA 5CVVA 3FAZA 5HKBA 2W9XA 4HQLA 4R83A 5E2BA 1R4ZA 2F4NA 4D5GA 4MUIA 2H31A 4WESA 2QSJA 1L4EA 3H1GA 1EYZA 3V7YA 1N57A 1IHYA 4S04A 3UUFA 3K16A 1XZDA 1YFKA 1VIYA 2H1WA 3CUEF 3DL7A 3IMFA 1P19A 2O7RA 1XRJA 2XUJA 1AU9A 2E5LB 3M1YA 3SSMA 4KUGA 2PGLA 1C3OB 4W4TA 4X7RA 2WJGA 1R16A 3ZUPA 4HNTA 4OX9B 1HNNA 3R3ZA 3INGA 4CIVA 3J7AC 3D4PA 1PZNA 1TCAA 5J47A 1S89A 2G6TA 3UTCA 1XOIA 4KRFA 5K0CA 4OKSA 3DE1X 3KL4A 1UMCA 2J45A 1G7CA 3G7SA 3VH2A 5LB2A 1J97A 3LBYA 4KIJA 4KODA 2QW0X 4PQFA 2BM8A 1T0HB 1GP2A 4KTTE 4RA9B 3ZI0A 1IDN1 4Z3KA 5K6RA 5A9SB 1KEUA 4LNUB 1OWLA 4UMDA 1RYEA 3IULA 2DE0X 4B3HA 2ZIXB 5AOCA 5C34B 1P0QA 4ZARA 1R0XA 1BAPA 3C3XA 4RDHA 1RPNA 4KH1A 1P0FA 3B70A 5BYJA 4G5SA 2YIJA 3T0IA 4U9UA 3QVGB 5DGDA 3QF4B 5BXYA 4UU0A 1T2CA 3KZKA 1H9BA 3T7SA 2BZGA 4GQAA 3I9LA 1N2XA 5CM8B 5BV2P 5C8XA 1FNCA 5HWSA 3UH0A 4AY2A 2R84A 2GTPA 2Q3HA 3ICCA 3JQBA 2H1OA 1NQXA 5DLQC 1WXXA 3R7NA 1IVYA 3ZWOA 1D0SA 5AKXA 3OCWA 3OCVA 1C7IA 2O4UX 3L43A 4R0NA 1IY1A 1UJ5A 4DYVA 1P8AA 2PX4A 5DE3A 2QSUA 2IEAA 5ADHA 1XZBA 1JHPA 2WMNB 4IZOA 1NZFA 1RQNA 2WSIA 3GLTA 1Z3CA 3QLVC 4D46A 3UFXA 5L53A 4AKGA 3FVVA 3O91A 1J2YA 3IKLA 1L4HA 1JW9B 1RTKA 1HDYA 1E2KA 2A1UB 3GWZA 3RU3A 2PO5A 3E7XA 2CLKB 4MW5A 1EVYA 1XNHA 1ZN8A 3CR7A 1L8XA 2VHEA 1R00A 4Y67A 5K3OA 1HO3A 3LPNA 3U7IA 4R98A 3V8EA 2MMGA 4UBNA 5IAGA 4IGEA 4X1IB 4G5GA 3ZV6A 3ZS8A 3IAS1 2YN2A 3B82A 5HBRA 1NJ5A 1NNI1 5DM0A 1GXSB 2QT9A 1KY4A 1WO8A 2QZSA 3EIHA 3GJ8A 1ITZA 4HRVA 4QO7A 3UAOA 2NV6A 2XOEA 2Z2ZA 3T9BA 3ZE8A 1QSGA 1LY1A 1A8SA 3DZDA 5AHKA 3T7IA 1P7WA 3QWHA 1YA8A 4LWPA 3VR6D 3DAGA 3DB1A 1NW3A 3E7DA 3WYBA 4P32A 5AKHA 4BJHB 5FXMA 4X54A 4YYEA 3DLTA 3DQPA 3U4AA 1O6CA 4JGIA 1YJBA 3U1BA 