3CQQA

Human sod1 g85r variant, structure ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
134
Chain Sequence
b'TKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGRHVGDLRNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structures of the G85R Variant of SOD1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 134
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3cqqA00
1MFMA 2XJKA 2XJLA 1EQWA 1COBA 1XSOA 3CE1A 4L05A 1IBBA 3S0PA 4A7TA 5CU9A 4BCZA 1JCVA 1IB5A 4OH2A 1F1GA 2GBUA 2C9SA 2VR7A 3QQDB 3CQQA 1EJ8A 3GZPA 3H2QA 3L9EA 2WZ5A 4FF9A 1QUPA 1F18A 1SXBA 3GTTA 2WWOA 2Z7UA 1JK9B 3GZQA 1B4LA 4BD4A 1SXCA 1BZOA 1SOSA 2VR8A 1OZUA 2R27A 3SODB 1CBJA 2ZOWA 2C9UA 3HFFA 3HOGA 1DSWA 3L9YA 3F7LA 1TO4A 5KBMA 1Q0EA 1SDYA 2SODB 1IBHA 3T5WA 1OEZW 1YAIA 3H2PA 5KBLA 3QQDA 2Q2LA 4N3TA 1YAZA 2APSA 5KBKA 1F1AA 4OJAA 1IBFA 4BCYA 1ESOA 1SXAA 2WZ0A 1JK9A 4A7SA 3F7KA 1IBDA 2ZKYA 1SXNA 2JCWA 1OALA 2AQNA 2AQQA 4U4IA 2Z7YA 2AQTA 1HL5A 2AQRA 3KBEA 4B3EA 3GQFA 2WKOF 2E47A 1KMGA 3PU7A 4MCNA 4N3UA 3GTVA 2ZKWA 2K4WA 1PU0A 2Z7WA 1E9PB 4A7GA 3MKGA 1SPDA 1YSOA 1UXLA 3MNDA 4MCMA 1SXZA 1N19A 1E9OB 2LU5A 3KM1A 2C9VA 1F1DA 4A7GF 2E46A 2GBVA 3RE0A 2AQSA 2WZ6A 1SDAB 1E9QB 4A7VA 3GZOA 1U3NA 3LTVA 2JLPA 2WKOA 1PZSA 1OZTG 1BA9A 3KM2A 2GBTA 2ZKXA 1P1VA 3KBFA 3KH4A 3ECWA 1L3NA 1FUNA 1N18A 2AQPA 3HW7A 1DO5A 1Z9PA 3K91A 1RK7A 1E9PA 1OAJA 1TO5A 3CQPA 1B4TA 1XTLA 3KH3A 2AF2A 2WWNA 1CB4A 1SRDA 1Z9NA 1XTMA 4A7UA 1E9OA 2WYZA 1PTZA 1SXSA 2NNXA 1AZVA 2AEOA 4A7QA 1HL4A 3ECUA 2VR6A 2Z7ZA 1UXMA 2V0AA 2WYTA 1E9QA 3ECVA 1S4IA
chains in the Genus database with same CATH superfamily
2AMUA 4X99A 2O6FA 3FPYA 4MXVE 5E94B 3L7EA 1A7QH 1W72B 5GRVL 3LVEA 2CA4A 3KGSA 4F58L 1S7QA 2B1HH 4WK0B 1XF2A 4N2IA 2HKFL 4TQ8A 4AV4A 3UABA 2ALWA 3GO1L 3LZNA 3ZMNA 3K2UL 4F58H 1VGEL 1FGVH 3RWGB 5HYSG 2HFFB 3LYRA 5MEOA 1JPFB 1HIML 1E2VA 3F58L 3K2UH 3FUMA 2ZCLL 3CLWA 2P28B 3ARZA 2VDRL 3CJJA 3L7FA 1U6AH 3GGWA 4JPIB 3BEVA 5PAZA 3ALWA 1SZNA 2Y06L 1LLAA 4KQ4H 2ZCLH 4IRSD 4XO3A 2AQ2A 1AO7D 3VFTB 4LLDB 4DP4X 1FHNA 1DSWA 1I85C 1LWHA 4M03A 5DI8A 2Y06H 3L9YA 1WJ3A 3C8KA 3QJHB 3CN2A 2VABB 2YAFA 3BCDA 1CVSC 4OW6A 1HXMA 3NSXA 4OV5A 2YBGA 4JPVL 3HE6B 1NMBL 1NCGA 1ZJAA 3QQDA 4XN5A 1U8CB 5IROC 4LSRL 5SX4I 1ZRUA 2EE3A 4XCCL 4RNRA 5E2UL 4F9LA 1YC7A 2NNFA 2OA9A 3CUPB 4LHUD 1M7IB 4YLQT 4IU2A 4LSRH 5DUPH 4IRSA 3VG9C 3VD4A 2MMXA 1AO7A 3DGCR 1I1FB 4XCCH 3GPEA 4LLYB 3VB9A 5L0QC 5J11B 1S9YB 3N42F 4L8SA 5KG9A 1YEIH 4ZUUB 2X4UA 4LDCA 1BZDA 4KI5C 3C6LB 1NICA 1Q4NX 4OI8A 3GBEA 2YPVL 3F5WA 2IMNA 3AQZA 4PTTB 2PP9A 4XNUH 5HGGS 5DURD 4DFHA 4P05A 2J1ZA 4ETQB 1H15B 3LS4L 3D87B 3WGVB 1KJ3L 2BVPB 3BZ5A 1P84K 2DBLH 2E6QA 4I48B 4N1HB 3SPJA 4PRIB 1G1CA 2J4WL 4PJGF 1HDMB 2ZP9A 3VCLA 4D3CL 2EE2A 2ZCKH 3IFOA 4HKZA 1KJ3H 3K8MA 5H94A 2P8LA 3MRLA 4L3ED 4LHUA 4NSKA 1TYEB 4QXVA 2J4WH 5IHZA 5TDOA 1OVZA 4JFEB 4NC1E 1BM3L 4X5WB 3US9A 4S11A 4DN3L 4AYGA 3WFBL 2ZG2A 4MA3B 1UT1A 1AC0A 1MCHA 1NCNA 1KB9K 1BM3H 3CSFA 5C2BL 4FFTA 3WFBH 4YXLL 3ZHLA 4MHHI 4TVUA 4A7UA 5DJ6A 5TK2A 4L3EA 3VFSA 3MA7A 4YXLH 1QLRB 2K9FB 5L2KB 3TT1L 5EOCL 2ICEC 3EZJB 2V0AA 1EK3A 2PO6B 4BSJA 2VRAA 4GAYB 1AZUA 2NY6B 4AZ8B 2R1YA 4LSSL 3NP3A 4LAJH 5D71H 1B2WL 5EOCH 5MENB 5DFAA 4TULL 2BC4B 2IPKA 3VXOA 5J56B 1E43A 2D0GA 2DF3A 3A24A 2W38A 3V6OC 1IU1A 5TD4A 5ILTL 4XVOA 3DUSB 1UM6H 4I4WB 4UNUA 2NCMA 2ZF9A 3IDIB 1JRHH 4KGJA 1K4CA 1O0VA 1G5AA 1HNFA 1UH4A 3EHBD 3OHXC 4HK0B 5E1AB 5AVSB 2ICEA 3B4NA 3P0VH 5MEPA 4FQIH 4G9DA 3EO0A 4FNQA 1U42A 2RH0A 2FT7A 1YY9D 2FECI 2AJZB 12E8L 2YC1B 1BQHA 2XXMB 3UGXA 5C7XH 3OXSB 1KPRA 4S0TD 1QR4A 3B6SB 1F6AA 3VI4E 2GTZB 4XWOD 4A7SA 1BX2A 2XQ0A 2QVMA 5DS8A 5SWQA 2FT6A 1UZ8B 3BDYL 2IGLA 3ELAT 3FT9A 3GMQB 2EDWA 3RDJA 5IW1A 4A38A 1S9XB 2ROYA 1AHKA 4G6JL 5H37G 2IQAB 4R0LC 2BOCA 3D85D 4NQQA 2HG5B 3ULUE 4LAQH 1NGWB 3D2TA 5F3BA 3KNBB 3TN0B 3NEXA 1HNYA 2TRYA 2PXYC 2VXTL 3KPQA 1N9PA 1T2QH 5DEGA 1W72H 4N26A 3CFBB 2QSCL 3X13A 2VM9A 3SD5A 1GZQB 2VXTH 5DRXA 2KLTA 2QSCH 2LAAA 1SLWA 4FFVC 3JV4A 2YR3A 4CMHB 4JHWH 5GGRA 4YBHA 5F89A 3D85A 2FO1A 4FFVD 1OAJA 3MLTA 5JNYA 2W91A 3CZNA 1TT6A 3WFDH 1A14L 3RIKA 1T5WB 2IXQA 4Y9BA 1G7MA 3LSOB 3L4CA 5F70A 3RWCB 3IMTA 4DT2A 3I50L 1A14H 2GK0B 3SKJL 3NEEA 1N6QL 1WCQA 3NH7L 2B59B 2CXGA 3MGOA 5KBNC 1HQ4A 4TM9A 3OB0H 1YDPB 2OMZA 3BZEA 3I50H 1KYUA 3OJDA 4R2GB 3SKJH 1N6QH 2NXZC 5E6IC 1EZVY 2E56A 4P04A 3QZWA 4X9GA 4JJ5B 5F9WB 3BSZL 5IVXF 3RWIB 1JHLH 4XMKH 2NXZD 2GJ6E 4PG9A 1TVBA 4LP8A 3LNHA 1IUZA 1YCSA 1BV8A 5D7LD 5E6ID 5IOPA 3BSZH 2WGXA 1HHJA 2JJTA 3ZU8A 2VXUL 2NUTA 3V10A 1IGML 5JIIA 1WK0A 3V95A 