3CQHA

Crystal structure of l-xylulose-5-phosphate 3-epimerase ulae from the anaerobic l-ascorbate utilization pathway of escherichia coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
277
structure length
257
Chain Sequence
QIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMLNNPWFQLYPDIGNLSAWVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate binding motif within a TIM barrel fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords L-ribulose-5-phosphate 3-epimerase ulaE
total genus 89
structure length 257
sequence length 277
chains with identical sequence B
ec nomenclature ec 5.1.3.22: L-ribulose-5-phosphate 3-epimerase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3cqhA00
2X7WA 3ITTA 5FA5A 4PGLA 3CNYA 4XIAA 5B7ZA 1QTWA 3QZAA 3UA4A 3VNKA 3U3HA 4HHMA 3UA3A 5I7GA 3CWHA 3UVAA 3FVMA 1A0EA 2QW5A 4J4KA 5B7YA 2X7VA 1XIHA 1XYAA 5AVNA 1XLFA 1BXCA 3AALA 2G0WA 3KBJA 3VNMA 3IUHA 3LMZA 3M0HA 3DX5A 2HK1A 1OADA 3NGFA 4PFHA 3UU0A 5EMKA 1TZ9A 1BXBA 3QYSA 3GNXA 4XISA 1MUWA 1DIDA 1XYLA 3CQHA 3QC0A 4A8LA 3DBNA 2XIMA 3KBMA 1QT1A 2NQJA 3BDKA 1DIEA 1YX1A 4KW2A 4QEEA 5XIMA 1XLCA 4A8RA 5B80A 1XIIA 2HCVA 1DE5A 3KTCA 4E3VA 1XLMA 1DXIA 3IUDA 2NQ9A 3N4AA 4YTQA 5C9ZA 4A8IA 3BZGA 2ZDSA 3JU2A 4GJJA 7XIMA 4HGXA 3CQIA 3AYVA 1S5NA 4DUOA 2I56A 1XLBA 3M0YA 4X63A 3ITYA 4QDPA 1DE6A 3KWSA 4A8NA 1D8WA 5H1WA 1XLEA 2GLKA 4ZBCA 5H6HA 4K1GA 3VNLA 3M0VA 1XIJA 9XIMA 2Q02A 1XLAA 3ITOA 3C0LA 9XIAA 1S5MA 4EACA 4X60A 2G4JA 8XIAA 2QUNA 3P14A 4Q7IA 3KBNA 6XIAA 2HK0A 1XLHA 1XLGA 3ITLA 5J8LA 3WQOA 1XIMA 1O1HA 1XISA 3AAMA 3C0SA 3M0LA 1QUMA 3KBWA 2OU4A 1A0DA 4GLEA 4OVXA 4LNCA 3KBVA 4ZB2A 3OBEA 4XSMA 4YTSA 5AVHA 4YTTA 1XICA 4W4QA 5XIAA 6XIMA 4ZB5A 3CQKA 4K3ZA 4YTUA 3C0QA 3XINA 3QXBA 5XINA 3IUIA 3XIMA 3KCJA 4HNOA 8XIMA 3CQJA 1XLJA 1XIEA 3KCOA 2GYIA 3UXIA 4DVOA 3M0XA 1XYBA 4QEHA 4QDWA 3TVAA 4EAYA 3P6LA 3VNIA 4XKMA 3AYTA 1XLDA 4GQBA 2XISA 1XINA 1I60A 1XYMA 4QE5A 3XISA 3ITVA 1XIDA 1MNZA 1XLLA 1XIFA 3ITXA 5EMJA 4XSLA 1XIGA 4GJIA 4QE1A 1XLKA 3BZJA 4X61A 2XINA 3L23A 1A0CA 1I6NA 3M0MA 2NQHA 2J6VA 2QULA 3KBSA 3BANA 1XYCA 1GW9A 1K77A 1XP3A 1CLKA 2GUBA 3BWWA 5TNVA 4YTRA 3U0HA 1XIBA 4QE4A 2I57A 4G56A 4HHLA 5EMMA 3VNJA 4ZB0A 3VYLA 1XLIA 3TC3A 2QUMA 2ZVRA 3KCLA 5EMLA 2GVEA 4XIMA 4US6A
chains in the Genus database with same CATH superfamily
4IX0A 3ME3A 3AU6A 4H19A 3MCMA 4E2DA 2A3AA 1OF8A 3CZJA 4IMEA 3ZLHA 3HFTA 4WLCA 2E4TA 3NGFA 3SSJA 4FB7A 2X0YA 4B5NA 1TUFA 2ZQ0A 2P88A 1TVPA 3DBNA 2QJNA 5M17A 1IWAA 3WEMA 4EE9A 4L6HA 3OZYA 1I2QA 1MZHA 1UR2A 3VPLA 3RLVA 2JF6A 4JFVA 4JTUA 4QJ3B 4G7EB 1A5OC 2PDWA 1BD0A 4XZLX 5HMEA 3GRIA 4DUOA 1L8NA 4LH8A 4AVOA 2Z25A 4P8WA 2QMJA 3FLUA 4P8XA 1J0ZA 3LDVA 4JTGA 1F3WA 3SCOA 4EACA 3CUXA 2XFWA 3DFQA 2QVHA 4XBSA 3KW3A 3CAWA 1UROA 2WC3A 1SZFA 3CZEA 3UZJA 3XIMA 2R24A 1XF0A 3NIYA 4H6QA 2WC4A 2BOEX 1VFSA 1QFEA 3NNTA 1E1CA 1EBGA 4PCPA 1LROA 2VDGA 4UFKA 3MMWA 2A3LA 1DXEA 1GKRA 3DERA 1X7IA 2NXHA 1M9HA 3D0CA 2OT0A 1UD6A 2OLHA 3L4WA 1OYCA 3E0VA 2PGFA 3HG3A 3R7MA 4TVUA 4IGMA 3LPFA 5LZLA 4PB4A 2J24A 4AZ5A 1FX6A 2XPKA 4EWND 1R9YA 4CCCA 1JNDA 5GPRA 3GC5A 3SCWA 1HJQA 1UD4A 4LRSA 2V81A 1LWIA 4IISA 1F76A 2GDUA 1ZCCA 3BDKA 4ZSUA 1Y0EA 4BF5A 2V2HA 3EA3A 1VCVA 4H3DA 1T8QA 4EANA 3FX4A 1PHQA 1GOMA 1ALDA 2R94A 4I7UA 3ARYA 1JRBA 4JOMA 9XIAA 3GTNA 1OHLA 3LSCA 1QHPA 4M19A 3TYEA 3GHUA 4F2TA 3AIRA 4HPHA 2TMDA 1UWRA 2NVAA 2D2OA 3GDBA 2OU4A 1LBMA 3A5VA 2XH0A 4JKMA 3N17A 1P1MA 5CJMA 2EAWA 4E0CA 1T41A 1FH7A 1TV5A 2NZLA 1W1TA 4PC8A 3L9CA 3GDRA 1XYMA 5JBDA 3W29A 2BV9A 1C9DA 2XFRA 2QDEA 3B8TA 1XBVA 2QKFA 2Z1XA 4ZE4A 4DYJA 1S2VA 3FS2A 1SW3A 2FZ9A 4GI6A 3AHVA 2GWNA 4ZTXA 4TVDA 2WMHA 4L56A 4N9BA 1LOQA 2OPJA 3W6YA 4CQCA 5L9FA 4DBEA 1XKJA 1LZOA 2RDWA 1V6YA 1RHCA 3SM0A 4J7RA 4UFJA 3S2JA 4Y9OA 4HMNA 1WX0A 2G0WA 5CSUA 4OFCA 4GYKA 2OSYA 4LUJA 1FDYA 3B06A 3GLCA 3M6YA 2XIQA 4FAMA 2BGSA 1TMLA 5DFAA 3OP2A 1XFBA 2Y88A 4H8NA 2VOTA 1YTDA 3WQFA 4MJ2A 5LHFA 4GI9A 4FLQA 1ECEA 3IUDA 4PUUA 5K3VA 4XD4A 1UD5A 4IMGA 3SN1A 3FA4A 5C71A 4AXNA 2E1DA 3CJPA 1RLCL 1AFSA 4TMBA 2BOFX 3R1ZA 3L68A 1C8YA 2FHFA 3VXGA 4D6FA 5AHNA 1J93A 4KETA 4Z1CA 5LNSA 5A94A 3B3DA 3QPZA 3EX2A 1PZ0A 2DY3A 3EDFA 4DF0A 2EPHA 1POJA 2VT0A 1S2UA 3MBFA 1CBGA 1I60A 2F2HA 3NQCA 2DIJA 3L4VA 2J8FA 2Z1KA 1NARA 1ADDA 1J0IA 1QAPA 1QU4A 4CD7A 3T9PA 4QSHA 4AZHA 4AY8A 1QR7A 3NXFA 4NI8A 5CGQA 1VFHA 3PZUA 1XRFA 4F0KA 3IVUA 3VDAA 1WPCA 2ISDA 3UY7A 1TIMA 3QQ0A 5A6TC 4L1GA 1BYAA 4R3UA 4Z42C 3DHDA 3A4WA 4OU1A 5HINA 3VNZA 1XQKA 1DIDA 3W01A 5D37A 1CPUA 4FA3A 4F79A 2FTWA 3T4CA 3FK4A 4NNAA 3BGAA 3CO8A 3UGRA 3E96A 1R3RA 3ITYA 3DXIA 1X6NA 2ZRZA 3PZGA 3VNLA 3PZOA 4QIUA 1B31A 3LYEA 4I6VA 1G4SA 3CT2A 3QEZA 4DQWA 4NZ5A 4HOWA 2OLSA 3WUFA 4DO6A 4G2DA 4M3PA 3CL7A 3BMVA 1EUAA 1YDNA 2OR2A 4WK9A 1EIBA 4GI8A 4GQBA 3W00A 4JTTA 1OX4A 1PZ2A 3GFZA 4GOAA 1EGVA 2DZVA 3M0MA 5CC6A 1EA0A 1E9ZB 2AMGA 3LS9A 2ZCGA 2BB0A 3HJZA 1DJYA 5AHEA 5AC8A 5EMYA 3KRSA 3DHUA 2TSYA 1FWCC 1PTGA 1BEUA 3DAQA 3NDOA 3VD9A 4LUTA 4RV3A 4LF2A 4RK8A 1TZ9A 5FJRA 1JFHA 4ERIA 1VYRA 1C92A 4LF1A 1KXHA 1W1VA 1AUSL 1TPFA 1XKYA 3P7YA 5CJ5A 