3CQ9A

Crystal structure of the lp_1622 protein from lactobacillus plantarum. northeast structural genomics consortium target lpr114
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
202
Chain Sequence
TIVNLLVGGPTANYPADLTTIPGPWVGADRGALRLVKRGIQPVMVVGDFTVKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGRLDHLLANMWLVLDPVFRQWAPQIKLIDKQNSVRFFLPGDYQITKEADKRYLAFVPLMPMHLTLPDEKYQLDAAYNAYPISWASNEFSGNTGHFSFDAGVLAVIQSRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein lp_1622
publication title Crystal structure of the lp_1622 protein from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Transferase
total genus 44
structure length 202
sequence length 211
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 3cq9A00
2F17A 1IG0A 3MELA 3S4YA 3L8MA 3LM8A 3CQ9A 3K94A 2HH9A 2G9ZA 2OMKA 1IG3A 3IHKA
chains in the Genus database with same CATH superfamily
1BDBA 1ZMBA 1EFCA 1E4EB 1L7RA 2XNHA 2XMPA 4FCVA 3CKMA 4IEEA 4KV7A 3D3JA 4M1OA 3DEAA 2JASA 1DELA 4Y98A 4RHYA 3GDFA 1Q44A 1AA6A 3WDMA 4RA9B 1KE1A 3TUIC 2A9OA 4BN4A 1PV4A 4TMYA 1CUXA 1T2EA 4YX9A 1KDTA 1L8LA 3EVAA 5C46F 2CNKA 2HWWA 3DOHA 4G26A 4NAHA 3SIWA 2ZSIA 2C4TA 3TL2A 4UTNA 4BUJA 3VR3A 4O4IA 1VIDA 2PV7A 4V0OA 3PQ6A 1KAMA 1FDUA 2DHDA 3RROA 4LF7B 2UYOA 2Y1GA 1J23A 3RNOA 1T1GA 5F23A 1C81A 1QK4A 2X5JO 3EGOA 2FWAA 3OBIA 4AKSA 1T10A 5EWJB 1U8EA 3R9KA 1WW8A 4DRYA 3SQXA 1XTBA 4MI6A 4AKGA 4RYDA 3MJ4A 2J07A 2NX2A 1G7TA 2JFHA 2Q3BA 1T9ZA 3TLJA 5ICCA 1EEXB 1E6UA 2QRVB 1WRBA 2ZUBA 3BS4A 4PYIA 4R68A 2WUVA 4ERNA 4CKWB 2ID9A 4H1VA 3COZA 3GQBA 3N2NA 4J49A 2HV9A 5FOVA 1VTKA 1MJHA 2XJ9A 4PO1A 1LX6A 4DQKA 3WKCA 2YFYA 2JIPA 2BFBA 3ESDA 2QG6A 3LXMA 4Y2PA 2OQVA 5IUNC 4ALIA 1NVXQ 4BMYA 2CDBA 1SN7A 2GN2A 2JH3A 2XLBA 1V2GA 3RUHA 3HK2A 1LVGA 2PD4A 2W2PA 5BN4A 1WB4A 3G9UA 1FRNA 2I4MA 2JI8A 3G82C 1IRIA 3U6BA 5LIRA 4Z1MD 2OCLA 2WWRA 3AR5A 3TLMA 1JIUA 4YDRA 3MVEA 1X9IA 1EBFA 4QUKA 3RRXA 2BF4A 3K9QO 5BR1A 2UZIR 2BUAA 3NAZA 1V1JA 1CERA 1N8TA 2OQIA 3JWPA 2B8WA 2WIJA 3O94A 4FFBB 2ORIA 2AJ8A 3K1JA 5BMOA 3HKDA 5IK2D 2XRFA 1D0VA 1D2GA 1IJBA 1RCFA 3A14A 4NK5A 3ZWCA 1POWA 2O8DB 3F5FA 3OPXA 1TQHA 2QTMA 3BF7A 2HBRA 3DL7A 5DGTA 2PY6A 4D8YA 3MTQA 4L02A 2OP1A 4ZT6A 3DYIA 5L3SA 4P1ZA 2VTVA 3HBAA 3F74A 4YCMA 3D8RA 1XEXA 5KCZA 1YKSA 1P81A 4WZ6A 4JJ8A 4BWVA 4KQ2A 4HBGA 1Q20A 2RGEA 2PWYA 3VU1A 3BE6A 3T7KA 1OLXB 1X15A 2RB5A 1RAIA 4CQLB 2HCJB 2P75A 2HPZA 3VISA 1P2FA 4LC0A 3BGVA 4MH0R 2C07A 4PLHA 4DEYA 4Q3CA 1G3QA 1J07A 2QU7A 2CMKA 1YRBA 3EW9A 3FH0A 4M0EA 3ADDA 2QJWA 4JI6B 1RXSA 3RRJA 4A26A 4ISCA 1ZVQA 3ZYCA 4RE5A 4WXPA 4EH1A 2CYCA 1SUBA 4EG7A 3H2KA 3JZFA 4K9MA 2FEOA 4KYUA 2ADOA 3MS4A 1AO3A 4IW3B 3HKBB 3OCJA 1JWLA 2Q2WA 4S1WA 4YJGA 4Z6KA 2P6NA 3QNUA 2BFEA 4Q16A 3T9DA 1PWHA 1Z83A 5C1IA 3H11B 4MEJA 1SA0A 3DL2A 4FDMA 4U0JA 3HNRA 4KWCA 3LC0A 2VRNA 1PFKA 4CF3A 4H18A 2Q5QA 4P7GA 1UBGA 3MGCA 2RHTA 5KYYA 4KMSA 4EDFA 1UXOA 3MWEB 5KJEA 3C5EA 3DPSA 3FCXA 5ULLA 3AP1A 1CUZA 5IWAB 4LZAA 3QTBA 1MABA 2EF1A 4QEKA 2IS4A 1S2NA 1NQ5A 1M73E 1XQWA 2HHLA 5FT9A 4ESEA 3G79A 1AZTA 2JFZA 2JK1A 3ND9A 3SJCA 1H1TA 1COZA 2B6HA 1I1OA 1WR8A 1M5UA 3F5SA 5LPNA 4GOND 4NVRA 3P71T 1XXHB 1MV8A 4LXYA 4D0LB 2G76A 4URUR 2F6RA 4RMGA 1JI0A 2VSQA 4PINA 1QDEA 2W93A 3WYAA 3K0CA 1DCMA 4FFPA 4F2GA 5KYXB 3HRHA 1YJBA 1NX6A 2F3PA 4EJSC 2BJWA 2G0TA 2DY0A 1JG6A 3E61A 5EWMA 5U4QA 4OQ4A 4UOQA 3GLIE 3DCNA 2PVPA 5ICEA 4DCUA 3GJ0A 5COBA 7ABPA 1ICEA 1L7OA 3M6FA 4Y2QA 3LWNA 5IBCA 1ATZA 1Y1TA 1ZUWA 2IFTA 2EW8A 2FQYA 1VRCA 2EIHA 1HOXA 2G5GX 1ML3A 1YQ9A 4MULA 5J2TF 4C4ZA 1K1EA 3IL2A 3ZLUA 4JQOA 3GVHA 3HVRA 2C7GA 1OAOC 2XHZA 1J0XO 4M0FA 3DKRA 1Q91A 2PK3A 1X7YA 4BAZA 3F4KA 3DLBA 2YINC 1J8YF 1K5DA 3NV7A 3ASYA 2AXQA 4RMHA 2WU8A 2IYVA 3REQA 4M6WA 5FFNA 1G5IA 2XF8A 2YJZA 1G20B 4IQ4A 4CF7A 5I3CA 4YHHB 2XCRB 1U81A 4BMVA 1Q6YA 3OIUA 4GP9A 5EWLA 3A9RA 3NM6B 3SCZA 2ZT6A 2ECQA 3P2EA 4D4KA 1DQZA 1PS0A 2DZDA 2RK6A 2C9MA 2VPQA 3O3CA 4W9RA 1MNAA 1NJ1A 1GZSA 2CN1A 1RRVA 3OZ7A 4UAVA 5CLHA 3E2IA 2OUKA 2JFNA 1SHKA 1JLHA 2ZJ2A 4IX9A 4UARA 4JXJA 1N77A 4AY2A 4NU0A 3RSQA 1JDPA 5BUQA 2XRMA 1YR3A 3VPXA 2VAVA 5IJ9A 4PRZA 2NU7B 2EJCA 3ANSA 3TDMA 2M98A 4MP8A 2JGFA 4YAUA 3MLEA 4A6DA 5M04A 2E5FA 1XMPA 1D1QA 1VC2A 1XJ0A 1VOTA 5BSMA 5DBFA 4AY6A 1RTKA 2RI0A 4OQDA 1ZC4A 2Z5VA 3WMEA 4HWKA 5FI5A 4BASA 4IZ6A 5FR1A 3PYMA 2P9QA 4L28A 6GPBA 1SMKA 1Z4KA 4G5QA 4XVQA 3RRNA 4IS2A 4RWZA 5CRIA 1WOMA 1U1DA 4NOKA 3F97A 4K86A 1W34A 4KB5A 5FBRB 4ESHA 1QOQB 2FU5C 2QLBA 1ZI8A 3O4VA 1PDOA 5JCPA 1COWD 3X1JA 4Q4CA 3K2EA 1NRIA 3BTUA 3IEMA 2EKPA 3PTLA 2ZE6A 4B0OA 4U7JA 1HPLA 3I04A 4B4OA 2PSFA 1V3TA 2Q5LA 3T5PA 4IS3A 2P2SA 2X15A 2ZTLA 3M1YA 4PE5B 3RSCA 1IOVA 5AHRA 4BBPA 3U60B 1LDBA 4LF6B 3QK7A 3AVTA 3GGOA 1A9XA 2XMCA 1CUGA 1UPUA 3H5IA 4P7JA 4PX3A 3W4IA 3B1FA 1VI6A 4RSMA 1A04A 2KLHA 3WLRA 4BV2A 3LAWA 3NC1C 3LDAA 3VTAA 3BHJA 2NZWA 4O1MA 5JSKA 1G4AE 3PC4A 2QGNA 1ZMRA 1XCGB 4C7BA 3BGIA 4LOLA 1JGTA 2HGSA 1I01A 5WRFA 1TAGA 2MT9A 3HJFA 5EN4A 3ENNA 3FDFA 5AR1A 3ZU3A 3BJRA 3DJFA 3AO0B 3BULA 1RWVA 4ZZ2A 3T3OA 4KQJA 3BHIA 3WHLA 1PTJA 4JQYA 2H1WA 4C2BA 5CYFA 2Y1LA 2WYVA 3OQNA 3QLVC 2C2MA 