1KJMA 4IS6A 4YHKL 1U8KB 1BZ9B 2VXUH 2FCBA 1IGMH 1DCLA 4LGPB 5I74B 1YMHB 5I9QB 2V9QA 5FB8B 4WWKC 4YHKH 1DEEA 3WS6C 4O51B 4X7EC 4EKXA 4GLRH 5KSAD 1WIUA 4U1SA 4WTZA 4MNQD 1V3JA 4K5MA 3GXFA 4FFYA 4JPQA 1I8AA 2F74A 5D7LA 5E6IA 4KO5A 2YGQA 5K1NA 1T0MB 3CK0H 4GINA 3K72B 2NNCA 4ZPVB 2AC0A 1X5MA 2YFNA 3DTXA 2FR4A 5CBEA 1ZGLA 3QWQB 1SHMA 4XX1E 2MCG1 2NSQA 2JF1A 3I3DA 1E8YA 3QR1A 5AW6B 3QGVA 2DQGL 3BD3A 3KPSB 4GKNB 3IRCA 5IW6A 4YZFF 4M5ZH 5KSAA 1Z5LA 4MNQA 3BIBX 1F3JA 2R4SL 1PBYA 1ZWIB 1RUKL 1TZGL 2PWEA 3FQXB 5F8QC 5FWQA 3OKEA 3U2SB 2JIXB 5I1CH 4EZMA 1TZGH 1JWUB 2ADJA 1JGEB 2VNCA 5C70A 1C16B 3ILQD 3FRUB 3K2KA 3MNVA 4PY7A 4QXTB 3WLBB 5BVJA 5HSFA 3R4RA 3N04A 3WJJC 4Z5RB 4G6AD 1VA9A 3TBTA 3OZ9L 2FNBA 3EGSB 5LHDA 1KJVA 1RJZB 3BHBB 4GS7B 4WI8A 4QOKD 1DDHB 3V5DB 5KSVA 4MCYA 4OI9A 5I5IA 1ZVSA 4R3SB 3OZ9H 1AGFA 4U7SA 3RNQA 2BSCA 2C3VB 2IPTL 3HZVA 1R4XA 1X4YA 2N1TE 5G2NA 1INQA 4AUUA 3RP1A 4BSWA 3QHZL 3UZQA 1EXHA 1DQML 4LNVA 3H1ZA 2IPTH 2QFRA 4U33A 4XH2B 5JHDB 3OXRA 2IV8A 1J5OL 3PF2A 2E7BA 4MMXB 3JWOC 3QHZH 1DQMH 1EO5A 5DK2B 5C9JA 1EZVX 1KCLA 1DQJA 1EQWA 4J2QA 1NIFA 5C0EB 2AV1B 4QOKA 1J5OH 4QYOA 4NXKA 4JKLA 3E38A 4HD9A 4OCLC 1I8LC 3MLXL 2DH2A 1FNSH 2YD8A 1ZMYA 1D7CA 1QNIA 2KBGA 4B0MM 2E27L 4HPYH 1FG2A 3MNZA 4DVBA 3GSQB 3X3FL 3LEVH 3RTQC 4BKLA 1OY3B 3SQOL 2DJ4A 3AG4B 4TYUA 4QNPF 4AM0Q 4M5YL 4TUUA 5KTEH 2RFXA 3G5XA 4FFWC 4KJWD 2XQYK 5CN2A 3X3FH 3RTQD 4Q0XH 5EFIA 1LO2H 4UDUB 5ADOL 3UZVB 1UZ6E 1KZYA 4FFWD 4PJAA 1XB6A 4QRQB 3I02B 4KK8C 4HX1B 5CWSA 1WC7B 3QCTH 3QH3B 5IMMB 4LIQH 1GPOL 2BIMA 4BRVA 2E5EA 2EC8A 2OX5A 2F7PA 4G43B 4GI8A 4LVHB 1MCJA 1NCHA 2CO3A 3AZUA 3MGAA 4KK8D 1HINH 3ZIMA 3TCXA 4JBSA 1GPOH 5C0AB 3B7SA 4NJ9L 1KPVA 2R4RH 5FS5A 4DGVL 5IHBA 1DVYA 2V2TB 2WXNA 2XZQH 4DQAA 4UINL 3IGAB 3A4EA 2Q9OA 1RPQA 2PNDA 3TASA 4K71C 1G4MA 4DKEH 1FFNA 1K2DB 4APQD 2FQEA 3CVIH 4JHUA 5ESAB 1DQDL 1JNLL 3Q48A 3B7TA 1ET8A 3LRGA 1EUTA 3IMUA 3RZWA 5IV2A 4HJIA 1MN4A 4DOHB 5CINH 1JNLH 3PNRB 3CC5B 1ET7A 5JIHA 2DQCH 3VXNA 4GMTL 1QSEB 4RSVA 4EE2A 5IQMA 3VSVA 1BLIA 5AQ0A 1P7KB 1NBCA 1TKWB 1WQVT 3BKML 4GMTH 2EYRB 2VERN 2XKNA 3BESR 3KPNB 4BFGA 2AJSH 1L6PA 2FAUA 4APQA 2OK0H 1JPEA 3BN9C 1CF1A 4OCYL 3VFNB 3DDGA 1CTOA 4BEIA 4GFTB 5EU6E 3RUGA 3KDMA 1N2RA 1TXKA 5E08L 2VQ1B 1MCDA 2IANE 1D6VL 2AVGA 3LHAA 4KKNA 1FNEB 5F6IC 3GLDA 4UM8B 1XTLA 1N0LA 2P4AB 2X4TB 2XY1A 2X2JA 2R39A 5E08H 3GI9L 1QHPA 2VMFA 3BN3B 5J12C 3S5LA 1UKTA 3ZL4L 5I5MA 5INCB 2XPZA 3FFOA 3QRBA 1PKQB 3GI9H 2FWUA 4R7DA 1UM5L 5C3LD 3ZL4H 4EUPB 5I1AA 3IKCA 1HEZB 4I7ZC 3DGGB 4PLJC 3APCA 1KXQE 2CRZA 4JY4A 3DDFA 2CKBL 1DUYA 4YSOA 1KN2L 4NO3B 4U1HA 2DW5A 3I3EA 1XV8A 4FHBD 3KXFB 1KN2H 4M7JL 1L9TA 2RB8A 3FTGB 5C6TH 4NX0A 3VI3F 1T20B 1P6FA 3ARUA 5JORA 4M7JH 5C0NC 5CFHA 4G83A 3EF4A 1MLBA 2Y2TA 2ADFL 1WA2X 4MX7B 1TTUA 4M8RA 1E5UI 3UJJL 4X9YA 4NQXA 2Y7LA 3U6RB 4JCWA 3T6ZA 1MAML 5DRNA 1KFAL 3UJJH 5IVZB 1N6VA 5I71B 2GFBB 1DZ0A 3N41B 1O7DC 5D2NE 4QAMB 1OL0A 1IC0A 1TCMA 1F8TL 3IJEB 4HQQH 1JERA 1D5XA 4QF1A 1AHMA 3CDGA 4WHYG 4OGZA 3I74A 3BVXA 1CLZH 4Y4FD 1S7RB 2A1WL 2CPUA 1F8TH 4BFRA 2VDMB 2Z4QA 2WNGA 3KWUA 1KCBA 4BFKA 4PJ7E 4PREB 4P57A 2Z31C 3BC9A 4HIJB 4LBEA 5GS1B 2ZG3A 3UCQA 3DHJA 3ZDZE 4N1CA 1Z9MA 3VFVA 2Z31D 4K7PL 1FIGL 4OB5H 1I3RB 3V5HA 3W38A 2MOVA 3QNZB 5FOJA 3RI5K 3T3MF 5DC2A 1PAMA 2LU5A 1INDH 3CVHL 3MV8B 3T0WA 1HE8A 1JK8A 1RZQA 3EG9A 3EJUA 4K7PH 1FIGH 4Y4FA 2E46A 3TBCA 2HRLA 4NC1C 1FJ1A 2QPUA 4Z95L 3NK4A 1TZHA 2XV0A 4PYGA 4K73A 2OR9L 1UD6A 1PLCA 1JPGA 1AOHA 1BECA 3J27A 3T0BA 4BDVA 3EFFB 4Z95H 1KDIA 4DO6A 2FB4H 3UAJD 2OR9H 2IOIA 4QKXB 4NRZB 1M7UA 2Z1PA 3NJKA 5E99L 1J86A 4WDIB 4JFPB 2Z31A 5D2LF 5GSVA 5IQ9A 2P46B 2IGTA 4C8XA 3AUVA 3MLSH 1BG9A 2R7EA 4PJ5E 5E99H 1OGSA 1B9KA 3S5ZA 1DBAH 3CIQA 2I5YL 1A9EA 4GQ9L 1FZKB 1R3JB 1K8DA 4CSSA 3DX4A 3FSOA 3QDME 2I5YH 3IDGA 4GQ9H 4ZX6A 3FCUB 4NPYA 2XN9D 4X9FA 4P2CG 3GMMB 5FDWB 4FP8L 5DD5H 3UAJA 1T22B 3CDYA 3HZKA 1NUNB 3GF8A 5DTFA 3BIKA 3L9RB 3SDDC 2AJXH 2PP7A 1XF5A 1QLEB 4LASL 4O2CB 4XP5L 3EFDL 4M4RB 5IR1A 1CFNA 3MRPA 4L8CA 3GZPA 1P6AB 4LRNL 4WSKA 2VXQL 3WHXB 4F9PC 4XP5H 1F18A 3EFDH 1JYVA 2KH2B 4MDJA 5BOPA 2XVLA 3JWDH 4LRNH 1RMFL 4CNIA 5T3ZE 1ETB1 1FYTE 2VXQH 1DFBH 1OZUA 1J8HB 2ZOWA 3LMJL 1J0YA 4I18B 4Z7VF 4KO6A 1RMFH 1T7XA 4PR5B 4PTUB 5F3HA 1WS7A 2E75C 3DXAD 2I69A 1KTJA 3LMJH 1XH1A 5A43C 4N2DA 3S8FB 3UG3A 1HFUA 4RMWA 4N3TA 4U6XA 3MRHB 4ZFOB 1KCVL 4R97C 2XWEA 4DF9A 3ZPDA 3O3DB 1BP3B 4U6HB 1KTKE 4BFEA 5CIPA 4ZQTA 5DUML 4YDKL 1PS3A 1L6ZA 3FQTA 3N42B 5F88B 5IESH 4HS3B 4FQ1L 5B38A 2PYFA 1ZT4A 3LKPA 4E0RB 2QHRL 5CJBA 5DUMH 2AQTA 2J20A 4X4KA 3T9WA 2X4PA 