4B6JA 2ON6A 5J58A 4F3KA 1QYWA 3VKFA 4F91B 1OYVA 1BKYA 1K4YA 1ZIXA 4K5QA 1NM5C 1NPDA 1VJ0A 3AI7A 4BN5A 1DGQA 4JEHA 1EFCA 1Q0ZA 1L4UA 4CMHA 4E5SA 3BFKA 3GU3A 1V3VA 3U9LA 3VDNB 3V9AA 2F9LA 3NBZC 4MV9A 1VL1A 2JC3A 1QQTA 3OU2A 4BUCA 2VDMB 5AVVA 1UJCA 3D6JA 3VJLA 4TS9A 1C7RA 1XVTA 2W2VA 2OMEA 5TE9A 1MTZA 1GSIA 4E1BA 2YQ4A 3BIFA 2FY8A 3O2QB 3Q6MA 4BV2A 3STVA 2J0UA 4R0VA 3H2ZA 2HI0A 4J76A 5ILQA 1MDBA 4CF4A 1F17A 4YGXB 3WG9A 5BORA 1QH9A 4WLEA 1DAMA 4Q3AA 3VYSB 4DXHA 1IC6A 3ML1A 1QO7A 3FJ1A 3FJOA 4KMRA 3PR2B 3NGXA 5FTNA 4OFBA 5K8CA 2GJ4A 5EEHA 3ZXUB 1IZZA 4FBMA 4RK6A 4KXVA 1B0ZA 4D1YA 4HGZA 4U3JA 2CXUA 3RTGA 1AB5A 2NPIA 4FGKA 4MQLA 1YR8A 2ZYHA 4PSKA 3TLJA 4CKBA 2DVMA 2CJFA 3PUHA 2PS1A 4QVGA 4RVSA 4PR0A 2IOFA 4P0QB 3R0IA 1VBNA 3A6FA 3C7TA 2IRWA 2H6EA 3H6KA 1EBBA 3I9JA 3MLAA 1CJKC 1ODSA 3U48A 3OPQA 3NOOA 2FEXA 1FYVA 3S2ZA 3CVWA 2UXCB 1E5TA 4DE5A 4Y18A 3OCUA 5TJ9A 1UXJA 3OD1A 2VYCA 4G01B 1F4VA 5ES4B 3MD0A 1G5QA 4OHMA 2F17A 3Q7IA 4IZ6A 2EX1A 2M6SA 1NTRA 3CVOA 3G9TA 4BGUA 3SBEA 5KYWA 4O2RA 1OXKB 4F3TA 2QMHA 4JVMA 5K0FA 4P08A 5T41A 1GNSA 1PEAA 1MOSA 1CEEA 2ID4A 3HM9A 3F5SA 2PUCA 1TT5A 1O94D 3JS5A 1JLLA 1G9SA 2BT4A 3IXMA 3FGNA 4YP5A 3KXKA 3V6LA 2ODTX 3TLKA 4BLQA 3KLOA 2FPOA 4QBFA 3KFXA 3E7PA 4OJYA 4C14A 4EVIA 1O0CA 1XNQB 1Z3IX 4Q9AA 2PS0A 1CUJA 4KPUB 3BD9A 1U6JA 1QQAA 4MPJA 2F43A 2EWMA 3U6BA 2N3ZA 3DAOA 4DWOA 3CVYA 1JG7A 4FP9A 4GM1A 3L49A 4MLCA 2WDZA 3AETA 1KYZA 1DAKA 4YRFA 2ZAYA 3M3HA 3ZVKA 1TCVA 3BXEA 2R8ZA 3CEHA 3E58A 4OK5A 3T34A 2P9CA 2QG6A 4QDXA 3L6DA 3Q41A 4P3YA 2ZWIA 2WINI 4H17A 1OAAA 5U1PA 1A2QA 1C0KA 4RLHA 1DWPA 2NO9A 5LP6C 3KUDA 4ZT6A 5KTPA 3FWNA 5KYKA 3W2IA 1TZKA 1ZL0A 1YQUA 2X9GA 