2W4MA 1ODFA 3HYNA 3IUQA 3LYAA 1Q15A 3GRUA 5CR9A 1Q1QA 2H65A 3N3BC 2I6UA 3UC9A 1X70A 3H2YA 4D1YA 2PPVA 5ADWA 2HW8A 5ALOA 3AUJB 3MWKA 1PGOA 5EZQA 2IP4A 3IHKA 4OJTA 4TKVA 5I6DA 2DR3A 1E3SA 1B6GA 3IUEA 4IMJB 4NPAA 3ZHXA 3GAMA 3OTOB 4QU8A 2RGRA 1I2DA 3EUFA 1LLQA 1KJIA 1ANKA 4RS4A 3MELA 3EIHA 3I1IA 4RKQA 2VAXA 2H85A 1UZMA 5IBQA 3S2ZA 4UTVA 4YXFA 5K6AA 1JR6A 4LWOA 4ND7A 1YMVA 2J3MA 2D0IA 2E48A 3BSFA 3ZJ5A 2Q07A 4DLXA 4J1QA 3PQEA 1FLDA 4QOFA 3PK0A 4EA6A 3HDQA 1R8XA 2IS6A 3Q41A 1MH1A 4IDOA 7MHTA 2ZYSA 1Z63A 2Q49A 2R3SA 3AEZA 5ADHA 4UUBA 1YB6A 4PPGA 1EYZA 1QS0A 2O05A 2A7XA 2X6RA 2YUIA 3O4IA 4Z8XA 4AI6A 2W00A 4O1HA 4INZA 3RCBA 1JA1A 4B2IA 5EZYB 3B1YA 3PT9A 2FSFA 1A98A 1Z0JA 2ZT8A 1SR8A 3M9WA 2OE2A 4Q3KA 2DERA 2O3RA 1AJEA 3K2IA 3R7DA 4O4LB 3TPFA 2E49A 4AJEA 3GAZA 1GA4A 2GO7A 4F3RA 3CYFA 3G6WA 4LK2A 4IIGA 4NYIQ 3ZHUA 1GITA 2WAMA 4OBXA 3AB7A 3SX2A 4QA9A 3FFWA 5ALZA 4ZTBA 1SC4A 1VE3A 1JR2A 2H7XA 1NA5A 3TIVA 3OA2A 3WKBA 4FOLA 1SD5A 3SR3A 1I7QB 3FE2A 4Q1BA 2YW9A 4FGSA 5EFZA 4QOGA 3WFIA 2DUNA 2I67A 5B1YA 4K6CA 5JRJA 8GPBA 3WWEA 2GM5A 4YJDA 4W7SA 3D2CA 3E9RA 1DT5A 4JP5A 3QKSA 1KBOA 4IIJA 1L5MA 4ZT4A 2ZSHA 2WNIA 3SVZA 4FE7A 1I10A 1J09A 3TJMA 2PH3A 3H5WA 3OUUA 3V4OA 2HSGA 2OSBA 2WTEA 2B0JA 1R4MA 3PYLA 4OXNA 5A3QA 1US8B 1NZJA 3FIJA 3VJRA 1MBZA 2XAAA 5KAPA 2XXBA 3OE7A 5JE8A 1X2EA 5JS2A 5IF3A 4C2UA 3QITA 5HS6A 4AJPA 3BF8A 4ED9A 4E46A 1BH6A 2Q8QA 1LNSA 2FGKA 4MHOA 5K09A 2JZOA 3PL5A 4IV0A 4Q3OA 3ZGNA 2JDID 2RSLA 1BWPA 4KXYA 1D4OA 1L5WA 2EKZA 5GGXA 3HEBA 3WNDA 1TDJA 3B9PA 4Y0AA 3O2SB 5B36A 4YECA 1T2NA 2AMYA 3EIXA 2YVQA 3UV6A 2WJIA 3C4JA 3LFUA 3ZDRA 3VO8A 1E99A 5EXSA 3TGWA 3O73A 1E2JA 3BH6A 1F0NA 3GWGA 4XUCA 1E3WB 3Q5EA 3PFKA 3VPDA 1YMQA 1LZLA 3ZJYA 1KZ9A 2ISSD 4Y6SA 3MHPA 3JYLA 1KJYA 3DQQA 3HU3A 1OLOA 1NU6A 3QEAZ 2XGJA 3GOQA 3KYDA 3N3AC 4QGGA 4E94A 1XF1A 3N0XA 3PQ5A 3PC7A 4C04A 1L5FA 5KQLA 2FW8A 4E32A 3IQWA 1DDOA 1OZAA 1FX1A 1TO1E 1XC7A 2XQVA 1L7PA 2Q0SA 5BQPA 1M0SA 3GZNB 1YA8A 4LY6A 1H23A 5CT6A 5TQVA 4JR0A 2XMZA 3T3GA 4D0RA 4C0SA 1JDBC 3WJ2A 1FS5A 3DMPA 3SQDA 4Z4QA 1XZJA 3U3JA 1Z16A 1RI4A 2ZJBA 1HYQA 3JQEA 1GAWA 2R11A 5DE3A 4O63O 2YHAA 3PNKA 3FPHA 4D0GA 3RTBA 3G1TA 1SUCA 3H8JA 4B3IA 2AYZA 2YXDA 3SG0A 5EJFA 1MD9A 3FXAA 3ONWA 5CGQB 2Q50A 4HRYA 1KEKA 1T91A 3X2SA 3WYNA 4EKEA 1M2KA 5B57C 5KTKA 1WCIB 1KK0A 2HN9A 2VBIA 2WA1A 3BWCA 2Q0HA 2PGNA 2YHIB 3RUFA 3VMFA 3ZV5A 3ZCTA 1PJLA 1WDTA 4BE7B 1KWKA 3S1SA 4M1MA 5FPQA 5AJUA 4MVWA 1NDHA 4U00A 2OV3A 2JIQA 1GAJA 1M1NA 2Y9PB 2ZYWX 3BPSA 3KELA 2OPBA 4G0OA 1BGVA 8ATCA 4JLAA 2H54A 2VT3A 2QRNA 4N12A 3TTSA 2ZYDA 3HYTA 3KR0A 4MVJM 2WWVD 1YOVB 4TYPA 1ISHA 3GLFB 3IP6A 1RXUA 2Z1DA 1MIOA 1TC2A 3ZDYB 5KYNA 1UOPA 1MUUA 1R50A 1Z26A 4OHXA 3O4HA 3UB3A 2NU6B 4KTTE 4N82A 1HETA 4BP8A 3KQHA 1TXGA 2OOKA 2JKYA 4RIFA 1U1GA 4DGQA 2E4XA 4OJQA 3LA8A 5KVSA 1OBOA 4DMFA 2VXBA 3AEKB 3B82A 3IIEA 3LUDA 5LA6F 2NTNA 3FVWA 2RFLA 3RAGA 3TZBA 3GRYA 5SZJA 3NH6A 1GR1A 3V48A 5FAKA 1P44A 2RHJA 2PM8A 2FOXA 2G1UA 2FTKE 3I2YX 1A9TA 2CD7A 3L0PA 4JJEA 4Q93A 1PGNA 3V8EA 3R7NA 3ZYZA 4EG0A 5K8CA 3EUWA 4OQZA 4LNUA 3AFOA 2CLFB 4C4RA 1ZIPA 4UNQA 4ARVA 3QTTA 2XB2A 2BY4A 4MUNA 1P6QA 4HZUB 3STVA 4YCCA 2RGUA 4OUKX 4RF5A 4U6QA 3W2HA 4RKWA 4ZK6A 5CT4A 2VK8A 4K8OA 1ZR4A 3HY3A 3IUYA 4MICA 1ID8A 3E22A 3EEQA 1FPQA 1EP9A 1XTUA 1V5WA 4BGVA 4IHKA 1IWPB 3A2KA 3JAMA 5KS2A 1OX5A 2CXHA 1UZUA 4NSNA 3IUPA 3QKRB 3DL0A 3RQSA 2PGLA 5I45A 3JV7A 5IH3A 4MUKA 4DWOA 5CM9C 1HDYA 2YWGA 3OZRA 3ZHRA 1RMTA 4EL5A 3JWJA 3D4BA 1ZG3A 3GGCA 3T8YA 4PCLA 2FFBA 1G8PA 1C4KA 2PGAA 1XZHA 3NGMA 1S1CA 3ESZA 4CG3A 5C8VA 1LU9A 2BKUA 1KQOA 1JLSA 4YWHA 1H9CA 4RC9A 1XLTA 2ECPA 5L53A 5ER6A 4LSWA 1X92A 1KYZA 5K3EA 4HWSA 3TR0A 1HNWB 1P1HA 1XPRA 3OLWA 4JLWA 4X7RA 3LA6A 1JHRA 2ZIFA 4UJ3A 2XVAA 4ZYVA 2VNJA 3FDIA 2HJRA 5A9TA 1TEXA 1C4WA 3A4MA 3P9NA 4YMHA 4HLNA 1PSDA 4AS2A 3C15C 1ETUA 1Y9AA 4C0HA 1ODCA 2WM3A 4E5KA 3EZXA 2HU7A 3B3QA 1GNTA 4KUEA 4L16A 2F59A 1LFDB 4U7FA 3WQBA 3GLGA 2VH2A 1XRJA 2V7GA 2A9KA 2PX2A 2VDWB 3EA5A 1QGYA 3ZE7A 4DYDA 2ZJZA 4XQGA 1Y4DE 3D3NA 3QE0A 1JJBA 1FS4A 4MQ4A 4XASA 4R6WA 4C0LA 4DWWA 3FNFA 1ZD1A 5T67A 1Q7BA 1N5JA 3QEJA 5K3AA 4A2QA 5FA8A 1W44A 5J40A 4BNYA 4YT2A 4RTSA 5HSGA 1E0DA 2F43B 2WUWE 3FZEA 3ITDA 3LY8A 4HP8A 4OHBA 1NLYA 4UU7A 4ZVSA 4F6CA 4QG3A 2PL3A 4FWBA 4B80A 1H6AA 4S12A 1CULC 1SELA 5T7BA 4Z9YA 3P8ZA 1Y9JA 3AK4A 3RYFB 3U80A 3THXB 2EW2A 1J97A 5JCOA 1YI8A 5K3CA 5CEJA 2ON6A 4C78A 1UR5A 1NURA 1ZNYA 1W5AA 2F3RA 2Q9AA 2XQGA 3HDHA 1O5IA 4UAUA 5IUJC 4RD0A 2JBAA 4D9JA 5DXAA 4F5ZA 1TUGA 2QENA 1PR1A 3TJZA 3CRW1 3FCEA 4UU1A 1HZJA 4EW1A 3PFIA 4DLKA 5FTMA 1Z7YA 1JBKA 5CB6A 1RWOA 3K0CC 2IYFA 1DX9A 1GL3A 4XTRA 3X1ZA 4DC0A 1QYIA 3VC2A 1N9ZA 3KQNA 4MGIR 3IP5A 3OSUA 3ZW8A 5F7JA 4NOMA 5LZ4A 4KXLA 1QHYA 1ZBDA 4H4CA 1B15A 3R7FA 4ZVUA 3AUUA 4FEAA 2D13A 5AW9A 4I4LA 1DU4A 3VPCA 4EYQA 2GK3A 1XQXA 4K1XA 5I7EA 1LB1B 3NBXX 5HEKA 3MQ4A 1HG0A 1M66A 1Q92A 4IF6A 4QYXA 4BATA 4R9UC 2HWUA 5BSFA 1CP3A 4MPJA 2X4LA 2MMGA 2GEUA 5LDHA 1RJ9A 1RKQA 1VKNA 1PUXA 1K2WA 2H63A 3DEJA 3MFQA 4P4TA 3NHMA 1RE1A 2RH8A 2X14A 2RHHA 2ROQA 3E1KA 4FW9A 4OKSA 3WNBA 4F2HA 1VL5A 