3MRCA 5JPMC 4KXBA 3ULUC 2P7TB 3QIUC 2FJHA 1UM4H 2OCCB 3CDCA 4FQ1H 5FHAL 1NWOA 1GA2A 2QHRH 4GW5B 2GHWB 1KLUA 4HUKB 4Q4IA 1NEPA 5AOIA 3IN0A 4JZNA 3ULUD 1RZFH 3S88L 4NKIH 5FHAH 4R8WH 3HN3A 4AKOA 3CZSA 4EUPH 1BBDL 4NUJB 5EUOE 2EQDA 5DMIL 3VI4A 3S88H 3LQZA 2VMEA 3U9UB 5JMOC 2EYTA 1M6OA 3ISYA 2WZAA 5JIPA 4KVCH 3HUJB 5CN3A 1RP8A 2AABH 1BBDH 2F8VA 4HHAB 3FU7A 4TVPH 1CBVH 2EH7H 2V9RA 5JXEC 4PRPB 2F5BH 2KT6A 5HVHB 2CJTA 3HG1B 1F41A 5JXED 3IGFA 3S3CB 3EDJA 4NNPH 1HWHB 1M05B 1MW2A 1JPTL 1G9NH 3D48R 4GBXD 3RZCC 5JPNB 2E86A 4EI5A 2VXSH 1MFVA 1E8XA 1JPTH 4GG6B 4M7KL 2A6IB 4YPGA 1LO4L 3V4PA 4KXCA 1S7SB 1FVCB 2V33A 3D3VE 4RMTA 1JHTB 4XGZB 1Z0NA 3PHAA 1LO4H 5LCVA 5BOJA 1YPZE 5JXEA 3EJYC 3WEXB 4XI5C 3P3YA 5DK0B 4GBXA 5C0BB 3QVAA 4FMKA 1TJGH 5DD0H 1U8MA 1D5MB 2GJ6D 3EJYD 4ZUSB 2VDMH 4JDEB 4XI5D 4JRXE 1GCYA 4ZDHB 3X2QB 4RVBA 1I1YB 4ONOA 4KXZH 1SXBA 4BFIB 1Q72H 2X4OB 4JDZB 4UMGA 2JKSA 4J3OF 1NC4D 2G5BB 5A2BA 3QYMA 4AW7A 1YN7B 1MQKH 5GJSL 4Z8FL 2V2XB 4GIPD 3ZT5A 4F7MA 1BCIA 3QG7L 4KXAA 2ZYHA 3KYKH 4G2AA 4AXWB 1A1MB 2J7LA 3MVSA 1GW0A 2BNUA 3L5XL 4ZMWA 2VLRE 3RWHB 2GJ6A 3QG7H 4EXKA 1RI8A 1E6OL 1FNAA 3GEFA 1ETJA 3DYOA 1O9ZA 5JDSB 3S5YA 3MACH 1HESA 2HKHH 2ICCA 4WO0A 1G7QA 2ZWSA 5K93A 4B96A 2E59A 2GJZA 3U36B 4E41E 1NC4A 2OPCA 4CW1A 3FCTB 2ZF8A 1UUSA 4LSQH 3I9IA 5EO1B 3U1SH 2CAKA 3FUIA 5K9JH 2AQRA 2R1WA 4LF3B 2F6AA 1SN0A 3ZMRA 4NGHH 4BYHA 1GH7A 1IEAB 2WBXA 4MJIB 3NZSA 4Q9QL 4K3DL 4LU5H 5FF6A 5GHWL 3CBJB 1A7OL 4U3XA 2CO6A 1CD0A 1E4WH 2WLHA 3I2CH 3HC0B 2BVQA 3P11L 2JKWA 3S34H 3U0TB 1ICTA 1NAMB 1QLEL 5GHWH 4LL9A 2R0KL 1QZNA 1YNKL 5F9OL 3CQFA 2HLFD 4LNRB 4ADIA 4HBQA 3VGDA 2Q2EB 4GW1A 3W9EA 2XG5A 3VYPA 3W57A 3RU8H 3JWNG 1HVXA 5B21A 1QLEH 4NQDB 2R0KH 2UX7A 3PJSA 5I1JL 2GBTA 1I1CA 3VD3A 2EDMA 1B88A 1FP5A 5DXWA 3LIZA 1F86A 32C2B 1SBSL 5IUSA 5ISZB 2FX9H 4NKOA 4XOCA 5I1JH 2XICA 2IPUG 4KK6C 1ACXA 2DLEA 3BI9X 3CBRA 2FEEL 4N0UE 1SBSH 2VJ8A 4M00A 1P6WA 4AJ0A 2MQ3A 4WFGE 4U7KA 2ICES 2YPVA 5IGXH 3HI1A 2BERA 4F7CB 2F19L 2HJKB 4KMTH 4RWHA 3CWGA 3UTQB 4MYPA 1A6WL 5JQ6H 5LNGA 5F21B 5IWLC 5IBUG 4XN1A 2F19H 3AXLB 2QGEA 4YDLC 4RZCB 4UTBH 1TQSA 3AU1B 4JDTL 4QHKI 3VXSE 5HYJB 4AIZB 3GMOB 2QQQA 2VIRA 3TZVC 1U36A 3E7JA 4HIIA 3MR9A 1NC2D 3D4CA 4MA1B 3ARBB 1U0QA 4OF0A 3OD3A 3FF7A 5DJCA 1JZ4A 1NTDA 4PEEA 3LKRA 3FHQA 4PWJA 3VFMB 2J6EL 4N2AA 3WJMB 4XN9A 5GGQL 1H0DB 3IE4A 2DDQL 5EIIB 4IRJB 1LDPL 1IAKB 4AYMC 2ZP8A 4Z77A 2J6EH 5BUPA 3SD2A 3D34A 2NW2B 5ACLA 3IU3A 4M61B 1DJZA 5L6YL 4YXHL 2DDQH 3II1A 1RZ8A 3QJFA 1VFUA 3WN5B 2CIKB 2J88L 2ZCZA 2X1OA 5L6YH 4OCSL 1NC2A 2WSKA 4QRSB 1XT5A 2Y5EA 2FYYA 4XNBA 2NW3B 5GS0L 2VOTA 2J88H 4XXCC 5ADPL 2J1XA 5C6PB 1BIIA 1EO8L 5BS0B 2IQ9L 5EU4B 1PSKH 3C5XA 2FWOB 3FB5A 5GGUA 3G6DH 2O61B 2Z6FA 1SMOA 4LPWA 5ADPH 2WTRB 4Y16B 4YE0A 3GXPA 1EO8H 3LN4B 5HI3D 3DYMA 2CUMA 3KBHE 5FFOA 1UGNA 4J4PC 4I77H 3RY6C 1U8IB 5DRZB 2FX8H 3VGEA 3BUBA 1JNHA 1SN5A 2VZVA 3FT2B 3HJEA 5I73B 3QNFA 3UC0H 4HJUA 3VFRA 1KYDA 5LBSL 4J4PD 1WBXA 1R33A 3DK2A 4JKPH 4HCIA 1XCQB 1NBYB 1CXLA 3AY4C 2IG2L 3G5ZA 4BQ6A 3CFJB 2PR4L 2Z93B 2AEIT 4YHNA 3DPBB 1JAEA 1V27A 3B7YA 4P9HL 2IH3A 2FSEA 2IG2H 3RVVC 2A6DA 2EIDA 4NENA 5C0FB 3AS3A 2AQSA 3H7BB 1AXTL 3LXBA 3JVFC 1NBZA 3CFCL 4N2KA 1ZLUK 2P49B 3RVVD 1JFHA 3VUAA 3K0WA 5E9DB 1KENH 1ND0A 1AXTH 4J12A 1KB5A 4OZGE 5IIEB 4JJOA 3RFZA 2DYRB 5EU6D 1P1VA 2XG4B 4R84A 3CFCH 4J4PA 1C12B 5KYXB 2PPCA 2Q7YB 1ZLEA 2IAND 3DECA 2EXSA 4YDJA 4LOFA 5AW1B 3VG0L 3P9MA 5E1IA 2X6UA 3EH3B 1J1OL 1REIA 1NLDL 3TPKA 3RX8A 4KUCD 3TA3B 3PIQB 1B3IA 4GYBA 4XPGL 1OD7A 1J5DA 1WE5A 3QHTC 1Y0LB 3ZR6A 4AYFB 2B1AH 1J1OH 1HL4A 4QRUA 1NLDH 5J6HB 1PCSA 3MLWH 2G9HA 4W6WB 4IIQC 5DF0A 9PCYA 1OOAA 3CV5A 1S8DA 1AR2A 3HAEG 2DPKA 1T0NA 4RFEA 5EU6A 4E9QA 1YRKA 1EERB 4JN2B 1NPJA 3D39B 4YNYA 2IANA 3COOA 1A6AB 1FNLA 5FYLL 3IMRA 5AL8A 4NP9A 2LOEA 2ENJA 3WNIA 2P52A 4Y4KB 5K9OA 2C9SA 4MXWL 3DX9A 4MASA 1UA7A 1QNZL 3GHEL 1ETZA 2CR3A 4PLNC 4ZFGH 3SOBL 1AFVL 3BZ4B 5J11C 4IOIA 2E74C 5L8LB 4PHXA 3QFDA 3C6LC 3FZUC 1BREA 1G7LA 3H85A 4F37F 4IBTA 3ROLB 3SOBH 1XIWB 1EZUA 1AFVH 1IILE 2HN7A 2DQIL 1D7BA 3ZKSD 4BK5C 1DN0A 5HYSB 2RQEA 1GAFL 1KXQA 1F90H 4BKTC 4NYLA 4QI3A 3GMPA 5GJTH 3X1EA 3V6ZB 1JZ7A 5IB5B 4YHIB 5FAAA 4A2MA 1NAMH 1OEZW 4C57C 4LCYB 4ANUA 4LPTA 2NUPA 2DQDH 3NCJH 4MVBC 5IM7A 1OSZB 1R3LA 3KVPA 4N20A 3I84A 1G6RL 2FX7L 1V54B 3BP4B 5C97A 3NJFA 1J5CA 5I71C 4NQSB 4C55A 2CIIA 1ZVNA 2HFEB 1A9VA 1LO3H 2WBJB 3IDXH 1CXIA 1IC5L 5I75C 1A3ZA 1H5BB 2R2BB 3DVNA 4HVBA 2W8CA 1YVLA 2XN1A 2E8YA 5LAXB 1I4FA 3B37A 3OAZK 4BK5A 1IC5H 2GSGA 2EXTA 5IKCA 3RGVD 4P3DA 2EDHA 3F00A 1GZPA 5D2NA 