3SUTA 4ILSA 4PL2A 4WKAA 3I4EA 1Q2SA 3EWDA 4JIPA 1EJWC 3NO1A 5HXMA 1V03A 1KA9F 2C3ZA 5C9RA 5H1WA 4H00A 3H24A 2FPVA 5FJPA 2UY5A 1F9CA 1JZ5A 3K8MA 8XIAA 3IAQA 4O53A 4GFIA 4TX6A 1DP0A 4WDWA 3QBUA 3CPRA 3QC3A 3P61A 1QNRA 3SFKA 4DO4A 3QM3A 2OLAA 3EZ4A 4C6IA 3APTA 3ZLFA 1JCXA 1ZNNA 3QFEA 4H9VA 2QUUA 1P0BA 4XAFA 3DYPA 3LQLA 3MHUA 1DWGM 5CG0A 3SR7A 2VWSA 4U4MA 3WLRA 2OKOA 2I1OA 3LNPA 3RUBL 1YNQA 4IPNB 1VBHA 4IJBA 1M6JA 4C1NA 2QNEA 6ALDA 4DJFD 1GYNA 1ICSA 4EPEC 5HK4A 4W93A 2XDFA 4P7NA 1EP1A 1HUVA 3UJRA 4HK5A 5CC3A 4IFKB 3VGHA 4NIRA 1M7PA 1FWBC 2H9AB 2FH8A 1OM0A 5JIPA 1ME9A 3A4JA 3EMZA 3GTHA 1L0PA 2WK2A 2BHUA 4J2PA 3V35A 4A2SA 4HB7A 1NDWA 3WJSA 3WFAA 2ZADA 4W85A 5I02A 4K8EA 3UXDA 2XGZA 1BQCA 3TV8A 2DEPA 4AIUA 2D3LA 3WUGA 1PZ1A 3CQIA 3PJTA 1TJ1A 2IPJA 1CLXA 3PPFA 4BCEA 5C0QA 4WF7A 2WVSA 4MDPA 4WRHA 4UQCA 3MHGA 3DFTA 4HTBA 5D8ZA 2P5NA 1FDZA 3GQYA 1Z8AA 2JEQA 4OE7A 2WZHA 3E12A 3BMXA 3QV7A 2YX0A 4P8VA 4BWLC 2CLHA 4UZSA 5MKGA 2BXZA 4JX5A 1QCWA 4GY1A 1QATA 4L65A 6A3HA 1FH8A 3EDJA 2RHGA 4B90A 2WNQA 1UIPA 1B4EA 3ZQ9A 3VIMA 1T5AA 3UWZA 1A3HA 4LY8A 1V77A 2CLOA 5AHLA 3ZXWA 4MIMA 4QJ5B 3DBPA 1ODZA 5A8GA 7PTDA 2QULA 4Q3MA 1EC9A 4NJGA 3KLKA 2WVUA 4AHPA 2BODX 1WKFA 4K38A 5AYBA 3B8WA 1S2WA 4GY0A 4WXZA 2G3IA 5EYWA 2PLJA 3P82A 4DUXA 5M5DA 3ARRA 4W8LA 2W3ZA 1SFJA 3BTNA 1YEYA 3PVFA 1Q6EA 5A8MA 1TPH1 4AMAA 3EDKA 1EP3A 1NWRA 1VRXA 2GGHA 2C13A 3W26A 3A9IA 3S1WA 4GGBA 2X30A 3S9YA 1Q85A 2PU1A 1WAUA 4QLLA 3JR2A 4X0NA 3UD6A 2VFGA 1YQ2A 2YCJA 5IFTA 1TX2A 1HKIA 3U7VA 3G6MA 1EWEA 3C0LA 3POCA 4L64A 4CCZA 1IEWA 1V3LA 4HMDA 5AECA 4HSNA 1UZ4A 4G7FA 1G7UA 4RDWA 4YYCA 1CXLA 1E1CB 1UPPA 2QPXA 3EB2A 1M04A 1W3TA 1XIEA 5E93A 3N4EA 2ZIDA 1ITCA 4F40A 2WJZA 3GIYA 4AYGA 1PKNA 1T8XA 2EPLX 3AIWA 5HA7A 3OZOA 2CBUA 1OCQA 2WNNA 4XUYA 1S3HA 1QPQA 4E2BA 4KEZA 3H8AA 1XCXA 1GOXA 3FN9A 1O94A 3TIMA 1OD0A 3VCRA 3DGRA 3G1HA 3MSYA 4LVAA 4ZQPA 4BFAA 2OSWA 4TMCA 1K6AA 3NL3A 2WBKA 1QNSA 3T2PA 5BU6A 3SEPA 1JYXA 4H9UA 2VX7A 4JHOA 1FWIC 2RJHA 2D2GA 1SZNA 1M68A 1ONEA 4FNSA 4NAFA 3DIPA 1H11A 3L2IA 3WLIA 2PWGA 1Q45A 2XVNA 1GCYA 2BVTA 1VFTA 4NJKA 3TCSA 4PSPA 3FIGA 4QDPA 3CQ0A 1HKWA 4WGXA 1OK4A 4ZBCA 3BPWA 1F74A 3IAPA 3MVIA 1KFKA 4MJZA 3T8LA 2YPIA 4P61A 2VGBA 4MUPA 3FGCB 3U2OA 4ML9A 4XZIA 4V1XA 3S9ZA 3RIKA 1JD7A 3QHMA 4FR6A 1E0TA 3U6WA 3TQ0A 4QQUA 2VEGA 1B57A 4QCFA 4R85A 4LUSB 2BMBA 2Y7GA 1J01A 2E28A 3M0IA 2RGMA 3AS3A 2JKAA 3GSMA 4LVFA 4CN1A 1T7LA 3GVVA 5D30A 4C1KA 1O12A 3S5SA 3CUFA 1R0MA 3VKAA 2PLMA 3WQPA 3QJAA 3W2NA 4LOCA 5GJPA 4HQVA 4YPJA 1WA3A 1E0UA 1V4YA 3U2ZA 3VMOA 3GDTA 3P0WA 2YL5A 2EJAA 2F9RA 3PAOA 1GQLA 2VZTA 2X1RA 3AALA 1W2VA 4WUIA 3OBKA 2PBGA 3BXWA 2YL6A 3FHQA 3G3DA 5CXPA 3PZTA 3MI3A 2D0FA 1JDAA 5LA0A 1NSJA 1QOXA 3WL1A 1DIEA 1ZHAA 4AIBA 3ZR5A 2EG8A 1UKSA 2IUZA 2W0UA 1F61A 2P1FA 3ES8A 1BF6A 2EPMX 4AZIA 3QN3A 4O4VA 4UTIA 3KL5A 2XVLA 4MZ8A 3WQ6A 2ZX8A 4AF0B 4G6CA 4QS5A 3MUZ1 2G3MA 2WZEA 3PNZA 2YCLA 4ECLA 2XFYA 4ENLA 3VIPA 1R38A 4KQNA 3G1AA 1YE4A 4RZ5A 3WK0A 1TR1A 3OVRA 5HULA 3ERPA 4XX6A 2D1ZA 1XPGA 3BLLA 1S5WA 2CERA 3W76A 3IV3A 3B0UX 4XKMA 1LP6A 3S83A 3OVGA 2E5BA 1XM3A 4O4WA 1VS1A 2A7NA 4ADTA 4YIWA 1US2A 4E38A 2FIQA 4UR8A 3T07A 3UNDA 3VGBA 4C6QA 2IKHA 4HHLA 1KD0A 4DBDA 4LV4A 4S2BA 3VYLA 2E77A 2HS8A 2E8YA 1JZ7A 3TU9A 3Q58A 4MSSA 1OINA 3E0FA 3PSWA 3CWHA 1KGXA 4WJEA 1OIMA 1PO9A 1ZAJA 4BA0A 1GQIA 4Y8FA 1REQB 2PDUA 2Y7EA 2QGHA 3WDJA 3UG5A 3EX3A 1BRLA 2R1LA 2WWCA 4O10A 4LAZA 3N9KA 5E70A 1ISXA 1OB0A 1UJPA 2DP3A 2Y62A 4RZ6A 4V33A 4O52A 4ROQA 3QW3A 2WMIB 3RILA 1SO5A 2VWTA 2CNCA 3RGTA 5H91A 2XVGA 3ES7A 4FX8A 3VMNA 2ZRWA 3GXDA 3W02A 5HJXA 1XLAA 5ABFB 4L4PA 1NOWA 4QSFA 1UR8A 1VEMA 1FDJA 4AYSA 3V3WA 4DJDC 5JH2A 2O4QA 4ZQMA 1OGBA 4KRUA 3CQKA 4M51A 3FEQA 1TA3A 3QYQA 1VH7A 1SR9A 3GDLA 4JTLA 4FSAA 1G4PA 5H8UA 3ITXA 2QJGA 1TKKA 2GQAA 1B54A 3OPSA 2VKZG 3RDKA 3HPXA 4OIFA 2FZDA 1GOIA 2P53A 3GXPA 1V6TA 3GG8A 3N6QA 1OCBA 3VIHA 1N8FA 2XIIA 1K8XA 2NW0A 1XLFA 4QM1A 3DH7A 2X16A 1F5ZA 1C7TA 4BEQA 6TAAA 1GJUA 1KGUA 1O95A 2PBOA 3UBPC 3PWIA 1G7VA 4JEQA 1LBFA 4R5EA 1LT8A 4XAZA 3LHTA 4JTQA 2WCAA 5JIWA 2PTDA 5AYIA 4AD2A 1A5NC 2YDSA 3FY1A 1CGUA 1E9IA 1SSDA 1UKOA 2ZUUA 2XN0A 4GG9A 1JF6A 3THCA 1Z48A 3SO7A 3KBNA 3ZMRA 1KM2A 3M0LA 4AX6A 5DMNA 4DB7A 1UR1A 2ZWZA 1XYFA 4ZVJA 3I6TA 1ZY9A 3KP1A 1RXOB 3V16A 3TMQA 1Y8BA 3W73A 1FWHC 1AK5A 5T26A 4O28A 1IZKA 1NELA 4H2CA 3SRFA 3L5LA 1H3GA 2BY2A 3KVLA 2WV8A 3W86A 4X9SA 2YCKX 1LCOA 2QUTA 5I6SA 2V8ZA 3W7LA 1CX9A 4U28A 1OABA 1M53A 1FWRA 3GU1A 2IKIA 3ZT5A 3WX7A 1PKLA 4NILA 1ZJHA 2ZZ1A 4Q8NA 4GCXA 4GI4A 2C1IA 3AHZA 4NY2A 3QHOA 4LUSA 4IPLA 4E3TA 5CZSA 4H8UA 5EFDA 3BOLA 1W8SA 2J8GA 4CEUC 4F0RA 4DZAA 1RD6A 5C9ZA 1H0GA 2FZMA 3O9NA 2I7GA 3N9RA 1DE6A 4WCJA 4IHCA 5KZEA 5DMLA 2OEJA 2ACRA 3I6RA 4O11A 1GZ1A 3UERA 4CN6A 3NDZA 1E6XM 4CCDA 3EWWA 3SCRA 2PGEA 5LXXA 4UR7A 1KCZA 1QI4A 3S2NA 4MZYA 4ZB5A 4YTUA 4UMAA 4JY8A 3K1GA 2UY2A 5DEZA 1ISVA 4AZCA 2AL2A 1E71M 4IGSA 3GVGA 2O92A 1BTCA 1BYDA 3S3GA 1P43A 1UP2A 2NQZA 4GZ7A 1PCKA 3ABSA 2QDHA 2WZMA 1UD3A 1XUUA 2CBIA 3SQMA 4UTTA 3DOPA 2VR5A 4IX2A 1CW2A 3PBUA 1KFLA 3QRHA 4N9CA 4U5KA 4B5TA 1OYBA 