3CQQA

Human sod1 g85r variant, structure ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
134
Chain Sequence
b'TKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGRHVGDLRNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the G85R Variant of SOD1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
molecule keywords Superoxide dismutase [Cu-Zn]
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 134
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3cqqA00
1EJ8A 1TO5A 1CBJA 2AQNA 2AQSA 2JCWA 3MNDA 2LU5A 5KBLA 1Q0EA 2NNXA 1DO5A 2E46A 2ZKWA 2C9UA 2XJKA 1OZUA 1OZTG 3L9YA 1B4TA 1MFMA 2ZOWA 1PZSA 2WYTA 1OEZW 3F7KA 3LTVA 1SRDA 3HOGA 3T5WA 3GZOA 1N19A 1AZVA 2SODB 2WZ5A 1JCVA 3H2PA 1YAZA 2WKOA 2WZ6A 1F1GA 1HL5A 1OALA 4A7SA 2GBTA 3S0PA 1IBHA 1BZOA 1F1AA 3KM2A 4BCYA 2WKOF 2AEOA 1TO4A 1QUPA 2AQQA 4L05A 3GTTA 3KBEA 3CE1A 2AF2A 3GQFA 1FUNA 3ECWA 1HL4A 4B3EA 1XSOA 1B4LA 1KMGA 3RE0A 3GTVA 3KBFA 1F18A 2AQTA 1E9OB 1E9PB 3CQQA 1IB5A 2Z7UA 3PU7A 3H2QA 1UXMA 3KM1A 1L3NA 1OAJA 1XTLA 2WWNA 4FF9A 4MCMA 5KBKA 2GBVA 2VR6A 1SPDA 4BD4A 2Z7WA 1E9OA 2K4WA 3SODB 1E9PA 1PU0A 3KH3A 3GZQA 2C9SA 2WWOA 1SXNA 1S4IA 1U3NA 2C9VA 3L9EA 5KBMA 1UXLA 4OH2A 1Z9NA 3MKGA 1JK9B 2E47A 2WYZA 2R27A 3HFFA 2Q2LA 1ESOA 3QQDB 1IBBA 3CQPA 1EQWA 1SDAB 1SOSA 1SXZA 1E9QA 2ZKYA 2AQRA 4N3TA 2VR7A 4U4IA 1JK9A 2Z7YA 4A7UA 1CB4A 3HW7A 3K91A 3QQDA 1YAIA 5CU9A 1PTZA 1SXBA 1IBFA 2XJLA 4A7GF 3ECUA 4BCZA 3GZPA 1COBA 2WZ0A 3F7LA 1N18A 2APSA 1YSOA 1DSWA 1P1VA 2AQPA 1Z9PA 2Z7ZA 1IBDA 4N3UA 1F1DA 4A7VA 4MCNA 1SDYA 1RK7A 4A7TA 2ZKXA 1E9QB 1SXAA 1XTMA 3ECVA 1BA9A 2V0AA 2GBUA 2VR8A 4A7GA 3KH4A 4A7QA 1SXCA 2JLPA 1SXSA 4OJAA
chains in the Genus database with same CATH superfamily
3RWIB 1V5JA 3HBGA 2BNQE 3D8MA 4H8WC 3ZR5A 1PLCA 4IM8A 3HMXL 1E30A 1LHZA 2XXCB 1PCSA 5C08B 1YEKH 4RH4A 1PZSA 3UPRA 4ZS7L 1DBKL 5FR3A 4M43L 1HHHB 1J87A 3NN8B 1EHLL 2R8SL 5D4QA 5SWQB 2BMKA 5F7BA 3WNLA 5F7DB 4TULL 2I60H 1ZWIA 1A4JA 5DEJA 4LCWB 1C5BH 4MVBC 4OSUH 3AS2A 4FYTA 4ICXA 1PAMA 4NOFA 1K8IB 3OAWA 1KYOK 3NIGF 1KYFA 4HUXB 4L05A 5D2LE 4ZFFB 3GMMB 4AZUA 1CE1L 2NNAB 1NC2A 5I8KL 3SEPA 1QTSA 1TVBB 4BQCA 4NUGH 1NINA 1NLDL 4NERA 1I1AD 4WUUD 1T21B 2BFGA 2WQUA 4YHLL 2NPLX 2J2ZB 2Q7AA 4UM9B 1DN0B 1IGTB 1N59B 2EE2A 1E0OB 3ALWA 4JY5L 2GSMB 4R6UA 2LTQC 3U46A 5KVDL 1WBZB 1RJLB 1JJUA 3PDOB 4YAQB 4KTDL 4MNGE 3GXDA 2Q7YA 5DJAB 4Q97A 5FKAB 1UOWA 3BKJH 4R2GD 3FB6A 3G5WA 3JV4A 4FLOA 3CBRA 4M7LL 5FIEA 5D1ZD 1MCOH 4RCAA 4F20A 5AQ0A 7PAZA 1CG9B 4Y0GA 5CWSB 5SWSB 4Y5YA 1BXXA 2FE0A 1I9IH 2MKWA 3EOAA 4E36A 4RQQA 3FCSB 4AQAA 2W60B 4Z18A 4KKZA 5BUGA 1EDHA 3CXDH 5M95B 4RRPA 3LKSB 1XD0A 4TVPL 3UFIA 1PTZA 2E3VA 4OGXL 3W39A 2FHFA 4IU3A 4P2OB 5L0QB 4L4VD 1JERA 2A9MH 1PZ5B 4OI7A 5FYJL 5F6HI 2AVFA 2HX9A 1CYGA 3F6JA 1T6VN 3BI9X 4FXKC 3MV9A 4ZUVA 4BXSV 3P11L 4HMDA 4NC1C 3P1VA 2QELA 3T8VA 4QRPE 4ZX4A 2DY2A 2FJHA 1RIUL 4FP8L 2DDQL 1U8CA 3F8UB 2E56A 2ICWJ 3K6NA 4MAYC 4OZIE 4A7QA 3TV3H 3PGDA 4X9IA 1JZ7A 5INDB 2BPBA 2ZPKL 3BPOC 3KVQA 4TNVF 1CI5A 4R84A 2VR3A 2VN6A 1AOZA 1BWWA 4G1EA 4OLWH 2NYZA 3QIUA 2I27N 3ZE0E 3K6SB 3EBIA 4PRHD 1KEMH 4G9FE 2HLFC 1Q1JL 3C09B 4OFYA 1KGXA 1FZJB 3TM6A 5CJOH 2ZJSL 4L48A 4PYGA 4QRBA 4XPFL 3MRGA 4FG4A 2XZCH 5EIIA 3KPLA 1R9FA 1HOEA 4XO8A 2HA1A 2HFGL 1BVNT 3P77B 2NY4C 1YNKL 4JW3A 4JDEB 2BFVL 4XRCA 4RX4A 3DV4B 4P59H 1SYSA 4HP5A 4L37B 1CL7I 2AAAA 2DQCL 1WC7B 5AYQA 1BZOA 2GFBB 3ZZQA 1D5IL 1QP1A 3WEXA 4XPAH 4KHXH 4PN6A 2BY1A 1NFDA 2WMPB 1PZAA 2CPCA 3BT2L 3CFKA 1I31A 2G0KA 4B3EA 3VFMB 1FDLH 4LVHB 2HN7B 2WN2A 2GJ6D 2ITDB 3QULB 1N2RA 4XT1C 1UASA 4JZJB 3DJTA 5LBSL 6FABH 1Q0YH 1DJYA 2YJLA 5CCKL 4LQFH 5AD0B 3VXRE 2GJZA 2D0HA 3BZEB 1R33A 2QV4A 2VDPL 1D6VH 4P46B 5LDUA 3VXNB 4WTWA 1BIIB 3V7AG 3RKDD 2VKXA 4JQIA 2IXQB 2EVJA 3PDDA 5DK0A 2Q5BA 3NCXA 4TOYH 4LZKA 2CIKA 1RZGA 4YUEH 5CEZH 2HAZA 5DVLA 2OLDA 1JWSA 1BZQK 4DGWC 2WXIA 3LZFH 2B8OT 3QH3B 5HYEA 4B9GA 1A64A 4QOKA 1UEMA 3HC2A 3D25B 2HFEB 3CZLA 4PG9B 1MCIA 3VFPA 3IPFA 3AT0A 3VFGL 4ACTA 2JCCB 2BM3A 5TPWL 4LAJH 3KPMB 4HFUL 4MRCA 2BZDA 1WH0A 4FNLH 4AUUA 1NH6A 1IBGH 4FULA 3GSOB 3BP5A 1JNLH 3A6BL 2EDMA 4JR9H 4K7PY 4MB3A 4NQCB 4GG6A 2X9YA 3EFOA 2Y4SA 5I76A 3X11B 1RH8A 2Y1ZA 5KN5A 3EGXB 3AQDA 4XB8A 3FU9A 4BHUA 5JUEH 3VG9B 4XPGL 4PCKA 2V33A 2ZCHL 3HB3C 4JRYA 3VWJA 2AEPH 3VB8A 2BRRL 3BPLC 2WUBH 4JO8A 4FZEH 5I0ZA 3SJVB 4YDJB 2MCPH 1IGML 4L2YA 1YMHB 4PCTA 1E6JH 3B7RL 3QQ9D 3S37H 4HIPA 2FX7L 4JLRB 5IBLC 5GGRA 4UNIA 3AB0B 2FUTA 2DD8L 4F2FA 4LO9A 1G7LB 3G7TA 4Y5YC 1KPUB 1KTJA 2DQGL 1ZSHA 4FQQA 5LGJA 4R4FH 1SFHA 5BQ7A 2B1HH 3CZNA 3FU5A 2EQDA 1OEZW 5BO1H 4Y8DC 1Z7JA 3AY4A 3TWYA 4GO8A 4CMMB 1CLOH 2G5BA 3ML9A 3ZTNL 4P3CL 4BGLA 5D4IA 1P6FA 1TQCC 3O81A 4D8PA 4YEEA 3U4BH 25C8H 2FSDA 1ETA1 1PD0A 3II2A 4YHYC 1YEDA 3T4AB 3CFJB 1FWXA 3O3EB 1YMMA 4UTCA 3FKUS 3EO9H 1GZPB 4LCUA 4U1SA 3AS0A 4LP5A 4A6YL 3OX8A 1F2XK 4XOAA 4OI9A 1PJWA 4N0CD 5MP6H 1Y6NR 5H94A 4XP1L 4EPSA 1XIWA 3I75A 5E8DH 4NNPL 4OZGF 4JM4L 4XO5A 1GW6A 3PU7A 2QQLH 3QIUC 3HG1E 1JK8A 1FGNL 2ZX5A 5FDWA 4QRRB 2SEBB 1MCPH 4G7YH 1G7IA 2VXQH 1DQML 3DROA 