2OZ4H 3GXNA 1HU8A 4K3JL 1UXLA 3P1VA 5J13C 3VGAB 4C4KO 2NY6C 1ILUA 5IHHA 1J7VR 4WSGA 4QT5B 1SJXA 5I8EB 4DP0X 1IEHA 1PY4A 3D2UD 3TT3L 4YHZL 4N8VA 1DN2A 1KLGA 1TQWA 4PJ7A 3H0TA 4X6CB 1PYWA 2GSIA 5AYQA 2E0PA 2A73A 4HA1A 4YHZH 2EJ1A 3R4DA 4Y1SA 3DHPA 3RGVA 1EEZB 5T8IA 5LB1A 3ROOA 2P44B 1UJ3B 3CMOL 3D4GA 1IAIM 1KBVA 5K9QG 4PJ5D 5AOKA 4X8GA 3A5VA 5FYJU 4BH8A 1PLBA 3NIDF 5AVQB 3ZE0F 4Z7AA 4HWBL 1SYVB 2X3BA 3D18B 3D2UA 4M5SA 4JFHE 3WFEH 2XACC 3PFUA 4HWBH 1E5CA 5D5ME 2WOYA 3SE9L 2OLDA 4FEMA 2WC7A 3SO3C 4HPHA 2XKSA 3LEXA 2ILLA 4NO0B 1DLFL 4OCNC 1S7XA 3FQWB 5J1TC 3CSYA 3OV6A 3SE9H 5HI5C 1UWXH 5F0JB 1XSKA 2OMWA 4HJ0C 2Z65C 4NKDB 1CFTB 4PJ5A 4A2FA 1YO4A 3G5YB 1MJJB 3L9EA 1BJ1H 1D9KA 1SJVA 2AGJL 3MROA 3SGDI 1YYCA 2QBWA 2VM3A 4ZG1A 3QDMA 1NDMA 2GQHA 1SHXA 5B3NA 5T3ZD 1FYTD 4AT6B 4CC4C 2AGJH 3VX1A 4MJJA 4OQTL 4DFIA 3WFCH 1RD6A 2XOTA 3SEPA 3IFPA 5E2TL 4G7QB 1O7SA 3CSBA 4PJGE 3V0WL 1X7QA 5DSCB 3K4ZA 4XNQA 5FFGA 5DZLA 5FGCE 5E2TH 3SQBA 4ONHB 1J18A 1KIUA 3G3LA 4FQCL 3V0WH 2VL5B 4OJAA 3KWWB 3CZEA 1TQBB 3F7PC 5DQ9B 4HGKC 2J12B 4XCEB 2F1BA 3RVWC 2WQAA 3TBYB 3U25A 3WUWG 3RILA 4CMHC 1B0GB 1LHZA 3U7YL 2A77L 1FYTA 3OSVA 5B4MD 2VAAA 3RVWD 3IU4L 2A83A 2I07A 3FPXA 2ZSWB 4JRYB 3QDGE 3MBWB 4GRMA 1ANUA 2JK5A 2R23A 1A4KB 4Z76A 1FL6A 2AQ3A 3D69B 2BOBA 3QO1B 3T4AB 3H3BC 1TVDA 1ZDSA 3Q1SL 3QFGA 2WLNA 4FE9A 5C0GA 4WI7A 2J8HA 4M8QA 3I6GB 5I1DA 4AL8L 3V6FA 3GK8L 5CCGE 5KAQF 4U05A 2FT8A 1N12A 2XI9A 3Q1SH 1R19A 4YSRA 3VH8A 1ML0A 1SYSB 4LVEA 2K3HA 4PJCB 3CPLA 1KB3A 5D2LB 4AL8H 4G1MB 3GK8H 3X14A 1T5XA 2H3XC 1IGTA 4NAMA 4B41A 3TF7C 4AE0A 3RPIA 3S35X 4Z23A 3QIWC 1QR1A 1M1SA 1AMYA 2FJGB 4FDWA 4DZBB 3EXLA 1ILSA 5EUOA 3O2WH 4PJ9D 5I74C 4UQIM 5DMJB 1XGQA 5I9QC 3EJTA 3QIWD 1JTTA 3D3VD 3IXAB 3TPUA 5E8OB 3D08A 3I9GH 3V4VL 2H1PL 4HWZB 3IYLW 4J6RH 4QXUH 2GITA 1M2OA 2OMTB 1SLUA 5CU9A 4AYEC 4HCRH 2A6JB 2RACA 3DMMB 1IQDB 5I1IH 1ACZA 2A9CA 2DY2A 3OAYH 1TNNA 3ARDB 2EABA 4UZSA 4GAJH 4OD1L 4KDWA 4JRXD 4KC3B 5DJ2B 4Z3GA 4PJ9A 5D93B 4ODSL 5JIDA 3QIWA 1OPGL 4RAUB 3IXTA 1CTMA 1MRCL 1URIA 2V3EA 3D3VA 3MLZH 3ZDXE 1I9IL 5FYLE 1XH0A 1M7DA 2KC0A 4Z0XA 4ODSH 3V55A 4MKMA 4UYQA 4QHMA 2Y07L 4PGCA 1PQZB 3IFLH 1YPZA 4UDTA 2OTWA 1RHFA 5E1GA 4CVXB 4NM4L 1MW3A 5BXFA 2D3JA 2ZYSA 3MRDB 5DS2A 5GS2D 2Y07H 1H3PH 3QHFL 3WDJA 5L7XL 2G60H 3KYOA 3MUZ1 4X42A 2CO2A 2VLRD 4YFLI 3FJTA 4KZDL 4PIRF 2OSXA 4H20H 1ZHLA 4WEEA 4Y88A 3VFPB 4JRXA 1MIEL 3QHFH 3STZB 4F15B 3AREB 5L7XH 1XGTA 2AJVL 4HIEB 2CKBA 1A5FL 4L5FH 4E41D 1MIEH 3HR5B 1ORSA 5TH2A 3MRGA 1E5ZA 2W1NA 1DVFC 2AJVH 2YEZB 3ILPB 3TEUA 1A5FH 3M7OA 1EHKB 4CMMA 5HDLA 4S0SD 4DGYL 2O6PA 1DVFD 5HGHA 4MS8C 3BMWA 4OJEH 2DQHH 1RZKH 2Q8BL 2VLRA 4KRPD 3ZTNL 3KGRA 3N0AA 4W6XB 1A4JB 3PAYA 4MMXC 5E0QA 2Q8BH 3S3BB 5BPPA 1AS7A 4H8WL 3QQ3B 3DO4A 3AAZB 4E41A 4PJXE 3MRKA 3O8XB 1TMCB 3MV9B 3LKQB 5AW0B 3DVGA 3QJUB 3HE7C 1FFQA 1O9VA 5IVXE 4IHBA 4JFQA 5E8DL 5KN5B 1JF6A 1IX2A 3UFIA 1TTCA 3QUKA 1DVFA 3KBFA 3D09A 4HGMA 1O6SB 2YSSA 4HC1H 3F6JA 3HE7D 3P54A 3M8OH 2AXGA 5HHXH 1U8PA 4U6YA 1X5XA 1XAUA 4MA7L 3V4LA 4BZ2A 3PV6B 3P77B 5F71A 4ADJA 2B39A 2AEOA 4WFGD 4ODTL 2PCFA 3UL4A 1VCBC 4MA7H 3LH8A 3HMXH 4Y9CA 4NHUA 3W81A 4NRXB 2AKRB 4QRBA 3OC8A 4F8PA 3NCBB 4LVHC 2X1XR 3MGTA 1DUZB 4MQ7A 1CZ8L 2WQRA 4DGWC 5HDWA 3R19A 3CVHA 1CDBA 2DWTA 4MB1A 1CTNA 2VC2L 3VXSD 1NFDF 1R5WB 4A7TA 3IMWA 3HE7A 2P24B 1WFMA 1CZ8H 3MXWL 3L5WB 3QJSB 5EBLB 3ZRCC 2B8OT 3Q1EA 3F6IA 5T5NF 4N0UA 4R6UA 1PZ2A 1YNTB 4B9FA 3MXWH 4KI1A 2YD5A 3FUHA 1SMAA 3GSRA 1W0VB 3N2JA 1YQVL 3LKSA 3O2DL 1KNOB 1MFBH 2VZOA 3RIFF 2GCYB 4YZFE 3B3BA 4HFUL 1YQVH 2YLHA 1NFIB 4ZMLA 4LHUG 3VXSA 2NY1B 2ED7A 3D0LB 2XCMC 4HFUH 4WUKL 4KFMA 2UY6A 3MRFB 5H37H 1XZ0B 2WO3B 1CI3M 4WUKH 4L1LA 4HW6A 3TJEL 3GJFB 4LCWD 4MDIA 1NCOA 1YN6B 2VKXA 4URTB 5CR1A 5BRZE 3GMRA 3ZHNA 5F93C 3UACA 3TJEH 3Q8AA 4XTRD 1FVDB 5CEXA 1NIBA 4H8PA 1CFQB 1UACL 2FBOJ 1CK0L 1KCSH 1WWAX 3ME0B 4FZEL 3F65A 3LDBC 4YHPA 3BP7B 1S3RA 4GOSA 4TNGA 3IPBA 1D6EA 3BGFC 4E9WA 1K5NA 5EBMA 1OCWL 4HH9A 1UACH 2BP8A 4QHNA 4FZEH 4PJBB 4JFDB 5F1IB 3X11A 2ITCA 1KBGL 3D4ZA 1TEFA 1MJ7H 2MNUA 2X10A 3GJEB 1OCWH 4WI4A 5DRWB 5HJDA 4MXQC 1P7QD 3IJHA 2GEEA 4G7YL 4LCWA 3U4EB 4IEFA 1OPOA 4AENB 5J1AA 43CAB 2A0LD 4Z0BL 2BY2A 4G7YH 3UJIH 1HL9A 4BGLA 4JFYB 2OTPA 2EEFA 2UWEF 4FKHA 5CHNB 4Z0BH 4TVSa 1GGIH 4XAWL 3E6FB 3LZPA 3C6SB 2IAMD 3BWUC 3JQOB 4E9VA 4YJZL 2ZOOA 4Z7UF 2JTYA 5ID0A 2NLJA 2BX5A 1TZOA 4UQEA 3WELA 3ZUCA 4LLMB 4XAWH 4YZWA 5LGKA 2BFVH 4W9KC 2ZE0A 1CFVL 3ISWA 3MXVL 1P7QA 2AFNA 2X2UA 1JZDC 3B2PA 4KQ0A 1UQSB 1UXWB 1CFVH 4FXKB 5DD1H 4H1LA 2Z92B 4NBZB 3FF8A 3VGFA 4ALAL 3S9DB 3LKNA 