1DS6A 1URPA 2EF0A 3RG8A 2FEKA 3OPQA 2R6HA 3P9SA 3R3JA 4MWGA 2B82A 1GPUA 4YBZA 1UDXA 2GXSA 2WZBA 3DHNA 1UOEA 3T3EA 4H1WA 1LC0A 3EASA 3ESQA 3MMXA 1Z2NX 5H81A 5KYUA 1F12A 2IHZA 3KYJB 2HYIC 3I1FA 3QQ5A 1XRMA 2CLIB 3TMAA 4RTRA 5L45A 2IRWA 1N2CB 3QUBA 1P5RA 1VLQA 1W59A 3ACCA 4HDSA 5DI3A 3GW8A 5G2OA 4BN5A 3EDOA 4BTEA 4H16A 2CD9A 4UCQA 3UHFA 1KFJB 2BP7B 2CVHA 3H4TA 4BV8A 1JI3A 2WYIA 4OI4A 2WB2A 221PA 1L8QA 2H92A 3RPEA 1DV1A 4GWKA 3VKWA 4DIKA 5AVWA 4HT3B 4YT8A 4EEZA 5JLJA 4NS1A 1VJTA 4CUZA 1QYDA 2ZB8A 3FYCA 4JU8A 2PZ8A 1YE5A 1FFAA 2Q7DA 2FWIA 4ZOLF 2OKCA 2I80A 2IDJA 3OHMA 4RESA 5ALLA 4Z0PA 5JSZB 3THWB 1U7HA 3FDJA 5F73A 4A2PA 4DDMA 4CNBA 3VQTA 4IJMA 1GZ6A 2CJWA 5JDIA 2OD7A 3NNSA 4X1YA 3WRXA 4OBWA 2WPDD 4YP1A 4UTRA 1ISGA 1HYGA 2PEYA 1IWBB 4U7HA 2I7TA 3F6YA 1KDYA 1M2GA 3OM0A 1T5HX 1X1CA 4P92A 2QP3A 3CLTD 3HR7A 3O84A 1P2DA 4DKJA 5KDLA 1TD9A 4M9ZA 1MB3A 2JJYA 3OAAD 4GX0A 4XSVA 3L4KA 4LE0A 2WQ7A 2RG1A 4R8KA 4D4JA 1OYVA 2ZIXB 4C0BA 1ST3A 1N4DA 1OFIA 4QGBA 4QC2A 4B6QA 1K9SA 3CB4A 2H5EA 3GZJA 3PP8A 5CPFA 1A9YA 1V9SA 1XTVA 3C24A 1WZNA 3F5QA 3VVCA 1DT3A 1Z73A 3C74A 5J63A 1P8AA 3ZCQA 2CCKA 3BL8A 2CCJA 3FDZA 1D09A 2YQ4A 1QR2A 2AGVA 4YO7A 1J25A 2B78A 1J7JA 2EV9A 2PO5A 1N92A 4M0MA 4OXQA 2ZUSA 3A3PA 1RJFA 2H1LA 5A0VA 4BX3A 1TUIA 1Y98A 1V1RB 2C8LA 2PFGA 2GAOA 3F6CA 4CTNA 3R7SA 2QD4A 4WE3A 4DREA 1PTJC 1ZHHA 3OG9A 1RKVA 2C5SA 3GC6A 3HVJA 1G3RA 1JNYA 4IOMA 1JHXA 4Q9IA 1QYRA 5B1HA 4CL2A 4WFQA 1DQRA 1WWKA 1VL0A 4M76B 1KOJA 2LR0A 1IY8A 1F2UB 1NY5A 3OKAA 3D0QA 4KXXA 4D41A 4FEGA 3Q3JB 4FHFA 2QY6A 1DQPA 3HVKA 4ZV7A 4R8MA 1JBEA 1WP4A 3FR7A 3KXKA 4FYWA 4OREX 4DIDA 4NNPA 2G9VA 4QIHA 5J2UB 3MGAA 5JAHA 5LWHA 1S2GA 5IASA 4MIEA 3U16A 2VK2A 3KETA 3DXXA 5D5PA 2G9QA 3FPAA 3HZOA 3PE4A 4UPEA 3AERA 2X9LA 2G1AA 2X23A 1F2DA 2CLEB 3AHFA 3FYTA 5EZ5A 4QYSA 3UFXA 1DG3A 2XNJA 3KSZO 3N1UA 4FJ0A 5KYVA 4I4TA 2PLFA 4M9QA 3O03A 4TRMA 3V9AA 2UYHA 2EWMA 2MHCA 1GQRA 1W52X 2QUJA 2Z57A 4NK4A 1CUYA 3EZNA 3I92A 3JYOA 3N2IA 3C39A 3M33A 5HQTA 1SCNE 2WU0A 4WXEA 2JZCA 1QGZA 4DUYB 1NVFA 2XE8A 3HHPA 3BMOB 3LBHA 4YDHB 2DCMA 5DM1A 3VBEA 4CR7A 1UWCA 4RHEA 5ARCA 3K0AB 5IAJA 1X77A 3IERA 3THYA 1T5OA 1Q7RA 2D59A 3ER9A 4IOLA 1ZGCA 4CN8A 1OFVA 3OZVA 4O3FA 2ENWA 1B6SA 4CM6A 3SQOA 2DJ5A 5KB3A 3H4MA 2VKTA 2Y1XA 2J1LA 1ECCA 1NG1A 3H17A 2MYPA 2X6TA 1K6JA 4I5IA 4CQJA 5F64A 4FMDB 3Q0TA 1G7RA 1U2GA 2BE9A 4FILA 1ZVVA 1RVV1 4B83A 4H2DA 4M99A 2VK1A 2X7XA 1JQAA 3IESA 4PICA 1K4MA 3JQ9A 5DGDA 4WOKA 2IBSA 1RXWA 1I8TA 1R12A 3HO8A 3NWJA 1XVTA 1UQTA 1Z0KA 3L8DA 3R8XA 3MMPA 3C8DA 4LCJA 3E2PA 3IH5A 2NGRA 1U28C 3P9QA 4DA0A 1G0NA 2V55B 8LDHA 4WRRA 4FIDA 4B6GA 3UG6A 5BPHA 4EUSA 4AMVA 4U2KA 3U56A 3QTLA 4ZV4A 1WMDA 1Z47A 2BKLA 3GZ4A 3PUVA 1ZZEA 2IY9A 3MA0A 2O4CA 3B6MA 3DPUA 3HP1A 3NIWA 3SVTA 2NO0A 2UZ1A 4DUGD 1P1BA 2AR0A 3CGGA 3RSZA 4FI3F 1L5GB 4DNOA 3JASB 4BMCA 1T34A 1Y8RB 3LX5A 4OFBA 4CMIB 2G9UA 4RZ3A 3T9EA 3ML1A 1A1VA 1CIJA 1XRNA 3IUBA 1TF7A 2BFPA 2Z2JA 1R88A 3Q3GE 4RD1A 4TV8F 2VYFA 2ZR0A 3DWFA 2D00A 4EB3A 3WA7A 4UFOA 1EGAA 3LY7A 4TV9B 4ZXFA 4KR6A 1OFTA 3KZKA 1UBOS 4MUJA 3HWSA 3CVWA 4N0PA 4ZQHA 3IKLA 4FDAA 1SKQA 1A2QA 2GUGA 2ECOA 2C3YA 3DTVA 2IYYA 5E6SA 1LTQA 1WCWA 2A0YA 2LCQA 1I6KA 1S3IA 1YHZA 1EUDB 1I51A 1JIJA 1I13A 5DNDA 4DADA 2D8MA 4YV7A 3FPSA 2VJOA 1YBMA 2G6TA 3F6RA 2CYBA 3Q2OA 3ZCPA 2PG3A 1BXRB 2QE7A 2Z95A 3M2TA 4V1CA 4HDMA 1MPTA 5CG2A 4Q5IA 1AK1A 2E2WA 1BMTA 3C4QA 1TM4E 4V0MA 1HTWA 1BJRE 3A9TA 4GFDA 4LTNA 3AY6A 4CI0B 5HP4A 2WM8A 4HJXA 3UCXA 4F93B 1N0HA 1RLTA 1XZAA 1JTFA 3AF6A 1UWKA 1CQWA 2XUIA 1PQUA 4FU0A 4E14A 4YRZA 1YGYA 3HJGA 4KUGA 4AB1A 1QH8B 5H16A 1XHLA 2X4GA 4D3ZA 2PU5A 2JFVA 5HKAA 3EYWA 1TU0A 2G08A 5F9HA 4K88A 2E4VA 3KWMA 1NKTA 2IQIA 1U3GA 3HHEA 3PDUA 4BO6A 4G4IA 1IHYA 1WMAA 3M4NA 4BPBA 1ZN2A 2PZAA 3IPCA 1YVPA 5DW3A 1E32A 2EX0A 1OGJA 2VDNB 3OIYA 4MARA 2WHQA 3WQRA 5JMWA 4QUEA 1W36C 1RI1A 1J8VA 1NVAA 2YZ2A 4JLUA 3WQHA 4FGJA 2YWXA 4ND1A 2VPZA 5FKJA 1F1BA 1XZCA 2JHPA 4D9MA 3IEXA 4INOA 1O97C 5JZOA 3W1VA 1HKHA 2WJAA 1U5BA 2OO3A 3AY0A 1MAAA 3KFVA 4PZLA 5CNKA 1TC1A 3KR1A 2KS6A 4MQFA 4C1BA 3K3PA 5HDQA 2HBYA 3H86A 4HFJA 1T3SA 3GJ8A 4Q7EA 4NBRA 3X2EA 1WS6A 3SR0A 4HEJA 3UT6A 2PFSA 2DF8A 4NCIA 3PFCA 2Q7OE 3SC6A 2FMUA 4HXEB 1JPVA 1NR5A 5F52A 3TE7A 4CIYA 4IZHA 4IF4A 3UK6A 2ZREA 3UPDA 3BA6A 3FR8A 4QQFA 4AY4A 3QEMB 3FFAA 7YASA 1GGMA 5EJ5A 5B3AA 4JB8A 1GTMA 4P7BA 1W581 4H6PA 2ZE5A 5CA1F 1NR7A 4C89A 4ZI7B 4X64B 3E84A 3EJWA 3WISA 3SHFA 2P6MA 4BJ5A 3K73O 1ULTA 1P77A 5K51A 2MSLA 4JJKA 1XX6A 2JGNA 4KQGA 3UV7A 2JBWA 1HR0B 1W19A 4M37A 3FUUA 5LXTA 1KI6A 3IULA 1S8OA 1MV5A 3SICE 3BE4A 3WBBA 2G1KA 4EGJA 3J80A 3QVTA 2AFIE 4PHCA 3O8CA 3D31A 3KT3A 4FXOA 4NQRA 5AOVA 1OU0A 2YIMA 3PD1A 5SYAA 4YUVA 1PHRA 5DSTA 2A86A 4KIWA 3PWKA 5IJ0A 1OYOA 1IY9A 4QE3A 2B3DA 2PRZA 3DEZA 2GQ0A 3CPSA 3G5LA 4ZANA 3KU1A 4WBXC 3T5BA 1VCOA 5M29A 3AG6A 5H80A 4JSYA 3O95A 3CVXA 1XCJA 4ZO7A 4H1UA 1ZNZA 2D2IA 4ZAGA 2P2NA 1GGJA 2W6PA 4Q3AA 4DLVA 4WOJA 5AKLA 3VDXA 5MN6A 4MUHA 3CONA 4WK6A 4HV4A 4O4IB 1N6HA 5J23A 4RBNA 2Q5EA 2Q4TA 3PF9A 4XQEA 3HCBA 5DX8A 1XLTC 1ZIOA 1CEYA 1PN3A 2QT1A 4R2XA 1Z62A 2VUUA 3I9MA 