4IJ3C 3B3BA 4UBDC 1P4LA 1GH7A 3EFFB 2CXGA 4MD4B 5BZWB 1H19A 3JTTA 3HI5H 4R7NA 5IQOA 4AKQA 1VFAA 4LVOC 2HG5A 2WWOA 4MXVE 1EHKB 3UZVA 3FQNB 1HIML 4HULB 5DC9B 3NESA 3OF6A 3ISWA 4L4JA 3EDEA 3L3OA 3IJHA 4P3DB 4Z0XA 2R27A 1EFXB 1NCTA 2JJTA 2GHZA 2X88A 3M1BA 4NUMA 2WQXA 3GT6A 2C3HA 5TJWK 3P0GB 5HGBB 3HE7B 3NAAL 3PG2A 2D2OA 1E28B 3VXUD 4BUQA 3TT3L 1K4CB 1H3UA 1UQSA 3HI6H 3RURA 3LS5H 3MNVA 4OLEA 4ZUUB 1JAEA 2CGZA 3HKFA 4OAWB 3ZVVA 1JS4A 3BE1H 5KJRH 1JYXA 3BSHA 4G6JL 4HSQA 4QT5B 2VH5L 4RAVB 4PQXA 4FERA 4NRZA 1RZKC 5IHLB 3QXAA 3CDGB 2PWHA 3V5KB 5ISZA 1O0VA 3O6ML 4AY0A 4HWNA 3MV8E 2BH0A 2EYTA 3GDBA 5AW2B 3RDTA 5CLYA 2XQYK 1CK0L 2GBUA 4L2LA 1FYTE 2WXOA 4N2GA 4Y9CA 4MASA 4ACPA 5D1QC 3T2LA 3TXAA 4NHCL 1VGKB 1WZMA 3ETBJ 3UYRH 4GPVA 3BPCB 2WOYA 3MRFA 4HAKA 2XPGB 5IW6A 1ZHBB 1EZLA 1B0GB 3NCJH 2EUXA 4WY7L 3GXMA 1P7QD 4MQTB 2H3KA 3TCLA 1QO3B 3FTVA 4GOSA 3VFNA 1T0PB 4UT6A 5TDNB 3HZKA 5C0JA 2V37A 3GBML 2DBLH 4OD1L 2PW1A 3L16A 4RMSA 4XXDB 3Q6GH 5DTFA 2YWYA 3VXMD 3QFJB 5B22A 1OAXL 5TE6H 1RUAH 1Z6JT 1EGJA 3JWNC 2DL2A 3Q2LA 4NCDA 4EKJA 2J21A 3MRHB 4F7PB 1GGUA 2F58L 3U1PA 5I5JA 4YHKL 3CGTA 1CXHA 3ZQ9A 2IANE 2F1AA 2IGTA 2NY5C 3PAUA 4YGVA 3H3PL 3MX0A 4D7BA 2XQYG 3PAYA 3VWJC 3CN1A 2FO1A 2AKRA 1OCCB 3BCFA 4Y4KB 1J5CA 3MLRL 2EINB 2CGYA 1QUPA 1X5JA 5FUCE 1JGDA 2ZXWB 1YYLL 3Q1EA 4HIEA 5C09E 3LIZL 5E9AA 4NCC2 2DL9A 2F8IA 2N01B 4F1SA 1J8HA 2UY6A 1N68A 4NN7B 5EORL 4FHJA 3ASOB 3OSKA 1QSFB 3KYAA 3UTTD 1TR7A 2FX9H 4O5LL 1I7RB 1S9KC 1U8MA 5D7LA 2KKQA 2GSIB 3D07A 1ECYA 4ZO8A 3UO1H 3WHE1 3PLYA 4JUSA 3L3IB 5JPMB 3E7JA 3AY4C 3IDGA 1HQ4A 3D0LA 3TEZA 4MD5B 3L13A 3GI9L 4MCYB 2V2WB 4ODSL 4C83B 3V8CA 1P1ZB 3OG4B 5C0FB 3VQ1C 3Q0HA 3TBYA 3QWOA 2ICWB 2ZUVA 1F6FB 2EACA 2VSKB 4WI7A 1GZHA 1J9CT 4P2QD 2F19L 2O6FA 3G5YA 1U91A 2J44A 1ZVSA 4ZAKD 3MV7B 1ADQH 3BIBX 1MCJA 2LVCA 5K59F 2DS4A 5HYQA 2MOVA 2QKSA 4HEMA 1KENL 1J1OH 1XIWC 4PBDA 3PWLB 5L8LB 2KZBA 4KAQL 1BYPA 2DYRB 3MCLH 4URTB 3BP6B 2P8MA 3MACH 3SDYH 4TPRL 1ZLUK 3II3A 1D5XA 2FAUA 4ZMAT 3C6SA 3RWEB 3ILQC 4QF1B 3FS9A 2FATL 2CRMA 3IS0X 3KNBA 4YE4L 5DRWB 2NZIA 1NSNH 2UWEA 4TLKA 4WGVB 4XH2B 3KGSA 5E8OB 3FU7A 4C4KO 1TETH 1TQWA 4ZX5A 2I85A 2VLJB 1F4YL 5CN3A 3ULUF 3EDKA 1W15A 5K9JL 3LNFA 3L3OC 4E9YA 3IDMA 4XC3H 1R3JA 5HHOB 2JJTC 1QFWL 4U0RB 4CRPA 5A7BA 3GKWL 1KN4H 3NIDE 1A9EB 1U8HA 4GO9A 1QWNA 5E8NB 2HSIA 1EXGA 4WUKH 4A37A 1UWGL 3I9PA 1WA0X 4I0KA 5DSCB 2EKSB 3RG1C 2BIMA 4JFDD 3ARBA 1FNHA 4PJDB 3ATFA 1KTDA 3SDXF 1GCFA 1MSPA 3S36X 4QRSA 1JYWA 1CO1A 2ZF9A 2VDQH 3V0WL 3ZX1A 2WZ6A 4M6MH 4Y5VA 2E6QA 4Q9QH 1P84J 4BFBD 2QADD 1GOFA 5I5MA 3FBKA 2D0GA 2JIXA 3ECBB 1I3UA 3CVDA 4OBSA 1F86A 1MCHA 3EGSA 3RDTC 4U1KB 4S1QH 5MENB 1BFOA 2QPUA 2E7BA 3BPNB 4M8QA 5C0DB 4KI5D 4E9SA 2PW2A 3T2NH 4RZCA 5D4HA 4GXVH 3CFEB 3NIGE 3S4SA 3PABA 1JE6A 1XCQA 3EYSL 3WG7B 2LLNA 4HCIA 2V17H 4G3YL 1U8KB 1AQKH 2IH1A 5SWSA 3DJSA 1AD9A 5DGRA 4DPCX 4ANKA 3PWNA 1BEYH 5JIHA 1CIUA 1EJ6A 3KPRD 2E9IA 5C0CB 4TYUA 4Y4HC 5FUOH 1JNNH 1P5UB 1N9PA 4P2OA 4R26L 3P0YH 4BSWB 4QHKI 2R4SH 5HPMA 3WFZA 1ESOA 2WWMC 3L48A 3MREB 4JKMA 3PPSA 3N1GC 1MJ8H 4GH7B 4YSCA 3D39E 4PRBB 4GB9A 3ALXA 3IMVA 4Y2LA 1IGIL 4BGDA 4GSDL 1ZGLP 5E9DA 4PB9H 3ARTA 4KKBD 4QO1A 4AC4A 5GGTL 4ZZKA 5L6YH 4NIYE 4Y1AB 3ELAT 2KLTA 5KW9H 3QYNA 1B4RA 1Y18A 2PMZA 3CFDB 3X12B 3IYLW 3AABA 4K5MA 5F7HA 5IP4A 2BDNL 4PJAA 1HSAB 3C2SA 2Y7QA 3KLKA 5CJBA 5I6XB 4ZDHB 1T2QH 4JE0A 2F53A 1OSEA 4GRMA 5HJDA 4LSRL 1U3HB 5CGMA 4EN3A 3VDCA 4XCEB 2MCG1 1BLIA 3K6FA 4DVRH 5K9OB 1I3GL 3C5JA 1Q38A 3HS0A 1JV5A 3DBXA 3LJ3A 4M6NH 1NGWB 5L2JB 5HDWA 4WFGE 3UBXA 2MPAL 1QUNA 5D6DA 2EDTA 2PWGA 5ITBL 2P45B 3MXWH 4IGBA 4HCRA 3FZUD 3PWPB 1SLWA 3UTQB 1GOGA 4AQ8A 4M7ZC 4K7FA 1GZHC 2NUTA 2B0SH 3QDHA 1HHGB 3OHXB 2AJXL 2VLKA 4D0DA 1Q0EA 1Q72H 2CJUH 2GT9B 3BEWB 3OWEA 3DV4A 3GSWB 1W0WB 2COQA 2XXFA 3K2UH 3AUVA 4L37A 12E8H 3U25A 1WC7A 3BUBA 3K8KA 2VDRB 4CC1A 4HVBA 2QSTA 4MXWH 4X98A 1J5IA 3ZHKA 2XN9A 2FQDA 2HXAA 3MCKA 3QDJE 4D9LL 3CLFL 1R3IH 3BX7C 1PY4A 1XV8A 1YEIH 2LR4A 3PQYA 1A1OB 2OTPA 4XI5C 5JW5B 3ZDXE 4FFVD 2P5PA 5AD0A 3H9SE 4TTGA 3MLZL 1I1RA 2PCYA 1P0SE 1TSHA 4WFHE 1QI4A 5DJDB 4Y4FD 5DQDL 4ANWA 2QKIB 3KJ6L 1MN4A 4XN8A 2VQUA 3BIKB 4JCWA 5E00A 2PWEA 1P9MA 1JFHA 2YEQA 3NZ8A 5LGHL 4LSVL 4NN6C 4AGLA 3D2UA 5CGTA 3S8GB 3K2IA 4TSCH 1F4WH 2P24B 4ODBD 3VSUA 2A99A 2BSRB 1F3DJ 2P8PB 4HDIB 2O6DA 3EG9B 3L5XH 5EULV 3DMMB 3TTSA 4HSAC 4AJVA 3OXSB 4UQCA 1XXFC 1YJDL 4IW4C 5KSUA 3B1TA 1Q9WA 1TQBB 2C9SA 1LDPL 3ARBC 5FA3A 5TFSH 1O6TA 4JFFE 4NP9A 4OJYA 2JTYA 1J5DA 4OIAA 3SDAB 5FGRA 3DC0A 2XWTB 1KEGH 3U1SH 1KB9J 1OB1B 3UBGA 4NUJB 4Y5VC 1KXQE 3QZOA 1CF8H 2X1XR 1QG3A 1TTGA 3LRSA 2XQYA 1JD7A 1SDAB 5L4JA 1QSEE 2JE8A 4BA8A 1N0LA 2BSSB 1LGVA 3HE6B 1U2YA 4N1EA 1A3QA 1ZE3C 2FWUA 5IMOB 4R8WL 4P04A 2I25N 4L3CA 2F8OA 1SLVA 1QBLH 3FHQA 5B3NA 3LN9A 4WWOA 3B7YA 1E40A 1V27A 2B15A 3PAZA 4AITA 1BZ8A 1M6OA 5CLTA 2YS4A 3DURA 1BQLH 1GC1L 2MOGA 3F7LA 5FUZH 2AQPA 1NBCA 2WCSA 4PJEB 1WTGT 4LL1A 4GNKB 4X5WB 4W4OA 4MHHI 1G7LA 1BQSA 1NC4B 2J88H 3MYZA 4X50A 5E03A 1KPUA 3QEUB 4FE9A 4UIMA 1FH5L 4OF8A 4QRPB 2H45A 4J3VA 4HOMA 