2R1UA 1LBSA 4KLCA 2Y3IA 4ZZ0A 2QQGA 3QRWA 1T5LA 2C8JA 3T1QA 2ONCA 3UAZA 1CIPA 4K6FA 2WAYA 4MRVA 1XRRA 4YCJA 4JROA 4MIEA 3FCXA 3TXXA 2YCLA 3KYCA 1Z83A 3AHGA 3QFCA 4Q9DA 5DXJA 5JQGF 5CD1A 1S1CA 2BI8A 4WK0B 5JMPA 3VU9B 1RZRA 5EQFA 3WDMA 3A4NA 1C41A 3WWZA 1F2TB 2JFFA 4YONB 3E7WA 3KB2A 3R4VA 5K8TA 4GGOA 1ECPA 3CPHA 3QELA 4GPD1 4EARA 4EUNA 2WRZA 4PPFA 3NHRA 5FO1A 2W6NA 2CMFA 3ZCUA 1DKRA 4MWOA 5FH9A 3FUCA 3QHPA 3DDWA 1QTNA 5SYNA 3R3YA 4IHJA 5EHXA 4ABTA 4M7PA 1DUVG 3O9MA 2R6CA 3TW8A 2VF2A 1BQ3A 1UKZA 3VPHA 1WZ2A 1JBQA 1DIOB 3D8TA 2GF2A 2B7CA 2VQFB 1EE2A 4JN6B 1BXZA 3LY7A 1YB2A 4OGWA 5ALEA 5K0JA 4DCCA 4E1AA 4IRXA 4S1OA 5K0GA 3IT0A 1H2WA 4KXQA 5LZ9A 2BLNA 2XGSA 4U7DA 1E92A 2HLDA 2A1IA 2HM7A 2RGGA 3KHUA 4OGLA 4AN0A 2VT6A 3FF1A 3I39X 3PA8A 4LCBA 3JAKB 3RG2A 3N8DA 1E69A 1P7ZA 1H1LA 5D5QA 2VSNA 3QBJA 3Q7TA 1LPSA 2BKLA 4JBLA 5A6VA 4Z0TA 5J63A 4BMDA 2HH9A 3C6MA 4ALNA 2QN1A 2ZUTA 4Y9RA 5KTNA 1BA3A 3TFQA 1S8AA 4YJGA 4C7OA 2HMVA 2UDPA 2EBWA 4LWQA 4LYDA 2J6BA 3K0CC 3W8DA 1J0DA 3D2CA 4B8ZA 1VPDA 3P4YA 3HYCA 2HIAA 3TOVA 1P60A 4AKTA 3PL1A 1NXSA 3ROXA 2E7ZA 1MZVA 3OZSA 3GFGA 1P9OA 2C7GA 2I2DA 3P20A 2X3UA 4IMIB 4HDAA 2XMDA 3SQMA 4KN6A 1OTXA 2DFLA 5B1HA 1EM8A 3DV0B 4ENUA 1WXWA 3H7IA 1UBOS 1B3RA 4XUDA 5THQA 1E6MA 4XQ0A 3V2UA 1Z2NX 4AI6A 1I7PA 3FWHA 4HFJA 4P82A 2V4UA 1ST3A 1DAPA 4L7VA 4HC4A 3PQ4A 4LE2A 1SOMA 2YOFA 4XFDA 1G63A 1L7RA 2CLIB 4MP3A 3H3FA 2QUKA 4IXNA 2Y9MB 2ZJ3A 3A1WA 3PJGA 4H3HB 5KYGA 4C0XA 2DHRA 1Q2XA 3FSGD 3NR2A 1EFUA 4LAFA 3RRNA 3AW8A 4PZEA 4BFZA 3G5TA 3F78A 3LOQA 4I5EA 1IB6A 4KX3A 3DKRA 2XDYA 5EJ7A 4GS5A 2VUUA 4URYR 3WB0A 1KFKB 4EWLA 4OOEA 1QNFA 1Z08A 1FIUA 1SCUA 4LWZA 1PSWA 1D5CA 2VA8A 