2VXNA 4F9JA 1AMKA 4US6A 3ITTA 1A3WA 1CI1A 3B03A 1XD0A 4DBWA 2CHNA 3HQ1A 2IQ0A 2DPEA 3I68A 3IANA 4C6LA 3W1LA 4NJIA 1Q63A 3K8LA 5EMKA 3FSTA 1QNOA 1O68A 1TE6A 2WVVB 4HYRA 3HGOA 3DFNA 1Z6KA 4QEEA 4XKYA 1RK5A 3CUIA 3BOFA 4O50A 1LUCA 3W53A 3BSHA 4MG4A 3W74A 3P60A 1JGIA 3M47A 2KZHA 1YPFA 4QCEA 3ALFA 1S38A 3MO4A 4FALA 4JYEA 3BLKA 1V5XA 2DJXA 3TSMA 1U30A 3KRUA 3P74A 1S5MA 1UWTA 3BC9A 2HE8A 4K8GA 5LIUX 3O0FA 1GQKA 4KRTA 1QUMA 3OQEA 1A0DA 2A21A 3DI1A 4RNHA 3HGSA 4ZL1A 1T6MA 1W54A 2AKZA 2C1GA 5AFDA 4AU0A 4H7CA 1IR2A 1GYLA 4NVTA 1RQHA 1DIKA 4GABA 2QCLA 1PX3A 3CEUA 3P5ZA 5SWUA 1J2BA 5HJYA 4O1BA 3CH0A 3ANVA 1EF3A 3F5KA 3HA1A 3B0PA 2VFFA 3GHRA 2HXTA 2CLMA 4FS9A 5FJJA 3UP8A 3PSVA 4F0HA 3HO8A 3DG3A 2A6LA 1V0KA 2QEZA 3QZAA 1W17A 2P8CA 3GIQA 5HWJA 3W2JA 1E9YB 2INZA 2YLAA 2W67A 4UTUA 2FGZA 1JDDA 1OD8A 3F2CA 3U8GA 4KH2A 3W85A 1HQTA 1H4PA 2GQ9A 4W5ZA 3TSBA 4M8UA 3D5HA 1W9DM 4CQ8A 4C6JA 3O07A 4ZFCA 3SRKA 3WLKX 1FKWA 3STGA 5K9DA 2ZVIA 3MW7A 3IJ7A 3SCVA 1ZPTA 3BICA 1LG2A 1BVWA 1ZBCA 4GIRA 3W7PA 2Q02A 1P0KA 4LRTA 2AOSA 1M65A 4Z0SA 1FHLA 2HK0A 3P0XA 3A22A 3GU9A 3G1VA 1G94A 4RE4A 4HN8A 1GOOA 1SU5A 3NGJA 3OHIA 2ZXDA 4PODA 3NQ7A 2XHYA 3MVTA 4GY7A 2DSZA 2FFCA 3VDBA 3WL0A 3H2MA 2OGJA 2JIWA 3B9NA 3E2VA 3AIUA 3ELFA 2BHYA 1YW1A 3KOYA 3FW6A 3T0BA 4GH1A 3AYSA 4DHGA 3M7WA 5EFFA 2OT1A 2OYKA 5BCAA 2WCSA 2PRLA 3QV8A 1XRVA 1IT8A 3CHFA 3GTFA 3IIPA 4TOQA 3USBA 4JZ5A 3QOKA 1GTHA 1DORA 1YADA 3PB0A 4Z0JA 1C8VA 2PDIA 3ARXA 1D3CA 1HN1A 4UQDA 2Z4GA 4CKQA 1QWKA 2P3ZA 5A8OA 3LCHA 2VP8A 4XISA 5CZ0A 3LZ3A 2NSXA 1VQTA 2CBJA 3S1UA 4U3AA 3V5OA 1RLDA 4N02A 2J7GA 4W89A 2EBNA 3W1PA 3WY1A 4ZO8A 4DX3A 4BEUA 1OVDA 1OFPA 3BGGA 1JUKA 1TJ0A 5GNXA 3B4UA 2VFHA 4XTDA 2V6AA 2VGIA 1XBXA 4C90A 1TB3A 4DRSA 1MSSA 9XIMA 3A13A 2NT0A 1E72M 3BV7A 4R33A 4U31A 3N13A 2YYUA 2WWDA 2NSOA 3WMSA 2P0IA 3AAMA 1NQKA 3A12A 4GD0A 1QI5A 3NL6A 5F2IA 4IICA 1XX1A 1LLWA 1O60A 3H2FA 3EX4A 3KCJA 3W84A 3GH5A 4OECA 1XLJA 4QQ3A 3VNYA 3K2GA 3W1RA 3IJDA 1S3TC 3VINA 4LUTB 3BJFA 4ML4A 3EAUA 2X2GA 1GW1A 2ZX7A 1BHGA 2W79A 4NAEB 3L23A 1CGTA 3PPHA 3T0AA 3O16A 2Z1SA 4YCPA 3WD3A 1KRBC 4DI8A 1WDWA 5FSEC 1DQWA 1IWPA 3S1VA 4PTXA 3WFZA 3DDMA 3IIOA 3OG3A 3SI9A 3CM4A 3EGJA 5EBUA 4L4OA 4AMCA 1EL3A 1TV2A 4JY9A 1PX8A 2EKGA 3M0HA 1E1EA 4B5XA 2FPTA 3W2UA 3H2OA 2DSUA 3B8SA 2CBVA 1R2TA 2ABAA 1E56A 4KCWA 4B9ZA 1UMLA 4NP7A 3GZAA 4JQ3A 1QI3A 3MUXA 4JNMA 2Y7FA 2JIEA 2B81A 3A23A 1FWDC 3JZEA 2WLZA 1XYZA 5BOFA 4AC1X 1JZ4A 4X63A 5FAGA 4A8NA 1RCQA 1SJCA 1D8WA 2Y24A 2WNWA 2C0HA 1Q6DA 1VPXA 4UOQA 3BW4A 3W28A 4BHYA 3V36A 4C6FA 1KR1A 1KB3A 4MJMA 2QV4A 1EC7A 2YXXA 3BMWA 2WB5A 4TV5A 1HKVA 3UPWA 1VPQA 1R3QA 1GZGA 1H62A 2PF0A 4AFYA 1CDGA 1MW3A 2ZZ3A 4AD1A 2PC4A 4KERA 4ES4A 2ASHA 3STPA 1XINA 4AC7C 1IHIA 1VR6A 3ARSA 1V02E 2J27A 4MNJA 3HQPA 1JPHA 2NUWA 3K5XA 2H3BA 1P6BA 4PEKA 4GNJA 5BMWA 3SUSA 3VCCA 1NJJA 1OY0A 3AMLA 1KQYA 3KP0A 1JDCA 4LYKA 5H8MA 2EG6A 1UP0A 4QG6A 2DJLA 4P5UA 2DZTA 3S1XA 2ZFAA 5JVLA 1RV8A 2XVKA 1ISYA 2X1SA 4POCA 1SGJA 1SR0A 5KMYA 3EXSA 1R3TA 3G18A 4IFKA 1A5BA 3SUUA 3BAXA 3AXMA 2FFIA 5D9PA 3TUUA 4QFUA 1R7OA 3DCPA 1W9PA 3O6CA 2B4GA 2GJXB 3FXGA 1S39A 1JZ2A 1C90A 1R9ZA 4HU0A 4WZHA 5CC7A 5HMSA 1AVAA 3ABZA 3OLDA 4LTSA 2HPMA 4DLFA 4ZCWA 3G1DA 2DDXA 1UCWA 3NQ8A 1DL3A 3BSMA 3ZIZA 2F6UA 5HJLA 1W2PA 3WQ4A 4UFMA 1HJXA 3GIPA 1JI1A 2FHCA 4PUJA 1EOMA 3C0QA 3WLJA 1TZ7A 3W70A 4DNHA 3W7RA 4KF1A 4O19A 4QEHA 1VKFA 3LI0A 4H7VA 1AQ0A 2WSQA 1UBPC 2J79A 5DCEA 5C5YA 2ZUTA 3W24A 3LCIA 1V79A 1DQUA 3T08A 3CO4A 1L9WA 1JULA 2R1KA 5EMLA 1QNVA 3MSDA 3WQGA 2G8ZA 1Z9AA 1RQEA 4Y9NA 4JFSA 4GQ0A 3MMUA 3IGSA 1ZJIA 1VF8A 1TWDA 3T55A 1VFUA 4V2XA 3G1RA 1JVNA 3NVTA 3MCOA 1BXBA 1Q4WA 4NSBA 3H21A 4I9AA 4Z2IA 3MUY1 1TX0A 4OWGA 4UTLA 1KCLA 2G96A 2P10A 3GVQA 4NAEA 2VURA 1E70M 4IFOA 1M3UA 4HU4A 4GNKB 2BSLA 3CB8A 1XLEA 3B9OA 5I00A 4I5UA 2G4JA 3PNUA 3TQKA 4Q7IA 1ECQA 4D2JA 2FDMA 3AJ7A 1V02A 4M7TA 4IQDA 1JGMA 2Z27A 3M07A 4AY1A 1FRBA 5JUVA 3QTPA 4CQDA 4P7LA 5F2LA 1H7NA 3F4VA 5CEWA 3GG1A 3UQNA 2D3NA 4O1AA 5C54A 3TFCA 3ALGA 1QHZA 4LQ1A 2JGYA 1G9HA 3N2CA 1EF2A 2HNEA 2OJPA 4NKCA 2I5GA 3NZQA 1W8GA 1CLVA 1NQ6A 3BANA 1XYCA 4R9OA 1X8CA 3NEVA 4AD3A 3T2OA 1X6LA 2VEKA 1WBHA 2RJGA 4V28A 1AL7A 1T40A 3UNTA 3MMTA 5GNYA 3DESA 3GVRA 1GPWA 1JG9A 1RD5A 3H4XA 4B15A 5A95A 4J4KA 1LG1A 4E4PA 1H7WA 2Y8UA 3VKKA 1ZLPA 1EGMA 1B0IA 3PUEA 1WAWA 4DM2A 1OFBA 4EAMA 1FWEC 1TPB1 4AHQA 4DZIA 3RO6A 4LY4A 1DJXA 4FLOA 4E8DA 3WD4A 2GSEA 1TPVA 1EO5A 2Y89A 4AWEA 1MFVA 1AQFA 2ALDA 1FCBA 3PG8A 3KX6A 3G22A 1B30A 3IIXA 1NWTA 2YDQA 2VRJA 3UZWA 1X7FA 5F1VA 3NFUA 1EC8A 4IUGA 2XUCA 2HXUA 4NZ4A 5BROA 1NU5A 4DBSA 5LIKX 1CECA 4NG3A 3URQA 1L8PA 1VBGA 1PS9A 3PZMA 4TVCA 3QVQA 3QSRA 5KZDA 3W87A 1UZHA 3VGFA 4J35A 1JF5A 1G67A 2DZSA 1SFTA 4JTRA 2IKGA 1SVDA 4Y7EA 1W3HA 5EMJA 4XSLA 1QW9A 2YA1A 1K7FA 4GQQA 4PB5A 3ISIX 2D2JA 1PPIA 3BAKA 3KBSA 1Q7QA 8CGTA 2R9RA 2NWRA 2QPSA 4Q32A 2CETA 3LHUA 4LS1A 4NYUA 2CW6A 4OGZA 3MUAA 4WY0F 1LOLA 3NZRA 3CNYA 3WBYA 1L2UA 3AFBA 2OTDA 2OO6A 2ISSA 3II1A 3LM7A 1XYAA 2OYMA 2HBXA 4KWUA 3NURA 1NVMA 1C91A 3QGKC 2Z0IA 3QR1A 2WW5A 5KSWA 5XIMA 1W91A 3H54A 3Q65A 