5JHBA 5C07B 2IQAB 4O2CA 5EF1A 4GFTB 4LXFA 1T2JA 1UB5A 1YEGH 3IXTB 3MV01 5IHUH 3FB8B 5GS0D 1IUZA 4YDIH 2XBZA 4KMTL 3V4VL 5C2BH 2XDHA 3CVIH 4H40A 2GBAA 4IRJB 2XQBH 4HBCH 5F9WC 1CE6A 5D6CB 1YN7B 3SE8H 5HYJB 5ENWA 3QNXB 2F5BL 2EO1A 3BVTA 4LPVA 1Z0MA 4N2NA 2XXGA 3RIKA 3O3EA 1VFMA 3DV6B 3GMRA 1HL9A 2DQEH 3G04A 4JKWA 4OZHA 4B9ZA 1G9ML 1H8SA 1ASPA 2IDCA 3N50A 2ZX6A 4NGHH 3UJIH 1E4XH 2GB2A 1RVFH 3ULUH 5C8JB 5CJXA 4WU7A 4U0QB 3KG5A 3SGDH 2Q86A 3QQXA 2WXQA 4EN3C 1SQMA 4DUWA 4P5KA 3CC5A 1UWYA 1A4BA 5E1AB 3NIFF 2IVFC 4NO5A 4R4ND 5EZIH 3VSTA 4GXFA 3HS0C 1M6UA 3CSGA 3VFOA 1JPFB 1D5ZA 3KEHA 2W81C 3DNKA 5D6DC 3IGAB 2VISB 4IGBC 4GY4A 4AQ8C 2IH8A 2XFGB 2FR4A 3CX5K 4KKRA 4FG6C 3VTTA 3ZJAA 3AWEA 4MNHB 3LHPH 3E9TA 4O51B 4JPIB 1U4EA 2PETA 4HX1B 4WK4B 2DJUA 1DJWA 1PX4A 5J11C 1NOFA 3GBNL 4UUJB 3UBHA 2DQUH 1EEZA 4NDMA 4D7PA 1E28A 3OHMB 5HD8C 3I2CL 5GIRB 4APQD 1XGRB 3DETC 1NUNB 1NMAH 4JFXB 3RWGB 2IGLA 5AFAA 2BSBA 5D55A 4EE2A 4MNQB 3HRPA 3ROOA 3ARVA 3NCCB 2NY0B 4ERSL 2NR6D 2NDGA 1CT8B 3O6KH 3RA7L 4MQ7A 3W5MA 2CR3A 5I24A 2YKKA 5FB8B 3F85A 4GLRH 5A1AA 2OL3H 4C54A 2DICA 2R29L 1HAWA 3CDGA 2HJFA 1P9MC 3DX2A 4KUCF 4FTVA 2HRPH 2WIIA 1G9NL 1WTLA 3CFBA 2WGXA 3S7GA 1WZ1H 2IBBA 3WHXA 3T6QC 3VD7A 4NQEE 3EJCA 2ZYHA 2GJRA 4GI6A 5I5IA 1O7DE 1VGKA 1KN2H 2BXZA 4KDWA 3J8F7 1EAOA 2DH2A 4GQQA 4GI8A 1S7TB 4B96A 4PTUA 3O2DH 4O00A 3FYEB 3NZSA 4YXLL 1DJIA 1XF3B 4I48A 4KHTH 3TWCL 3EDDA 1UB6B 4HJSA 2YD6A 2PNDA 3NGBC 5J56B 5EPMB 3EYQD 4IIZA 4CA4A 5IHBA 2ZOTA 1QBBA 4DGYL 1N3NA 1Q4NX 3TZVB 1RLWA 2WNGA 2WQWA 4CN4A 4NSKA 1TNMA 2ED7A 5GGRY 2WLNA 4GAJL 3RL1B 4KNUA 3RWHA 1NMCB 5IJKA 4ETYA 4BQBA 1P6AB 2EICA 5J6GB 2XCMC 2CMRH 3GMPA 4LSTL 1JN6A 5ITFA 2OBGA 1XVSA 3L3HA 5JOFB 2XHNA 4MTMA 4RLDA 4FLHA 3ES6A 4QJ3B 3GB7A 4NKIH 4W4OC 3BVVA 4LHQB 4ES9A 5I17A 1P7KB 3S5LB 4QJ4B 4GQRA 1KIQA 5IEHB 1JNHB 3TBVA 1TQSA 2DMBA 3BVWA 1T03H 3L3IA 1ZSDA 2J6EL 2PCPB 2KZ1B 1CFTB 4M8UA 2DQDH 4X9YA 3HS9A 1P1ZA 4EDWH 2F7PA 2PPDA 1AG6A 4F7CB 2A9CA 3LMJH 3N5AA 4NWTL 1F4XL 1ZANH 3L1OH 3WN5A 4FXGB 3F05A 1SPDA 4OCSH 3BFWA 1A6WH 4WW1B 4JFVA 3CTTA 2CR0A 1TZGH 3WEMA 4PJHF 2DMKA 2I24N 4HKJA 2HVKB 2YAPA 1AIFA 3MV7A 2JKLA 2MQ0A 2JB5L 3BGMB 1PX8A 3MJ8B 5CJXC 1NM4A 1IZKA 1I8IA 2AZAA 1X9QA 4X6BA 3RY4A 4F3FB 1M57B 1G7PB 3O45A 5FGBA 4HUKB 2AI0L 2XNAA 1G5GA 4GT0A 4KKAD 3LRMA 4NYLB 4UDUB 3HS8A 1JHLH 1RULL 1M1XA 4UTAH 3QWRD 5ABZA 5GRJH 4D9QD 2EECA 2H5UA 2GTWA 5CINH 3QQDA 3EXLA 4FRWA 3WL9A 4H7VA 1W16A 4PJ8B 1OT4A 4NQDA 3S3PA 4XODA 2YOAA 3GIVB 4KFMA 4S0SD 1TCMA 2P47B 4KJWD 3MBEB 3S96A 1UYWL 2CBOA 2FQGA 3PL6A 4FS0A 2WQAA 4RGOH 4WAFA 2K6ZA 2YD8A 1NCJA 1VERA 4QCIB 3TPUB 3FUEA 1CFQA 1E7VA 3BYYA 4FG2A 5CUSH 2AITA 3LYRA 1TTRA 4WHTB 1A4KA 3UPCA 5IROA 5DSCA 1EHNA 1LO2L 4L1BA 3E1ZA 4Y9FA 2AK4E 1QLRA 2LT9A 4YIQA 5K5YA 3KPOB 1EJOL 3KVPA 4Y16B 2OSLA 3U2JA 1PW3A 3FCGA 1L9SA 3T04D 1FVCB 1BDYA 1C08A 1ZV9A 2X44D 2ZKWA 5JQ6H 4JMNA 4IHOA 4Z1PA 3KYKH 4BHUI 3DYPA 3SKJH 3SYQA 5IKCB 5F8RC 2VZTA 1GGYA 2ZOWA 3N9GL 3STLB 4ZW6A 1HJCA 3TN0B 3A0OA 5D1XB 2BY3A 3VSVA 2DAVA 3D05A 3W11D 4B3VA 3T2OA 4NQXB 5E23A 1OPGL 4IRSD 1U8QA 5F7FA 1PIGA 4J12A 2XXMB 2BVEA 4TRPL 4YHMH 1OAUH 4JRXA 3QUKB 2P5WA 4UB0H 2RAMA 1ED3B 2OI9B 1AGCA 3BRDA 4L9DA 1U8LB 4ADIA 3HTLX 3GMOB 5IMKB 4JG0L 3FSOA 4L8BB 4M5ZH 3BKYH 4MKTA 3OR7B 1XB3A 5K33A 3V9FA 4PS4H 2BNRB 4IDJL 2D7TH 3SKOB 4IBSA 4Q56A 3H53A 1MFAH 1M7DB 1D6EA 2ZONA 3NJLA 3UEQA 1TIUA 4X8JB 2OR9L 4BSWA 3F7PC 2DQJL 1Y6MR 3BVNB 1TU2B 2YD2A 3Q43A 4F37F 2ZWZA 4FABL 2R2EB 2NW2B 3QAQA 2PUQT 2I32A 3ZE1E 3Q6FB 4DEPB 5IJKC 1TYEB 4UCFA 2Q7NA 1BYOA 1PQZB 1FAIL 4TVPD 1S7WA 4DGUA 2FSEB 2M8XA 4M48L 1DBJL 5J6HB 5I1GL 3ATBA 4NN7C 3R4DA 3STZA 3CFDA 1XL4A 2EXWC 3PHQB 2Z64C 4G6AC 4M1CC 5FYJD 2OMTA 4KFZC 1E4WH 4YX2L 1UADC 3KPPA 4PG2A 1HYSC 3W0WD 1XBRA 3C9NB 4ZDHA 1HVXA 1ITCA 1BLNB 1A4CA 1GGTA 1AQDA 1YUHB 4C47A 2GAZA 4RFNB 5JXED 3KXFA 4IYKA 4OKVA 3AU0A 4S11A 2A1WH 3S5LG 3ZT5A 4YDNA 2P5EB 2E4FA 5DS2A 1GSMA 5AVSB 1E8ZA 2O1AA 5T5FL 2VN5A 5HHPA 3EH2A 1JZ4A 4XP6H 4LMQI 3MI6A 3WN5C 1AJ7H 1KXTB 3BCDA 5CBEB 5FPIA 1HHGA 3OHXA 1E65A 1RZPA 4KRNA 2Y3AA 3S88L 2BNQA 4K94C 3H8NA 4Y2OB 3HUJE 1NCDH 2X70B 3B6SB 3VFSA 4MJ4A 3T3PB 2V0AA 2YSTA 3MSPA 1ZHLA 4QRQB 4E41D 4KOBA 4UAOB 1XD1A 2NXZD 1D7BA 1V05A 1R5IA 2WO2B 2Q87A 5FGBC 3UX9B 4R4BA 4Z5RA 4OD2B 3H7LA 4RFOH 2APBA 3QG7L 5GGQL 3M46A 4KRPD 5C9JB 2AXJA 5F9DC 1NKRA 3ABLB 3CN2A 2VL5A 4KZEH 2HX7A 4LPUA 2DWEA 3FT9A 3K2MC 5KVGH 1OIOA 2QQKL 3LH8A 5I8CB 1E27B 1RZ7H 1HZKA 3BZDA 4Y89A 5BO0D 3HOGA 2K9UA 5KTEH 3PP4H 4U6YB 5D2LA 3GI8L 5HHNA 4A2DA 5JXAH 1RK0B 3PL6C 2BVPB 2B1AH 4RNRB 4P23B 3OMIB 4FXLA 1FLRL 1X5YA 3LQZA 3PWVA 2UY7B 4YOKA 1OALA 2JJUA 2YUZA 1BQHB 4MGXA 3ATEA 3A3YB 4RMRA 4NZTH 1W72A 1F58L 1ETZB 1RI8A 5C0NC 5DYFA 4WEBL 5IROC 3P0VL 2C9AA 3DTXB 1ILSA 1YN6A 2F54B 2YLKA 4AKPA 5DDHB 1L7TH 5TD4A 1MH5A 3V6ZA 3ZUNC 3BWSA 4Q4IA 4DAGH 2XZAL 2WY3B 2X89D 4MNGA 3BKMH 3HHRB 5KSAD 1F90L 4WIQA 1LMKA 4M1GL 4RMTA 3E6HB 1ECZA 5ILTL 1QTPA 3V2AR 3V79C 4I4WB 1KBPA 1GHFL 5C0AB 2R1XA 4LSDA 5FW7A 5AZ2L 3QQ4A 4K5LA 3CC1A 1LE9B 2R4RL 2NT1A 3ULVE 4Z8FH 