3US0A 3NESA 1SLXA 3V0EA 5I76B 1JWMB 2AQ1A 3OR6B 4NQEE 2H2PD 1XGRB 1JNNH 1TDQA 1MNUH 2DWEB 4PGDA 2ERJB 5FYKU 4OZGA 3LN5A 2G2RB 5DA4A 4GAGL 5HYQB 4OZHF 2IAMA 4S2SA 4PRBB 3FQUB 5CLZA 3LY6A 5E7BA 1E6JL 1WAEA 3X1BA 1SJEA 2FEEI 4P4KB 2EDQA 2HWZL 4GAGH 4U1GB 2DIEA 4XVTH 3ZX1A 3HBZA 5KYWB 1N70A 4WHDA 4AQ1C 2HWZH 5EO0B 2ZAIA 3IJ9A 5SX5K 5FM4A 3PWPB 1N5AA 1QUPA 1DVXA 1EHAA 1MW0A 1XVSA 2CK0H 3W11D 4ZFZB 5J06A 3DO7B 2OL3L 2I24N 5E8EA 1QQDA 4WFEE 3G9AB 2NZ1A 3HOGA 4XNAA 3U0PA 2E9IA 2Y6SC 1MEXH 1ZK5A 4JFOA 1HH9A 3DV4A 2F68X 4XT1C 5EC2A 1G7HB 4CVZA 4EEEA 3J7HA 4Y2NA 1K72A 3C5ZC 3E8UH 4QRRE 4N90D 2Y6SD 1RLBA 3V0IA 1I9EA 1BBJA 3B1UA 5INDA 4FFZH 1G87A 2VLJB 2DKMA 1CGTA 4PP2B 4EIZC 2D4FA 3C5ZD 3MLYL 5I6NA 1KTDA 4Z3TA 4JFFE 3QEUB 3RWDA 2EVFA 3T1WA 4XZ4A 4NWUH 2BWIA 1DZBA 2A9AA 2H0FA 1EXGA 5HJ3B 3TM6A 1NH6A 4U1LB 1VIWA 1OF2B 4ZS7L 4WV1C 4B9YA 3ABGA 4X0KB 5HJGA 4APXB 1FH2A 3F04A 5I17B 5CSGA 1L7TL 2ODHA 4OLVL 3Q13A 4CN4A 4LGSB 5EUKA 4LKCA 2ROXA 3RIFK 4FD0A 4TLUA 4R9HA 3APMA 3CHOA 1L7TH 2IOMA 3C5ZA 3OSKA 5T3XL 2R0WH 5GRYA 1FORH 3QZWG 4MHHG 4H88L 4ISVB 1ECYA 3TNNA 1AXSA 1VFAA 3F7YB 1MI5B 4QWWC 2GK2A 1TYJA 4X7FC 2E7MA 5IB1A 2X6MA 5C8JA 1U93B 1G9ML 3ML9A 3MOAL 5EN2A 5LUMA 4QWWD 4Q7DA 3NOIA 5HJBA 1WTGT 3BDXA 4CGUB 2O4EA 4ICXA 1XF4B 1G9MH 3OMNB 3LQAL 4J3OH 2P8MB 1DP0A 4WV1A 5D8JL 1Q9LA 3VI3E 1HZKA 2QVKA 3QNXB 2QMJA 3ULAB 4UWQB 3Q43A 5D8JH 3N55A 5CEZL 2Z8WC 4PWIA 2OSYA 1OCRB 4Y5VB 2OR7A 2B9AA 1XEDA 3AT0A 3TO2A 4XMWA 2B0SL 3IDJB 2OYPA 1D7DA 3BQUC 4AI7A 1BGXH 5DUBA 1MRDL 4KKQA 3GJFH 4ZSOE 4UQ3B 1QFWM 3BQUD 1L9RA 4MD4A 3S3DB 2JJSA 3RQ3A 1JN6B 1FYHB 1RULH 2AITA 3HC2A 1MCWM 3E80A 4BZYA 1QLFA 3VM5A 4TUJA 2DI8A 1QSFB 4O2EB 3HG2A 1JWSA 3CX2A 4JL2A 4LVOB 2F8OA 2O6DA 2FBRA 4P46B 4L29A 5D5MA 3QUMB 3F7VB 3GSVA 1NCIA 4EOWL 3H9SB 4NO5B 5IB2B 5HVGB 3HZMB 3L9BA 5KZCB 1SEQL 1FAIH 3MLPA 3T3ME 4KJQD 1MCBA 1U58A 3BQUA 3L1OL 1EGJA 4N2GA 4YSUA 2XV2A 4ORGA 4Z7WB 1L9NA 2FSDA 3HPLA 1R0AL 3IWVA 2CBOA 5JZ7C 2VWEC 4TKWA 3BH4A 3FT0A 4J3SA 1NCWL 1KV7A 3RWJB 3L1OH 2QVIA 4JDVA 5DJDA 3QC5X 5GS0C 5I8CB 5JZ7D 3JTSB 2BSTB 1IBDA 5HVHC 1C5CL 3E9UA 3SO5A 2XKUA 3O3EB 3HHMA 5A16B 4XPTL 1NCDH 5GS0D 2VISA 1XD1A 3KYNB 1YEGL 1C5CH 5EIVA 6PCYA 5FYJH 3GRWA 3VSQA 3IGLA 1XR9A 4XPTH 2F7IA 4PJGA 2ARJA 4S0HA 5GQBA 1KELL 3I6SA 4DZ8A 1ULVA 1YEGH 4YBLB 4XB7A 2NRDA 4GQRA 5HDQH 2CG9X 2QR0B 1SPDA 1HL8A 4MJ6B 3QCUH 1N19A 2F0CA 4YN3A 2KZKA 1ZLWH 1G84A 5D9SA 5IW3A 2PTTA 4LOEA 2EKJA 3UYOD 1IARB 2IWEA 2Q86A 5KYUA 3NPSB 3TBWA 6PAZA 5JO5A 5IQ7L 3KR3L 4KJYB 4P9HC 1HH6A 3J07A 5DMKB 1L0QA 5CFAA 1U91A 5BUGA 4QY8A 1PX8A 1MKFA 4UIMA 2DMKA 3QDGA 5E4OA 1RJYA 2P26A 2CJUL 4YXKH 2EDBA 5LN4A 2ZXDA 2ZOLA 4JM2F 3EOYG 3ARQA 1LNUB 3NIDB 4KU1A 1F11A 4X7CC 1CG9B 1W9XA 4UOW1 1HS6A 4H40A 5FHBL 2XYCA 1G5GA 5DC0A 5LBSA 1UH3A 3IDMA 5F0LB 4XVUC 4Z7VE 1EEUA 5T1MB 3DNKA 4I3RL 3AVEA 1J9CT 2ZXEB 3TCTA 2HRHA 1I9JL 4QHPA 3FHEA 1YEFL 1QPPA 1Z9SA 4K8RL 3VRIA 4KVNH 1PDKA 3GUTA 5ELIA 1D7FA 1DQVA 3QI9B 4HKJA 5E2JA 4AK2A 4AIXA 3HC4H 5D7JB 4G42A 1Q9WA 2ZKHH 3H2QA 4OCXH 3TXAA 3AXIA 3WNPA 5DJZB 3BRGC 3KS0H 5T1LD 4HUVA 3PJNA 1KIQB 2Y5TA 3AWEA 5FYLD 3WNMA 4A2HA 1ADQL 1DSYA 4WHYH 3CPUA 4WO4B 4FG4A 4NAJA 2F08A 4XP6H 3BKJH 3S7GA 1EZSA 4R26L 4XNXH 1D2OA 2EDEA 5BO0D 1ADQH 3UBGA 3SJVB 5K1VA 3RJDA 2N4IA 5D7SL 1HILB 4HUUB 1OGTA 4N0FA 3CU7A 3PABA 4KKLD 1BPLB 4WTXA 4X50A 4ENZA 5CD3A 1GTNA 4Q2ZB 4YPJA 1H19A 2OI9B 2BSRB 4RIRA 5T1LA 4N8CH 3FOLB 5IG7A 3EO1A 3N40F 4L9DA 5DQDL 3BVNB 3KPLB 4TQHA 4XP9L 2AQQA 5FF6B 1QW8A 5E0FA 1N8OE 3S5LG 3BO8B 1MQ8A 1S7WB 4HISA 5B1JC 1TPXC 2O5XH 3DUUA 4P2QE 4J3VA 4XP9H 1JF5A 4MCZB 2AK1L 4XVSL 3KHOA 1C08B 2Q76A 3N1QC 1I9RH 2R2EA 4P5TC 2CO7B 1BZQK 2JI2A 2V7NA 2MTAA 4OCWL 1HCZA 4XVSH 4Q52A 2D7MA 1T1XA 2JKIS 3SPVA 2RBLA 5I2IA 3TEZA 3N1PC 1X5FA 4AVHA 4P5TD 1AQKL 3PPSA 1RPKA 4ODHH 1F6FB 1KIRA 3C6EA 1PJWA 2OKMA 2A9ML 2XQYA 3H3KA 3MV7B 5H2BB 2GW5A 3LH9A 4GT0A 3FQ1A 7FABL 5ITBL 5ANME 3ARBC 5I6LA 3FTXA 1OW0C 3ES6B 5T3XE 5IB4B 4HAKA 3AB0B 5EU5B 2FLMA 4QO1B 1G6RA 3NCMA 1YUHB 1EDHA 1FLTX 4IRJC 3QUML 4UILH 1JDCA 5DLML 3AS1A 3MCYA 5D1QB 4P5TA 2JFCA 2FIRT 3ZJAA 3QUMH 1THAA 2Z7ZA 3CN1A 3WN5C 2PCXA 1FH5H 1Y6MR 4PJXA 1UT2A 4GKSA 1W8NA 5EZPA 2XTJB 1TG8A 2I60L 2WXJA 3EYOA 2IO5A 4DCQB 5IVXA 2Z0BA 1YYML 4G9FE 4K94L 3QR0A 3NA4A 4P23D 3CHSA 1GIGH 1YYMH 1MHEA 4UT6L 4K94H 4TXVB 4U1NB 4Y16C 3B8YA 1GC1H 4HJGB 3QUYC 4JG0H 5D1ZB 1ORQB 5IBUB 3GSWB 3TVMB 3B7UX 3PL6D 4ZO9A 1Q9KA 1HHGB 3VRLE 4A67A 2I9TA 4KK9C 1ZEAH 2D31B 2BS9A 3O9WC 3DYPA 1PFCA 3OWRA 3PV7A 3QUYD 2XETA 3EOTL 3I6KB 5I73C 1A1NA 4U1KB 4RA0C 1SY6A 1T1WB 4X0NA 2YMOA 