1DE5A 5LYRA 3TP4A 1IXPA 3LK6A 1AZ1A 5E0KA 2PAJA 7REQB 1FFRA 3MV01 5DMMA 1KXTA 3O06A 4C6EA 5CPOA 3CWOX 3BAJA 2DORA 1EHAA 3GTIA 5A69A 2PDBA 5J04A 3KM8A 3M5XA 4WVXA 4AWSA 3M43A 5LHEA 2OZ8A 1JCLA 1XIMA 4QNWA 1R3SA 3AYRA 2XM1A 2A3BA 2YCLB 4OV9A 3D6NA 3A3HA 3NPUA 4OOZA 1C8XA 3PJUA 2OCZA 2NXGA 4PMRA 1MDRA 1L6FA 4EVZA 1JI2A 1J4EA 5HNNA 2CWXA 4HA0A 1FVPA 5BU9A 3BARA 4EX4A 2JFEX 3M0XA 1M7OA 4J5NA 4QDWA 1JCYA 3PZQA 3NQFA 5DY3A 3LV5A 3MDUA 4EXQA 1FWAC 4GUGA 3WJXA 4RKAA 2WPBA 1MO0A 1TTQA 3FYOA 5D38A 1YXYA 4R27A 4GO8A 2NUXA 1J9YA 3HJEA 3OIXA 2JALA 3H7RA 3EMCA 3UCQA 4X2RA 1QASA 3UA4A 3FHAA 2WJEA 3U3HA 4Q8MA 1CGVA 1DBTA 3AMKA 4KWWA 1Q7ZA 3HMCA 3IUHA 1X96A 2C79A 3LBOA 2D22A 2Y8KA 1K7XA 1CT5A 1MUWA 3VX0A 4PMJA 2X05A 1TQJA 4NT0A 1EP2A 2E6AA 4HNVA 2Z6IA 3NQMA 3VOFA 3AS2A 1OFRA 4OKDA 4QR6A 4NNCA 1I2NA 3K46A 3NPWA 2HCVA 3ZFHA 4AB4A 3W71A 3JU2A 4PMOA 2WMJA 1W6TA 2Z7KA 1ZRQA 4NASA 3U9IA 1FY6A 4K1GA 1X38A 1LJYA 1Z41A 1D3HA 4X9YA 1R5YA 2PD9A 1ZTVA 4FOKA 1AMYA 3U2CA 3L4UA 2BY0A 2PB1A 4E4UA 1PTAA 1GWJA 4IQEA 3OA3A 3NQDA 1ZBVA 3KOFA 1BWVA 4JKLA 2ZRUA 4DVOA 2EO7A 3C2VA 2WM0A 1TA3B 5IOBA 1BXNA 4MNLA 4PSRA 3IVTA 1KXVA 3WN6A 1RY0A 2NX1A 1PBGA 3L65A 4IGHA 3Q67A 3A64A 3TWBA 2PP3A 3LGGA 4YHEA 2BWGA 1HVQA 1ICPA 2DGAA 4JTCA 5C70A 3R6IA 2EPOA 3E0LA 1CXKA 3W1TA 3A4XA 3B8DA 2J47A 3B9EA 1V6WA 3RPMA 1YNPA 2DU2A 4A6GA 3AIBA 4RNJA 4KIEA 1CCWB 4LVDA 4LU0A 3TWAA 4QDMA 4N0RA 2J7HA 1D9EA 3R58A 5A3HA 1FWTA 3V0SA 1JYVA 1UH2A 3GTXA 5H8PA 3NL5A 5LIWX 1DPMA 4MGGA 2NV1A 1LLOA 2Q3RA 3I65A 2A7RA 1TCDA 2VEFA 1AH0A 1O5QA 2V3FA 3O2LA 3GUWA 1WKDA 5D2WA 1F6KA 3C2YA 1EZ2A 3KOWA 1XR2A 3UWUA 4IT1A 2R8WA 4ATDA 1E40A 3KBWA 5I03A 2C18A 4ZOBA 2FVKA 3VOHA 4LS2A 2Z2AA 3LNMA 4ZA0A 1IZCA 3W6MA 4F66A 3I3DA 3MI2A 2HWGA 3QXBA 3CIWA 3KCOA 4N4QA 2PF8A 4UTJA 3SN0A 4O54A 4TX8A 3ITVA 1TV8A 1GVOA 2WANA 4GZEA 3B40A 4KCVA 3AHYA 3T0CA 3MP5A 2PDCA 1K8YA 3ZO9A 5A2CA 3RO8A 5D05A 3F4CA 2QCDA 4IG2B 3MKCA 3S1GA 2YL9A 1EOKA 4N4PA 4YCOA 4MNMA 5B7YA 5AVNA 2DW7A 1MQRA 1U1HA 1A4LA 1FA2A 2P76A 1BAGA 3O6DA 3S4TA 2VZUA 1KQZA 3WKZA 3M46A 2SFPA 1W3NA 2IS7A 4Z2GA 4AX7A 3L4XA 5HQMA 3CXOA 5B80A 5FIPA 3PUGA 1J96A 3OLGA 4J3UA 3NQ6A 5RUBA 4E4FA 1O66A 4F0SA 3U4FA 2GJRA 4Y90A 3AIQA 2PGRA 2GOUA 2PGWA 2GSJA 3HTWA 3GNDA 4O15A 3G8EA 2PEVA 3WQ5A 4OV4A 4B16A 4KKXA 3PULA 1G1YA 2DFAA 1RCXB 3HN3A 3TQPA 4LAOA 1ZSXA 3APYA 4HNOA 2VQUA 3LGDA 1ZP4A 2XU2A 2J7DA 3BAYA 3TJXA 4DY1A 2PURA 1WE5A 2CIPA 2XIBA 5FF7A 4JTDA 1CNVA 3ZSSA 2V5KA 1UWQA 1XIGA 1SZGA 2QCFA 4UC5A 1Q13A 2VDHA 1KM1A 1UG6A 1UR9A 4J1OA 3REQA 1YDOA 2QUMA 4LS0A 2ZVRA 4IL2A 3MP3A 1PB0A 4AAJA 4XWUA 1XUZA 2R91A 4JICA 1WZMA 2J74A 4LX4A 1P7TB 3DZ1A 3L21A 5IBXC 1KBLA 1OADA 3V0TA 4AZCB 4DEFA 1K9DA 2EJ1A 1R3YA 3L66A 3S0CA 1E73M 1Y65A 1IGWA 1PDZA 3FEMA 3WMBA 3FJ6A 4Q6XA 2QQ6A 3M0KA 4ONVA 1GEHA 3T4WA 4URIA 5G2WA 2ANUA 2POTA 3AYVA 1JJKA 3WLTA 3BUVA 4I7VA 1ZBKA 3MPGA 3QKZA 1QDSA 5HNTA 2VFIA 2UV8G 1JIBA 2GK1A 1KRCC 4NI3A 1P48A 1FWGC 3WDRA 3EOUA 4M56A 3WBXA 4HU3A 4DXXA 3TMLA 2YBUA 3U5YA 4C7DA 1YTEA 3GDMA 1P1XA 3GXIA 4W8BA 4IIBA 4ASTA 4XAYA 3EA2A 3TN5A 3HMJG 2DVUA 3C4UA 5D9OA 1WKEA 2JF7A 3OZPA 3T78A 1A0CA 3NOYA 2ZUMA 4K68A 2CLKA 3OZMA 4FLSA 1P0DA 3W6LA 1BF2A 4UTTC 3WG6A 2GVEA 3RF9A 3E0IA 2BFGA 2O9TA 1MXGA 1PZ3A 1A80A 4OBRA 2ZZ6A 4OHQA 3UJ2A 3WLOA 5DMYA 1BXCA 4W87A 3KBJA 2QCEA 3W2MA 2VMFA 4H1ZA 1DJZA 1KTCA 1W1IE 3S46A 3GYCA 7CGTA 3BURA 1V0NA 2GPTA 3VAVA 1KGWA 1LORA 3FAXA 3IPWA 4PEEA 5BXTA 3TJ4A 1OWQA 3N73A 3BZGA 5AYZA 4F3HA 2G3FA 2DIKA 3O6AA 2GLKA 1QWGA 4DI9A 2CHOA 3SCSA 4DO5A 5U7SA 4G9PA 3BJSA 1E1FA 2X2YA 2VRQA 3H53A 3R10A 1GUVA 3GR7A 1E4LA 1JCJA 1WXYA 1TZZA 1PDYA 4WR3A 2LLEA 4GQRA 2PWVA 1VC4A 2V5DA 2CWNA 4D6DA 1W9XA 3FDGA 5CSYA 4NZFA 4MJ4A 3VD5A 4G1KA 4FNRA 1TPUA 3LY0A 1IYXA 1S2AA 3CLWA 4JTJA 2QF7A 4GRSA 3F2DA 3M5VA 4K2SA 4O13A 3VNJA 3WNMA 1UWAA 4PR4A 1DWJM 4QXIA 1LT7A 4QBXA 3APGA 2IMRA 4NJHA 5B7ZA 3VD7A 2VR4A 1DWIM 4S3GA 1O6IA 3UXKA 3AZSA 4IWWA 2XTKA 3PC0A 3NPVA 3OOQA 4J3ZA 3ZOAA 4JIHA 2WSKA 1I1XA 5KZ6A 1BRLB 3WELA 1XRSA 3WK2A 3RHGA 3VZXA 2ABBA 1QK2A 4I90A 3DYMA 5D33A 4BQ5A 4MF4A 1WCGA 2VX5A 5F4SA 1OZQA 1KWKA 3QKEA 1KM5A 3IEBA 1CXEA 2FHBA 1R9XA 1LQ0A 4D6CA 2YDRA 3QPEA 3R25A 4CUCA 1HJVA 2F2KA 5DX7A 3H22A 3BQ6A 1AH4A 1VBJA 3LHYA 1RSCA 1LLZA 3TN3A 1DQXA 1HX0A 2DUXA 2QUVA 3DN5A 3EWCA 5A6BA 3M4HA 4JQ1A 1XIFA 3KZPA 2Z24A 5K4ZA 1LRNA 3WK1A 2HS6A 3WQ8A 2GL5A 3T6CA 2Q3OA 4DJEC 1IQ8A 4Y8EA 3W9ZA 1NF0A 2J88A 5TD4A 1RPXA 1F4AA 1E0WA 2HNHA 4HBKA 2QVNA 4V1YA 3RMEA 4KT2A 5D09A 3BCDA 3C0JA 1SMDA 2E67A 3G0XA 4JN8A 4TXEA 3UXAA 2RH9A 1OZMA 1W5OA 1ZUAX 4DJDA 4HK6A 3LHVA 3KTCA 2YB4A 5CG7A 4NNBA 3OVPA 4OJYA 3JS3A 5T8GA 5DXYA 2A3EA 2DIEA 4W86A 4DZ5A 4Q4PA 4AVFA 5HAOA 2ZDRA 3FJNA 2XIJA 5CAHA 3WH6A 3WQEA 3S5YA 3IARA 3MTWA 5I3FA 5H2ZA 2AKMA 3RCYA 2VYOA 3HV9A 1U5VA 3UZXA 3ARVA 5XIAA 1B90A 1WUFA 2HZGA 1QMLA 5E0FA 4GISA 5CJNA 4MADA 1HZYA 2W62A 3NYDA 1S2TA 2ZUSA 3A4AA 1A50A 1A47A 2XINA 2A79A 5CZJA 4ZENA 5DELA 4J3SA 2B7PA 4YNGA 3E5PA 3TLQA 1EWDA 2PWEA 2FZ8A 3EB4A 3QOMA 3CLMA 3RCMA 2IKJA 1ENUA 3WNPA 4XIAA 3JUGA 2AGKA 3V18A 4YVXA 4CU8A 4E5TA 2J62A 1B4KA 