4H4DA 1WOYA 1QJ4A 3CX8A 4GBED 4P4LA 5FHQA 3NJ8A 3UIEA 1DQSA 3EEFA 5EXTA 5HFAA 3GDOA 4NBLA 4Q4JA 2Q1XA 4UE6A 4JWKA 1SU4A 4NH0A 5LLTA 3FMIA 2C4MA 4ZC8A 4K87A 1TMGE 1QO0A 2HWXA 3GQBB 1JNXX 2BYTA 1J0CA 4LDZA 5JSQA 2GJ4A 5JYCA 3LC7O 1OJLA 2BFBB 3AXSA 1EK5A 3HRKA 2Q1TA 3MMSA 3MWJA 4LAFA 4BNVA 2HREA 3BAFA 1RWXA 4GPZA 5TSDA 1W9MA 421PA 1HLFA 4D5EA 1D6JA 1S2LA 2PAAA 1FBNA 3BWXA 1IOLA 3N7AA 5EP3A 5BN4B 4ISBA 3SBEA 3NEJA 1V7CA 3BXOA 3PQ7A 3WI7A 1UKVY 2CMDA 5PGMA 3ZGVA 4ZIRB 3SLGA 4JYZA 2HZ7A 1GFWA 3V2IA 2V7QD 3AI7A 1QIIA 2C0PA 2CK3D 2NACA 1OFGA 3OZTA 4FZVA 4XDGA 3VVLA 1FFHA 3OWXA 3D6JA 3HWRA 3P0IA 4FC6A 4L5BA 4ZHQF 3PWZA 2B99A 4UVHA 3HKDB 5IF9A 4CLOA 1I0IA 1H69A 1TA0A 2B36A 3U3MA 3UHJA 1Z0ZA 4IHJA 4W4TA 4F9EA 5JCOC 3HWWA 1Z33A 2HEGA 2QX7A 2O0JA 3SKYA 3RVMA 2O23A 4EARA 1E8MA 1Z8FA 4LJ5A 4MMZB 5L3SB 2BFNA 3OECA 1XEXB 2WUFA 4M0LA 3QE3A 3D5TA 2JGMA 3CHYA 5LCXA 3MFYA 3VPGA 3LYHA 2Z1MA 3MBOA 2DULA 5TF0A 5SICE 3D81A 3I4CA 5F3DA 4Z1MA 4F45A 3AL0C 1NXQA 2OHJA 1WSAA 1FK8A 4H77A 1ORDA 4PPFA 3WL5A 2O8EA 1KXZA 4M7RA 1BQEA 5ILGA 1BE8A 1YJQA 3FAKA 3DO8A 3TPZA 2FMTA 2B1JA 3PHLA 1DJLA 4PQRA 1ESEA 4ZU3A 2VPXA 3S1AA 2AW3A 4A91A 1V9LA 1P91A 2IC5A 3HDJA 5DHFA 1P9WA 4H6XA 2OFXA 2RGAA 3S2FA 3VR0A 3U5ZB 4Q7JB 4JBWA 3KYBA 1OZGA 1JVBA 2QY9A 1XZDA 1O0CA 2PUAA 3TW4A 4YJGB 3RO7A 3R77A 3WMGA 1MAHA 2BFEB 3ZV4A 3GEPA 1Q7TA 4N5LA 1V5GA 4WUVA 2FDRA 4RTQA 2ATCA 1YK1A 1E3DA 1NYQA 1SA0B 2GN8A 2YWRA 4YIHA 1FTNA 3R5SA 2PBFA 4YRAA 2PQMA 3ABQB 5KYYB 3FFBA 1HL3A 3DE5X 2VXYA 5IH7A 2UDPA 3ICVA 1IY1A 2DUWA 3H19A 4YJ3A 4KK3A 3WWZA 1MABB 1ZCFA 2C4HA 4QEDA 1JDSA 1PI3A 3G2NA 4C0XA 2RJNA 4M38A 4UPDA 1ZH4A 4IYRA 3PCTA 1OLSA 1DL5A 1LLFA 5TT0A 1XZQA 1OBHA 3O3OB 1V16A 3N7TA 2P35A 3R0IA 4GKJB 5A4FS 2CKMA 2ERCA 4RZQA 2RH4A 3RC8A 2GCIA 4BRWA 1WE2A 3MOIA 4OK3A 3ZV3A 5KSOA 1QPZA 4GXTA 4DR7B 1H2XA 1QHFA 3CR8A 1D5WA 1JLRA 3UMRA 2XAUA 2XADA 1GZHB 5EWMB 4J29A 5L3RA 2FKAA 4UTPA 1PL7A 5A9RA 3LT4A 5B30A 1V3UA 1RCUA 2B8NA 1SRQA 3DM5A 5EIWA 3I58A 3SXUA 1YH3A 3FUXA 1Y7IA 2C7OA 4J8PA 4BTLA 4P31A 1P0FA 1XUOA 4JBHA 3E48A 3NDJA 5JDIC 4DTCA 2D5LA 1XN1A 2V97A 2BGKA 5T41A 1SHLA 3WRXC 1XLUA 1ZMOA 1GSIA 4ALMA 1SEVA 4L0CA 4DA7A 2GRJA 5AW1A 2IUUA 4D9FA 3WK9A 1X7YB 1N6NA 4ETNA 4MS1A 1FC0A 2FLVA 5AVXA 4ITRC 3AJDA 2D7DA 3SBDA 1F8YA 5E2BA 1M2WA 5C8XA 1D2RA 3REQB 1VDMA 2B21A 3AW8A 4M6WB 3REFA 2ZWMA 2FA9A 5FO0A 4CCSA 4R2HA 4X0EA 2DFNA 4HB4A 5EWLB 3BWMA 3T3HA 4JI2B 2O1WA 4HYYA 3A2LA 5TMBA 4PXSA 4OI0A 2DU8A 2C7PA 2GI4A 3DB2A 1H2FA 2P3OA 3EVGA 1B8OA 1EHCA 2JIOA 3EXFA 1KKLA 4K9OA 2RE8A 4MSUA 2DETA 3TCKA 4WIAA 3AM3A 3WB9A 5IT9A 1FP7A 1YGPA 3DOOA 4GOKA 2WD7A 1U9YA 2PS3A 3IJPA 4B6OA 3OJFA 1O2DA 1Q84A 3SBXA 3L8EA 3GLSA 3Q3EA 4FSHA 1XVIA 2E7ZA 1QCYA 2FOIA 4JP2A 4Y6QA 3LCJA 2WMOB 4BJHB 1KORA 2PRSA 1E7SA 3TTYA 4G9EA 3A05A 4P36A 2CXPA 3A4VA 4DVJA 2O54A 2CWWA 3L6DA 2QN9A 1WZEA 4U7DA 5KVVA 3BN3A 2Q45A 3DAPA 1UKCA 1H2WA 4WKBA 1KDOA 1SHZA 1TA9A 4IJQA 4TUYF 2GKOA 4MW0A 4E03A 3QVKA 2CV1A 4XLLA 1EDEA 1YIAA 3BHNA 3PUIA 4KE6A 3I6MA 1YI0A 4WA7A 2VJLA 3L07A 2W2OA 5LYYA 1QG0A 1EFRA 1P2VA 2PPLA 3L0CA 2PSEA 3T1QA 2PBLA 1AKUA 1O89A 1QNFA 2QMUA 2VBFA 2BFFA 4QPNA 2NSJA 4ZCPA 5BSUA 1P1RA 3UAGA 3D1VA 3T7CA 4DB4A 1FXWA 1AKYA 3PI7A 1CUEA 4AK9A 3QQPA 2CNBA 4E09A 3CN9A 4POAA 1W46A 4WK0B 3CNQS 4Q1CA 3HDTA 4R05A 3U0VA 5BW8A 3U7RA 1SXPA 2AH5A 4LXXA 3DDCA 4EFNA 1FDRA 4REQA 5DBOA 3RIXA 4OAPA 1TIBA 1CUAA 3PFBA 4YLGA 5K3FA 1YK0A 1D5CA 3AZQA 3C1UA 3K96A 5BRAA 4QWMA 2EL7A 4N7MA 4MTLA 1GADO 1KR5A 3F3KA 4IH9A 4M9UA 2V3VA 1QF9A 3Q3IA 4Y2HA 2NN3C 4LOKA 1H1LA 3UMBA 1U7PA 4EEKA 3COVA 4G9BA 4LMPA 3CMCO 3WKAA 4JVSB 3SQMA 2PVCA 1R0CA 4OKNA 3U37A 3FTPA 4RZ2A 1NOIA 1ZSVA 2AUNA 4UATA 1U8UA 2V8OA 2RK3A 3R3VA 5FTWA 3PXCX 4AO8A 5EHXA 3A1FA 3NR2A 5A03A 2VQ3A 3W8FA 2ZIVB 1JWBB 5CH3A 5F51A 3RSFA 4FR5A 4D8TA 1V5IA 2O0MA 4TKVB 1E77A 1JSCA 3JCZA 4XYGA 2CFIA 2FUG1 1SIWA 1EX9A 3FTCA 4Z54A 4GYJA 3VR5D 3QUCA 3ANLA 4N76A 2WJGA 4MVJP 5AJTA 3SPXA 4DCJA 3ORSA 1T5IA 1BA3A 3C1AA 1P2GA 2BMEA 4NRDA 4RENA 3WYDA 4EMUA 4GSYA 5F77A 4RTJA 2ZI7A 3IJ5A 5ADUS 3SOPA 5J4KA 2GM4A 1O77A 3UN1A 2VJBA 4CKXA 4ZZ0A 1E1QD 4GZMA 1SK8A 2F1RA 2F3TA 1QS0B 3HCPA 4URHA 3TX2A 2CLKB 2UXCB 2P11A 5DN6D 3O83A 4RPLA 4QJBA 2KI5A 3O1IC 5DHUA 1E4OA 2JATA 1IPEA 4G2TA 2IF2A 5L6LB 3ZWAA 4RJ2A 1WSWA 4PZ9A 5C0OE 2AI2A 4INPA 1AXEA 1E94E 4MPTA 1HT1E 3HEAA 4NCXA 3CUVA 2SICE 3LYLA 3B1ZA 3MIIA 4AURA 2QN1A 4GH5A 2YTZA 4LWPA 2CL0X 2Y1FA 3CRNA 4W5QA 1N2OA 1KK1A 2ZK7A 3OF3A 3RK4A 1IY0A 2TMDA 3N6RA 3PI6A 2F4VB 5FYQA 5CLJA 1MFPA 2QRPA 3KUUA 1VIVA 4TQAA 2II6A 3QPAA 4W5NA 3BH7A 5E0OA 4IFBA 4OSEA 4IIJB 3SZMA 4IEFB 1XZIA 1PT7A 4HGNA 4OQYA 521PA 4BZZA 1MT0A 1K5HA 2NV0A 1K4KA 1BW9B 1UPTA 1Z7GA 3DBLA 4H3KB 3C5VA 4HGRA 4IO1A 1R4MB 4IFTA 3GAFA 4JUIA 4ZVKA 5K4GA 4ZICA 3AJAA 4LHYA 2QRGA 1A69A 1UBTS 2AXEA 3K5PA 4RMNA 4RVHA 4X60A 1F6DA 3DGEC 5B58T 5JJLA 5JS1A 3LP6A 4MGEA 1M8JA 2GHQA 4K46A 2AWOA 1N2IA 2WILA 4UHCA 5J3JA 2C5FA 4GC5A 2F8LA 4TWJA 3WWOA 3LS2A 3ZD8A 4O0MA 2C2WA 2JH8A 4EY6A 5C51B 2PUGA 3DCIA 2Z4SA 1ZA2A 1S6YA 4EJFA 3MXTA 1MG5A 1CR6A 4FFSA 2Y4OA 3NHFA 3WIBA 2GPWA 4F4FA 5M2QA 