4MBOA 4J3OC 2EIZA 3PHOB 4K55A 1KFAL 4FOMA 4R97B 4ZW8A 4Q9BA 1G0YR 1SM3L 3P3RA 3PF2A 4KROD 1BMGA 5DHDA 2FGZA 4KQ3L 4ZO9A 3FPXA 4L9LA 1WFMA 4LAQL 3T1FA 5EC1B 2BIQA 4CADB 4RMQA 4DZBA 1Q90A 2FT6A 4QKXB 5C0BB 3OXRB 5E7BA 1KC5L 2QZQA 4QRPA 1KELH 4ZX3A 3G6AA 3CFIC 3RGVD 3IXTA 5C3IA 2YPLB 4MDIB 4ODUA 1GSKA 3EJTA 4HIXH 1UM5H 4OZIA 1D5RA 5GSRB 2ZCLL 4P06A 2R0WH 4YO0A 4C58B 1WFNA 4Z9KB 5TQ2L 2D4DA 5LCVH 5JZ7C 1D9KB 3QJVB 3TBWA 1F0LA 3IBEA 4MA1C 4G9FA 5C71A 5K9QI 4FNSA 4N85A 2NSXA 3MUZ1 5J0BA 1BZ9B 1XH0A 3HPLB 1UD3A 4XVJH 4PG2C 3QDGE 1SXSA 4YNYB 3MJ9A 1RSFA 1XZWA 1QPKA 3NSJA 2V2XA 2VR5A 3HLAB 3RZCA 3RUGE 2ZOKB 1A1NB 3RNQA 3PP3K 4AQZA 2R2BA 1SQ2N 3KHOA 4E5XB 3FT3A 1J05A 1MUJB 1XR8A 3FN3A 4TSAL 1B90A 1DR9A 3UYPA 5F1IB 3QZWG 1J0KA 3IGAA 3K1KC 3FCBA 1ZK9A 1AXSA 4F57H 1DVYA 3OKKA 5I1IH 2JTDA 2XG4A 3CLEH 1O6VA 3O41A 3OHXC 4IMLA 3VM7A 4L4TB 2QLVB 2R0KH 2YK1L 4MNHA 3UC0L 4RZKA 4P3WA 4AQOA 1C5CH 3C5ZB 3T0DA 3VXRA 3M17A 3OZ9H 4Y9EA 4HX1A 4N26A 5C3LD 2XC8A 4XHJD 1WEJL 3X13A 4WFFE 5ALCH 5GHWL 3BO8B 1IT9H 3NCMA 3VGAC 5HHVL 2CM5A 4FQXB 3B4NA 5SX4I 4WWKD 2YHGA 1F02I 1JF1A 1TTCA 2B77A 4QHUB 5F0PB 4I0CC 1A1MB 1C7TA 3IDNA 1JVKA 3LZPA 1WRFA 2EC9U 4BYHA 2WBXA 3IKCA 3FQXB 2W0PA 2ED6A 3P4LA 3DKHA 4MMZB 3EHBB 1M9SA 4MA3B 4H8VA 4ZUSB 4QRUA 5DHVH 1S7SA 3ZXAC 4KK5C 3RVWD 2BZCA 1KDIA 3GMNA 4TV3A 3UPAA 4Z7WF 5BV7C 8PAZA 1S7RB 3O2VH 4YZFF 3L4XA 4DTGH 4XGZA 1A5FH 3LVTA 1KT2A 3W38A 2B16A 1DLHB 2ZYSA 2VW6A 4UM8B 1X9LA 2BHUA 5TK4A 2FQEA 3MMEB 5KVFL 5EZOL 4EIGB 2FECL 2VLLA 5C9KA 3H42H 1T7YA 1GJUA 2BS71 4K2UH 5GISL 4M7LT 3ZYZA 1U42A 1QHQA 3CPLB 3MRIB 1COBA 4MA8H 4K7PX 4MMXB 4PJ9A 4F5CE 3TBTB 3BUTA 1F4HA 1IC5L 3QNZA 3B9VA 5EPMA 4XO4A 2G75B 3V9EA 3SE4A 1WFTA 1D7DA 2AMUA 5IREA 1CURA 1ROWA 3DX1A 3L3GB 4QRAA 2DZEA 1BXVA 3N3EA 1U8PB 1S46A 1YDPB 4JPVH 4N2LA 5EU6B 1X3DA 1OAZH 5KVGE 2VO8A 3T3ME 1HWHB 1ZOXA 4Y8AA 1UATA 4ZNEE 3UCQA 5I1JH 1IKOP 2DF3A 5J6GA 4LHJB 4NP4H 4QHNB 4U1HB 4R90H 1BECA 1WG3A 1B88A 3U4EA 3AG3B 4MJIE 1CCZA 3BAKA 4IRZH 5BRZE 3B7SA 3QNYA 3DX3A 1JZFA 4L9LC 1ND0A 2VDQB 3OAUL 2R23A 3IDYB 4Q52A 1ZV2A 4V1DB 1CL7H 1EERB 1LNUB 3OKLA 3P69A 5IWLA 4J4PA 3BWAB 3OKEA 5T1LD 5D9SB 4K5OA 4BKTC 2N1TE 3P9LB 3SCMA 3UBXI 2VQ4A 2EVHA 2O6PA 3G6DH 2Y1VA 1SEBA 3O2WH 2WKOA 1HKFA 1T5WA 1NAKL 3AZUA 5ETUB 1UT1A 4TNVK 3ZRCC 2J1YA 4W1TA 3TESA 2UZXB 4JFWA 2ISDA 1WGVA 1A3LH 4X8CA 2X6VA 3G6JF 3HG1A 1UTDA 4CDHA 1MFEL 1Q94B 1T66C 4FQJH 4N87A 4M02A 4NRYB 3MLPA 3HNSL 4YHYB 3ABKB 3KWXA 3EO0B 5DEFB 2BHYA 2R7EA 3QXDB 5FDYA 5B1BB 5KJ4A 5J3HD 2EC9T 3D85A 3HN5A 2NNCA 4LP8A 3NUKA 3F00A 3QISA 3ESVF 3RZCC 1G7PA 2YGQA 3GRWH 5DD0H 4HK0B 1XF1A 2WBWB 4OZGB 4UDUA 4ZPVA 4XZ4A 1C12B 2ZD0A 1JPGB 5F7WC 3MGAA 5D8JH 1QKZH 1TZHB 1ORQA 3L1GA 3BD4A 4I2XE 3ME0B 4K71B 4PJHE 1X5AA 4NPJA 2J8UF 3M86A 4E5XG 2C4FU 5B7EA 5EZLA 4KVNH 3BH4A 5B7FA 3OAYH 1XF4A 4LU5H 3WS3B 3UTPD 4WJ5A 1H6EA 2EEDA 1RPQA 1QATA 4GQZA 3SQBA 4AENA 4MWFB 4H88H 2HFFB 1VADA 2DKMA 3WBDA 3DVNA 1CICB 4U49A 1MIMH 4PRID 1NCAL 5ID0B 5I0XA 3JTSA 3I74A 4WHTA 5DQ9A 4G6KL 1T20B 2HTLC 3B8YA 3MV8A 5SWZD 1IAOA 1PNDA 4R83A 1FYTA 4HAGA 3JZ7A 1QLFA 4OFYD 3GGWB 4Z7VB 5T1KA 1RERA 4L8SB 1WS8A 1P2CB 2QQNL 2VDRL 4OCWL 1OQOA 1FL5A 2YPKA 4X7EC 2NCEA 1NBZA 1H3TA 3GSRB 4QLWA 3HBPA 5DXWA 4KQ0A 1MRDL 3VDAA 2VDOB 1NGYB 4RX4D 3T0VA 2CIIB 2PCFA 3G5VB 2NZ9C 4LEBA 4JY4B 5BCAA 4O9HH 3D0VA 1LEIB 3LKNB 3OC5A 5HHMB 4WWID 1AO7E 1ZT7B 1OL0A 2CHDA 2ITCA 3C6LA 1CBJA 3BZ4A 4B41A 2CKBH 3O6FA 2JKJA 1A7OH 4M3HA 4HOWA 4YDVA 3IJEA 4QEGA 3FONB 2IANA 4YWGL 1G5AA 3HG4A 4HIJB 3O9WA 4OM1L 3TASA 3FCTB 4DPAX 3U30C 2R2HB 1NWOA 1U9KA 3CFNA 5IG7A 5D71L 1I85A 1KBBA 2R1WA 3MRKB 4PJ9C 1S7UA 1JCVA 3GHBL 2CLRA 4Y2DA 5C09A 5SV3A 3PHSA 3WIHH 3D33A 1F1GA 3CCHB 4PGBA 1ZDSA 3SE4C 2R1YB 3IXAB 1TKWB 1PGRB 3TBSA 1JMXA 4YBHA 4KX9A 2Y5TB 2OK0L 3LEXB 4W6WB 1NOAA 4CVXA 4JFYB 1CFSA 5L2KE 2EXYD 2QHLA 3D69A 1OAKH 1IGFH 1QW8A 4H0LC 4QOKD 1A7BA 3VRLE 1UM6L 4WI0A 1I1FB 4JANA 3JVGA 4JVPA 2WPGA 4K8RC 2V7NB 2Z7UA 2FWSA 2HUEA 2X4PB 4KPHH 2PO6A 3IGLA 1UM4H 2XWBA 2EIEA 4JM2A 5FCSH 4X80H 1JZ2A 2OTWB 4IBLT 4Y9GA 1DVQA 1MW0A 4HXBH 4W9DC 5LG1A 1AH1A 5IWLC 3HZVB 3C9NA 4J4PC 3A47A 2W0FB 5BOJA 2H26A 2C4FT 3MBWA 3BAIA 3QZWA 3IJSA 4HKZB 3SCMC 4LIQE 1KJVA 3HNTH 3D3VD 3HAEB 3GO1H 2GVYA 4XVTH 3RTQA 4BFGA 2AS5M 4JG5A 1MY5A 3LV3B 4KJQC 1N12A 4UINH 1X6LA 4MAUL 1PAZA 1RZ8A 1YHPA 5IB4A 3DHPA 3KL3A 4XX1E 3QXWA 4XMZA 2WK2A 4ZRGA 4Z7QF 2IPUK 4UZUA 3DOSA 1XEDA 5CD5C 1QNIA 4ZOBA 4CILA 3IKKA 3GLEA 4ELKB 5L88H 4U3SB 2CDFB 1EXHA 4LLDB 4YL4A 1JPTH 1KG0B 1A14H 1NIBA 2AXFB 2RMNA 1GY2A 3TGXA 2UUDK 2YWZA 5A16B 5E1HB 1I7TA 1AKJA 1NL0H 4HJJH 1FFNB 5HBBA 2DEWX 2YA2A 2GK2A 3HRZB 4XNBA 2OYKA 3I9GL 1MF2L 3QHTC 4QTIH 1AR1D 4ZBJA 2QSCL 4JPWH 5T3XH 4LEXL 1H3PH 1J0JA 4PREA 3VXOA 1A02N 1P5VA 4WNQB 2BVPA 3RWJA 5FCUH 1QASA 3W9DA 3HI1B 1XIWD 1U0QA 3O4LB 1WCBB 1OE3A 5E8EA 1X5HA 4J3SA 1YEJL 4GUOA 5DHMC 4AL8C 1ETZA 2PTTA 1RZIA 3WU1A 1TYJA 3DARA 5EUOB 5A2JH 4LSPH 2NYYD 5CGYC 3N55A 2W07A 1HCYA 1YEEL 1YNLL 3PE9A 4IDLA 4F8QA 5JHDD 4PMEA 2VKWA 2J7LA 4J6RL 1E8YA 4M1DL 4AWJC 1ID5I 3OF6D 2IMNA 