1BLIA 1LOSA 2ACQA 2HK1A 4UFLA 1I0DA 2DSKA 4UBPC 1I2RA 5CBBA 5TIMA 2PDLA 3VCNA 2X41A 4QJ4B 4KW2A 4LGXA 4A8RA 3ZS4A 2J8TA 5LIXX 1IE7C 3EX6A 1HT6A 2AAMA 3BVJA 1JZ6A 4GJJA 4NL1A 4UR9A 4TTGA 4XO7A 3C86A 1X1ZA 2OQLA 5A6SA 3VIOA 1PUDA 3P81A 2G5WA 3GNOA 3TDFA 5HR6A 4X60A 1GHSA 4QG9A 3NSXA 4L1XA 2C71A 3TW9A 2ZX9A 3ITLA 2R1MA 4QP0A 4DAIA 1RQBA 3R8RA 3E2SA 4IGNA 3ZT7A 2V82A 1B9ZA 3L4TA 4Q4RA 5DY2A 1GT8A 2F6KA 4Q22A 4D1IA 4P7OA 3V1HA 2YW3A 3DG7A 1K8ZA 1TV3A 3TSDA 3BSGA 4O1EA 5AZ1A 4ZO6A 2J6VA 4ICMA 2YCEA 4DN1A 3ANYA 1OC7A 1PHWA 3GNRA 5FSDC 5D2TA 3OTRA 4LCQA 4Q7NA 1FWNA 2WPGA 3GVWA 4H01A 3TROA 1YXCA 2E5CA 4I5RA 3ARZA 4G1NA 3JZUA 1GYMA 5D2YA 4B4HA 3WNLA 1C29A 1THFD 5HATA 5IXEA 3VNMA 1MRAA 3DX5A 3ABOA 3W3OA 5I78A 4A3RA 3GWQA 1XDMA 1RP9A 1OG0A 3LBCA 1XIIA 4BI7A 5F1UA 2PFHA 4RXFA 3CEPA 5CAKA 3S6OA 3UJFA 2VHLA 2D2HA 1EJ7L 3PZNA 2WJFA 1OEPA 3F5JA 1XL9A 4MLRA 3WF3A 2PLKA 4K7VA 3STCA 3OVQA 3CMFA 4A05A 1KLZA 3N34A 2J77A 5C7HA 2VL4A 1GOKA 3H12A 4GPNA 3FKRA 1FH9A 3RLUA 3VIKA 2C0AA 3CYJA 1DTNA 1NDVA 2CLLA 2WYSA 3G1FA 1O5XA 1V7YA 4HA4A 3SCUA 3NPXA 5BRPA 3MSGA 1XCWA 2E1WA 1Z7AA 3KE0A 4KFOA 4Y9PA 1FCVA 1JDFA 4IQLA 3EWXA 1CYGA 1V6UA 1I75A 4GBDA 3N2MA 4XV0A 1XP3A 4YTRA 2RDUA 3URBA 1UWUA 4U5IA 4YMZA 2C1HA 1ADOA 9RUBA 4QAWA 1UKQA 2VZOA 2OYLA 5FCZA 2PCQA 4GIYA 2ZUNA 4LNYA 2YZRA 2PUZA 4BF9A 1JQXA 3CAKA 4DWSD 1JCMP 1JPIA 4F9DA 4L9ZA 3W7KA 3KBMA 2QHAA 1H60A 1OK6A 4IF2A 1UZ1A 1H5YA 1RVGA 2BXVA 3L4YA 1TELA 3CAQA 2EPNA 2RUSA 3LEPA 4V27A 5LA2A 2KAUC 1LQ2A 1RY8A 3JW7A 1B3ZA 3GNNA 1ITUA 1B3YA 3BOXA 4ADSA 1FUYA 1X1OA 3R2GA 1ZZMA 3OGVA 4ZTYA 4K8HA 1CXIA 1KW1A 3BO9A 5AC6A 7TAAA 3DGBA 4JXCA 3GW3A 4KEUA 1QW8A 4GCAA 4KRZA 4KFNA 4LB3A 3TZFA 3GXNA 3LG3A 2X0SA 4K36A 4IFRA 4UZUA 4FEZA 4WEVX 4GXWA 3RR4A 1BG4A 4DF2A 4CEXC 4DBUA 2WMGA 5I3JA 3U4AA 4W8AA 1SQ7A 5EL1A 3VM5A 3QTGA 4DO7A 4K6AA 1VZWA 2O9PA 3QQWA 3E3HA 4HA1A 2E25A 2G50A 4WX2A 5PTDA 3UZ5A 2DH3A 5D8WA 3MA8A 3RAOA 5G5IA 3L7RA 1W1A1 4J27A 1B3VA 3M7SA 4C1LA 2VGGA 3SW6A 2HISA 3PWAA 4F8XA 2CLPA 5AC7A 4N2YA 4HCHA 4LFYA 2QCHA 4IXHA 4UUIA 8RUCA 2Y4SA 3HPSA 4JD4A 3NYZA 2V3EA 2GUYA 2OODA 3VILA 2BHZA 4A8LA 3PJXA 4I9MA 3O15A 1ODUA 1U83A 4MWAD 1UR0A 4MKVA 5K2ZA 1DXIA 4M6QA 2YXOA 1E6RA 1GTEA 4GUJA 4BF7A 2VEMA 1E0VA 2YB1A 4D6GA 2CZ5A 4F0MA 1J6OA 1H7OA 4OUIA 5AC4A 1F3TA 3VABA 4YLWA 1EH9A 4C5ZA 3HG2A 2PE4A 1Q6CA 1UUMA 3U2EA 5C6MA 2JGQA 2FGBA 3GE7A 1EJSC 4FIQA 3W7QA 1B5TA 3OBEA 3QY7A 3HOJA 4IM4A 1TRDA 3GKFA 3IWPA 1FQ0A 1YHTA 2XH7A 4RE0A 3W82A 2BP1A 1RALA 1VCGA 1ME8A 1R86A 2ZC1A 3P6LA 3ARPA 1OX6A 3ATYA 1OFEA 3H4WA 3BZJA 2Y7DA 4S39A 5K7JA 1PCWA 3VM7A 4HNTA 4NRRA 2VCAA 2VCCA 4LUIA 1KC7A 5C9XA 3W7GA 2EG7A 2VO5A 3FV9A 5FA5A 1V51A 3NEHA 4LWWA 1NTHA 2FMNA 1FWJC 3LX9A 3E74A 4QS6A 3TR2A 3TTYA 3FKKA 1R3WA 3S2MA 2Y85A 3S2CA 4IL0A 1AW1A 1ONXA 2ADAA 1TWZA 2E9LA 1UBSA 4Z2HA 2UWFA 3LPPA 2XH4A 2R14A 2PCEA 3I7RA 2VM8A 3ZM8A 3TZNA 1NDZA 2C91A 5ABHA 1Q6QA 2YW4A 1CWYA 1WXZA 3W4RA 4XD5A 3KOZA 1RBLA 3LTYA 3LPGA 4WSHA 1RH9A 3TYDA 3P8IA 4AD5A 5JBFA 1XISA 3M64A 3S6DA 4L61A 3E9AA 3NCOA 4MFEA 2RKXA 3H26A 3BLDA 2FQIA 3MV11 4HD5A 3CQJA 3UT0A 2Q71A 4HTYA 5D9NA 2H6RA 2OX4A 2J9XA 2FYMA 4GUIA 4XZMX 3C2RA 3R12A 1E5JA 5A6BD 3OODA 3AI0A 3TR9A 2V5BA 5IDIA 6REQB 3I4KA 1QJWA 3DENA 4GYJA 1SW7A 5FAJA 2X7WA 3PZVA 1JZ8A 2BGNE 4WD0A 1PWLA 5C2CA 3UCCA 2D73A 4PULA 1HKKA 3BAIA 4HA3A 1DKWA 4YU1A 4UTFA 3UU0A 1CXFA 3BG9A 4HMCA 1NAL1 3I3BA 4L4LA 3ZVHA 2AQWA 3SADA 5EU9A 1DWHM 5AOUA 3MT1A 1E9LA 4IIGA 3WD1A 2RFGA 4Z08A 4Y9MA 4YTQA 4A8IA 3IS4A 2GDVA 4DM1A 2PZ0A 3BCJA 2J9ZA 5TF0A 2TYSA 1MVYA 1HP5A 1C8QA 4LJ3A 3W25A 3R0UA 1LYXA 3IV8A 2Y1HA 3CV7A 3HQNA 1RA5A 4IIEA 2BY1A 3C56A 2W66A 3H4GA 1SMAA 1A5LC 3IK4A 4AEOA 4IMAA 3C0SA 3PAJA 4GGHA 3WH7A 2V9DA 3M5YA 4UIOA 3W1AA 4QG8A 1EYEA 4Q4OA 1JR1A 4IIDA 1Y5XA 4OUEA 3S5ZA 4LBSA 1OT1A 3R5EA 2I5QA 3LI1A 1M41A 4ATLA 3KRBA 4DJFA 4A2RA 3T2QA 2A0NA 3QMTA 3VKJA 3QLDA 1PKYA 3AQUA 1QPKA 4IJCA 4S2CA 3W2LA 1DJWA 1G69A 3BQ5A 4UQAA 1WDSA 4WHBA 1AJ2A 4Y2WA 1K9EA 3POHA 4YXGA 1XDLA 3W83A 2UZ9A 4IIHA 1GG1A 3T0DA 2R1NA 4J3XA 5F7UA 5BWFA 5DRIA 3RYSA 2R6OA 2QJIA 4E3VA 3VDHA 3INPA 4ZXOA 3TW7A 1H63A 3CC1A 1KM6A 1XSKA 3LXAA 3U7BA 4B5WA 5IDZA 1KKOA 3VI2A 3IJ6A 5CKSA 4UFIA 3OW1A 1XIJA 4ZO7A 1NFPA 3C2OA 2J9YA 2Z1VA 1EUNA 1SO4A 5ECVA 3C6CA 3SCQA 4ACZB 3URNA 3W7DA 1UR4A 4H83A 4H8HA 2B31A 3TONA 1WV2A 3IIVA 5IFPA 3MYPA 4D8AA 4CQBA 1MZRA 4MOZA 3NQAA 1RCOB 1ELSA 3QW4B 1HO1A 3GZ3A 4X61A 4AUBA 1K77A 5TNVA 3GR4A 3HGRA 1VB9A 5TQLA 2DV0A 4JTFA 3UWQA 3NR0A 2X1IA 1T96A 3P8JA 1PIGA 3IJ9A 4FNQA 4E8GA 1GVSA 1TCMA 3GUGA 2PMQA 3AHXA 4GVGA 2BDQA 3VOJA 2AL1A 2REQA 3L0NA 3M41A 4ZZ9A 4G7EA 3VZZA 3MUCA 1WZKA 2W6RA 1VYSX 3CMGA 1FHUA 4LW7A 2PWHA 3PZ9A 2V69A 1H0IA 4OZOA 4AXKA 4QROA 4BY3A 1LL7A 4FF5A 2CITA 4B2DA 1HVXA 4BK9A 3ICJA 3RPTA 4W5UA 1EXBA 4KIRA 2I9UA 2ZTKA 3NUKA 1FXPA 2DQXA 5E6YA 2QPUA 5CCZA 1X6UA 3VGEA 1XV8A 3MKKA 2RGLA 1VEPA 4D72A 1EX1A 3N2OA 2PDQA 6XIAA 3IRSA 3VKBA 5DXXA 1F8MA 1A5UA 3EPNA 5ABFA 3CTLA 3QGVA 3H2AA 1ICQA 1OGSA 4W4QA 3UXLA 3F03K 5A2AA 3NTYA 1QK0A 3LZ5A 4REQB 2HTMA 4CVUA 4I5XA 5EB8A 4AIOA 1R47A 4UFHA 4HPNA 