2X1MA 3EGVA 1H85A 3EQ8A 3VU1A 5LD2B 1KIAA 4D9NA 5AVRA 4LY3A 1BKSB 2PWPA 2VNAA 1E9CA 5K20A 2XA1A 3SSOA 4BGVA 1VZ3A 1MB0A 1WKBA 2D74A 2QL5A 1Y1PA 1Z88A 2XNDD 1H0HA 2IEBA 3G5MA 1U7OA 2XMCA 3H2BA 4MWDA 1JSCA 3TD9A 3BQMB 1GL7A 2NTJA 3BRWD 4M1ZA 4C87A 3S7TA 4R1TA 2GEJA 1U2QA 3RSQA 1G4UR 5GOZA 4IDDA 3UHJA 1RPTA 1J0AA 1KHHA 1CUXA 1MEJA 3GOQA 4IJUA 4M98A 3LDFA 5TEVA 1KEEA 3QSYA 3KRTA 3NIDB 1ESMA 2BBOA 3OD5A 1TEZA 1MO2A 2E6UX 4IR7A 3UGQA 4LYFA 1W9MA 3ZZTA 5DULA 4BVKA 3C6QA 4FEAA 3AU8A 3CZMA 3EVZA 4MRPA 1GIAA 1QHHB 1G7RA 1TQHA 2V7EA 1KOGA 1T29A 4Q3CA 5TY0A 3FDZB 2ADMA 2MYNA 1R0BA 4AW9A 3W5JA 4WUTA 1J0XO 3DAHA 5I7OA 4BFXA 5AW2A 4HDNB 1G2QA 3WTBA 1P31A 3NHAA 4F06A 3V48A 2AB0A 4R8KA 1STOA 5FTJA 3DOOA 4JJAA 5JTUA 3QPVA 2CL7X 4EKDA 1NUAA 2LZ0A 3VO8A 1U5CA 2QPAA 3H2YA 4JYPA 3NTRA 1XLTC 3PD7A 1C7EA 2F9MA 4YVFA 3X43A 3KJFA 4R3NA 1FDVA 4B7UA 3FKSD 1OFGA 3P52A 1Z7YA 2BEKA 1Q1QA 3SKXA 3P2YA 1DDOA 5FO0A 5LB4A 1JSLA 3WRXA 4CKEB 5CBPA 3ZY5A 3ZZNA 3HHPA 5SZHB 1FYWA 3MQ2A 2Q6IA 5C7LO 1FTYA 3RH0A 3MA0A 3O1HB 3ZQUA 1JTFA 4QXRA 4U2KA 4YHBA 3WK5A 3D4LA 2AN5A 2R11A 3N28A 4ENPA 2ZCJA 2W6MA 3NNSA 1OYWA 3WBKA 4C6TA 2GD2A 3JYPA 8GPBA 1TAHA 2X42A 2PS9A 1RBYA 3SC4A 2IUSA 4X7BA 3OC6A 2X0FA 1FA9A 2G5CA 2RK4A 3HB4X 1OX6A 2HA7A 4R1UA 5AK5A 1XTPA 2PMFA 2VJPA 4FB5A 5KVCA 4DREA 4CKZA 3KR0A 2F3QA 4EF4A 4DNXA 4TLDA 4YRGA 3Q7PA 2DY1A 1E32A 4GI7A 2GCOB 4BNJA 2IP2A 1N2ZA 2B1QA 2B78A 2WVGA 4PC3A 3UENA 4EYKA 2ES4A 3OLZA 4P36A 1L5NA 5L9AA 3HC7A 3N5KA 3EFEA 4UOQA 4M8LA 4JSYA 5GTDA 2EWWA 1MAUA 2OT3B 3ZJVA 3KJZA 1FUKA 3HMQA 3SQLA 3BEDA 1N6HA 3BRQA 5EVCA 4DZRA 1ZKMA 4RMIA 1I6WA 1R4AA 1O6FA 1QHFA 2NXEA 3HN7A 3CZAA 1ZIPA 3OZBA 4YJFB 