3C08H 5JHLH 1KB5H 3Q3GA 4O4YL 5CP7A 3SDXB 3QJHB 1G1KA 4GSRA 1DVFB 4G59C 1F8TH 3MOAH 3CE1A 3QHZH 4PLKC 1P53A 3TO4B 3BQUB 1U21A 2W9EL 2EDLA 1A6TA 3TTYA 3TEUA 3S3SA 3RB5A 3I84A 1FVEB 3C6LC 5IF0A 1KFGA 3O6FC 4HUNB 2NX5E 2FCBA 3OZKA 3PHOA 3KPSD 4HLEA 5ANMB 5JOEA 4ZQKB 4M4RB 1NDGB 3O9WC 2JXMB 2ZYIA 3BGFC 2A77H 4LARL 2IDFA 2APFA 1IGYB 1KJ3L 4HC1L 4I77L 3D39A 4TSBL 5E99H 5EO1A 3BFQG 3MN8A 3QYCA 1QA9A 1I85C 1I3VA 3FUKA 4PJ6A 2EIKB 5FUCC 2R69L 3OXRA 3D34A 3GM8A 2XG5A 1MIEL 1DLFH 3ZZSA 3HCVB 1N8ZA 4Y2DC 1A7QH 5EIQA 2AP2A 4NFDA 1JRHI 2D3JA 2WBKA 4GFXA 4YHIA 3ILPA 2FEDD 4LGPB 2WC7A 4ENEC 4PP2B 3T0WA 3ISYA 1MHEA 1U93B 4DGIH 1YEKL 4AGQA 3DHUA 1KTLB 3K91A 4Q58C 4RWYL 4YSPA 4GRWF 1MLBB 2DQTH 5KYYA 2J8OA 3VA6A 1J88A 5K1VA 3F7VA 3F2LA 2A6JA 4N5EC 5DWUH 5IVXF 1NFAA 3QDAA 3JVGC 5IQLA 4ZJ9A 2IBGA 2OAAA 2QVTA 1F42A 4EZMA 4HV8B 3SE9H 4RRPM 2I60L 2PO6C 1MJJB 1ZT1B 1CXKA 1HNYA 4JM2C 1RK1B 4GAFB 2D0FA 1NFIA 2IALA 4OSUL 4H5SB 2WTPA 4NM4H 4P2CG 5E5MB 1MWAH 1B9KA 6PAZA 2F74A 3T71A 5FYKL 3HLAA 4OV6F 5E2UH 5I6KA 4DKEH 1A1NA 3POHA 1HDMB 3QPXH 4G7VH 3P9MB 4MLSA 4L8CA 4XBGB 4P57A 4F7MA 4PRPB 5B39B 2Z92A 5AW4B 4A7GA 2WWMD 3RTQC 4QXGH 2RHEA 3ZKXB 3MA7B 4B7IA 4YK4C 3UCRA 3C6EA 4RDQF 3QDJA 2CA4A 2OJEA 5E7FA 3SDDA 1ZLVK 3GFUA 2YD0A 2DWXA 3RWFB 4K9EC 1AD0B 4I0PA 2WHVA 4PVNA 2IV9A 4JO3H 4PS3A 4BFFA 2Z4QB 4I3GA 4LQ1A 3H9SA 4YDLC 5KUKA 5T1MB 3OMNB 1S7VA 1WVZA 2Y7SA 3L2MA 3T5WA 5DVOA 2JKXA 3BKJL 2SODB 3STBA 1PZ2A 2Y06H 4IU2A 2BINA 3ZKMC 1MCOL 5IBUB 5ACZA 1BZDA 2AABH 3QIBD 3MOQA 2VTFA 4EI5C 1DFBH 4C56D 5C0GB 3DIFA 2H32A 2QEJA 5JW4Q 2M2DA 3D12B 2W59A 4QXUH 3CXDL 4XCNB 3KDMB 3ZKQD 1CGVA 3A22A 1F6AB 4QHLA 1BZ7A 1ADQA 3IDXL 4YDKH 2A9ML 4L3EE 1IFGA 5DVNA 2OMVA 4JFFA 1WITA 5DFAA 4F15B 1KCRH 4OZ4A 3PNRB 3WAJA 4HGMA 1KGJA 1S7RA 4BH7A 4HQQH 2EEBA 3QORB 3RVUD 4LLUA 2HVJA 3QAZB 3K71B 3FFDA 4LHUG 1KXQA 3IN0A 4UZSA 4XE5B 1YEHH 3BVDB 3V0EA 1QSEA 5ICYA 1FNEA 1ZV5A 2ZQKA 3D09A 4G80A 4HS8H 5IM7A 4UM8A 2ESVE 1H6UA 3IPBA 4JZNB 1T0NA 1LD9B 2VDNH 2C9VA 3VQLA 1OF0A 3ZE2E 3K6OA 3TV3L 1CGUA 2Z6FA 1KXVA 3FO2B 4NLHA 3TVMA 3FU0A 3WI9A 2X4TB 3CSBA 2K78A 4ILDA 4OLWL 2NY6B 4D3CH 4ZT1A 1SF3A 4Z7WE 5DMKB 3BFOA 4BKSC 3ENEA 4IBQA 2NY2B 3F7RA 3KPNB 5EHFA 1UZ6F 4MX7B 5CJOL 5E0QA 1JXFA 5AUMA 4H8WH 2F68X 1S7QB 3T77B 4LEOA 3EBHA 2XZCL 2Y1YA 4UZGA 2B14A 4JQVA 2YRPA 5CR1A 4LCWD 1ZHNB 4PRAB 4XWOC 4UTBH 4OLZH 3GSUB 3LN4B 4U1MB 4P59L 4P2RB 5IJVB 2J1XA 5F3HB 5F6HJ 3K74B 4HJ1A 1HNGA 3L9BA 3ZK0A 2FYYB 4KHXL 4UYQA 3AW5A 1U8OA 1NEPA 2ZX8A 3D87B 4DPBX 4MB4A 4XO9A 1AZCA 3BIAX 4WEMB 5HHXH 3PAVA 2D31B 3UTSB 4D2NA 1RURH 3EF7A 5H4YA 2BVTA 6FABL 4OJAA 1Q0YL 5HGDA 4LQFL 1QI3A 4LLQB 4UM9D 2V9QA 3FBQA 5DLLA 4IKLA 1D6VL 5HXMA 1KWGA 1JUFA 5HDBF 4YMPA 1K5WA 3VCLA 1HILB 3VXSB 2BIOA 4FFYA 1IAII 3BW9A 3TJHD 4Q6IB 4KQ4L 1HWGB 1QQDB 1R5WA 3KE0A 1T1YB 1RD6A 2FGWL 3RRQA 1Q94A 4YUEL 2WUCL 5CEZL 3MRBB 2B5IB 1S9WB 4H8HA 3S3BB 2XUWA 2AQ2A 2DWDA 5SWSD 3LZFL 3WV0A 3KLDA 1INQA 2XICA 3QUGA 2PKDA 3FRPB 2BP8A 4WTXA 1HL5A 3C60B 1A2YA 1SOKA 4OLUH 3VO0A 5IHHA 1JZ6A 3GK8L 3DK2A 3M07A 5EOTA 3TEXA 1RQ5A 4ZXBA 2J25A 4P2OD 2DYPB 1ZHKA 4ZMQA 1I8MA 1CLYH 1QLEH 5B8CB 1FZKA 5IT2H 4JFOB 3DSNA 4OLXH 3G6JE 4XTRD 3ZN6A 1TZHA 2ZOLA 3NIFB 2OQJB 1IBGL 1F18A 4JR9L 1B3JA 1JNLL 4CVZA 3ME0A 5DURB 3SDDC 5AW6B 5T3ZL 5B39G 1HTYA 2XN1A 5I16B 5AVUB 4I0PC 2AEPL 1ZS8A 2Y24A 2WUBL 3RVVD 4FZEL 4LDCA 4PJXE 3MYJA 3AMLA 1HHIB 4N2AA 2MCPL 3ZMRA 1DHKA 1SJEB 2QPFA 1PPIA 2TRHA 4GEJA 3S37L 4MJ6B 2W95A 1ZLSL 5AOMA 4OIBA 1W80A 3L7FA 5FF6B 2EDYA 4G71B 2HVBA 4I5BB 4ZMTA 3KYOB 4NQEA 3GMLB 1V8HA 2AQRA 4CSTA 4WTQA 2J8UE 5E08H 3MCG1 2QPSA 4L8SA 4R4FL 3R0MA 5LQBH 2B1HL 4OFDA 5IBUG 5C7ZA 3V4PH 2JKSA 4ZG1A 5BO1L 2BERA 4JFHE 5BS0B 1CLOL 3U6RB 1TUPA 2UZYB 5DF0A 2Q8AH 3U4BL 2RJMA 3ZDZF 3KZ8A 4GW1B 4HISA 3VUAA 1LEIA 3LKNA 3KWUA 5J13C 4LPWA 3ZDYB 4OUOA 5DK2B 5I71B 4ZMPA 1S3RA 1OXYA 3A67L 3EO9L 4H25B 4IBZA 1M2VB 5HD8D 3SDCA 3TF4A 3DETD 4BZ1A 9PCYA 4U6VL 5HTSA 6CGTA 4GKSB 4PS7A 5MP6L 2VW7A 5IEKA 4NJAH 3RWCA 5HVFB 2R9HD 1L7IH 1KXVC 1M7XA 2XRAL 4GRWH 5E8DL 4PR5B 3TVMC 2WTOA 3LZQA 3VDBA 1K3ZA 4B5EA 2JKWA 4FFWD 4G42A 5CMAA 2QQLL 4JHUA 4YHZH 4P46D 3MRLB 3NSXA 2VABB 1MCPL 4G7YL 2VXQL 3AXIA 3AAZA 5K39A 1X9RA 2A74A 1VCBC 1AI1H 3C8KA 2QDWA 4HWZA 3HI5L 5D7EA 2DQMA 2J1WA 5F89A 3MRQA 1NBYA 4KV5E 3U79A 4FNUA 4ORGB 3ISRA 1FORH 3LEXA 5JNYB 1J9QA 1J0YA 4JQVC 1EDYA 43C9B 1N64H 5H35B 3FOLB 1PYWA 3I6LE 5KVMC 1EAPA 2H3XC 3EBAA 4PH8A 4KKLC 4Q8BA 2QLYA 1C16A 2CK0H 4YC2C 4HKBA 3E6FA 3EJRA 3HHMA 1BGXH 1LK2B 1IJNA 5E6IB 5AOZA 1BVLA 2WQ8A 1L9MA 1QFOA 1S9YA 3LDBC 3RYMA 3QEQB 1L0YA 3IDIB 2Y72A 3HI6L 4NZUH 3LS5L 4Y19B 1J1XH 3BQVA 2ZTBA 1DQVA 1SHWA 3LPOA 4HFWA 3NVQA 1HH6B 3ROLA 5HGHB 4NLAA 4AK1A 3F5WB 4PGJA 4NQCD 1ZCRA 5KYXB 3BE1L 5KJRL 1XZ0A 3QWNA 2QGEA 4LF3A 3QE5A 2DMCA 2WANA 4BE6A 2OMUB 4JPQA 1AGBA 1RMFH 1MCSA 3U0PA 5CN1A 1RHHA 2V9UA 2Q1EA 1IBZA 4PY7B 3OAZH 4KUZH 1ZXQA 3SJVD 2A4CA 3QR0A 1LM8V 3LKPA 1JPSH 3PNWA 4MCZB 3NDYE 4JO4H 3HC3H 3BAYA 2ATPB 2EH7H 2QZ5A 1UXSB 1XCTB 1IKFH 3N42F 4IOSD 2ZP0T 4QYOB 4Z7NF 4PJHB 4LDOB 3A4DA 