1LWJA 1TV7A 5CPMA 1UQZA 3VOGA 1REQA 1K1DA 6ENLA 2E68A 2PDMA 2PA6A 3BE7A 3A21A 3KCLA 4JX4A 3S8HA 3GH4A 2PDHA 2ATSA 1UA7A 3UR5A 4D6JA 5KEZA 3SGZA 5DBTA 3QF0A 2BGQA 2C6QA 4CN4A 3YPIA 1MW0A 4AZ6A 4MLJA 2V2DA 3VO0A 1TTJA 1EEPA 2F8QA 4WOQA 2BZNA 2DW6A 4LC8A 1BVNP 3PG9A 3P2VA 2WCGA 5BZAA 2VUNA 4C65A 3QMRA 1XJBA 1F6PA 1FCQA 4CQAA 2ZA2A 3TN4A 3LM3A 1ZJBA 2OMAA 3PWGA 2Y8VA 3KDNA 1PV8A 4DUVA 3KXQA 3VIIA 3WNOA 1TR9A 3EWYA 4GE8A 1DJGA 2PP0A 4RDYA 4NZ3A 2RDTA 4XZWA 3QSTA 4B9YA 1XLGA 4OBSA 1WNOA 4Z1YA 1VJZA 4D8ZA 5I5RA 2ZBTA 4XVDA 1QPOA 4ZE5A 5FJIA 3ARWA 1HJSA 1KCKA 1C3FA 2DH2A 4HYWA 4WDTA 1ADSA 1RBOB 1EJTC 1E3ZA 3AZTA 3AYTA 5BW6A 3AZRA 5CZKA 2TRSA 4AW7A 2HSAA 3WBWA 4HZ7A 4UTWA 2ZA3A 3B05A 4EIVA 4Q7BA 2WJDA 1W1YA 1Q6FA 5T9BG 2NX3A 1EFZA 4ADUA 1HJWA 5LGZA 3TYCA 3TXVA 3UYIA 3TYBA 4XBKA 4RPPA 1W9BM 2CLEA 1Q4NX 3MP4A 2XIOA 1EJVC 3WQWA 1G6CA 1EHNA 2IQTA 2E5DA 1VCFA 2WOQA 1VJSA 2O9RA 4HJFA 3EXTA 5C9UA 4D6EA 3REQB 4UQEA 1RA0A 3WFLA 1L6GA 3TEVA 3MY9A 4INFA 3DFOA 1DJIA 1CGWA 1VFLA 4L7ZA 1MXDA 3CUJA 1RZMA 3SUWA 4R34A 4PA8A 3E0WA 1JCTA 3NQGA 3IRDA 1XLHA 1HXJA 1H7XA 4GXMA 5HQLA 4FNTA 4O1DA 5FL1A 3NM1A 1XRTA 4C7FA 4O0KA 3M0JA 3XINA 2WKJA 4LV9A 1I4NA 3R0KA 1RPKA 4KMQA 4BI5A 1BQGA 4X0VA 2QS8A 1GJPA 1KKRA 4QJ1A 2PDJA 2QZRA 2CLFA 4HK7A 5T91A 4FLRA 1US3A 3P84A 4WKFA 3UY8A 1VHCA 4N6EA 1ZJAA 3VVGA 3ZJ6A 3GXTA 1NOFA 1R85A 4AEFA 1E6SM 1M5WA 4PGLA 1UD2A 3G3MA 2WZIA 1XC4A 4L80A 3RK8A 3ZJKA 3EYPA 2UY4A 1EXPA 5ECUA 3W72A 3CV6A 3PR2A 4E2VA 1Q7MA 2GOKA 2NLIA 1TJPA 3QR0A 5HOSA 1YXDA 1J5SA 1MQQA 5MHBA 4DIAA 5I24A 3NL2A 4H4IA 2OZ3A 1FXQA 5AHIA 5E0CA 3UWEA 3HF3A 1GVIA 4B3KA 2WSRA 1NFGA 4LB4A 4DUWA 4Z1DA 3BLEA 4XZNX 3RLHA 3IK2A 2OELA 1KFCA 3NO3A 3WDHA 4GO9A 2VC9A 7XIMA 4EF9A 2YBVA 4C6NA 3ZSTA 3VE9A 3N2BA 5LIYX 5AHMA 4HNNA 2J7FA 2Z28A 1WDQA 3RRAA 4C7GA 4NX0A 1JRCA 3T44A 3AXIA 3LPOA 4KWOA 1OFAA 1WDDA 4O57A 1UB3A 1H49A 5FESA 1GONA 1G4EA 5GJNA 1XLDA 5JBEA 1N2VA 3SN4A 1P6WA 4HP5A 1QBAA 1I1WA 2Q8ZA 2TAAA 2OVLA 4PTMA 4QHRA 2W63A 4UCFA 1KNWA 2YGYA 2HMCA 4JS3A 4F4RA 4WJ8A 2Z7GA 1JL8A 2VC6A 4R88A 1M7XA 3BW3A 2YA0A 5FJUA 1IEIA 3EBVA 1HFBA 2QT3A 4PTVA 1OIFA 3W07A 3N4FA 2C15A 4YL2A 1Q2RA 1XYLA 2ZRVA 3TA6A 4GBUA 2AL2B 5FEZA 1P5BA 5IHSA 2PDKA 4W7UA 4JBRA 3RU6A 4QISA 2OB3A 3W7HA 2ZX6A 3IJLA 3KWXA 3U57A 2VDIA 3IGUA 3MJMA 5BRQA 3AICA 4DPQA 5MKGB 3TAKA 1UPMB 1RJPA 3CHDA 4H6RA 1EB3A 1JYNA 4GMEA 2I14A 1EBHA 3PTDA 4QX4A 1G0CA 2V5LA 3MMDA 5HDRA 4Q8QA 4N6FA 4HHPA 4C6DA 3HPAA 1YRRA 3GD6A 4JAWA 2CLIA 3MWAA 2OOGA 2Y5EA 3CL8A 8XIMA 3UJSA 2C19A 3OBAA 4GIEA 4WDUA 1EZWA 3N04A 2ODOA 1DEDA 2I9EA 2G97A 3WMLA 3FJLA 4JEJA 4RJEA 4R53A 4Z2JA 2WM1A 3R11A 4QLJA 3T05A 1P7TA 4Y9AA 2CEQA 3DFHA 4DYKA 5I79A 3B8UA 1LL6A 4LAMA 3I6EA 5G1TA 1Q6RA 1VRDA 4FX7A 3ZLGA 3ITGA 1OC5A 3LMZA 5G1MA 2C14A 4W7WA 2WVTA 1BWKA 3BLIA 1VFOA 3EPOA 4NAFB 1J12A 1GZJA 2ONEA 1OG6A 1YPXA 4DLMA 3O3RA 3Q4DA 3SIMA 1EDGA 3CYVA 3WDPP 1S1RA 2J13A 4LSBA 2QCCA 2V0TA 5AKQA 3KWSA 1I2OA 3I10A 4B4FA 3W1MA 4D6HA 3QQ1A 4D6IA 2PZNA 2FLIA 4FR1A 3N2TA 3P14A 1TPC1 1VJIA 4UOJA 7A3HA 2PWDA 1GNXA 3BG5A 1KCXA 4HIBA 3SY5A 4JQAA 4PFMA 1W9UA 3DU0A 3TYUA 4IJRA 1YBQA 2YSWA 3MHFA 4Z17A 1JDEA 3PN8A 4HYVA 1R2RA 4MY1A 1E5NA 1QO5A 4LAKA 1GOWA 3VOIA 1PEZA 4M24A 4GKTA 4A3QA 1E43A 3SGUA 5HNUA 2GUUA 2NLYA 1F6YA 3AMGA 2A4AA 3UVIA 3QLLA 4O1CA 4IPPA 1VIZA 3KS6A 1XIBA 4MB4A 3S47A 5E6ZA 1VBRA 1XLIA 3TJIA 3WEOA 3F4WA 2QCDB 4IG2A 3WSUA 3KS5A 2XZ9A 3UYCA 4E6MA 3CGTA 2V63A 2X7VA 4HOXA 2Q01A 4CU7A 2MUCA 4ERAA 1IEVA 1A5MC 1R8LA 3CHVA 3AWOA 4V15A 4MB3A 1X39A 3O0KA 3O1NA 1ZS2A 1AG1O 3GC2A 3SQLA 2ZDSA 2QJMA 4JIEA 4RE3A 3QGAC 3RN6A 2IXVA 4K1WA 5GVJA 4DF1A 4GX8A 1AJZA 1YNYA 3WQCA 1DJHA 1ML1A 4RLIA 5AY7A 3IACA 4OVXA 3MANA 4CNNA 4HKPA 4X22A 3DHFA 2BG5A 3VUSA 1GVQA 1QBBA 2VVNA 1ESWA 1F4HA 1X98A 3HBLA 4GWEA 4Q4KA 1SO3A 3S9IA 4JIRA 3AHTA 2QJHA 3EKZA 1MMFA 1K7EA 5E1QA 4RR4A 5I3IA 3LN3A 5LSMA 4HSOA 3UETA 1DYSA 1N8IA 3LGEA 4C6CA 3SECA 3BWWA 2FMOA 3EEGA 4UTWC 4ZB0A 1PYMA 1Q8JA 2FTPA 1V8EA 3RX2A 4UNKA 3AXXA 4NX5A 1FHVA 1TJ2A 1WKYA 3MI6A 1WUEA 1B3XA 3BW2A 2A5HA 2ACUA 1QPNA 1WOBA 3SRHA 3LSBA 3SIZA 3FVDA 3C2FA 3STEA 4J40A 4AVNA 3TAOA 5ABTA 4IXXA 5JU6A 4KFPA 4MDOA 3IJIA 4PUMA 1H51A 1XQLA 4O18A 1MYRA 3W37A 4Q4SA 1ZFJA 1XGDA 1PE1A 1TPEA 3T81A 2ZX5A 1W1PA 2VD9A 2ZZ7A 4IP5A 3B0VC 1RP8A 3L5AA 4H9MA 2WC7A 3MC5A 3AXKA 2QGYA 4RUBA 1MUCA 3D3FA 3WYZA 5CPNA 4WKHA 2F7FA 1OFOA 3CUZA 4C1NB 1ISZA 3CZGA 3QV6A 1V0LA 1TWSA 2GVYA 2PPGA 3BGJA 1DVJA 4S3EA 1YLVA 3DHPA 1EJRC 4I7WA 3WNKA 4H2HA 3SGGA 2VFDA 1L6WA 2WZTA 1SFLA 5FI8A 2DZUA 4Q8OA 4LEFA 1XI3A 4QAIA 2XISA 1XIDA 1MW2A 5D03A 4IH3A 1CXHA 2CZVA 1E15A 3E5BA 2NQHA 3DI0A 1Y5WA 1CLKA 3BK0A 3NDYA 3GBEA 4ROPA 1DWFM 4EKJA 4A3YA 4NU7A 4MWAC 2CKSA 4EPBC 4GYPC 4UMBA 4FIRA 4JTSA 2DT3A 5EA9A 4U2ZA 3VA8A 3TTOA 4LUYA 3DKJA 3MSRA 4J3VA 2HE5A 3TLLA 3WF1A 3T09A 1SO6A 1ZAHA 2VZVA 3GM8A 2X09A 1FFQA 4PB3A 3QMSA 1E4NA 3HZ3A 1TMHA 1AA1B 3NG3A 1A3XA 3N3TA 4HHHA 4HNCA 1PYFA 1OCNA 1G01A 2VD8A 4NRSA 1OGGA 1JPMA 1XFCA 1A4MA 1PSCA 2D23A 4HZ6A 4JNZA 4J3WA 1ITXA 1U22A 2E09A 4X2PA 1TUXA 3AMDA 4EWJA 2Y63A 3ARQA 3OYXA 1KBIA 4FI4A 