4ND1A 2WEKA 5LSAA 2C9YA 2Z8YM 1CS0A 2VF4X 3OJXA 3FROA 1TLTA 2P67A 4L76A 4HQRA 3MTBA 4DIEA 5KJFA 1O9GA 2ZCUA 4X60A 4KGDA 1NVEA 3GK3A 1UZMA 4B8YA 2WWXA 1YBFA 2QYSA 1FL9A 2IPAB 3HUTA 3IDZA 1GYPA 4V0OA 4CUKA 1IBCA 3E8MA 3O3CA 3DLPX 3H0CA 4WZBA 3DFKA 2G5GX 2PZKA 4IAOA 4F92B 3C97A 5CFPA 3D3WB 3LQYA 4OY3A 4Z1MD 2E49A 3P9QA 4LJYA 2ZP1A 3NV9A 5AVYA 2LDBA 1ESCA 5LVAA 1X7XB 3SJBA 3R9XB 1FDUA 3IA7A 3KOXA 4COKA 2R8EA 3CO0S 5G1NA 1P0IA 2JLQA 2XVYA 3OOYA 5JU6A 2WF8A 3E15A 3NHSA 2ZBRA 1HH4A 2QTHA 3QKUA 5DISB 5IN4A 2FDRA 4XPIB 2Q50A 5KC8A 1U9ZA 4D82A 5IU6A 4YMTA 4E30A 4F9EA 2F8SA 1KFEB 1H3NA 2AYYA 1CG6A 2O52A 2OC4A 2C7QA 5B3AA 1UC9A 3EISA 4L0QA 2OHHA 2FQQA 2W2QA 4C0BA 2VH2A 4RTMA 2JRLA 1QIIA 4LNAA 1IBRA 1KARA 2D0DA 2PH1A 2Q4BA 5EMMA 1ZW1A 5INTA 1AJEA 4X71A 1Y1LA 2NSLA 4KUEA 3M3DA 1VCOA 3R0ZA 1JV2B 4OU4A 2B94A 3OOJA 4NR0A 4NULA 3HDYA 4RJTA 4YUZA 1FDOA 2ISQA 3GW8A 4UEJA 3GHYA 1KH1A 3JD2A 3EEOA 3PUIA 3C43A 2JCSA 3L6RA 5EHNA 1S01A 3H1TA 4ND8B 5AVSA 4ZGWA 1AE1A 3R77A 1T5TA 3OZXA 1HRDA 2Q3BA 4DDWA 1PW7A 5M3BA 4ZDWA 4UJ5A 5AHWA 4DA6A 4DHEA 4D79A 3T5MA 4MUBA 4EYSA 2LKDA 2WFAA 4B40A 3ZK9A 4X85A 4HQNA 1ZQ9A 3TR6A 4PFQA 3Q5GA 1BS9A 4KQ2A 2AD1A 1C30B 1VG8A 2R7KA 4JBWA 2V98A 3CUKA 3GG9A 2AN3A 2GESA 2XJ9A 2VPQA 1S5PA 4LRWA 4D7AA 1SN7A 4LMBA 4G1EB 2RGDA 5K8IA 4PSCA 2C99A 3S1AA 1TA4A 2B4QA 2B98A 5JAUA 3AEKA 3WDSA 1DXYA 1VLVA 3IP7A 4J4TA 1OR8A 3LHSA 4M1OA 3E4CA 4O4JF 3VTZA 3WGIA 4Q37A 4MCJA 1MRNA 5TDHA 2H11A 3WC4A 2IY8A 3AEZA 3VR0A 3UOAB 4K8OA 1GRVA 4KR2A 1YJQA 2CJYA 3L0CA 2FWRA 2R48A 3PDWA 3SEAA 4J49A 2EJWA 3OT1B 3TMAA 3DWEX 4L27A 4RIIA 1U5BB 2QZPA 4YR9A 4YJHB 3M4JA 4UM9B 1DTWB 1I0IA 4M8NE 3LP8A 1TAUA 5A4IS 