3GJEB 3H6AA 4DUVA 5JOPE 3ARFA 2HLAB 4GRLA 4HJGB 4NEHB 5AB9A 3DTDA 1CR9L 4ZXBC 2VQ1B 1PNCA 3HC4L 3KWWA 1BOGA 2VE6B 2X4RA 1UJ3A 3FRPG 4Z95H 3GNMH 5A16A 1WBYB 3CD4A 1WFUA 1Z9SA 2DBLL 3VG0H 1MCKA 3HZ3A 4D0BA 3Q6GL 1FFNA 5D7JA 4M7JH 1M05A 2I5YL 3MLXH 5TE6L 1GGIH 3LKQA 2DM2A 1AGFA 1QRNE 3IJ8A 3GPEA 2XVGA 4JE4B 4LHUA 1UD8A 2AK4A 3EADA 5D96C 2ETWA 1QHOA 3ZKNC 3FTUA 4FGMA 2H6PB 5DU7A 2X4NB 4DVBB 4N1HB 1AGDA 3W9EB 3D9AH 3SOTA 1JL8A 3BC9A 1KBVA 3CQFA 2X4OA 3OKDB 2AJSH 3BISA 1BJ8A 5DUJA 1WCBA 2FNBA 4LNRA 1I7ZB 1NJ9A 3U6XS 1MFBH 2PPEA 1IM3B 3KCPA 3FT2B 4FQ2H 1IAKB 4QRRD 4BWWA 3MROB 2HFTA 2FX9L 5DZOA 4AM0B 4XN5A 3BH9A 3DGGA 4AIXA 5FXCH 1O7DC 1M56B 4UOW1 3EO1B 4L8SC 4N9OB 4QPEA 3UO1L 5JQIB 4G5ZH 4MMYA 2OJ1A 3MRPA 4EI6A 1SYVA 2GC4C 5F6IB 2BVOA 1MCCA 4HSCX 5DMGC 4DP9X 2Q8BH 4ZMOA 2YGNA 2UYLA 1WICA 1EFXD 1HN1A 3DXAB 1NEZB 2EO9A 4ZTOH 4MJ2A 5K9KA 3U82B 3IT8D 5AVYB 4Q0XH 1ZEAH 3QG6A 4RWHA 3MNZA 2WLKA 3HE7D 4OCLC 3PIQA 3SDCC 3UAEA 3N41F 2L8AA 4JREC 3X2QB 3HLKA 3KJ4B 4P5RA 4Q6YA 4U1LB 2VCOA 1H15A 5MEOB 2ENPA 1J1OL 1WAAE 2Q3AA 1ZLWK 3D7PA 3OLIA 1HXMB 1RUMH 3GQFA 2J71A 4LASH 4AYGA 3MCLL 5IFHH 3MACL 3CNKA 2OL3A 2ZE0A 5TQ0H 1LO4H 3BWUF 4XNAA 2W0LA 3QI9A 5IHWA 5DHVB 3QUYB 3Q1SH 3NH7H 4AYEC 1NIDA 4XP9H 1XTLA 4GKZB 4PRNB 2CUHA 3DO7B 1DSFH 1NSNL 2A74C 1ZPLA 4YPGB 1U4FA 3HFMH 3QHFL 1RLBA 4P48A 1TETL 2EDKA 2Z7WA 4UV7H 5I1DA 4HIHB 3VH8B 3R1GH 1BX2A 4WEEA 4XC3L 3VXTA 5LAXA 1T1WB 4JQIH 3SZ6A 1KN4L 3EJYD 1KJMA 2GUOA 3DX4A 1L6XA 3NYKA 4X6EA 3ZTEA 3ULSB 1SOSA 4Y5XB 4U2ZA 4UQ2B 2ZP8A 1WP6A 1VESA 4H5SA 5F3BA 5EOCH 4WUKL 4RBPH 3QFJD 3NJMA 1Q9KA 3LRHA 3H85A 1HDMA 2J55A 3HUJA 3CK0H 1OCWH 4RMWA 2AJZB 3L95B 2VDQL 1A9BB 3TCXA 4M6ML 3IU3B 4Q9QL 1HT6A 2DM4A 3SKNB 3BZFB 4Y4KD 5EBMB 1ZTXH 1NEUA 3JWNH 4AW7A 4JB9L 3SPVB 1CC3A 4WTZA 4EUPA 4D94A 2PWFA 1YYMH 1RJCA 4JJOA 4S1QL 2VXVH 1C8QA 3CHXA 1ET8A 2NY5H 4M1CD 2A6KA 1THCA 3T2NL 2X05A 5BZXA 1QSFD 1SNRA 4KI5F 1UZ8B 4QHMB 3SGJA 3S97C 4DWHA 3ARFC 4GRLC 3LEYH 3ZO0A 1PDKB 3IRZA 1Q9LB 4I3RH 2VSMB 1PBYA 1AQKL 2O93L 4XNUH 4IKNA 2P48B 1UJ3C 1BEYL 4B0MB 1MOEA 3HN3A 5D7JC 3OPZL 3LTVA 3QA3B 5FUOL 1JNNL 5IK3B 2XWJB 3QO0B 2B4CL 2GKIA 2VYRE 2GQHA 4WUUE 3P0YL 3X17A 4OM0L 2R4SL 3KLAA 2OTUB 2Y2WA 3MV7D 1MJ8L 2ZSWA 4HT1L 1MVYA 5KG9B 3DDFA 5CBAA 3ARGA 4AK2A 4J2XA 3EJZC 2WLIA 3CZUB 2YFNA 2KC0A 5KW9L 3HC0B 4RMUA 3GSVB 1CFVH 1Z5LB 4R9HA 3VX0A 1KIUA 1KTKE 3RPKA 1MDAA 2TSBA 1R3LB 2YN3A 3O3BB 4FJYA 5LHDA 5HHQA 1QFUH 2MSPA 4HS6B 3KLHD 1T2QL 5I75C 2GBVA 1FN4B 1EA9C 3UAFA 4N0YH 4DQOL 5B4MC 3VD9A 4BFOA 4L4VE 4DVRL 2HLEB 5FYLH 1L5GA 4QHPA 5HHOD 4M6NL 1EHXA 3FUMA 1HAUA 7TAAA 5KVEH 2LFGA 3OJDA 2D7MA 1S7QA 3BN9D 3MXWL 4NPYA 5HYFA 3AT8A 2G3ZA 2A6IA 3II1A 4JMXA 5AYUH 4POYA 4U6HB 4PJAF 5IV2A 2B0SL 5DZNA 2WINB 1NEZG 5ESVA 1Q72L 1TT6A 2CJUL 2BSDA 4QHKJ 1MW1A 5C0ND 3SQRA 4BFIA 5BOPA 4K9JA 1EO8L 3K2UL 5F3HA 12E8L 2VDOL 3PPEA 4N2EA 2VB5A 1BIHA 3EBGA 5GS1B 3UZQB 1ZD6A 1L0QA 2RQEA 3QI9C 3TOPA 4PRHE 1YEIL 1V3KA 3MLWH 2IQ9H 3OJMB 4YBQD 4A2LA 1ORSB 1YYCA 4LOVA 4F7KA 4JDVA 1WAPA 5J12B 5MEND 3QDGA 5C0EB 1OCOB 1FZMA 4KWUA 4XMLH 1BP3B 3CHRA 2CKBB 3QRBA 3LRLA 5EIVA 5CEYA 3RUGA 4JRXD 1QQDA 4QI3A 1OF2A 3INUL 1KWKA 4GIAA 5E5UB 3GC3A 3VH8G 1N0XL 1N7MH 2BOCB 5FM5O 3DVIA 1DZBA 1F4WL 2DBJA 4BFEA 3CPUA 1UJTA 4MXQC 3L5XL 2WBJA 2Z8RA 3C60A 3BSZA 5C0CD 1ICTA 1T1XB 4M61A 5FX3A 1LEGB 4ZZFA 1CDBA 2GJ6E 1T4KB 1D5BB 5TFSL 3OMAB 4QDGA 3OJVC 3ABMB 1SRDA 3V0GA 1KEGL 3AUWB 2GIXA 2EIJB 3U1SL 4UT6H 3KPTA 1A6VH 3QUXB 4E9LA 5GRVK 1KJ2L 1CF8L 4CJ0A 4U1NA 5IHZA 2OQJA 1YPZE 2EIMB 1EGJH 5CSZB 3HNVH 1T0OA 3MRJB 3N44F 4Y1AD 2IADA 5J9PB 3SGEI 3AWGA 1QBLL 3QP3A 3IU4H 5FO7A 1ITBB 5F88B 4BZ2L 2WQVA 4WCYL 3BRFA 1F13A 4L1TA 2L3BA 3SGJC 4P4KB 4H13C 1X4ZA 4MS8C 4Q2ZB 3KBFA 1QZ1A 1LE5B 5HI3C 1JZEA 1U3HD 3TT1L 1BQLL 1PIFA 4ZMXA 5IR1A 4MDJA 3KWTA 1MCWM 2J88L 3QVAA 3KS0H 3V4UL 3VMPA 5HVHC 5D1QE 3S8WA 1CDCA 1PLBA 1XSIA 3INOA 1J11A 1WJ3A 2OYPA 3FFCB 4WWNA 1TLMA 1YEGL 2GG1A 3PWPD 4U3HA 3MLUL 5EUKA 5IHUL 5KYWA 4CC0A 5C2BL 2E86A 3CVIL 1UUNA 4K3HA 3U6RA 3SYPA 1K5NB 5DI8B 2XQBL 4HBCL 2EDJA 5B1AB 4LKCB 2XA8L 3SE8L 5ICXB 1OP3K 3CUPA 3QAZC 2VN4A 1EWHA 3ARGC 2ADGA 4XCFH 4F58H 4F5CA 4TQ8A 4Z7WB 4M5YH 2DQEL 2GIYA 1HE7A 3QRGH 5BZDB 1R5VA 4B9KC 4I8DA 2GITB 4HOXA 2V2TB 2O5YH 1ZA6B 3OTTA 3IBOA 1OTTC 4NGHL 5EFIB 2YUXA 1E4XL 3S36L 3UJIL 1RVFL 1IFRA 4H2CA 3ULUL 3FYIB 4OGAD 1NFKA 3ZMNA 4XN7A 3O4OC 1NM9A 1SUHA 3ULVC 4ZNEA 1IILE 3FO0H 1JMZA 4UANA 5JO5A 1GS7A 4FQCL 4Z7OE 1AYOA 4QGYA 5IVZB 4MJIA 5ABDE 3ZDZE 1S9VA 1H3GA 5EZIL 4IHBA 5BRZA 1R3HA 4OZHF 4UU9B 5IESH 3O6LH 2HJKA 2V5RA 3KHQA 1J7VR 1DEEA 3QEHA 4XNZB 4XZUA 2EJ1A 3L7EB 1HZLA 1SEQH 1B2YA 3MLTA 1U2CA 1TVHB 3DMMD 1F97A 3LHPL 8CGTA 3VI3E 2AQSA 2E0PA 3ZL1A 1IQDB 1RJZB 5JIPA 4ODXA 3PXJA 4PGDB 3VSQA 4L5FH 4LOUC 5D5MB 3SDAD 2VR9A 35C8H 3IAPA 1KB5B 1XH3B 4AIZA 1HOCB 1NMAL 1T0MB 2VM9A 3DX9A 1TENA 3FSVA 3FTZA 4IK7A 2BVQB 3W37A 4UDTA 4J3XA 1NCNA 2Y7LA 3HE6D 5K1NA 1DJZA 5FAAA 3O6KL 1XF5A 3MHZA 3BYTA 2X6AA 2WLHA 3O11A 1GPOH 5TDPB 1GTNA 4N2OA 1T7VA 1T1ZA 3L3JB 4L29A 4P05A 1X5FA 3VI4B 2A4EA 1FYHB 