4KK9D 1CBJA 3O9WD 3TH4T 3EOTH 2ZUWA 3QJVB 4OF6A 3QR2A 3H7LA 2XPGB 2K70A 4P23A 2CLVB 3AS2A 5F1NB 4V2CB 1QFHA 1S7UB 3QUXB 4HOXA 4DN4L 1AGBA 3BRDA 3NN8B 3TBVA 2GTWA 1ZPLA 1TJIH 4X8JB 2Q2LA 4X5LA 3O3AB 3D0AA 4DN4H 4PVMA 3PL6A 2EACA 2H0JA 1T80A 5AVVB 1JF1A 3QUYA 2G5RA 2YZ8A 5BRZD 1NGXB 4ZODA 4NUPA 3FTSA 3GM0A 4K5LA 2VZTA 3FFDA 1MUJB 3O9WA 3RL2A 3ATAA 2EDLA 3QUZB 4LHJB 1S7VA 4BINA 4CA4A 2PW1B 3EYFB 3TA3C 4Z6AT 3OKLA 2UV3A 3P9LA 4AVIA 2KL6A 2ZKWA 3MOBH 5I15H 5F7DA 4Y1AB 1FO0L 1U8NB 1BOGA 4A2DA 3L1FA 4HDIA 4N86A 1FBIH 4OQTA 1WP6A 2DEXX 2KPWA 1MSPA 4NOFA 5BRZA 1MELA 5IK3A 5DVOA 1OTSD 3D0VB 2ZUTA 1QRNE 1TJXA 2KZ1B 2ZZUT 3VFWB 1R3KA 4HGWB 3JZ7A 4QHUB 4Y4KC 5F7WC 5I0XA 5HDRA 1A6VH 4AL8C 3B5HA 3FFCE 2YUXA 1BFSA 2G75A 2GIXA 3IETA 3TO4B 1F58L 5BVPL 1PAZA 5KVEL 4DEPB 3DJ9A 2MCMA 5LDUA 4X7TB 4Q6IB 2EYSB 4WHCA 3A23A 4LLVA 2C3GA 2P8PB 3AM8A 3NIFF 5BVPH 3QWOA 1F58H 1XTMA 1E9OA 2XWCA 4N6RA 3TFKC 4IBQA 4LIQE 3SYAA 5ABZA 5C0JB 1XIWC 5CJOL 1OLLA 4JRWA 4G6KH 2CO1A 1ZJBA 3ABKB 5E5MB 3TFKD 3WIHL 2PF6A 4PMEA 3VD0A 1GGYA 3SB3A 4RMSA 4NQED 3PGDA 4W4NA 3KPPA 4XMPH 5FECB 5JLZA 4FMVA 3MX0A 3VFUA 2H26B 1AG6A 5B38G 2WNXA 4A39A 4XMLL 1MWAB 5I19L 5A7EA 3A6OA 3EO9L 1JZJA 1HWWA 4JMXA 5CMAA 2PYEE 3LEYL 4L4VB 4C56B 4LVNB 3D25A 4XMLH 3TV3L 5BMFL 3WKNA 3HAEB 3VD5A 1FFOB 4KK5C 2YK1H 3GXUB 4HIXL 5AKRA 3P0YL 5FCUL 1YECL 3VJ6A 4NQEA 5IT2H 1C5DA 4Z7NB 3FT3A 4KK5D 4HIXH 4PS7A 4WFED 4EN3D 4I88A 3M1BB 5AOZA 3VGAC 4FQQB 4ZAKB 1R5IA 4KRNA 3ZBMA 4M4PA 1Q9OB 1DBKH 2OJ1A 1UA6H 3HG5A 3HCVB 4QRRD 1JI1A 4GIAA 5TF1H 3SHSA 4LK4A 4FI6A 1ZE3C 4FQXB 1F1AA 3V4VA 3EYUH 1KJ2B 4TSAL 1CL7I 1FI8C 3PWLA 3ATFA 4XRCB 2UXGA 2XRAL 4JFFD 3LRHA 4Y89A 3BWSA 4TSAH 2FGWL 3RDTD 4P4RB 4RRPA 3ZE1B 4YDIL 1OGPA 4C4BA 2XRAH 1NIAA 4K7FA 5DWUL 4EN3A 3IFNH 7CGTA 2C34A 4JFSA 5FO9B 1B4RA 1UJ3C 2FGWH 4EDWL 5FUOL 5I66B 5K9KB 3W37A 1N7ML 4K3HA 2QHLA 3AWGA 2BHUA 3EGXA 4JJHA 3IMSA 4OF8A 5DWUH 4Z7QF 4QRRA 3FKUS 3HFML 4M62H 3QEHB 3MBEB 2N7AA 4BUHA 3V0AC 4OIIL 1UWEL 5AEAA 5FYKH 3CSTA 1E65A 1NGYA 4OM0H 3HFMH 4HAFA 3VXQB 4JFFA 3BUQA 3EYSL 2CSPA 4ZW5A 2UWEB 2NYKA 4LEOB 3RDTA 4PGJA 3VXUE 2BOLA 4OBSA 2VDOB 5FA4A 5I26A 1Q94A 4CKVX 5K69A 1H8SA 1QO3B 3EYSH 4H8WC 4HEME 3SCMB 3FH8A 3O6MH 1NEZG 5TDNA 4ZYKA 1L9QA 1I1AD 4N28A 4XC1L 3WTTA 1MHCA 2MFNA 1JP5A 5EF1A 1U8LB 1PVHA 2AXFA 2HYMA 4FJYA 4KVPA 2R69A 5TFSH 1JGUH 4K2UL 3LZFH 5CJ8A 2A4EA 3WIFB 1LO0L 2C1OB 3FTVA 1TZ8A 4GB9A 3GNMH 5G4NA 4BSVA 1H8NA 3FTWA 4AQEA 1LO0H 2CCLA 1FCGA 2ZOKA 2ZX8A 3MRBB 4OJYA 3V52L 2ZYRA 3FQRB 4LLAA 3TIDA 2F1EA 2IH1B 3BZFB 4D0BA 1I1AA 4PJFB 3A22A 1X9UA 1Y18B 4TNVF 4XODA 1JV5A 4PJAF 1FA4A 3H2WA 1T89A 5TQ0L 5IP4A 3EXJA 3Q05A 2YJQA 4EI6B 3W9DA 3VI3A 4XXWC 2EXWC 2AEQL 2BW5A 1U3HD 3KL3A 3JUZA 3E2HC 1DBJL 3EDDA 2Z7UA 4PBXA 5EDXA 2NY5L 1EHLL 1W0WA 4N9GB 2EC9T 3U46A 4PY8J 1DBJH 2Y3AA 3R8QA 5F1SA 2RCSL 3QG6B 4X4YB 5AALA 3V7AE 4R83A 4CRPA 4CU7A 4ZSOA 4XX1G 3T2OA 4JO1L 5ICYB 1JGVL 3QAZB 1USQA 1U3HA 3EFOB 4KGLA 4W4OA 2B2XL 1MCIA 5BJTB 2NZ9C 1V8HA 3UPRA 1XDTT 1M3JA 4JO2L 4X83A 4JO1H 4XXWA 1OAKL 4DQOL 3ZHKA 1VENA 2X7LA 2B2XH 2WXRA 1UT9A 1F13A 1XX9C 3FB8A 4KKAC 5IJCC 3WBDA 1GJUA 3O4LE 5FKPA 2VKWA 4JY6B 1ZLDA 3C5JB 1MPAH 5F44A 1KTLA 2N0MA 4LL4A 4KKAD 3B2MA 1BLNA 2CR6A 5HHNB 1BZ7A 1XF3A 1BF8A 1KLFB 2WXFA 3NMEA 4L4TB 3RVUD 5AD0A 4YGAB 3O2DA 1EHNA 5TK4A 3OKMB 4OF5A 1LE9B 3RUGF 1QFUH 3FBKA 3MU3A 1N64L 1CGWA 1RIHH 2QDVA 4OLYH 4OAWA 4WWNA 4MJ5A 4CJ1A 2GI0A 2QLVB 4AM0B 4G1EB 3MRRB 4LB8A 3TC9A 1MWAL 2TSAA 1MCWW 1CXFA 3L5JA 4K9JA 1KGJA 3WOVA 3QO0A 2BSSA 1ZXKA 1XQ4A 2JLPA 1MWAH 2Y7QA 4FABL 4N2HA 5DZVA 1ZANL 3KPOB 2H7WA 3C8HA 2XC8A 2WPGA 3HAEH 1ZANH 3DX7A 1KCWA 5D93C 4D0DA 3MBXL 1VDGA 2QADC 3ZSTA 4QLWA 1H8LA 4HWEL 3KPMB 5ICXA 3ZN6A 2J8UB 3MBXH 1AHWB 1MZZA 4I9WE 3UOAB 1SQMA 3JVGA 4DW2L 2QADD 3TWCL 3F8UB 1U8QB 5KVEE 2RHEA 2O5ZL 1TCRA 4PLKD 1XBDA 2UY7B 1KJ2L 4X7SL 2VCOA 3BT2L 1CDCA 1KGYE 3TWCH 4DW2H 4E68A 4AC2A 4ALAC 1IBBA 3AACA 4MXVF 3IDYC 2PETA 1KJ2H 3L3JA 4F15C 4RBPK 3AREC 3BT2H 5F7FA 1ACCA 2CWRA 4JRLA 4AC4A 3GI8L 4YDVA 3ABLB 3GHPA 4FQ2L 4ZFOL 1BVOA 4MAYB 1TQVA 4LLQB 2UUDK 1IT9L 1PEWA 1WAPA 4DH2A 4FQ2H 2UX6A 3CZJA 3IS0X 4XBPA 3S96A 4G8AC 4X6FB 4Z7VA 1B3JA 2GG1A 4OT1L 5IZ7A 3ZTDC 2OJEB 2XBZA 3TH3T 2J55A 4G59C 5I6XB 3O6LL 2KI6A 4NKMB 1SVCP 1X5ZA 2DQEH 4WEUD 3DJSA 2ZKMX 1FSKC 4ODUB 2VM4A 4BQBA 5HHQB 1R3IL 1YC8A 3SKMB 3GUFA 3O6LH 5ETUB 4G8FB 1KN4L 5HDBB 2AI0L 2DYPD 2VN6A 4ABVA 2VDOH 3DRTA 2VSDA 4XPFH 4WVRA 2QSTA 4H26A 4MMZC 3TYGH 2Z91B 1S2EA 2VT0A 2XWJB 4TNVK 1LMIA 1XCTA 2DQ6A 2B5IC 4J7RA 1SEBB 5AB2A 4LGRB 1K8IA 4L0PB 1CFSB 4NJAH 3T65B 