1KMMA 1TUBB 1CR2A 1ECCA 4Z49A 4EQ6B 3VBCA 3P9PA 1NRWA 2CW5A 3IRVA 3H9UA 4FKBA 4OYHA 3IO3A 3ZIAA 4C04A 3MF4A 1IQ0A 2GJKA 2DG2A 3O82A 4JXJA 4RK0A 5JLAA 3BH7A 4EVSA 4QTYA 4PCLA 2ZUWA 4M6WA 2P7HA 3W1VA 5FV4A 3ZD6A 3SVZA 4EDFA 5BURA 2HJRA 4WBXC 3TZ6A 5EIFA 3RHTA 3T5BA 4XLTA 3P26A 4DTIA 1R9MA 2GKGA 2OZPA 2PG3A 3EZYA 4M0CA 3FIUA 4KN9S 3U5TA 4B3MB 3K9FC 3ESXA 4KWIA 2O5VA 6ABPA 4RZQA 2QDXA 1MEEA 3G5LA 3TOCA 1I4LD 4EQZA 2I29A 4R84A 5LJIA 1EP2B 1UQRA 1P2VA 2GPSA 2P11A 3TRDA 4RD4A 4JASB 2NV0A 5A4DA 5CNMA 2HHHB 1YQDA 2OUKA 3FZNA 3SFTA 3GN2A 3ZWCA 2JHPA 5EZYA 4W82A 4YRNA 4DV4B 4I5IA 4IF6A 4L4SA 4N7RA 1OOEA 4LXXA 4ZAYA 4FONA 1SPBS 4B2YA 1ONBA 1ZVQA 2Z5GA 3KAPA 3U80A 4ZYXA 3BMQA 1UOEA 1DG3A 2ZYIA 5KB3A 3H05A 4MYSA 1QMPA 5LDGA 3UICA 3OQNA 3A8TA 1J2JA 1HE3A 1LC3A 1QYRA 2NPOA 4G5FA 4MUGA 1XFDA 1MPXA 2WM3A 4Q9LA 5J2TA 1XKTA 2AN1A 4MOWA 4Y9DA 1XPJA 4UULA 4ZRMA 2QT1A 3LBAA 3N2ZB 5TS3A 2N42A 1L1RA 3EGCA 1R0WA 5A7GA 2F55A 3N7UA 5AW3A 1GGNA 1C4KA 2O3UA 2ZRHA 4O2LA 2BELA 2WU0A 4TQ9A 4BGEA 2QOEA 2WT8A 1F9AA 4KQCA 3OBIA 1JIXA 3MTDA 5K03A 4KPGA 3KAQA 4UQLA 1T2FA 3MOGA 3QENA 5C4IA 4H7HA 3PQ2A 2FSUA 4POOA 3DBHA 1QRAA 2EKLA 3F5QA 1SUAA 3L6BA 1D09A 2R00C 1TQ8A 2IZ0A 2RGNC 5CLLA 1T6BY 2ZJAA 5EZQA 2RB4A 3E8SA 2JZOA 3K15A 1U9JA 4KWCA 3R0XA 2RAPA 3ER6A 3ROGA 4Z7NB 1SULA 1V11A 1AC5A 1UWCA 2EKPA 3IR7A 1ZRSA 1G9XA 3PFIA 3MUOA 3P0FA 3THXA 2G1JA 2PXCA 1J33A 1T36B 3QBTA 1A88A 4IQGA 2O8EA 1XU9A 3T7KA 5HR5A 2YNMC 4RKRA 3WJ1A 3E6AA 3U4IA 4XQ9A 1E2FA 3RSCA 1EPUA 2BGUA 1I7NA 2A0UA 2Q1WA 3P2KA 4DSUA 1LTHR 1DO2A 2GLUA 3A2MA 4WASA 4A9AA 4GKKB 3M6UA 1QLJA 4FUTA 4L5CA 1C3JA 4ZVPA 2ERYA 3AMVA 3UV7A 1Z0UA 2YHUA 3K1ZA 5LLTA 4WKBA 4B83A 