3G8CA 1TYBE 3V8MA 1B41A 1V96A 3H84A 2WLSA 4ZGGA 1KNQA 1L8AA 1I2MA 4B45A 2XV1A 1NZFA 4X71A 4S35A 5IW8A 2BMWA 3KQUA 2DG2A 3RJ5A 2F00A 3GUUA 3OFND 4OLHA 1PJTA 3E8MA 1FBTA 4K7JA 1KMMA 5FI0B 1I0ZA 5H70A 2B1GA 4GEKA 4UXIA 3HR4A 2RBGA 2V9PA 5DASA 1TRKA 1OI3A 2JDIA 3KYDB 3FYHA 4ANFA 5LQKA 2E55A 3LRXA 1T9HA 4BUCA 3ON5A 4EBBA 4P0TA 4NIMA 4NHOA 3IE2A 4H60A 1H66A 1NJ2A 1OROA 5GM2A 4EY8A 3ND7A 1PJZA 4NV0A 4R98A 5B6JA 4AXXA 1EK1A 2V7UA 1F48A 1I3MA 2DFDA 4TPKA 4O29A 2GFIA 3ZE8A 4MCJA 4A15A 5CB0A 3LX4A 5HKLA 4LCBA 1G64A 3ZHCA 2R1TA 1X1BA 3GT3A 2BUBA 1LC3A 2BTOA 4DAOA 1UMDA 5KQPA 5TLSA 1EX1A 4XI9A 3VKVA 2QW1A 2YFHA 4N3AA 1Z6YA 3C6BA 3NCTA 4ZO4A 5E6RA 3FMOB 1JAHA 3F7OA 2R6R1 4PTLA 3ZWMA 1UODA 3V7UA 4UEKA 1CZKA 1LRJA 5JFTA 1SVMA 4Q4AA 4C5AA 1J00A 4RIIA 1MHPA 4FR2A 4WNIA 1W36B 2C9BA 1NUTA 1QUEA 2Q6KA 1VL8A 1KI7A 3PRHA 4J1NA 4LDQA 4CM9D 4LMBA 4H6WA 4LTDA 1B73A 4IIBA 2NZJA 3I1JA 1AG9A 5JIBA 1WQ1R 3OO1A 3DAGA 4KL8S 1C3EA 2OXEA 1W73A 1OFUX 3AFGA 4QPCA 1TCCA 3WZLA 2RIPA 1R9NA 1IN6A 4F46A 4JCCA 1R6TA 2NSHA 4QQRA 4R5MA 1NXPA 2O19A 1M1NB 1QHHA 3I04M 4J7CA 1AMOA 3CZMA 2XPCA 3B9QA 3DTTA 3IE0A 3CH7A 2G71A 3KEOA 5D7NA 3FYSA 4TL6A 1R9JA 3RVBA 2GPAA 2GF2A 4E13A 1NQVA 1QWOA 3PS9A 4EQ6A 2XVMA 1PTKA 5C8YA 3R7AA 2H1IA 3QBVA 4HH4A 2C3MA 4G07A 4IICA 1ZNQO 3L01A 4GGMX 4NWIA 3U4CA 1AB5A 1MIOB 1QR6A 2WE7A 2BMFA 1EJ6A 2WKQA 4NZZA 1Q1AA 1PYGA 3WLOA 3VC7A 4PG8A 1G4HA 3IVRA 2Q27A 4MQ6A 4TLMB 4ZEOA 3B1XA 2VCYA 3OKFA 1SC3A 4MGKR 4GOMD 4P81A 3T7JA 1AUPA 3PA8A 3DOFA 5ALQA 5FD8A 1TB4A 1Q3HA 1OAAA 4B2YA 3BWYA 4AX8A 3KBOA 3OMLA 1LH0A 5TT1A 5FI3A 1T26A 3JQGA 4I50A 3GFVA 4L51A 4AX4A 5DWDA 1T1RA 4BLQA 4LNUB 2A94A 2FMIA 3E35A 3EGCA 3RC3A 3SD7A 2FUNB 2WT4A 4NMHA 3TB4A 2A1UA 2C2XA 1JQDA 1G8KA 2MR6A 4O2RA 4BNFA 2YYZA 1QTRA 3L93A 2D54A 1L7XA 1W87A 2CNWD 3SNHA 4FUTA 2RJOA 5B2ZA 2P6RA 4ESOA 4UQPA 3EIEA 3EGXA 4IDQA 4ND2A 2GBPA 1YRAA 2X76A 1GAXA 4ENVA 3OTWA 4ZEMA 4LRYA 4D9BA 3MN1A 2NVWA 2VL7A 4AW9A 4REMA 3HVUA 1WMEA 3OLQA 3KFLA 3ND8A 1XPUA 4X1KA 3NANA 2BM8A 5HGJA 3WG9A 2HZBA 2WJHA 4DDUA 2RGNA 1MKYA 3NFYA 4G5GA 5DP1A 1C9KA 2QRLA 3CA8A 1QYCA 4I55F 3AF0A 4BB6A 5KWVA 2IBTA 4KR7A 4XOIA 2BDUA 3LPLA 4QOIA 2FRVA 1Z2OX 2QP4A 4MKZA 1WKBA 1QCDA 5EERA 1ADCA 4CR6A 1KGSA 1UKZA 1BGXT 2F3UA 2A35A 3HCDA 1JMYA 1H65A 3DMYA 3HUUA 5FLKA 1F9AA 1WLSA 1N6RA 4JA0A 2PUTA 4CM4A 4BU0A 1G8SA 2C4NA 2AOTA 5CD1A 4JL6A 1XB2A 2GZ3A 4N6OA 3GRAA 4TS9A 4AY5A 3RE1A 1YVRA 5IN4A 3GJ4A 4AP5A 4BFXA 4I9UA 2H1SA 5LR6A 2G80A 1VKRA 1WJGA 3OM1A 4PLYA 4ZVRA 4GP6A 3ZR4B 1O3YA 1Y8AA 5KSYA 4IINA 2A1TS 3EZGA 1NYLA 2Q99A 1YVDA 4J9VA 5AHXA 5ED4A 3IEUA 2FR8A 4GPBA 3LX6A 3V1LA 1YS9A 2DSTA 3OU2A 4BDSA 3GLGB 2X0RA 3IRUA 3GEIA 1XA0A 1FTYA 1ZOLA 4NNOA 4Q1FA 4IHAA 2EX4A 2JF0A 4X8MA 5G53C 5K3BA 3E4CA 2Q1WA 2H7YA 1E9AA 3T52A 4B09A 1Z68A 3EBOA 2E1RA 5C8DA 1CW2B 2ACKA 2WWFA 3A1TA 3DZHA 3HFGA 4K2HA 4KH0A 4JCOA 3AT1A 4JVNA 1V11A 4WBSA 3PNMA 1V95A 1XA4A 1QIMA 1V4NA 3KVNA 2XH8A 1IBKB 4PAOA 2C97A 4KE7A 3R0VA 1XAGA 4UC0A 4P80A 4TM8A 2IW3A 3FYDA 1PDVA 2ZYVX 3P96A 3WLKX 2OCKA 3WK6A 2JBAB 2ISQA 2WWYA 4EKDA 3TDNA 4R6XA 1ZJJA 1XNHA 4LV5B 4YH1A 4G5SA 1P0IA 1U9ZA 2H4WA 2BSQA 3LF2A 4Y2TA 3RYTC 5HILA 5CITA 1LI4A 4ZYZA 4MWBA 1YQEA 5HW0A 4KWIA 2OXCA 5J5AA 4B85A 4MYTA 4Y30A 4JYAB 1FA9A 5KNBD 3K6RA 1HDEA 2I4IA 2PX0A 4HWOA 5K6TA 3ADCA 1KRWA 5CFQA 2FSVA 1GQFA 4TQUS 2I71A 1TMOA 2CE7A 4S1VA 3UJNA 5TJ9A 2ZG6A 3IJEB 2VRWA 2Y93A 5HMMA 2Y1KA 1RJ9B 4JC0A 4RFSB 2XT9A 4I7EA 2HWYA 1GO2A 4EYSA 3O2QB 3C3DA 5GZ1A 3U1BA 1P74A 4HC4A 3IP8A 3PDCA 1CUSA 1Z22A 2J5RA 1R3DA 4PG6A 1CRZA 1BCSA 1DXOA 4INAA 3QXSA 4W5HA 5DULA 5ECWA 1YNOA 1U02A 3ME5A 5BQ3A 1SQ6A 3Q0IA 1SHUX 2FSIA 4X20A 2H1OA 3N0VA 4OXYA 4RIHA 1T3GA 1WB5A 4B3SB 2QMOA 1OI2A 1VZ3A 2O52A 1ULSA 3A4YA 4L9AA 4WN9A 3KHKA 4YASA 5ALEA 4CMEA 3PUXA 1AHNA 5CD9A 3OURA 4MWOA 5ALGA 3WLTA 5BSWA 5KYUB 2JAWA 4HRXA 4F0JA 1ORWA 5ALDA 1MH9A 3R4CA 4QDXA 1P61B 4L5IA 5JS7A 4RDXA 4HDSB 1IZ7A 1MT3A 4YRCA 5DI3B 1J5PA 4K9RA 1Z2CA 4PXYA 4RK0A 3IOCA 2HB6A 2WM2A 3KP1A 3GMTA 4M7OA 5E3JA 2AI3A 1JR3A 5H4HA 1JN0A 1E3JA 1TT5A 1ZGAA 3LDHA 4I1IA 1MRSA 1N5DA 2I3DA 2ZRQA 1P29A 4RY9A 2WHXA 1G3MA 2PXAA 2XYQA 1WCYA 3DKIA 4M8SA 5BN5A 4D9GA 5LD2B 4KFTA 2CVQA 3KYIB 3EMBA 4HFRA 1QLHA 1BA2A 1N0UA 4OSPA 4B33A 3CKLA 3K9CA 5AKJA 4FIZA 4R8LA 3K53A 5ELMA 2A5LA 3TBHA 2H07A 1D4ZA 3AX6A 3DE7X 3I76A 1NT2A 1EM8A 1LSOA 1CZHA 2P9FA 2CJWB 4F9FA 4RGYA 4X1YB 3IEPA 5I4KA 2C1EA 3VA7A 3TD2A 1PGQA 1FS6A 1O94C 1VIYA 3FVRA 3HH8A 4RNCA 5FLEX 3U0BA 3RD5A 3B3AA 4IP0A 1K8QA 2Q62A 2CJYA 2J5XA 1N1MA 3Q2IA 3KSBC 2A8YA 3KB8A 3HXOA 4BQEA 6ADHA 2P68A 4RTMA 4KXNA 4BVLA 1Q22A 3FPLA 4JOCA 3TF5A 1DBQA 3LC1O 5DYGA 3T34A 3L04A 3HXTA 3SKVA 2JI4A 3PXEA 3VZPA 4P93A 1VHWA 1UFRA 2JJ1D 3K09A 3JZAA 3R5HA 3S8EA 2JIDA 4DNPA 2H1HA 2WYUA 4KLAA 3TM4A 1WPRA 1KH2A 5BORA 3C7TA 3UAWA 3NVKI 3BWDD 3VNRA 5CDYA 1V0JA 2H11A 3FDZB 4BKPA 4GIBA 3COYA 1BIFA 2PLAA 3UK2A 1BMDA 1IBSA 3UOAB 4B34A 1YTUA 1H6DA 3OAAA 4D3YA 1E2GA 1SUSA 2CDCA 1QQTA 1BEZA 3OETA 1LJLA 1XK6A 2UYQA 3KAQA 4UNRA 5KTNA 1S0UA 4OM7A 2LD4A 1I6MA 2PXCA 2VEDA 3OD1A 3RVKA 4UQLA 1MX9A 4LF4B 1Q1GA 1FU4A 2FLWA 5TR9A 