5CLTA 3LLDA 3QPYA 1H09A 3CHCA 2POZA 4OTKA 4Q4QA 3SDOA 1EDQA 4YTTA 5LNVA 3W2KA 1H1NA 5D02A 2EGZA 1UA3A 3JVAA 4QLKA 4O12A 4GC4A 2Z6JA 1H7RA 4M5PA 1I9CB 3PBYA 3H2NA 4Z1AA 2BVWA 2PI6A 1L6YA 1SJBA 3EWBX 2ISWA 2WKLA 1GHRA 3TCEA 4DWSB 3WLQA 2DT2A 2FB3A 1BGGA 3HGJA 2ESCA 3W7EA 3TYZA 5HMFA 5GNZA 3K4AA 3RM4A 2WHJA 4PMNA 2NV9A 3H55A 4LYPA 5LGXA 4JIIX 1AD1A 3K30A 1J10A 3GNXA 3W1UA 4Q8TA 4RW3A 3ZJ7A 1S46A 4Z2KA 1YBQB 3W7JA 3SCPA 1YKWA 2JBMA 4YVPA 3VDGA 3VMPA 2INFA 1XGEA 1ONRA 4F0LA 4J9JA 2BNJA 1BYBA 1MWOA 5A5WA 4JN7A 4MHBA 4MFDA 1BSLA 2ZXAA 4PMUA 1JUEA 2HEJA 3KRZA 4LCRA 1DOSA 3THAA 3WLLA 3K8KA 1E55A 1ZB5A 3HQOA 3HPFA 1E6ZA 1DHPA 4JR5A 1UC4A 5FEPA 1JUBA 3OGSA 1NOUA 1NY1A 3TNOA 2BVDA 2V67A 2HRWA 1Z44A 2BVYA 4BS0A 2WHLA 1AW2A 4PCSA 1KM0A 3LTPA 4PUWA 5DCBA 1PJ9A 4ZQOA 5IRPA 1WZAA 4QE1A 1HL9A 3H2CA 4MY8A 1TREA 1J5TA 2QAPA 3U5UA 2G37A 4B91A 4JQ2A 2YL8A 4M0XA 1WOAA 4CNTA 3T1GA 2Z2BA 2PTZA 4UOZA 1Q8AA 1J0YA 2WNZA 1TVNA 4Y96A 1UIOA 1EEXA 3E6EA 4GK8A 4W9TA 4NQ1A 4ZFMA 2YCIX 4LBUA 3WUBA 3MKVA 1H61A 1JQVA 4FP1A 5T9CE 4ZOAA 4O0ZA 1CIUA 3WEZA 2B7NA 3I3EA 1V0MA 5HPCA 4GYFA 1GVEA 2Y5JA 1TTIA 3VD3A 3B04A 2E9MA 3T40A 2A7PA 4CLMA 1W9VA 3TTQA 1V7AA 4MKSA 4PRWA 3R43A 2ZKMX 3BH4A 2A85A 3TC6A 3TC7A 5J5RA 3TH6A 1AD4A 1UASA 3O7UA 5JXQA 4LYQA 1VLIA 4J3TA 4EF8A 3MUIA 2PSNA 2W9MA 3GHTA 2CKRA 3HG5A 1RK6A 2X1TA 4CQ9A 2Y2WA 3GDKA 1I8JA 3ATZA 3WLPA 8TIMA 3T8QA 3RNDA 2VEIA 2OWXA 4TX9A 3LV6A 5GQBA 1TG7A 4JL1A 3VC5A 2R82A 4U33A 1W3IA 2VVSA 3EXRA 4QTGA 3MO7A 3SY1A 2FVMA 3SCTA 1US0A 3N11A 2O9OA 1NH6A 1R30A 5A1AA 2EHHA 3WD2A 3E38A 5FD0A 1UC5A 4FOJA 3U0HA 4M29A 5EMMA 2ZOXA 5LNUA 2HROA 2YXGA 4PBEA 1E6NA 4IPJA 3VZYA 1NP0A 4PTDA 3TK7A 1QHOA 1JEZA 4RV8A 1UQYA 2FB2A 2GQ8A 4MWAB 2VX4A 4AQLA 1VAHA 2YZ5A 5LA1A 5AZ0A 3CZ8A 2DZXA 5A6MA 4XG1A 1OC6A 1UWIA 1Q66A 3GYEA 3F2BA 2P50A 1JD9A 4UQBA 3L2LA 3THUA 2EPKX 3ZWTA 5ABGA 2DUZA 3WH8A 4GVFA 4JHMA 4P7RA 1NDYA 3D46A 2B7OA 1SJAA 5KITA 5CC5A 4HU8A 3NZPA 3O63A 3OYZA 3V5FA 2PDGA 4JCLA 3FA3A 3LRLA 1U1JA 1TRIA 3M0VA 4YS1A 4GUFA 4ZMGA 3RX4A 3N14A 1U33A 3WUEA 2PDFA 2JEPA 3KVMA 3EX1A 3PF3A 4KPLA 1N8WA 1PX4A 1UOZA 3GFXA 3TTSA 1XSJA 4IMCA 2WLYA 4ZOCA 1HL8A 1H7PA 4JTHA 3L5MA 3UWVA 3QR3A 2GYIA 3TOYA 2L5HA 3HFYA 1R2SA 4A3UA 2GJXA 3VUPA 4PN2A 4GJIA 3RJYA 4LC6A 1IEQA 4H9YA 2JE8A 3NWRA 3CK5A 3TOPA 2JQXA 3PB2A 3G5EA 4XKYB 2WQDA 3AROA 3LCXA 1EO7A 1XS2A 1GVRA 3S2LA 4H8VA 1MEIA 5EY5A 1KFBA 5IHRA 3N6JA 2ZTJA 1OFQA 1SFSA 2REQB 1KO0A 4CD5A 3VU2A 4WY0A 1YYAA 3BG3A 4HPJA 2VC7A 2AGTA 3O8AA 1EPXA 3KZSA 1I0BA 1BPLB 1JAEA 1OX4B 4JN6A 3EPMA 1QNPA 1W1ZA 1OCJA 3VKCA 4HCDA 1XLCA 4TUFA 3B4YA 2DT1A 4WXYA 3CT7A 1TMQA 1HKMA 3BAWA 3VGGA 1UUOA 1S5NA 1ZBWA 4Y6GA 5CZTA 2O55A 1KR0A 4M82A 2VUYA 1A49A 3W22A 1O7AA 1S1PA 2PTWA 3HIJA 3KVKA 3OU8A 3KHJA 4DNMA 1E4IA 4KCUA 3WLMA 2X1UA 1S5VA 5REQA 2OQHA 5L6UA 1I45A 4MWAE 3H7UA 4ZB2A 3Q37A 4UNIA 2YBTA 1EIXA 3VFLA 4NXSA 2EQDA 1X8FA 3ZYZA 4DELA 3VNIA 5TBOA 2WKGA 4EOUA 3FDKA 3VDCA 2OX1A 4WGHA 1EGZA 3R94A 4FHAA 2C8NA 2XSAA 4PMXA 4M1BA 1DV7A 2XSBA 3AO0A 4LT9A 5BYWA 2H3DA 5EKYA 2AAAA 2KX9A 4L6DA 2JKEA 2OKTA 1UW9A 1VENA 1Y5VA 1A0EA 3EKGA 4XAPA 3R8HA 3MU7A 5A6JA 1T99A 4B2DD 2G3JA 2W4XA 4BR1A 2ALRA 2ZZ4A 3ORWA 1J2WA 1UP3A 1TJRA 3OJGA 4LVGA 4CD4A 1QT1A 4J28A 1YX1A 3W88A 3UR7A 4W84A 1QI2A 4JIQA 5I3HA 2XWEA 4M6PA 2QV5A 5FL0A 5C7VA 1G5AA 2GK1B 5HANA 4K39A 4XD3A 3WBAA 1XWYA 3NQEA 3CASA 3LMYA 3LHWA 2OSXA 5A8QA 3LCLA 4O8RA 1VLWA 3CH9A 4PCNA 3B0YA 1UUQA 4R7JA 3J7HA 2VI0A 4I8YA 1X97A 3DC0A 5I23A 3AIVA 4OOUA 1NFBA 5FJOA 4ZODA 4REQA 4HZMA 3N9SA 1V6VA 3CB3A 4DJED 3U48A 3CL6A 3N3MA 2CYGA 4RDVA 5BOOA 1KV8A 4FF7A 4FK9A 4L5ZA 3W75A 1XBZA 3SSZA 2G3NA 1RVKA 2OEKA 3A3XA 1E0XA 3QFWA 1YE6A 5HWNA 2J7BA 2X0HA 4NZ1A 3ZR6A 4UMCA 3C3NA 6TIMA 2EKCA 3WZ0E 4DWDA 2WHKA 2D0HA 1B3WA 2DZPA 4O16A 3CS2A 1J8VA 4DJDD 1V3MA 2GVGA 4CCEA 1NIUA 2J4GA 4JQ4A 4EPDC 4G8TA 4LBRA 3WF2A 1W5NA 4IQJA 3W1XA 3BLPX 3GC4A 3H70A 2NVCA 3KL3A 3MYOA 3AC0A 4F2BA 4WY0B 1QO2A 4HGXA 3I7QA 2YOCA 3FYYA 3E02A 4JX6A 4XTIA 3CIVA 4EK7A 2G95A 1AJ0A 1R3VA 3TKFA 2OXNA 3GB6A 2HVNA 4RE2A 4C6MA 3UZZA 2ATMA 4KGJA 2CC0A 4N9DA 4CNSA 1WP6A 3WQOA 1GK8A 3TNBA 4S3CA 4GLEA 3BV4A 4PBGA 2ICSA 3H6OA 4CD6A 4MPQA 5AYYA 4Q8VA 1W3JA 3KUMA 1IWBA 3CPUA 2XZ7A 3IIZA 4JFUA 3ABXA 3UXIA 3V1PA 5FKYA 1XYBA 3DC8A 4US5A 5GJMA 3R4IA 1IZJA 1J0JA 1ZCOA 1KFEA 1YDVA 1GOQA 1F05A 2GGEA 1OYAA 4TIMA 1EJUC 1M7JA 4JYDA 4PTWA 4XZHA 2QYGA 3LBMA 2PTXA 5CH9A 5LKYA 3ZVIA 1MEWA 1GVFA 4JNYA 3LLXA 3RRXA 4UTMA 1CTNA 3NAVA 5G2IA 2QF8A 3GH7A 2J25A 1UOKA 4Q8PA 5F4XA 3H2EA 2XN2A 1WBJA 4FNPA 3F5LA 3EA1A 3G1SA 5HNRA 1MW1A 1VIWA 3ITCA 4NJJA 1DJNA 1WB0A 1FWFC 1ITQA 3R89A 5BXSA 3AWNA 2GVJA 3LUTA 1F3EA 2DUAA 4AHOA 3W7MA 4GACA 1CEOA 4C6PA 1EKOA 4DPPA 4KESA 4MWAA 2BXYA 1TIWA 1OFDA 4HJWA 4PMQA 1FP9A 2PS2A 3MB9A 4ZOEA 2Z1WA 4OBTA 3STFA 1UH4A 3V5CA 2AQOA 1QW7A 4I8DA 3N25A 1XH1A 1IV8A 4DZHA 4P7QA 5J8LA 3GX9A 3RG6A 1C93A 1OSEA 2CFFA 4UWMA 1VYPX 3VD4A 2IQDA 4ATWA 3QZ6A 1LBLA 1UKTA 1QRQA 4YTSA 3G8RA 1Z69A 2NWSA 5F2GA 4C5YA 1M1BA 2C7FA 3DECA 3RITA 1QOPA 3LOTA 2VZSA 4TTUA 3SAZA 3EKLA 2DVXA 3PUOA 1IT0A 1KBKA 2RAGA 