3HKDA 5IC6A 2QM8A 1R6BX 1NX6A 3O21A 4YQZA 4PFJA 3ZDCA 3V2GA 4GE3A 1X1QA 3FRIA 4QU0A 2O07A 1Z63A 3PWSA 4IOLA 1Q16A 3WK8A 1JG3A 3U19A 4EIWA 3H4IA 2RJOA 4IL5A 2C7OA 3AH8A 1YI8A 2G8NA 3MBKA 4WNAB 4D4LA 4GC5A 3PFCA 3R2JA 4N7MA 1VE1A 2X6QA 5BSFA 4YRPA 1M1NA 1BX1A 3EMKA 1A4XA 1I1NA 3AESB 1S8FA 1RYHA 2GHQA 1RQLA 1VFNA 4DCSA 4MP6A 1I4TD 4E12A 1GCGA 1HLGA 5JMOA 2AW5A 3IE1A 1D6SA 4NPHA 2PDAA 3PRHA 3OEYA 3GGGA 2I5PO 5KAPA 4HQOA 2HT6A 3C1TA 1Y5IA 3HNOA 5G0SA 2XXAA 1N9ZA 3IESA 2JKVA 3ICEA 5DM70 1NLUA 5CURA 1GLVA 1F3LA 1Z16A 2BRUC 2VDWA 5IBRA 2YHBA 1Q0LA 5THKA 3UG6A 3KVRA 4N12A 4DLZA 1XTKA 1XRSB 2NNWB 5J59A 3Q10A 3R6WA 4E07A 5JS2A 3EX7C 4UTZA 3TW4A 1V3UA 2GVZC 2HCRA 4WFQA 2FPGB 1D04A 4AF7A 2FA9A 2CNLA 4UTNA 1TADA 3EVGA 4R54A 2D5CA 1IUKA 3VC7A 4IJMA 3OM9A 4KE6A 3PE4A 3CTPA 5A5FA 4K81B 2WV9A 4DJTA 2R8XA 4NJEA 5HFAA 2XECA 4TZ0A 3L4EA 4BFLA 2B61A 5HNKA 3BXXA 1BS1A 4GEKA 2IOHA 2BZ1A 1XDBA 4W63A 5DK6A 1KJWA 1S0UA 2WSSA 2V6FA 3Q3GE 4XB1A 3HU1A 1S2GA 2ZRMA 4L28A 5HF8A 3ZDQA 3RTDA 2BCGY 3Q9NA 2O2HA 1QGZA 3BMOB 1BYUA 4AMBA 4E2WA 3EWIA 2QNIA 1FFWA 2VTDA 3NG1A 4CQMD 1NHGA 3THYB 5LA6A 4ZCTA 4PTZA 1MH9A 3VISA 1VE5A 5BV0A 2C8VA 1M0WA 2HHAA 1QG6A 4Y2HA 1C1DB 4ENSA 2EXXA 1E2PA 3E3AA 1IYZA 2V03A 2YR0A 1C2YA 3EULA 2D59A 3KQSA 3H5AA 4XCQA 2WU4A 5CXQA 1RWPA 1KO8A 2FN4A 5AJVB 1MX5A 2DFNA 3GEPA 4ZANA 1WIWA 3UXMA 4D3YA 4RTOA 5AP9A 4HLNA 1K8QA 5JJIA 1K98A 4CETA 1MO5A 5LU8A 2GCIA 4GOOD 2ZZNA 3STUA 4YXWD 1I1OA 2OBMA 4UAVA 4HNVA 2ECKA 2FFRA 1QHNA 1T43A 2C3OA 1NLMA 1RYFA 2IX9A 1BTOA 2WG2A 4KEAA 4KJXA 5BQOA 1NBOA 3ESBA 1VMAA 5CXUA 1EUCA 2B4TO 3KBOA 4I4TF 1YH3A 2CJPA 1WDWB 2QEQA 1EVQA 2HA2A 2Z08A 3P0JA 4C3ZA 5IASA 1TUEA 