2WKLA 3K74B 3NFPB 1RLWA 1I31A 4P2QD 1S78C 3BIAX 4OLUL 5JA8B 2FEDC 5DHEA 4C4UA 3UMTA 2KYIA 3QUGA 2DYPA 4DP6X 5FUCE 2OL3A 3RL1A 3MLRL 1U92A 1CFMA 2XXCB 4F2FA 1F2XK 2FEDD 2MJWA 3K2IA 3RHWF 3WO4B 1OM3L 2AZAA 3ZZSA 4ZX4A 2GC4C 4MMZA 2WVVB 4D94A 5FFLA 4JREB 4X99B 5KVGE 1JYWA 1AANA 3L7EB 3TCLA 2DAVA 3KPRE 3QXWA 4P2QA 5AVUB 1S7QB 3UBXI 5T3XD 4K7PY 1XF2B 2ITEA 1PCXA 4OD2A 4H0LC 3I75A 2Q3ZA 1G9MC 4BE5A 4J3OC 1UCBH 3QORC 1NINA 3H6AA 4LP4A 2B14A 5MEOB 3WY2A 4HIHA 1JUFA 3LQAC 3QORD 3M1CA 1YEDA 4H0HB 3SYQA 3Q5OA 3GGWB 1MHHA 3BEVB 3MUY1 3BPCA 2QZQA 1AE6L 1C8QA 4I5BA 4M7ZB 3MYJA 4RDBA 3RURA 5ANMA 4IMLA 2W0PA 5DI8B 1J05A 4G9FD 1AE6H 4TUKL 3C8KB 1TYRA 3EBGA 2NNRA 3GD1C 5CEZD 1HXMB 4OV5B 2EEDA 2L7EA 3NQKA 4HKXA 4WI0A 4I1NB 1H3UA 3HIZA 4OH2A 2VR7A 3QQDB 1K3ZA 5CZRA 3WCYA 3SE6A 5EZIL 4RNRB 4O4YL 4L8DA 4MS6A 5G4MA 1P4IH 3RYMA 4IU2B 4IRSB 5BZZA 3ZYZA 1AO7B 1J1XL 1V3LA 4O4YH 3QEQD 4LPYA 2MNWA 3QISA 3ARXA 4TNWF 5AL0A 4L8SB 2CK2A 5KG9B 4NKQB 4X5WA 4G9FA 2X4UB 4HBCL 5JHAA 2UYLA 1LVEA 4N8VG 3QXDA 3PDDA 3L2NA 1IAIL 1K6QL 4HBCH 4RCAA 5I1KL 1WIPA 3LX9A 1U95A 2FL5A 4DGIH 3VCLB 1JOIA 1T1YA 1K6QH 3IFOB 4HKZB 5H94B 2YXVA 2FD6L 2P8LB 4LHUB 4RAVA 5JIMA 1KBKA 1LILA 4NSKB 4P2YA 4B9KC 5KUKA 4PJDE 3SDAC 5IHZB 5TDOB 3T4YA 3VI4F 1T7YA 2FD6H 4O02A 4AEFA 3D8MA 5AOJA 2KPNA 3SDYL 3SDAD 3VG9B 4RA3A 2ZWLT 3DJTA 3EYVB 3IMVA 3QK0A 5DURB 3KVQA 2Q87A 1TTRA 2JKXA 4PWKA 3NIGB 4FXKC 2ZSVA 3PXJA 5DVPA 4JL1A 3TLRA 1NCJA 1SXZA 1A66A 5BOZG 3FU0A 5DJ6B 4L3EB 4AGPA 3VFSB 3MA7B 3T04D 2OQJA 5D6CA 4NZ8A 4YHYC 3MREA 2Q1EA 1NFDE 1QRND 4K7PX 2R1YB 2ATPA 3SDAA 2Z9TA 4U1GC 3AC0A 1FFPA 2IPKB 2ZX7A 3VXOB 1G7IA 3FFCD 4K5NA 1LP9F 25C8H 4ZUVB 4ECNA 3DA0A 3B2VH 2WWNA 4G11A 2CDEA 1O9WA 1X5JA 3EYQC 4C4KT 2XFGB 1KEGL 1UWGH 4YSDA 4H44C 3GSOB 5F0PB 1NUDA 4DO5A 5HGBA 3HUJE 1K4CB 3EYQD 3JTTA 1QRNA 3HNSL 5J3HC 3RWFA 5HHVH 3UBXA 1UZ8A 2ICEB 5GZNC 5MEPB 4G9DB 3EO0B 2CHNA 4BFBD 3WKPA 2FDBP 2H9GA 3HNSH 1OP5H 3P2DA 3FFCA 1T4KA 1KWKA 2DMHA 2IQAA 1SLVA 5GZND 4BCZA 2D2CC 2NQDA 1S9VA 5M94B 4YSEA 1BQHB 1X5GA 2ZQKA 2X9YA 1IFHL 3HA0A 2BIIA 2PYED 3MN8A 4PV8A 2VLJD 5CZVH 3L3DA 3EJQA 5B8CC 1KPRB 4K8RC 4FF9A 1MIML 1F6AB 1SOKA 4OUOA 4PS4H 1IFHH 3U82B 2R8SL 4WQOA 5IJDC 5EOQH 3EHBB 1BX2B 4K8RD 5DS8B 2J71A 1TJHL 2R27A 3JUYA 3LPWA 1MFAL 1OSPL 5DVLA 4BUQA 1HYSC 5IW1B 5KVDH 3ARPA 3QE5A 1TJHH 3WXWH 2EUVA 4PSPA 5GZNA 2WQVA 2CQVA 3AG2B 3ZY7A 2ATAA 1JS4A 1GGCH 1THCA 1XZWA 2BOCB 4JR9L 3RBGA 5KVMC 1HC1A 1HYSD 2X6BA 3H55A 3ULVF 5CBAA 5F3BB 2B08A 2PYEA 1MDTA 3FB6B 1F4YH 1EUUA 2MOQA 2NR6C 2X4NA 4JR9H 3G6AA 4G7RB 3KPQB 4QRPE 5DEGB 4KZEL 1NFKA 4WWID 3X13B 3VD2A 4JHVA 1LJMA 2NR6D 5EMYA 3SE4C 3MPCA 1OP3K 5B8CA 2EZ0C 1OE2A 3FYEB 1OE3A 5DRXB 1FGNL 4Z7UE 5DJYA 2NSMA 4PWHA 3JV4B 1T2JA 2EZ0D 1EJ6A 3EKCA 3SE3C 1ZV2A 3BOVA 2FHCA 4RESB 5F89B 5GGRB 3D85B 3EUDA 1B9ZA 3LHPH 1FZMA 1NKGA 4F7TA 1Q0XH 5JNYB 1ES0A 2BMKA 3VWJD 2APWA 4FC3E 3OMAB 4KH9A 2D7TL 4TNWK 4G80A 5DGRA 2IXQB 3CN4A 1EVUA 2EVJA 1G7MB 1JFQL 1KXVC 1UASA 2ICWI 3IEAA 3MJ9L 2C4FU 2NY4D 3QZMA 3RJOA 3MQIA 3W82A 1U9KA 2BS8A 4GO6B 4HK3N 4CN6A 4MWFA 4OZHE 2VO8A 1HHIA 2X4QA 1FDLL 3VXUD 2R2HA 3MGOB 1JFQH 4CJ0A 3LRLA 5DJ0A 4BWTA 1HQ4B 3NRQA 3BZEB 2OMZB 5DK3A 4MD5A 4FQJH 3OJDB 4BRJA 2J2ZA 5DJ8A 3DIVA 1MCSA 4PSRA 3NIFB 3UTPE 3QZWB 3OLDA 1AXIB 1ZK9A 3SE3A 5FX3A 3V0HA 3VWJA 2CHXA 4PG9B 1TVBB 5IOPB 3JXAA 3WYRA 4L2YA 1HHJB 5IQNA 1RK1A 3APDA 3ECUA 4JO3L 2ZD0A 1AOZA 1BDYA 1J9QA 1NJ9A 1UXMA 2NUTB 4OIBA 5ESVA 5CKAA 2MSPA 1KJMB 4KKZA 3VXUA 3B5TA 3BVVA 3H42L 4HEMA 4O9HH 3PGCA 4GKNA 4OJDH 1DEEB 3FQ4A 4WY7L 4U1SB 4EQ3A 1GKOA 4N4YB 2NXZB 2N7SA 2F74B 1AZZC 1A1OA 4K94C 4KV5E 1JZ8A 5D7LB 5E6IB 3CQQA 4FXGC 2WCGA 1CDUA 3SBPA 3DTXB 2OMYA 5CZXC 2FR4B 2BK8A 3T8VA 5CBEB 3KZ8A 1ZGLB 4F57L 1E5YA 4MA8L 2WTPA 1OAZH 5DCCA 5BZDA 2BIQA 4QTHA 4YBLC 2R0ZL 3BHBA 5IW6B 4F57H 5KSAB 3CN0A 1Z5LB 4XN2A 1UZ6F 4MA8H 4MNQB 2IGFL 1XGYH 4DTGL 1F3JB 2FBJL 2HLEB 3AMKA 3OKEB 2R0ZH 5ALBL 3ZDYE 1QBLH 1V55B 4JFZH 3NPSC 1KCUL 2GTQA 2K6ZA 3HBPA 4S1SL 3EBHA 3ZK0A 2ADJB 1BMWA 1RIUH 2VH5H 1IIKA 2LU7A 2W60A 3PP3H 1HSAB 3MNVB 4ORZC 4PY7B 5BVJB 4FXGA 3O4LD 2PTUA 4UT6A 1UVQA 4ZO6A 2WWMD 3TBTB 3VYOA 4JQXC 3UP6A 1KJVB 3KJ6L 5KSVB 3QFJE 4B5EA 1EAOA 2EO7A 3T0XA 1ZVSB 1AGFB 4RMVA 4P8QA 2X4RA 4OIFA 5DHYA 3RAJH 1X7SA 2MQ0A 4X6EA 4KHXL 2YXWA 1TENA 1INQB 4BSWB 4GY4A 3UZQB 1PG7L 3W39A 4DEUA 4OFVA 3O4LA 4KHXH 2UXFA 2BW4A 3OXRB 3E1F1 1PG7H 5C9JB 5AVXB 1DQJB 5CSBA 4QRQA 4QOKB 4QYOB 3QI9C 4YR6A 2FWSA 5D7JC 4JQXA 1FPTL 3HW7A 5BZWA 2CD0A 1UB5A 5TE4L 4UOJA 4GFXA 1FG2B 3ETBJ 3MNZB 2ICWA 4DVBB 1Z9NA 3K46A 4FI8A 5FGBC 3L1GA 4BKLB 