2WQRA 2HRPL 4WI6A 5FYLE 4JM0A 3F62A 1WZ1L 3NPSC 4LESA 4OF0A 1ZE3H 3V4LA 2ATPA 3G6JB 4N8PA 1MW2A 4PJBE 3VXUE 1KN2L 1KLFA 3CXHJ 1NC4D 3FFOA 3L5WB 2Y2YA 4I2XA 4PJHA 2BIHA 4JO2H 2DLGA 4LLVB 2WBJC 3UDWA 4F2MB 4NAJA 4QRPD 5I8OH 4NZJA 2OR7A 1A8ZA 5C07D 3O2DL 1JGIA 5DO2D 5BNXD 5AZEH 2FEEL 3MRMB 1EEYA 3SO3B 5ID1A 4IRJD 4DP1X 1AOHA 5DQJB 4DN4H 4YXHH 3HVNA 1DEDA 3JT2A 5HYJD 3BP7B 2WYZA 3DTUB 3L4UA 2PLTA 4NO0A 4FQHB 3WDIA 3DI2B 2ADYA 4DZ8B 4J8RA 2H6PA 2I07B 4DQAA 2E76C 4HU8A 1MWAB 4WU5B 3AU1B 3RAJL 1KF9B 1YVLA 1JGEA 2JQAA 2PPAA 3THMH 4PP1C 2H9GA 2WTRA 4AW4A 4NNXB 5I66A 2NCMA 1TJHH 4J1UA 1RZJC 4QYAA 5H8DA 2BX5A 3NMEA 1NDTA 2Y6SC 8FABB 1IAKA 2FX8H 4NKIL 3OGCA 3VXME 3WCYA 2OYMA 4RGNB 1AO7A 5A7EA 3OVUB 5A2KH 1T22A 4NO3B 5DD3L 2FO4B 2WLLA 5FK9B 3TJPA 3UERA 1T03L 2F15A 3GSNH 3EYOB 3RL2A 3LH2H 4G8IB 1WFIA 4WO4B 1QFPA 4FKHA 1VKXB 5CILH 1T7ZA 1OGAA 3ARXA 5GZOA 3MC0A 3LMJL 2X4SB 1E9QA 1A7PH 2C1OB 1ZANL 1BW8A 5L7XH 3L1OL 4CNIB 2BNUB 2WAHA 2NNRA 4OCSL 1A6WL 2GY7B 3BH8B 1E2ZA 3VRJA 3JVFC 1U8JA 4XNMB 4U1LA 1N4XH 4MNQD 2DJSA 5CEXB 4XMTA 3CAFA 3BP4B 1NGXB 5TDOB 4KKCC 5IW1B 2NY0D 3ARDB 1XB6A 5L2KA 2KZWA 2O6CA 1SFDA 3U9WA 7FABH 2WYIA 2B2XH 3MLVH 2LAGB 4A04A 4NQVA 4HZLA 3QT2A 1JHLL 4GKZA 2ZXGA 4PRNA 4UTAL 3DO7A 2O5ZH 3IF1B 5GRJL 5HP5A 2FK9A 2V5TA 5CINL 4AMKH 5KANI 1Y0LA 1N5YH 1AFVH 3VH8A 4P2QE 3VYNA 5ACLA 1HL4A 2VIRB 5F1KC 3RY6A 1E3FA 1SDDA 4LSUH 2VDNB 2AJVH 1RIHH 1EXUA 4I18B 2OMXB 3BHBB 2N7BA 3ZW3A 3Q2WA 1VEMA 3WO4C 2NUPB 4AM0Q 3F7YB 3WFHB 5IY5B 3ULSA 5MEQB 1NGPH 5CUSL 4ADGA 3L4YA 3RZWA 4GG8B 1DE4A 4KDVA 3TA4D 2RCSH 4JKLA 5ESQA 3R8BB 1X6NA 2NLJB 3LX9A 4TLTA 1UT2A 4X5QA 5ADOH 1XWVA 5GRUH 1JHTB 2DI9A 3TZVD 3C2AH 1B0IA 4G1MA 4YFLI 5DRNA 1EV2E 1XO8A 4HZ1A 1HINH 2YEVB 5EN3A 1PG7X 2XPYA 3OKMB 3WE6A 1GZQA 3B9AA 3K3QA 3IU3A 3UAJA 4EIZC 5JQ6L 3V6FB 2XWCA 3AY2A 4BH8B 3KYKL 1QEWB 2GTZA 3SKJL 5IB3A 4TQHA 4OZFA 3T8XA 3EKCA 4DCQB 5FYKD 3L3KB 4MLIA 1ERNA 5IJBC 4FJZA 1UH2A 5GRXG 1A8JH 2ATKB 3CDCA 2HT2D 3IMWA 4NKMB 1JWUB 1E67A 3SY0B 2UZIH 3BUDA 4P07A 2X6UA 4DNLA 4HG4K 3P73A 3RVXC 3WNKA 1VACA 4ANXA 5I6OA 4QHMA 3CZGA 5FGCB 5ALBL 1OAUL 2EAEA 4GBXA 4AXWA 3MFFA 4Z7QB 4YHML 3UDWC 3FUIA 1NAMH 3IDJA 4UB0L 4Q14A 5IIEA 2KH2B 1KULA 2O5NA 1CJYA 1NCOA 2OX5B 1U8IA 1IU1A 3P4OB 4JO1H 4XMXA 3BKYL 4JFEB 5EOCJ 2VLMD 3LZOA 4ENZA 5BXFA 4L5FE 1Z0NA 2EKJA 2JKRM 4PS4L 1BA9A 4X7SH 1E4HA 1KLGB 1IAIM 4KJQD 3BJLA 4XVSH 1KNOB 1MFAL 3NQIA 1R24B 2XV2A 2DIJA 5E56A 4QTHA 3QO0A 2CHWA 4XVUD 5ACMA 1J1PH 4JGJA 4HK3J 5FHBL 4G6MH 3L54A 4J3OF 4KI5E 1FG2B 5BVJB 2LTQB 4QGTA 3B43A 3SKMB 2XOTA 3KL5A 1IC4H 2Y1AA 2H8PB 3MZTA 3B2UC 4S1DC 2XZZA 4E9RA 5KYNA 3D85D 4KY2A 5ANHA 5IB1B 3RGBA 2DIBA 1WIUA 2QDVA 3QB7C 1XEUA 5LN8A 1QLEB 4OUUB 4QWWC 3AREA 4NNYA 3L5IA 1U36A 4GSQA 2K3TA 1G7MB 2YBRB 2F2HA 4R5TA 3KPRE 2AJ3B 1B0RA 2ZUXA 4GW4B 5HJ3A 3WIIH 4B60A 5G5DB 1FN4A 3CMGA 2EYRB 2NX5A 3F12A 4Y1TA 3HIZA 3PWJA 2QHRH 1PJ9A 2A1WL 1WUZA 2FHBA 1QR1A 4WI4A 4RFEA 3MBED 3NA9L 3CHPA 4FXKB 2H47C 2OSXA 5GZOC 3I3BA 4UT9A 4N8VB 4JL2A 1ZA3A 4XP6L 4DN3H 2NNFA 4XAKE 5LJYH 1L3NA 2YA1A 3RILA 2YJQA 4O2FA 5DR5H 3NSCA 3TA3A 1G6RA 1C5DB 3ET9F 3QEGH 2FIKA 4PGZA 3MV8D 1IQWL 4E9VA 4MAYB 1HSBB 4X83A 1YQ2A 2ED8A 4I1PA 3BPOB 5E2TH 1ZLUH 3V4PB 5I1AB 3IJYA 2WXGA 1N6QH 4Y16D 2FJUB 3NFPB 4M56A 3X14A 1CLVA 4OGZA 4JDTH 5FO9B 3L9RA 3BXNB 1H3VA 2D3NA 4JDZA 4AEHH 1H0DB 4RFOL 1XR9B 1VGEH 3TX4A 5KZCB 1W6WA 3I6GA 4HUCA 4Z7IA 4LGSB 4LP4A 3TN0D 2B08A 4KZEL 5D1XD 2BJMH 5ERWB 2K9FB 4PJAE 2G4EA 1RZ7L 3GLDA 5HI5D 4YS4A 2W91A 1SBBA 4P5MA 2BLFA 3PP4L 5DRZA 1FJ1B 2NY4B 3RY6C 5KTEL 3NJVA 2P80A 1BPVA 5JXAL 2GI7A 1IX2A 1KGWA 4RAHA 2B1AL 2D3LA 3DRQA 4GRWB 1WO2A 3QRFM 3O9WD 1E4JA 5HY9A 3CFCH 1AY1H 3OBAA 5DD1L 1FIGH 2PP9A 4PGCA 4XMVA 3W57A 2X3BA 3MNWB 4JG9A 5IVXB 5A2BA 1H3WM 4PUBH 4CUCA 4NZTL 1EMTH 4PV9B 1OP5K 2BNRD 3E8UH 4X5XA 1UG9A 3WIHA 4Y2DD 1KACB 3OB8A 4IOFC 1VLXA 2HRGA 2HT3C 4UOJA 2V8MA 2ADJA 4DAGL 5CEZD 1HE8A 5D2LF 4OB5H 1SMOA 3DWTA 3BKML 3IE4A 4QAMB 3UPRB 3UAJC 4UQ3A 3RVTD 1E5CA 3O8XA 2C9UA 3EZJB 2CBQA 2P26A 2BMKB 4BJLA 1RL1A 2QJDA 1BVNP 1A4JB 3R06A 1SMAA 2B20A 3F7QA 2MNWA 1VENA 3LZNA 5BPPA 4Z8FL 1B3IA 4GBXC 3MPCA 2Z1PA 3FQTA 4P2AA 3UG5A 4J39A 1UGKA 2P52A 4L3EA 4X4KA 4K5PA 4EBQL 2R0LH 2YGPA 4F33A 3VMNA 1T3FB 4X9BA 2P5ED 3EJPA 1NC2B 3X1FA 1KELL 3ARRA 2CUAA 4G8EA 1CDUA 3ZDWA 4UI2A 3MODH 5KSBE 2I7OA 2ESVA 1NBVH 3NFNA 4HIXL 2YXFA 4DT2A 1UM5L 3U0WH 1PFOA 2KLSA 3HB3B 3GS0A 3B8SA 3U46B 3BPLB 3BDYH 3GEFA 5LCVL 3O3UN 2Q7YB 1JRHH 3QUZA 5I1CH 4GP8B 4LL9A 3FB6B 3JWDH 4Z7WA 4Q89A 2ZZUT 1SXNA 5I1EH 2FQFA 2E9WA 2PXYB 3QJOA 2XWEA 1XBDA 1UXLA 4Y5YB 3EOAB 1IIIA 3CVHA 4PJCE 2AV1A 3AREC 4K94H 4XVJL 4AQAB 1UC6A 3EIFA 4OZIF 5KSVA 2XX1A 2D7PA 4OCMC 3W39B 3KS0J 5GXBB 4IU3B 2NY1C 5F1OB 1YECH 2C1PA 2WXRA 5ADPL 1M3IA 4L8DA 1TQCB 3ZE0F 1QSVA 3LD8C 4NOBA 2N3JA 3TLRA 5CHNA 4E68A 2LLLA 3TIDB 3VTAA 3MV9B 4ZUVB 2WZPA 4P23D 2MQCA 4NX0A 2XJLA 4UU9A 4BK4A 1FC1A 3GF8A 1IAMA 4PPTA 4Z76A 1DCLA 2H1XA 4F57L 1DBKH 1BEXA 2VITA 5I1IL 3MO1A 2IFFH 4WSJA 2FJHB 3CLEL 1S7XA 1VRSA 3WNMA 3ZOAA 1U8CB 1Z9PA 3TA3C 2R8SH 2R0KL 