3FGPA 5HG0A 5IUJC 1BMDA 1Q7GA 5EUMA 3UPUA 2HA3A 3W6UA 1XAHA 2P2YA 3C1AA 3L4BC 4GX1A 4CL0A 1TQ6A 2ZYSA 4NEQA 1E9RA 1QM5A 2JFBA 1AIPA 1M76A 3EXIB 1C3EA 2WA2A 3F2IA 1GL9B 4MW4A 2QX6A 1IK4A 2VJMA 3OFVA 2QX4A 4UM5A 5HFNA 4P4NA 2D2FA 5AOBA 1TKRA 3RTCA 1GZ7A 3UJ9A 1BMTA 3ITNA 1CHNA 5H3LA 4WK4B 3TLXA 5AW4A 2Z2YA 3CGWA 3GCXA 4ZCQA 4RY9A 3I5XA 1Q1AA 4O4LF 3UWKA 2DH6A 2FZLA 3RU2A 1PWYE 5JYBA 4DMRA 3DUFA 2A86A 3DFFA 3O95A 3H84A 1EZZA 3L0IB 1Z0ZA 4AP9A 3ZHYA 4NBRA 3A26A 4J0HA 3GLGE 1CUCA 4GP7A 2GZDA 4FE3A 4TSRA 2A9PA 1ZMTA 1VI2A 1PE0A 2BMEA 4OGGA 4XR9A 3RUEA 3WLSA 4CV2A 3GUYA 3KLNA 4M9XA 3EEBA 4HN2A 1Y33E 3I76A 1W34A 3QTTA 4JKYA 3JTMA 4DLSA 1VRCA 3AJDA 2P9EA 5I47A 5JAHA 2ST1A 4AY5A 3L1UA 3AKCA 4R9VA 8ATCA 1ZNQO 2FF7A 3IX7A 1JDJA 1M2KA 4PHFA 1Z12A 3B51X 3ED1A 4O4LB 4CODB 2ZQZA 4YA6A 4L5IA 2Z8XA 2B35A 2I7CA 1X1BA 3IAM6 2F64A 3LW8A 2IE0A 3BVPA 3DR3A 4XOIA 3HEAA 2BD0A 1XF9A 3OLXA 1D3AA 4MCAA 4LQCA 4YEDA 4N48A 1RHRA 1TO2E 4KK4A 4ZCRA 1YCHA 3F96A 3A0UA 4JJ4A 2XCRB 2Q6OA 4HNGA 2PX2A 2FX5A 3GG2A 4QXAA 4V0KA 4IFIA 1XIVA 3H9BA 1R5NA 3IHKA 3K09A 3KQTA 1RU3A 4DA9A 4XM1A 2GRUA 1FXSA 5EE1A 4HSGA 5ENDA 2OBYA 4CL3A 4FGWA 4AQ7A 2IS1A 5KNBA 3CW8X 4YALA 4YAKA 1YS1X 3ZXXA 5L51A 5LP6F 1J1IA 2D4HA 3QJGA 4RYLA 2EGUA 4G6ZA 3TXYA 2HLPA 4EM6A 1QANA 1M83A 3N2LA 4U00A 5JDIC 1E2UA 4QG7A 4JB3A 1WEKA 2P5YA 2VDOB 4CKXA 1EXNA 1H6DA 3CJRA 3I52A 4JQOA 2P6OA 4LC9A 3RYHA 5KNCD 3DAPA 1NPYA 2CLHB 2QL6A 1XFAA 2JLRA 4JJ7A 4RKEA 3ST7A 5I7HA 1KR5A 5KINB 1CEXA 2Z30A 3E4DA 1WSDA 3H3JA 4PHCA 4W99A 1UFVA 1ZLYA 3PPIA 4FYIA 3X1DA 1XT6A 4C05A 5BNWA 3DM9B 2IEDA 3L9WA 3B53X 2IIVA 4M1KA 2P6PA 1TJNA 3NVDA 1LDEA 1J5PA 2WZCA 1WULS 2IGTA 3HDHA