2NTEA 1JKJA 1FP6A 1KO1A 5DX1A 5T4HA 5EHZA 1KJJA 2BEVA 1SCDA 2QUAA 3BDVA 3PC3A 1HV8A 4GW3A 4LBVA 4RDIA 4V0ME 5G1NA 3EWIA 1XP8A 2YWFA 3GLHA 4A10A 4BNNA 4OI1A 4M54A 3L4JA 4J0EA 3ETHA 3NJRA 4IXMA 1ODIA 3F98A 4JL8A 1N3BA 1ZL0A 1HKUA 2RC6A 4LJRA 3JR7A 4X66B 3P9CA 3U3XA 4AJKA 1JPNA 1GYRA 2NO7A 4D9HA 1ZD8A 2FV8A 1EVJA 1NPYA 2W2KA 3AERB 4AAYA 4ND3A 4C20A 4HFNA 2GD2A 1B74A 1CF9A 2AJLI 4G1MB 2G07A 3UFXB 4RTKA 1NW8A 1E2HA 2GM3A 2HK6A 2ZBEA 4I4TB 5JR3A 2Q5FA 1ZH8A 2EJBA 3OHSX 3OM8A 4U5XA 5JNRA 1GG2A 1CQZA 1Q11A 1I3CA 1ZXBA 3QG5A 5DCUA 3TZKA 1LWNA 4V0RA 1W47A 4LJ4A 1FQWA 3P52A 3G9ZA 4RQTA 4IVPA 4BYMA 2GK6A 2G82A 1FSGA 3NGXA 1ORIA 1MQSA 2B37A 3BFXA 3KD3A 5LOVA 3THYB 1F5NA 5EAIA 5J47A 1THMA 1DAHA 3AILA 4HQOA 1B2RA 1OXKB 2YXPX 1TTQB 3P7MA 1UJMA 2HK9A 3EF1A 3GROA 3HG7A 2C5AA 4H7KA 4C43A 5BV7A 5LP1A 4EA9A 4OLFA 1F0PA 3U39A 3F6BX 3INTA 1R4NA 4GR4A 4BKQA 3QI2A 3ZVRA 3EPPA 3Q12A 1DAFA 1VPTA 1Y9EA 2COUA 2OFPA 3IIKA 3ROTA 3ABZA 1QMGA 1ZITA 2CL7X 3JZDA 1U2EA 5CB4A 4QM6A 1TRHA 1YL7A 1JU3A 2Q8NA 5DIFA 1G2PA 3WO0A 3FM9A 4YP5A 1RAAA 3ZGZA 3OI7A 1XP5A 4N03A 3LLVA 3V1MA 1NSTA 1QE0A 1QFSA 4PG5A 5DTIA 2QS9A 2PZEA 2ZSBA 4ZT5A 3ZS8A 3MGKA 4BNKA 4KPEC 5BYAA 5IARA 2FYTA 2QN8A 2V5VA 1XVUA 3A1WA 5F1OA 2GZSA 3VHRA 1K92A 4OK5A 5KOJA 4FFMA 4KR2A 3HV0A 1M0EA 3MK31 2VQEB 5FHRA 2QV0A 2C31A 3QHAA 3CZQA 4UBMA 2UZ1B 2B92A 2RAUA 4LZNA 4KJXA 3U61B 5IAEA 3QVMA 4L78A 1ZW1A 1U90A 2O2HA 2D1RA 5HX7A 1EWYA 1I4TD 3UG7A 3LBFA 3Q7IA 2JI6A 4RLHA 5FOWA 4X94A 1CQIA 2J4FA 1UOOA 1FUKA 1F7UA 1ZLXA 3JYNA 4OHCA 1FVXA 2HF2A 3LXXA 1ICIA 2YJ4A 3U62A 4RZHA 1SOWA 3B48A 3TUJC 3UUEA 4F04A 3NFRA 2VHWA 2JLYA 4MK4A 4C08A 4B5KA 4F4DA 3NEYA 3DTVB 1W1UA 5HMLA 3Q0EA 4C76A 1PL8A 1XTZA 2PT5A 2X7HA 5E6SB 5AK3A 1TQ8A 3E81A 4YRKA 1YL6A 4PIPA 3SM3A 3OTIA 2H4HA 2DUMA 4DUGA 1UT8A 4MWDA 4U1RA 1XOIA 1ZVJA 4V1CB 1MTZA 1TX4B 4HDMB 4P4GA 1QC5A 1X1RA 2OAP1 4Y8VA 4ZHQB 3UJ3X 3P4XA 1ABBA 2QX4A 4F8YA 5H02A 5IANA 5JWOA 4QFDA 3KSUA 5F7OA 4DV0B 3TEMA 1VIAA 3EA0A 1ISIA 3IV7A 4YMUA 3I4LA 1SBHA 3RS8A 3AUAA 3PG5A 1CIPA 3SSOA 1Q95A 5I9MA 3W6OA 3J81k 3L8MA 3ZWKA 2P9EA 4IG4A 3LPAA 2O9JA 4ID9A 3HB1A 1IG3A 1NXXA 4ER3A 1EAMA 3KLBA 4PYOA 3RT1A 3UAYA 1J20A 1T4CA 3S5UA 5TV2A 1OREA 4ENWA 2VTEA 4IJKA 1QV9A 4DIEA 2YMPA 4EYEA 4BN0A 2ZRCA 1M8FA 2O8NA 2JFOA 3ZNOA 4Z5XA 4NG5A 1E9VA 1GPKA 2B4QA 3ILHA 4XB6B 1NFRA 3RI3A 3VFDA 1RNLA 4GUAA 1ESZA 4RM2A 2A92A 4PC6A 5I51A 1CB7A 3UJ7A 4RF2A 1ND6A 2CXRA 3UWOA 1DOHA 1U5BB 3GPIA 5CYPA 3VH1A 1DIGA 1K88A 1IOZA 1KC1A 2ZQZA 1TKAA 1GKLA 2EFHB 4A0QA 4EKIA 4MQFB 3A1VA 2JLUA 3UUFA 2B7CA 5K8JB 3KZNA 4NPHA 4DQLA 4XIIA 5KX5F 1U4NA 2VHYA 4L72A 1M83A 4AJLA 1KP2A 3U13A 2G5PA 1EKXA 1SKBA 2Y68A 3DT8A 5A4JA 4BFLA 4OD0A 4JGIA 3IURA 3P0EA 3WLPA 1R5OA 2W6OA 3L8YA 4FEEA 2B5VA 1THTA 3B51X 3I09A 2BBTA 4Y6GB 1SXJA 2IPXA 2FI1A 1S8AA 2EFYA 2HSJA 3ETEA 4L07A 4YDSA 5ANRB 3V4VB 2F62A 2YW2A 3BERA 1ZM3A 2VKQA 3CZAA 3OUZA 2VDJA 5FOUA 1EXWA 5CK4A 4CG0A 4A0RA 3AHCA 4RELA 3MJFA 4YP0A 1QKJA 1KJNA 2F8MA 1DBSA 4B7AA 3TFQA 1U9CA 2VJAA 5THKA 1KFKB 5AUPB 3BRWA 3FNRA 1VCIA 5CTJA 1UXIA 1CCWA 1ORRA 2HADA 1ZVKA 3M8KA 5AHWA 1RXYA 4D6YA 4GPD1 4TWRA 3I4FA 2C98A 2WIFA 2FZGA 2P79A 3AEUA 1WTAA 2CF6A 5LXTB 1KI6B 1HE2A 2RGXA 3G9QA 4P54A 1GGNA 3O74A 2XUZA 3UEOA 3I45A 3STXA 3QKUA 4CTOA 1YRHA 3H8WA 2J0UA 1VZ2A 4WKNA 3AP3A 4P3NA 2OCAA 2FMHA 2MINA 4D45A 2FVXA 2Y66A 3PJFA 1TL7C 1Z9BA 2IDMA 4PO3X 3OX4A 3V2HA 4G3XA 3VO9A 4FSXA 1APBA 5IJ0B 1UFKA 3RM3A 2PYDA 2PKCA 3IBFA 3TWOA 4C06A 1E0JA 3MUNA 2CLMB 4TOIA 3OQHA 3IKVA 3PJGA 3PT5A 3UOWA 1ISSA 2RGNC 4G25A 1Z8NA 4Z2YA 2UUCB 1OPRA 2NPIA 4MUFA 1GPDG 1GTJ1 1K06A 4ID3A 1F5SA 4N6GA 3WIUA 4HGYA 1YQDA 4UREA 2IYEA 5ABPA 4L4YA 3BC1A 4FFLA 3RBZA 1QRAA 4Q01A 2HNKA 2R6DA 2RI6A 3D2LA 2R2AA 1Z34A 1CJMA 5CT5A 4JZYA 4Q4JB 1PVDA 3T38A 5FFFA 5I7AA 1BE6A 1ADYA 1JE0A 2FG7C 2P7IA 3M5DA 4EHBA 5DW0A 4B4UA 1HYHA 4N9QA 1YSCA 3LL4A 1P39A 1T4GA 1RLIA 1UKEA 5I4BA 4ROSA 4R9RA 3ZV7A 4R71A 1XMQB 1WB6A 3VO1A 5BQXA 1E59A 4CKEB 4UUMA 1GPWB 4NJOA 3WYGA 2ZTHA 3LKVA 2FR8C 3RSOA 4DHWA 3BCSA 3DZKA 5EIOA 3U4QA 1ZINA 1OBCA 3LF1A 4HUQB 2N42A 3W2GA 1SU6A 3KXDA 4QICA 1AOXA 3ISTA 2BTQB 2Q2OA 4BC0A 1TGVA 3QVVA 1YT5A 1SUWA 1RT9A 4YIKA 3N6VA 4KDCA 1PS8A 2JJ2D 3FGZA 2OK7A 3G02A 2H1VA 3MPOA 1IZYA 3QMVA 5COAA 4ZJZA 3QWAA 4HY3A 5T5QA 3HRIA 4I46A 4QUGA 4LBWA 1VGVA 3DO6A 4WWHA 3TZQA 4W1RA 4BO8A 2FN8A 1AQYA 1T1EA 3D8HA 1DARA 4B3BA 2IOFA 4CLOB 2GVDC 3SZLA 4IHJB 5HXAA 2J3JA 3BE8A 2ZXUA 1A8IA 2JFQA 2H4XA 4MQMA 3ZZUA 3UMSA 1M2JA 3K9BA 1Y8ZA 1WQ4A 3CVVA 3NNNA 3ZD6A 3BUSA 1GAEO 1A5SB 3ZHOA 4F2PA 1A9OA 3PC8C 4LQLA 4LYJA 5CFMA 1P18A 1J90A 1O6CA 4PO8A 1MJGA 2AFHA 1OXUA 2YASA 1M2FA 2WMYA 3BQNB 4OYYA 5CDUA 1JH8A 5ITZA 2C1ZA 2VTBB 1TKRA 5I7FA 1NM5A 3UGJA 5ESDA 1N1GA 2O8EB 2V7QA 1D1PA 1HDGO 2GXAA 3DEKA 1FMLA 3CJTA 4CM1A 1IATA 3PQ2A 3GRKA 3S1AB 2I3BA 2FSVC 1FYDA 3D7MA 4KAFA 2WVGA 1FTSA 1DUSA 1LV7A 1UKAA 3D4NA 3LX8A 3QVOA 5EVJA 3ETJA 5FO1A 3VNSA 2VZLA 4UD2A 3RYIA 4RS3A 2E6KA 4MTCA 3CX7A 2BFOA 1UPCA 1I3NA 3AUYA 1SVLA 1GIAA 2P9JA 3H42B 3UGKA 2EARA 2XEXA 4RHFA 2FX3A 3B6JA 3T4EA 3WY9A 2XVZA 4RAOA 1X1QA 4DCPA 4W5TA 1QDLB 