3CN0A 1H9DA 5I30L 4N8VG 1R0AH 4TULH 1PZCA 1SDYA 3PGDB 3AGWA 1CQKA 4DPRA 2F54D 1SXAA 5ALCL 2CHNA 3ZYIA 4G1EB 1KB5A 3QIUB 2VRKA 4HGKC 1IT9L 1HOCA 3CU1A 1CFNA 4GSUA 4LBAA 2YPVL 1FO0A 4IJ3B 4ONFH 3EOTH 5C0AD 4ZFOA 4MHHG 1VZHA 4LVOB 1IEBA 3D6GA 2JMRA 3MRGB 5EIIB 1EEQA 3KPLB 2BVUA 2AFNA 3FF8A 4M9OA 1OTUC 3NRQA 1BAGA 3Q01A 4K3DH 4XRCB 1BAFH 5F7NC 1SYSB 3A6CH 4Z7UE 3CZFA 5HDBB 4YHLH 4PBVC 3LZLA 1JXDA 3NCBB 4M3JA 3WEXB 3G6JA 4M5SA 5GSVA 4B95C 1D7CA 1KPVA 3WN6A 4DEUA 4KTDH 4BK5A 1MFDH 4NKQB 2X2UA 3CFKB 4WNSA 1CTOA 2ZUWA 3I6KA 5C0BD 3UYOD 2DYSB 4BCYA 2UX7A 3RFRA 4J3OH 1LO5A 2HJLA 1U3JA 1K8DA 4W9FC 5JYMA 3DECA 3H42L 3QK0A 1KBWA 1JTOA 1NGQH 2YPLD 2GJZB 4K2UL 1WSST 3GRGA 4PJXA 5E5RB 5E51A 4UT7H 2JV6A 3J7HA 1FNSH 2CK2A 1D9KD 3WJMA 2E7DA 2A83A 4I9XA 2QTVA 5DK0B 3O8XC 4DKDC 3UMNA 2CIKB 1RZGB 2H1LM 3MTXA 2K3HA 1E9PA 1EEUA 5D1QB 1JWSB 4U33A 4JPVL 2J8UA 4WFGD 1OAZL 2MTPA 5DVKA 3L4TA 4OCXL 2CDGA 4QOKB 5E2WL 5I1JL 4NP4L 4UOW0 3CHSA 3VWKA 4RDQG 2PYEE 4AV0A 1V7ML 2D7QA 1RIUH 3B2PA 4OLVL 5F96L 1ZS2A 4IRZL 1WD8A 1MAJA 4W9EC 3VFPB 2Y7MA 2X6MA 4JFPA 3SZKC 2I69A 1M7UA 2GEEA 4GKOA 4PBXA 4MQSB 3BP5B 4M3KB 3LSOA 4NAQA 3EFOB 5FK9A 1FRGH 4KMLB 5I76B 5KN5B 5JA8B 3EYOA 3G6DL 4TL5A 1XGQA 4KZCA 4G8IA 3O2WL 1J0HA 3D52A 4JRYB 1F41A 4JRFA 1U95A 4WO4A 4L4TD 4JCLA 1JDAA 4ZO7A 3LKOA 3VWJB 1VKXA 2Q0ZX 5I1HL 3C5ZD 2D03L 2DQFA 3UP1A 1A3LL 3QUZC 1W0VA 4HOZA 1F5WA 2BNUA 4E9TA 1AXTH 3ZDZB 4FQJL 1MCDA 1IAIH 5IFAH 2O61A 4FQXD 4HF5L 4W9HC 1D5IH 1K3IA 2YXMA 4FQQB 4TUJA 5LGJB 3C8HA 5BQ7B 1CZ8H 1DQKA 4KX7A 3W3BA 3BT2H 1VFOA 2ZAHA 5I6NA 1G1YA 1OY3B 4ZW5A 3GRWL 1I9JL 1AC0A 1DO5A 2G5BB 3EHBD 4YSSA 4M6AA 3L9YA 3PGCA 4RRPG 5D72L 3SBWA 1LTXA 2JELH 3T0EA 2ADFH 2X9WA 1QKZL 1YEDB 5EO9A 3LEVH 1JIBA 3F83A 1YMMB 3PRZA 4CU7A 1YC8A 3CIQA 4LCUB 2VJ0A 2K8MA 3M7FB 2YQBA 2VIRA 4MXVF 4U1SB 5HYIA 4UM9A 4KVNL 1XGTA 3ZRSA 4PJIE 3ZQWA 4LU5L 2OMXA 5H94B 5BV7H 1XIWB 3I75B 2K6WA 4H88L 4DOHE 4H8UA 1RIVL 1MIML 3N0PB 4PHZA 4ZK8A 5FDWB 1JK8B 4UQDA 1G7IB 5C70A 3DROB 1OGTA 2LOEA 1P4LB 2NLJA 4XHQA 1RUPH 2IC2A 3JTTB 4R7NB 4J8QA 1VFAB 2BW5A 2QMJA 2HG5B 1JHTA 5F2FA 5TPWH 3DUHA 3UZVB 4HFUH 4K15A 1OE2A 3MJ7A 3OKMA 5EU6D 4ODVL 1H8NA 2B59A 3ZSTA 3D48R 3L3OB 3IJHB 4U05A 4BH8A 1XF2A 3VQ2C 2VJ8A 3M1BB 3QO1A 2R2CA 3WDHA 1SY6A 5AB2A 5EIIG 4O9HL 2ATKA 2DQHH 4R96A 4ZOEA 1O5DT 1QYGH 3V8OA 2AC0A 2GC7C 1J9TA 4BK5C 1UQSB 2GY5A 1I8KA 3MNVB 1QRNA 3U36A 2NY3C 2CKBL 1OD9A 4V1DD 5A6IA 4X4XA 1A7OL 5EEYA 4F7TA 1J9RA 4KJPD 1JK9A 2IWFA 4LKXA 4WK2B 4Z7NB 1CB4A 4RBPK 1XAKA 4IEFA 4PV8A 5KJ7E 2OX5A 1TPXC 2DLFL 2X41A 5E6RB 2BP0B 2ZSVA 4DESA 4N0UE 2E5EA 5DO8A 3WY1A 4NRZB 1DYZA 3QXAB 4W9IC 4AGNA 5AW9B 2X2HA 1JWMB 5ISZB 4WW2A 2NXYC 3RDTB 4JG1L 5IB2A 2KQNA 5G55A 3PFUA 5CFAA 5BVJA 2HYMA 3FT0A 3WLBA 3MRFB 5EU5A 1K2DA 5IW6B 5FKPA 3LQAC 1OAKL 1IGFL 1MHPH 3CZJA 2WXHA 4R7VA 2VR4A 3VWKC 1GL4B 5AVVB 2R0ZH 3P30L 1AGEA 1I4FA 1RZQA 3FQUB 2WZAA 4UWQB 4ZXBD 4UQBA 2J5LC 4KPHL 1DVUA 3VFNB 5C0JB 1UM4L 3HZKB 4OUUA 4EI0A 4TTDD 5KVDE 4X80L 4M6OL 2PW1B 3TONA 1I1YA 4HXBL 4HAFA 5DTFB 3MJ9H 2AJ3A 4Y4HB 1TXKA 1FGNH 2LU3A 4AC2A 2GSGA 2NSMA 5AKSA 3UOAB 1E5AA 2ENSA 3ESUF 4BQ6A 2FT7A 3HNTL 4YGVB 3GO1L 4XVTL 3MX0B 5TE7H 1WAAA 2XWDA 3JWNG 4WO4C 5CZVH 2WJ5A 2P44B 1BPLB 2AKRB 4B50A 4UINL 4IBVA 3ASWA 4NRXA 4DJMA 3CN3A 4N8VA 1R3KB 2QVKA 1JGDB 1GRWA 2WLYA 4PJ7F 2OZNA 4TVPE 1JZ8A 4HIEB 4JM2F 1CICD 4G9DA 1J8HB 2G9HA 1EBPA 4LLWA 5FYJE 1C5DA 1A25A 4UV4L 1BCIA 3CDZA 3N41B 3W0WE 5L88L 3WKYA 1U8MB 5J1SC 4GMTL 4K7PL 5D7LB 4RIRA 3GTVA 5JIKA 3TT3H 1JPTL 1K72A 1NCWH 2MQ3A 3TU6A 4AEIH 1MW3A 1HQ4B 1JZ3A 3D0LB 3VQMA 2CO2A 3ZUCA 3DPBA 4TNFA 4F9LA 5DMGD 2L4OA 5TF1H 1T7WA 1NL0L 3SBWC 3T0EC 3FHAA 2VH5H 5GRWA 3TBYB 2Y7OA 3QWOB 3MTRA 5KS9F 2O26U 4M7ZB 5HHMD 5JDSB 1D7FA 3N04A 1HJBC 1KCUH 3G5YB 1U91B 2FL5A 4QTIL 1ZVSB 2H0FA 4JPWL 5T3XL 3P3TA 1X5IA 4KI1A 2YN5A 1X5ZA 3RIFK 5HYQB 2X4UA 3PV7A 1Z1WA 5FCUL 3U1QA 3TCTA 3P4NA 2ZWLT 1ET5A 3NJGA 4E9XA 1D5MA 4E41E 1FC2D 4PWKA 1OP4A 2P8MB 3U6XA 3BJ91 3N43F 3NIDF 1D5XB 3GXUB 4OJEH 3C6SB 4U1GC 3E2HB 3X1BA 4GUQA 4LEEA 3S37X 3KNBB 3O3AA 2UWEB 4LSPL 3EJUA 4CMHC 3FU7B 3VGGA 5PCYA 4M93C 3X1EA 4AI7A 3ATAA 2EIDA 5EEUA 4OD1H 1J86A 2YSSA 5E1QA 4N0RA 5JHLL 1PSKH 1KB5L 1SBSH 3IDMB 1R3JB 1U58A 3K0WA 3CJJA 1H3XA 4Z3IA 1F8TL 3UAAA 3MOAL 4XPBH 4NN6B 1CWVA 4P9HC 5I73C 1D2OA 1B6DA 1U8HB 2IG2H 3LNEA 3MLRH 4IBYA 1HEJC 2CALA 5EWIL 5AVZB 2RH0A 5JW4R 2EC8A 2EVIA 1I1AA 4U1JA 3LIZH 4WUUA 2JCWA 4EN2A 1HKLL 3QBTB 3ARBB 1NZRA 4X6CE 4K8RH 5EORH 15C8H 2A77L 3NZHH 4BEIA 1KTDB 1AS7A 2P8LA 4Y2NA 3QJFA 4QRSB 1Z5HA 2FJSA 5E99L 4PGEA 2COVD 5K1JA 2CQVA 2Z93A 3FN0L 1T3FA 5I19H 4Y5VB 2XFXB 1SJVA 4I1NB 5D1ZA 1DLFL 2FWLB 4M00A 2JIXB 4BQ8A 1A7QL 6PCYA 3US0A 5AAMA 4WW2C 3EGSB 3QR2A 1GGCL 3GI9H 1BFOB 3RHWK 3VGHA 1QHPA 4ODSH 4M8QB 4FNPA 2OJZH 2GBTA 2YRZA 2PW2B 4XP5H 4DGIL 4RZCB 3S4SB 1OHZA 3PABB 4L1LA 4HK3N 1JSYA 1XCQB 2QR0B 5FC9A 2XZQH 1R1CA 2F19H 3F01A 4L4VA 5DWUL 4DERA 4OI8A 2Q2EB 2FWOA 3DVGA 1F4AA 5L8JB 1K4DA 3SE9L 2OZ4L 2PXYA 3W82A 4YZWA 3QYMA 2IH1B 3MR9A 3MBXH 1J5OH 1AD9B 2BW4A 5JQHC 2XTJE 3GJFH 3