5ENLA 2NXIA 4R7OA 4FPSA 4BQ2A 5KINA 2A3CA 4KGLA 3LRMA 3Q2DA 4RL3A 2E8ZA 3UG8A 1J6PA 4ZR8A 1PXGA 1FTXA 2AMXA 4JL2A 3RMJA 2OGYA 4PUNA 4C60A 3AXHA 4S3JA 2NX9A 1P0EA 5A6LA 3C2EA 1HGYA 4PMVA 5LNRA 1LRTA 5DF0A 2HVOA 2I17A 2YA2A 3FVMA 3VTRA 4AD0A 3G6LA 3NQBA 3SBFA 2OWWA 4UQ9A 1HO4A 4GC3A 4ZQRA 3ZVHB 1OX5A 4JTAA 1UD8A 1FHDA 1RBAA 4JTKA 2GWGA 2E6DA 4ORIA 3AUJA 4QRNA 3N4AA 1T0OA 1O1ZA 3B0XA 1Z3NA 2FH6A 4EXAA 5F4WA 5BXRA 1CZ1A 2PD5A 5A8NA 4PTNA 3T0TA 2EEXA 4ZEPA 4JFWA 4AG0A 2VJXA 2UY3A 4HN4A 5ABEA 5F2MA 2XG9A 3FGCA 5D32A 1WDPA 4XSMA 1EX5A 1Q65A 2VFEA 1Q3NA 2HDJA 3PPCA 6XIMA 3RR1A 4PE8A 1B2YA 5K9CA 3HM7A 4EXBA 3LTSA 1H5VA 1VBUA 2HBVA 1A5CA 2DZWA 4BQ3A 3QH2A 3Q45A 4AF0A 4E8CA 1NWSA 4IIFA 3WQVA 1ME7A 1BGAA 3B8IA 2PDPA 4DJEA 1UH3A 2QIWA 3PFMA 1S2CA 4Q6JA 2ZYFA 3GFYA 3A5FA 3P67A 2YIHA 2Y6ZA 5FF0A 2WMFA 1RAKA 2E40A 4ACYA 1W31A 3AMCA 3UZYA 4JYFA 5CBIA 3UA3A 1GKPA 1XIHA 4C6BA 5HQEA 1LM1A 5FACA 5D04C 3KOXA 4M6UA 2YKKA 3KTXA 1SM9A 3BL3A 2QAFA 2D24A 2Q6ZA 4AY7A 3I7SA 4MPKA 1WXJA 4TR9A 2V30A 1H1YA 1W37A 4CNPA 1V08A 1HTIA 3VFCA 5CGTA 2W5FA 3QY8A 4XO6A 5CPLA 5I07A 3M0YA 3LCFA 5BNKA 3THQA 4RZ4A 1PVNA 3FXYA 1XH2A 4AZGA 4FOUA 4MUZA 4HPGA 4DYEA 3G24A 1N82A 4NZJA 3SQSA 3MQTA 4MM1A 2YFNA 3IJ8A 3IVSA 1U5JA 5EBAA 5AVHA 2Z00A 4A4AA 2QMKA 3DFYA 5LNWA 4K3ZA 3WLSA 1TPWA 2C16A 1P0NA 3UR8A 1XHGA 4M6VA 3QZEA 3ZT6A 2WSYA 1B1YA 4Q8UA 2FVLA 2OQYA 4Q8WA 3CUHA 1HJUA 4XQ6A 3SRDA 3KLLA 3KHDA 1Z89A 1LF1A 2GUBA 3K13A 4ICCX 3USZA 4RNIA 3TC3A 1DIOA 2F61A 2V68A 1EQPA 1V3IA 3LENA 1D7KA 1QTWA 4H6EA 3D3AA 3VNKA 2V3DA 4WJXA 4HHMA 3E2QA 2V3GA 3UWWA 3NZGA 2ACSA 2PWUA 5DRCA 3NOEA 3L0KA 4LPCA 2RDXA 4KBXA 7ENLA 3ONCA 5HMDA 3CHEA 4S3BA 3G0UA 3KEHA 2IPGA 5HUOA 3WH5A 1AQHA 3R13A 2FJKA 3R79A 4HT3A 1TQXA 3VE7A 5CSRA 5I77A 1HKJA 1RJRA 1GQJA 3M0ZA 1FCUA 3B9AA 3WLNA 1BYCA 1GJWA 2PDYA 3PY2A 3W7CA 4XUGA 5I3DA 1R6WA 3FA5A 5KTLA 2ZXBA 3PM6A 2CPUA 2OEMA 2XVPA 3RPDA 2WMIA 2CZFA 2EF9A 1E4MM 1IXQA 3UWYA 1UYQA 1PKMA 3WDQA 3LCGA 1E6PA 1JAKA 3DFPA 4UNLA 3C5QA 1IIGA 4GZIA 1ZL1A 3GBDA 1K4HA 4GVIA 4D71A 1TV4A 1Q6GA 4JDBA 1XCFA 2GFTA 1GG0A 2B7QA 4HSHA 1J11A 2VENA 4FZIA 2I57A 3OHMB 1NF7A 2H9AA 3P62A 4XIMA 3UR2A 3HURA 3HPZA 4K7YA 2OWCA 3GK0A 1IT7A 3VIGA 3VIFA 3QV9A 2QIIA 3KL0A 3QHNA 5I7GA 1AL8A 4RW5A 2BY3A 4CU6A 3LD5A 2O7SA 3EWUA 2XM2A 3N18A 2P8BA 4N42A 2FZBA 1GGOA 2ISFA 2NQJA 1FKXA 2ZZ5A 1HL2A 3PHAA 3RX3A 4PUKA 2BS9A 3ANUA 1XLMA 4LANA 3LU2A 3G1YA 3W23A 3NSNA 4ACZA 2A6NA 3TFXA 2GJNA 3FAWA 1QNQA 1LQAA 3L0GA 1CB2A 5BRBA 1W3KA 4YVVA 3WIJA 4ICNA 1W0MA 4ERGA 5FF2A 4WIWA 1OBAA 3ITOA 1AQMA 4GH3A 4U2YA 3G2GA 4XAGA 4I6KA 2HV5A 4GA8A 1ZP3A 2V5CA 4GIAA 2PDXA 2J66A 3E49A 4ZSTA 1K6WA 2Z2UA 1IIHA 1XD1A 5K9XA 3TQVA 4F2UA 8A3HA 2PWFA 1QI0A 1VGAA 4Q4MA 1W5PA 6PTDA 1XPYA 4QE5A 1Q6LA 2UBPC 3PBGA 2QDGA 1XLKA 1J18A 4JPGA 1DHKA 4GUHA 3W7IA 7REQA 4WQ6A 3S6TA 1GW9A 3PTQA 6CGTA 2OFJA 3MS8A 3SB0A 1KTBA 1HF6A 4KWSA 4HMEA 3C61A 3CZKA 3M44A 5DBUA 2G4FA 4HPXA 5MF5A 3WENA 4PRRA 4IUOA 4S3AA 4ZXLA 1VFMA 5A2BA 4MKNA 3C3UA 2GJPA 4RPQA 1GEQA 4BI6A 3A24A 3EOSA 5M03A 4KEVA 2IPWA 4FO4A 3M1ZA 3G1XA 3TJLA 4NHVA 2FTYA 2OOFA 1EJXC 4GXPA 4PZVA 3PP7A 2XH2A 2ZICA 5DT7A 5CPSA 3PBVA 1ZALA 4YN5A 3WH9A 4WDXA 3SUVA 3W27A 5D4YA 1KV5A 5G2HA 4XK2A 4KEMA 2GZXA 2Y0FA 5DCDA 3W7OA 3WJYA 3A47A 3OA5A 2Y61A 2O56A 3R0DA 2BLEA 2OZTA 2WQPA 3F4NA 1P6CA 1DXFA 1HG3A 1UZDA 2H8XA 4RX0A 1F3XA 1B9BA 1XDJA 1SW0A 1AW5A 3OGRA 3FOKA 4QGCA 4GINA 1KBJA 4CNOA 6REQA 4HNUA 2XWDA 1CB7B 5IM51 1HP4A 2ZWYA 2CU0A 1ZU8A 2ZXQA 4DWSA 3N2XA 2ON3A 2O7QA 2Y70A 3L4ZA 2GVLA 1PAMA 4OT7A 3VGDA 4WOZA 4RDZA 1SPQA 2BBFA 2F38A 4C91A 3G77A 3EOOA 1KRMA 4XD6A 3PBMA 5HWMA 1KFJA 3C52A 2VTFA 2XFFA 5AHFA 4B3LA 1H41A 1F73A 2ZRXA 1LDCA 3GS6A 1K9TA 1DTUA 1EA9C 3PJWA 2QLYA 1VFFA 2V2CA 2OZ0A 2CXGA 2E7FA 2PDNA 4JDYA 3SZ8A 3DKLA 1SUXA 4JKKA 3LXCA 3MWCA 1UMYA 3L2MA 3WF4A 2GGJA 1W32A 2CXEA 3CZLA 2HQAA 3MZ2A 3PPGA 2BX7A 4WSJA 4B5UA 4CGTA 2VGFA 1UHVA 2NQLA 1XICA 4D1JA 3N29A 1V3JA 1TYGA 1V3KA 4FNUA 2PLCA 1YTKA 4MYXA 3ABRA 2NUYA 3RLGA 5DO8A 2NQ5A 1VEOA 4UCGA 4JGDA 4RNFA 4C6OA 3RJXA 4LALA 1G4TA 2FZNA 3W1QA 3N12A 2J7EA 2WHMA 3VNDA 3RFAA 3LA4A 3GG7A 1ONWA 1EYWA 4AEEA 1MEHA 3FCPA 2B0MA 2ZUVA 1V6XA 4O8AA 2E9BA 3UEQA 3KTSA 2W61A 3MZNA 1JZ3A 1MXSA 4CVWA 1S5TA 2GJLA 5EMUA 3UFYA 3W38A 1ZQ5A 1B3OA 4MY9A 4A22A 3PZIA 4FXSA 2IW0A 2DSVA 2VEPA 3NM3A 5IBXA 3WJZA 3TYAA 2Z29A 2IXUA 4BQ4A 1LWHA 4RXGA 4JCMA 3S42A 4PRTA 2CZDA 2F84A 1GQNA 2J75A 3M16A 3NQVA 5JMUA 2NQ9A 1JYWA 1MRQA 2DT0A 4GQGA 1POKA 4IZGA 2VR2A 4GNVA 4G5DA 5H6HA 3T42A 5JQ9A 1FP8A 1XW8A 4ORMA 3ZR4A 5M1TA 1D7FA 1KTNA 2GGIA 2HJPA 4AZBA 3GKAA 4B3ZA 3RU8X 4BZYA 3PBWA 4HCLA 1KRAC 1NP2A 1VD6A 2NT1A 3GO2A 4ZO9A 3THDA 5XINA 1BFNA 4IMFA 2DSWA 2X8RA 3CU2A 4UTHA 2TPSA 1KFWA 3OLIA 1W1B1 3L67A 4S23A 2XGIA 2YYTA 1A5AA 1JFXA 3KDOA 2BTMA 4BKNA 4S1FA 4GFSA 2R1PA 5I09A 4AWTA 1HW6A 1LRQA 2BASA 3LB0A 1MFUA 3VC6A 4QE4A 4GVHA 2JK2A 4N7QA 3EMQA 1F07A 1JPKA 4CD8A 4H7ZA 2D0GA 3FNDA 4KWVA 1EDTA 3IJQA 3ONBA 1SJDA 2VQTA 3TXZA 1VPYA 1Y7VA 1BKSA 3A9BA 1JNEA 1WO2A 4H9ZA 3C8FA 2Y5SA 2W27A 4WSKA 3UGVA 2FPYA 1IEXA 2TODA 3HU7A 3RCNA 1O5KA