5BVGA 1BMFA 1FNNA 2ZBQA 3ETCA 4M0KA 4Z7JA 2DYKA 1X13A 3PPWA 3TSOA 4ZKDA 1VPEA 3LHFA 3IR7A 2Z6AA 3Q3CA 3R9XA 2O2EA 1E3IA 4N3GA 5DYIA 1Y89A 4CMEC 4K6KA 1AA9A 2CL6X 2WP0A 5AKKA 4POOA 4ZXPA 2RHWA 3PICA 2IUFA 3SQNA 2PZFA 4YJ3B 1DBRA 1MCZA 2C9OA 3GEBA 2G0AA 2WFMA 4FFNA 2C5LA 1G42A 5GAJA 4PC2A 5I9BA 1KE2A 2NO9A 3WLAA 2PE5A 1IM2A 1OLSB 1TZJA 4JNKA 2C04A 4R8VA 3H1PA 3WWDA 2E5LB 4DJDC 1V16B 4IL5A 3UPUA 5EIEA 3GDHA 1QOZA 1CDEA 3AIMA 4GNRA 5T8KC 3HSKA 1N9GB 3IE1A 3RFTA 3T5TA 1FVOA 2O3UA 1EVIA 1ZIDA 5H3LA 3RAEC 3OCVA 5EKDA 3T4XA 3OCWA 1GAQA 4UUOA 2XNDD 4CDNA 1FW6A 3UFBA 3PEFA 2P2DA 3HVIA 3JWGA 1RYZA 3EQ7A 3WHKA 5C5IA 1K7FB 3M6UA 4FZ5A 1SUFA 3INNA 2CZCA 4MI3A 3OWHA 3D8SA 2B69A 5EJAA 4H17A 1AM4D 3G2IA 1VRWA 2AD1A 3QXJA 4KYVA 3DBVO 4URYR 4X93A 3RJTA 2HAEA 1D07A 2M6LA 3SXUB 4MA0A 5AW3A 3KAKA 1RXVA 1N1DA 1R6UA 1Q7CA 1W5BA 5BSTA 3T4PA 1KXJA 2ZDHA 5KJ1A 2CV0A 5F3WB 4HQ0A 1BXGB 2PA0A 1I3LA 3KU4A 1MVLA 4QVKA 4RXMA 1E6MA 4QODA 5K4HA 2ZZNA 2NYVA 4OHYA 1LVUA 2X58A 2RHDA 5KDOA 4MS1B 3F9RA 2GO1A 1D9XA 4BNZA 3ZI7A 4DL9A 1MO2A 4Q3LA 1RJDA 2BLNA 3SYMA 1ZUIA 1Z0DA 2GERA 1XZ8A 1YQXA 4JVMA 1PW7A 1O96A 4NBNA 3VR6D 1I7SB 4KHPB 1WZCA 4GO1A 1LI5A 2FW6A 1XRPA 2B5OA 4OBEA 4DABA 1MA0A 1U4SA 2QUHA 5ITSA 2UV8A 4ZVQA 4YUZA 4YRTA 3K09C 4DSOA 2PA3A 4D56A 1X94A 1B8VA 4K03A 3EXFB 4XX1A 4YMTA 2EFGA 2LDXA 2WZCA 4P5DA 5JROA 2YZGA 4BOYA 2W9XA 2XOKA 3RUPA 2DLDA 4WQMA 3TUZC 4CXMA 1PQWA 3TSYA 3VYWA 2GBFA 3WKDA 4E5YA 1O95D 1TTPB 2VH1A 3OKCA 4GDMA 3EFEA 1GRNA 4LDPA 2WD7B 4PCVA 5LDDC 2JFWA 2PZLA 4H59A 4GKKB 2WG2A 4HDQB 2EQBA 4KHZA 3VTKA 3FOFC 1N9KA 4LDAA 1DC3A 5B6IA 3NUQA 3KXLA 3GRZA 3KDPA 1IK6A 2O5CA 5CX4A 3SFZA 2A3NA 4HDOB 5ESWA 3P45A 3ITKA 4AY3A 3M3DA 3TG8A 3FJ1A 1W4AA 4F5WA 1E2MA 3PJRA 1CHDA 1L5NA 5JCZA 1CS4C 2PMFA 2FN4A 1Q21A 3KO8A 1K7EB 1N6LA 2PUDA 1H5UA 1HDCA 2E4WA 1F6BA 1U7TA 1WHTA 2FPRA 2I7CA 4HDRA 4NMWA 1AF7A 4R1NA 4ZREA 4NYIR 2P40A 4EPRA 3T1TA 1HE4A 3DDWA 3R0ZA 5DHSA 4ZYXA 4PHHA 2P2ZA 4FBMA 2VI5A 4JUAA 4L9RA 1CUFA 4CV0A 1LQ2A 3ISVA 3BE5A 5BNTA 5BSHA 2O57A 1XMOB 4U7TB 3EZ9A 3UCEA 2NQ2C 2VT2A 2JLBA 5EA2A 1MNQA 1RWPA 3BXEA 2BFFB 3O2JA 4NU5A 4A36A 4UCFA 3EMKA 1YAJA 3G9TA 3H1FA 3KVYA 2B25A 4KYIB 1C3JA 5E7JA 4DFDA 5J59A 1PD0A 3FX2A 1CNMA 3FMVA 3HZRA 4GUDA 4B82A 3BRQA 4NULA 4D2IA 4CR8A 4X97A 5JYEA 1TQDA 2CEKA 1KEUA 2GPYA 3H3JA 3PCXA 2WF9A 1L7VC 2JS7A 4J0DA 4RZUA 4XLTA 2D2XA 3OQIA 4REQB 1I5OA 1JXQA 3E15A 4MKHA 5D1HA 5K3FB 3VYVA 1U6IA 1CT9A 1YR2A 1NRWA 3UCFA 1MQ8B 4R01A 2CNOA 4IOKA 3IOBA 1GY8A 2YOFA 3IVGA 3Q40A 3FKSA 4KSCA 1H1LB 3OOJA 3LG2A 1LVHA 2VF7A 1ADJA 3BT7A 4N5IX 2QLJA 4D96A 3OTHA 5CFZA 1QGAA 1WU8A 1AS2A 4UHKA 1YFLA 1OZ0A 2J3KA 4QBTA 1R2QA 4KKXB 3O8QA 2AC7A 4ZJUA 4UFNA 2NAFA 4RIGA 4EG4A 3L41A 3LYUA 4IJ6A 3WLQA 4P2BA 3H1GA 3CNEA 5KJCA 5EHGA 2VCHA 2QXUA 4GM4A 1HO3A 3AHEA 5GONF 4RKFA 1T0JB 2R7NA 3K9GA 3Q7SA 5TMEA 2UZ4A 5HBRA 3MGGA 4OQMA 2XDYA 3E2MA 4HG2A 5EE1A 3RFVA 3MJRA 3C48A 3FCOA 4FMPA 4P5EA 4TRRA 1QYWA 3BD8A 3ELYA 5HKBA 1M6NA 4X95A 2R7MA 4HUTA 2QT0A 2HF7A 3RK1A 1ZPDA 2FPWA 1YCDA 3ROXA 2PWZA 1N5LA 1U2SA 3ADKA 4OP1A 4ZYUA 2JGKA 5CXUA 1QK3A 2A67A 3AHIA 1E0KA 4NEGA 4FN5A 2V6MA 3OZCA 1ZD3A 3L6EA 3RTAA 2ZI3A 5DM4A 2IDKA 1XJQA 1G8AA 2AZTA 1OHHD 4M98A 4RAQA 5FTNA 3W34A 4D8UA 1XFDA 821PA 4PF1A 4XTCS 2BR3A 2VOEA 4HYEA 5BV1A 1YB2A 1FMTA 1M34E 1V8PA 4OGKA 3Q7EA 1CJBA 3MTAA 4PLCA 1LD3A 4ZODA 3PD7A 1A8HA 2D5CA 2R8ZA 1KDPA 4JMPA 5DTQA 5JXJA 1ATIA 1E2IA 3VUEA 3ET5A 2H16A 3VR5A 2K4MA 4LDJA 4M1YA 3MB5A 5HKKA 4P5PA 3OJCA 4OQQA 4P4NA 2XIJA 4J0FA 4RA6A 5C4IA 1J42A 3UJCA 1UIMA 2ZRFA 3UYKA 1O57A 1SOUA 1YFJA 1HA3A 2ZIAA 1GCOA 2ISCA 2VHCA 3V55A 3DHVA 1PVOA 5CCDA 1E1QA 4UZFA 5B1SA 1RBQA 1A5AB 2W6QA 4CCYA 2PLRA 5DN6A 3NAGA 1N5IA 1M2VA 2Y27A 1RHJA 4B6RA 5JNSA 2B98A 1QB7A 3ELBA 3PRJA 1THGA 3FOEC 2XQKA 2DFLA 1M1UA 1Y6QA 3DBLB 1G9SA 2H9YA 4OSOA 5AKGA 2X41A 2H17A 1IXSB 1PEDA 3HCCA 4ZZ3A 1YA6A 5AIBA 2B83A 1JEOA 1KY3A 3CO0S 4IKEA 2PQ0A 4RVNA 2R5FA 3FB4A 1W2GA 4Z4CA 5JNUA 2E89A 2N47A 4BDTA 2IIPA 3CF2A 1FIUA 4UUNA 3GDGA 1ZIXA 1AQNA 5LQAA 3AFNA 4GXNA 2ZWPA 3RV4A 3AYZB 4B3DA 2GMWA 3C3BA 2O2XA 5JD6A 3I52A 2O0LA 2PUCA 3OA0A 5CYOA 4ER5A 1P60A 4GKVA 4GRAA 1QFZA 2B2XA 3ZJTA 4Q37A 2C0QA 5CFPA 3R6LA 4FDVA 2EP8A 5B1DA 2CV2A 5JFGA 1VLVA 2I1WA 3UJHA 2AMVA 2FW0A 2IU3A 2WZQA 5A3RA 1EIWA 4BNGA 1E2EA 3QV2A 1U9IA 5AVTA 1RKXA 4Q0MA 2WSBA 5T4EA 3KSAC 5IJXA 2GASA 1AK2A 3EB9A 1UBFA 4WNYA 3C3XA 3NI2A 1IFXA 4LGCA 4I8DA 4MCIA 4MW5A 3PDWA 4GYKA 4XR4A 3T4UA 4QKQA 3T7EA 2ANBA 2ASVA 2VSNA 3AESA 2DUUA 1RM0A 1SXJC 2JLCA 1Q2UA 1Z06A 4EF5A 1BXZA 1YC2A 3W5DA 2AS0A 1LTKA 3GJTA 4MMXB 4JASB 3VJKA 4DBLC 1YQWA 5M34A 3S2GA 3LK7A 4M7PA 2P4SA 2WSYB 1U0GA 2CGEA 4XCVA 3VZRA 4DSNA 1L8OA 3IYLW 1S96A 1T0PA 1UMDB 3TKAA 3G1UA 2F1HA 3F71A 1UPAA 4OQNA 4IXNA 4AICA 5E6RB 3TDKA 3SS9X 1DC6A 3B38A 1PHPA 1UQUA 4Z7OB 2QPTA 3FBWA 3V4RA 1QH0A 4OHRA 3RVQA 3UOGA 4FCWA 1UC9A 3H9QA 5KYGA 2O3QA 4QUHA 2KBFA 3FRHA 1MPXA 1H9AA 3DB1A 4YJFA 5FEUA 3S70A 3BD6A 1A9RA 1HZZA 3JS5A 4FOTA 1KEZA 3WLJA 3PQ3A 4H7JA 4FWTA 5HTKA 2ZIGA 4YT4A 1HE8B 3L0BA 2OTCA 3ZX5A 3UNXA 5CLFA 4R0MA 3ZQ4A 2ZVQX 3PNVA 4QATA 4G0QA 3LRTA 3MB8A 1BD4A 3HB0A 4S0XA 2IODA 2FN3A 1SOAA 3A37A 1YA4A 1QHHB 2EBHX 2VH5R 1TQ2A 3TLZA 1CJTC 3IQDB 5EIAA 4CMGA 3VX3A 1E3TA 2JEOA 3KWFA 1R0XA 2ZAYA 2IH2A 2RG7A 2XY4A 3FOCA 4EQ6B 5C8YB 5EMLA 1VXOA 4PFSA 4PRYA 5GVSA 2MSWA 3NTVA 4RORA 5YASA 4US1R 2W43A 1PW5A 4DCCA 3UPTA 4TTPA 5FTJA 2P7HA 1V4BA 3F4LA 1L4YA 3F8SA 3TRFA 1V47A 1PFQA 3QU7A 1RQPA 2BGUA 2TRSB 1U5AA 3OCYA 2A0FA 2NXWA 4ITVA 5EPUA 4NESA 5IKMA 1V5FA 1DCKA 3BJIC 1L5SA 4C01A 5C53B 1P7WA 1WY7A 2GAJA 3FVTA 3WP0A 2O7SA 4NH4A 4NBWA 5EP4A 5EUBA 2A1IA 3J7AC 1TFUA 4I50B 3JQGB 3QMMA 4R7TA 1DB3A 2NG1A 2YBEA 1J2TA 4QBHA 4F1WA 1T3LA 2P5TB 1M2EA 1USKA 1HQKA 1B8NA 2WINI 4RFVA 3S3TA 1CTQA 2A1UB 1C9YA 2G28A 4FFDA 4PGMA 5JH7A 4TVOA 5DTEA 1Z6AA 5K6RA 1X8KA 1C7IA 2I6QA 3NNDA 4CUJA 5BUZA 5F9FA 1EFDN 2I4TA 3KKKA 2GSDA 4G01B 5KNDD 2Q5HA 3PUHA 1KVSA 2G4CA 3IQZA 4HPJB 3EGXB 1U7WA 4FYYA 5AM5A 5I48A 3FOZA 2PGOA 1ZGJA 2F48A 3T61A 1XYYA 5HRAA 1OZHA 3GY0A 2VJNA 4FGUA 3TQHA 4C7MA 1NONA 3F2IA 2P3QA 3P32A 1T2UA 1KI4A 2D3TA 2CMFA 3NHRA 5EOVA 2WTUA 3OEHD 1XL1A 4X1KB 1IDOA 1XLVA 4NMXB 5HF6A 1HI9A 2JJQA 1F17A 4EO9A 3VPAA 3GXOA 4A7PA 4KDRA 2YJGA 4M60A 4OFWA 1NL3A 3LBYA 4YGYA 3SN6A 3F78A 4IG9A 2D5AA 4HNSA 1PP4A 3I01A 3EE6A 5LU9A 4G97A 1L4BA 4B6FA 3NTUA 2IXAA 2VTKA 4NCJA 2A3RA 2OCIA 1U0RA 5IJAA 1Q77A 4CKYA 1RRMA 2M6SA 4Q7LA 3ZWPA 1USGA 1PGPA 4DM7A 2COEA 1JYFA 3VC1A 1RBYA 3EK2A 1J1IA 3TB6A 2R25B 1SVOA 2Q46A 5JSUA 1Y6ZA 1YCGA 3O3NB 1NM5C 2AA3A 3WYFA 2HPHA 2AOTB 5FBWB 1WXWA 3BIOA 4AP9A 2DQSA 2G8NA 3GYBA 1T2AA 3JQAD 1VYUA 4PLWA 2DB3A 3QKTA 1G6KA 4DQ0A 3LDGA 4KYTA 5ALXA 3VSCA 4BRUA 1KK2A 3CUTA 3A9SA 2FP4A 4DF3A 5TARA 1WD7A 3QX9A 4QQKA 2X2PA 5KKAA 5JISA 2AOXA 2IIVA 2VDRB 1CYDA 2I6SA 1MMFB 2ZPTX 1JHZA 1XQYA 4BO3A 1W6UA 3REOA 5LBUA 1K6EA 1GPH1 2WUEA 2PDAA 3AMVA 2HF9A 2X9NA 5IBPA 4I3HA 5ALJA 1TJNA 1QV7A 3AR9A 5EIXA 4FD3A 1CYEA 1QQAA 5KTTA 1O9BA 3ECAA 1WUJS 1JFFA 1U0NA 4M1ZA 4RO0A 2V7VA 1DTEA 5IXSA 5FB3A 1V11B 3QFCA 2Z5LA 3I9JA 4HAXA 3R6WA 1JLMA 1P0QA 3BL6A 4BE4A 2CDAA 3WL7A 1EDBA 3KLPX 4K8RB 1DAKA 4NMMA 3ZW7A 4CIBA 4Z9BA 3G1WA 3X1MA 3ZIAD 4F7DA 5EP2A 5CLLA 4TWAA 4TWIA 2WWTA 1IIBA 2R84A 2V4ZA 4FEYA 5CJPA 1OI4A 4RYLA 4AKHA 2AYYA 3UJAA 1BNCA 5E9JA 3F7TA 4HVLA 4H0NA 3ANNA 2DPXA 1XFAA 3UYLA 1E1MA 4MW1A 5CXQA 5JZ9A 2BC9A 1EDOA 3P2KA 4CV3A 5MDHA 3C3CA 4DW8A 5DK4A 2ZUEA 3SOZA 1R0KA 3VV3A 1WXEA 5BSEA 5K8VA 3C7CB 3HBLA 3TIXB 3C5WP 3WDSA 4M9SA 4DGSA 1IHOA 3K7EA 3E18A 4W9MC 3RAFC 3E27A 5D86A 2OORA 4CMHA 1L7MA 2P5YA 4WXHA 4F3YA 3VNUA 3QFFA 1M75A 3AVUA 2ZRMA 3RANA 5AUNB 1ZVMA 1F2TA 2J67A 1AC5A 2TMGA 4NZYA 2IBMA 3I05A 1TK2A 1PL0A 3HCEA 3MRXA 5I47A 1DHTA 5AESA 3LZDA 1QVAA 3MTEA 2OFWA 1LPMA 4E51A 1BCSB 1MTOA 5FLYA 1T4MA 3AM1A 1YS6A 1RAHA 3OPMA 3MCVA 1P2BA 2PLWA 1XDUA 4X20B 4PVCA 1B42A 3GD7A 2R79A 3ZY2A 1QU2A 4QHSA 2GBGA 1BTOA 3UUWA 4WN9B 3AEQA 5KNBA 4AWBA 4BZXA 2GKGA 3O3MB 2VSFA 4IDBA 5EJMA 1ZM2A 4K9QA 5CA0A 4EI7A 4D3XA 4WLOA 2IZ7A 5B37A 1A3CA 3GFPA 4FS3A 1JDNA 3T0IA 5LFAA 1L3CA 2AXPA 3B53X 5LN1A 4AJIA 5DBIA 1CRPA 3E58A 4CEJA 2H0QA 3GBPA 3TQFA 3GDWA 1XTJA 4Q34A 4CM5A 4O2BA 5FP0A 4HD8A 5A7GA 4EW2A 4ZAWA 1BHQ1 2I6FA 2XX3A 2JD1A 2FWRA 4B6PA 2XZPA 1WABA 1X1AA 5BN5B 3MCAA 4B7XA 2QVCA 3R23A 4E21A 4QTZA 1NF2A 3WVNA 4C6HA 1IHDA 3IQHX 1WCXA 1YZUA 1D2MA 1JL3A 2PT9A 1RD4A 4HRAA 1LLUA 1ODTC 2D1FA 3IAS1 3FF4A 3OZXA 4O4JF 4DR1B 3WRYA 1QG6A 2ZM5A 3B2QA 2JD0A 3GYGA 3V34A 4DANA 1Z88A 1EM8B 4YUAA 1TYDE 3S29A 1OIWA 5AK4A 1ZUHA 4MS4A 1QPGA 1TECE 2JGJA 2X7JA 3MSCA 3V1YA 5CJ2A 2ZSAA 3P19A 1C1XA 1RRFA 3PNLA 1UF9A 1QG4A 4MV1A 1JHDA 3A9WA 3RU7A 2AN3A 3AYXB 4BKUA 4D99A 4D79A 4KFSA 4ARBA 2OO5A 1GRQA 1Q50A 4DMKA 3INRA 1GNQA 1RJEA 3IB3A 3NWBA 4HAUA 1I2AA 3WXBA 4PW0A 2HLHA 5B2FA 5BT9A 2PTGA 1RZVA 2ZJYA 1ZD5A 4RULA 4JGGA 1KOFA 1V2HE 1E2DA 1EBUA 1H85A 5HYVA 4AQYB 2XTJA 5AQEA 3EEIA 1A4IA 2D1QA 2EWWA 2G5TA 1YONA 1B3RA 3HYRA 4BNMA 1FNSA 1HQCA 1NLZA 1T8YA 5LQMA 1FSFA 2FR0A 3L46A 4XRGA 3ORFA 3QU5A 5EINA 3SSMA 2FX2A 1LW6E 1R3UA 4BX2A 2IXTA 4JN6B 4JA2A 3WYBA 3U5TA 3DC2A 1F6WA 3ZS9A 1VGRA 2C2OA 2AV6A 2H4JA 3SC2A 1P5FA 4IZIA 2L42A 4LX8A 4ZQIA 9MHTA 4XXHA 4QTUB 4LYGA 3TEFA 4BVHA 2WK1A 3CEAA 3HZHA 3NVAA 4DJTA 1KAHA 1KVQA 3G0DA 1JKJB 2BHRA 3Q98A 2BEVB 2ZPAA 1RVDA 2VF5X 3EQ8A 2IT1A 3BRSA 4RF4A 3QY9A 3UC5A 1VCNA 2JJ1A 1SCKA 3GLHB 3JARA 3NT2A 3X1DA 4GX2A 4D42A 3QSGA 1L7AA 4JT2A 1J70A 1JXOA 1V8FA 1NW5A 1XDDA 3K6JA 1JMKC 5EJIA 4FLMA 3TOXA 1E7WA 3B9BA 2XA2A 3JD0A 1VKOA 2GNPA 3AF5A 3X43A 4ZRDA 2QN7A 2W2KB 3INYA 4FNGA 4K9LA 4L8LA 4KXUA 1LSUA 3JQ8A 5TNXA 5ADVA 1CFJA 2F55A 4X1IA 3E9QA 1AS3A 1D0SA 2QJOA 4R9SA 4PZEA 1JALA 1SVIA 4U6NA 3ZVNA 3TX6A 5DPMA 2C9CA 4D44A 5C80A 3K8QA 1K8ZB 3ICCA 3VR5H 4CIDA 4P3KA 2VRBA 3W8NA 3JWHA 4M1TA 4D8WA 5LOVB 1Y1KE 2JGAA 1Y8QB 1YZNA 1CETA 2OOSA 2NTVA 1HT3A 4PHTA 1G21E 1TZCA 2QNRA 3MWDA 1N5RA 3ZDAA 1X39A 2EERA 3JQQA 1SVWA 3VX4A 1M10A 3WHPA 2FN9A 4FYVA 4DHEA 4I08A 1SB8A 5EZSA 3O8RA 2LXNA 2PJRA 4PLVA 1R4NB 4MUGA 2H08A 1FW8A 2WFAA 1BWSA 1ZYUA 2BM0A 2ZYIA 3N5KA 4X9XA 1NXVA 3O9VA 4GLOA 1G3IA 1VMEA 1HXHA 2F3SA 3RKSA 3LSTA 3KK0A 3P0JA 1HRDA 4OM8A 1TAQA 1WF3A 3ZHQA 1SXJE 3HNPA 5CB4B 4ADSG 4A92A