2BHFA 4I0KA 4OU3A 4I9WD 5C0RH 2RFXB 3G5XB 3EJCA 4NFCA 1K2DA 1QASA 4PI2A 5EFIB 1FO0A 4OFKA 2VN3A 2BSDA 2V17L 1OAXL 2F5AL 3IF1A 3HG3A 1IRAY 4PJAB 4NUMA 5ID1A 4ZOEA 5CWSB 2E7LA 2APXA 3AG3B 1U8JA 1DANT 2WNKA 2OI9C 2F5AH 4IBZA 1VFBA 2X6AA 1UD8A 4BA8A 1BQKA 3QZBA 1H9DA 2BJML 3UEQA 4ERSL 3THMH 2VLLA 3NFSH 3TFBA 1BEYL 4JRFA 1KPVB 1W91A 2WXOA 4P2RD 5A2JH 3H3PL 2BJMH 5I0WA 3RTQB 5GRUL 1BEYH 1SOSA 2NY2C 4KRLB 4U0RB 2APFA 1FFNB 5IBLC 2BVYA 1LD9A 1IV8A 1WIOA 3MFFA 2G4GA 2KKQA 3A21A 3QEGL 5GRUH 3D4YA 2NDGA 3NCXA 2NY2D 1WZ1L 4NNYA 2NT1A 5IV2B 3L13A 3PPEA 3B9KC 3N9GL 4DAGL 2DKUA 2VQ1A 4EKJA 3DIDA 3VXNB 3WIHA 2J73A 5MERA 4DNLA 3B9KD 2DICA 2DI9A 4XP1L 3OG4B 1W16A 3H9HB 1MCCA 4PH8A 5I18L 2XKNB 1NSNL 3K6SB 4JANA 4L4JA 2DB8A 5A2LH 2GUYA 4AEIH 4APQB 4N2NA 2ZXAA 3BVTA 1HEZA 5GSRA 4K71B 1U2CA 2X2YA 3RUGB 2ZJSL 3IAGC 2BVEA 3O45B 3KDMB 5FUCC 1N2RB 4EUPG 3U4KA 4AEEA 5D1QC 3T2QA 1AGEA 3UZEC 3P40A 4PB0L 1V05A 2ZJSH 1ZA6A 3ZDZF 3B9KA 3GSXA 4DP8X 2A7BA 1N0LB 3QW9A 5TGBA 4TL4A 1PNDA 1B6UA 1SFHA 3D9AL 3GXIA 4PB0H 3S5LB 1WPCA 5HPOA 3BCFA 3BVDB 3U30B 1HYRC 3ABMB 3D9AH 3JSSA 4G8IA 4R7DB 2J1YA 2NY7L 1HZHL 5I1AB 3ZZQA 4FFYH 3IKCB 1AI1H 5E00A 4ZFFA 3KPRD 4JY4B 4KNSA 1HZHH 1B4JL 5EH1A 1DUYB 1MFNA 3TVMC 4FS0A 3V0VA 4U1HB 1JGIA 1B4TA 4W9JC 4PFEA 1DYZA 4ZFQA 1B4JH 3OKOA 3CSGA 4B60A 3CXDL 1JYXA 5EBGA 3UBHA 1CDGA 5IJVA 4HCGA 4KJPC 1TLMA 2QJDA 2VR4A 3QDJE 5JORB 4IM8A 4M3JA 4YVUA 2C7UB 5KYYA 2HFTA 3QUXC 5FOBA 3G04A 3KPRA 4HIJA 3FDWA 3VRJA 3TBBA 4ESKA 4HV8A 3C60C 5DRNB 3K0YA 1RZJL 1A0QL 2CKNA 2YKLH 2H3NA 2PR9A 3E8VA 3HNTH 1OXYA 5IQLA 4OLWL 1I3RA 3C60D 1RZJH 2HT2C 4Y9FA 5AUMA 1A0QH 5GRJH 4DK3A 15C8L 1D5XB 4XNMA 4QF1B 2HFGL 2VSKB 3CDGB 1Y07A 2LFEA 4JB9L 2HT2D 2CGRH 4Q58C 1KB9J 4GRLC 3FO1A 2Z4QB 2HFGH 1IC7H 2ZX9A 3VU1A 3QJXA 4JB9H 4NZFA 4P57B 4GXFA 2NY5C 4GRLD 2JELL 4LBEB 1RU9L 4GXVL 3M1OA 4P9ML 3VFVB 1Z3RA 1FCCA 4RFNB 4ANWA 3C60A 5DQJA 1GTFA 3V5HB 1J12A 1CO1A 1S5IH 5EU3A 2BIHA 4GRWE 5JHLL 1WCBA 4RGOL 4N2FA 2IWKA 1JK8B 2CLZA 3DHUA 3BVWA 3EG9B 3HVNA 3BUPA 4TQEL 4Y4FB 3POHA 1FJ1B 1GVIA 3UJTH 1TZHB 1BVZA 1N3NA 1EX0A 1JPGB 3NJJA 4Q4EA 4DEPC 4BDVB 3UYRH 1MFEH 4Q6IC 2NZIA 2AHIA 1R5VA 3C08L 1YHPA 2QKIC 2X09A 3R06A 4NN7C 1N5YL 5G4OA 2Z31B 5IQ9B 1OT2A 4ODVH 5GSVB 1XGPA 1WUZA 2PLTA 4GUPA 4KPHL 3GLZA 2IFFH 2VDKB 2EO9A 3BXNA 2R7EB 2COVD 2TRHA 3C08H 2W92A 2AZUA 3KM1A 1A9EB 5FV2A 5K33A 3UTTE 4BK4A 2QQLL 4Z9KB 1ZTXH 4A6YL 3JWOH 1OTTC 4PJDA 1L9PA 1K8DB 2E9WA 3PY9A 3QAQA 4A68A 1PD0A 4YEEA 1A7NH 3O6KL 4QGTA 1R46A 4WCYL 5I24A 4NPYB 3LTVA 4I2XE 1TTAA 4ZXBD 1XSIA 4KKBD 1BAFH 2AK4D 1K9TA 3BD5A 2ZX6A 5F1KC 5GZOC 4YFDB 3WS3A 5IMKA 2D0FA 2CO4A 3KGTA 3O6KH 2WD0A 4LVNC 1CGSL 3HZKB 4YUEL 5DTFB 3BIKB 3FTYA 4NI3A 1XF5B 3MUGA 4N2EA 2QKIA 4YUEH 3ZVVA 1V3KA 5E8PA 1I8KA 1D2PA 1CFNB 3MRPB 2L7JA 3L3GA 4YGVB 4L8CB 1EHXA 1SUJA 3HI6L 4YWGL 1RV6X 5HGAA 4MDJB 4HS6A 3FN9A 3H9YA 5BQ7B 1N59A 1P5VA 2LGNA 3BUYA 1NFDA 4FOMA 3G08A 2WLMA 4CNIB 4EBQL 3ENEA 4ZXBA 4OLZL 5BNXD 4NDMB 4M6NL 4EBQH 2LLNA 5EZLA 1D5RA 5CJQL 4POZC 5ICZA 4GW5A 4FQXC 5DA0B 3VXTA 4OLZH 2ZAHA 5F3HB 2HT3C 1F45A 4AQZA 1WGOA 4POZD 1PX3A 4U6XB 2WGNB 5DHMC 1UKSA 1RZ7H 4XN4A 2YA2A 2HT3D 4D0CA 4ONFL 4WI9A 4HMCA 1LEGA 3U9UA 5CIPB 1M7XA 4JKWA 3HUJA 1E0OB 3FQTB 3DJZA 1CDHA 4ONFH 5B38B 2PYFB 1ZT4B 3LKPB 3S37H 1PW3A 4YS4A 2E8ZA 5DO2C 3FXIC 2X4PB 3MRCB 1GGBH 2PKDA 3UPCA 2FJHB 2AEPH 2ITDA 3QJQB 4LSTL 3F62A 1KLUB 1WVZA 2IDSA 3DXAB 2G3NA 4WRLA 3T5WA 4JZNB 2AW2A 2HH0H 3INUL 5JPNA 1S9WA 2B77A 2Y1VA 4LSTH 3FU3A 1MWOA 1XR8A 2FUTA 5DHXB 4BWWA 3F6LA 4QRPD 3VI4B 3SCMC 2A6IA 3LQZB 1ONQA 4EIGB 2EYTB 1M6OB 4Y19E 4ZT1A 1OTUD 1H6EA 3N0PB 1H3WM 3SOTA 2NYYD 2W9DL 4MAUL 2FK9A 2WW8A 3OKNA 2ZXBA 4LHQB 2VAJA 3T08A 2W65A 1IAII 1ZV9A 3P69A 2A74A 3FQNA 4J1UA 4NRYA 4XC3L 2FYVA 2W9DH 3GSUA 2XBDA 2VN5A 2IDFA 3OX8A 3CLEL 1GW6A 3ARFD 2XWTB 3MLUL 1YSOA 3ET9F 5I0YA 5TDPA 1IJ9A 3M6DA 5SWZE 3CLEH 4F24A 5F8RC 4QRPA 1DQIA 4F8TA 4DERA 1E50A 2Y2YA 1LE5A 1BPVA 3V4PB 3H4HA 5SWSE 4BFIA 3GLEA 4LL1A 4Y4HD 1DCEA 1RIVL 1ZHBA 2YIHA 3KL0A 1MCKA 4V2BA 4Z7UA 4G8EA 1A3QA 3PXHA 5L88H 2ZICA 2JKNA 4H8QA 3KM2A 1RIVH 3WJLC 3GT6A 4N0YH 3ETBF 1U3ZA 2DTMH 1I7ZA 4M3HA 1OCOB 4AMKL 5JXAL 3ARFA 3UTPD 3T09A 4GBXB 4DESA 4POUB 5CD5C 2DBJA 1U8MB 6FABL 2WP3O 4RISL 4UIKL 2UZIH 1G0YR 5JXAH 2DWDA 1TNMA 4JUTA 3GB7A 5EORL 4HWNA 3SDCC 1J5IA 3DKHA 1Q1PA 2D3NA 5CD5D 4Y4HA 6FABH 1HXKA 4UIKH 5I1EL 4OZHA 1KSRA 4JK0D 3T2LA 1E3ZA 3MRMA 1URLA 3SDCD 3K71A 1P9MA 2XJLA 5EO1A 5I1EH 4F7MB 4JGNA 3Q8BA 4ZW6A 4LARH 4ZMTA 3MODL 2BNUB 1IEAA 2HVKA 4JFTA 3WJLA 5DZNA 5J57B 2GJ6B 1NMAL 1A25A 3M86A 2NCEA 1I7TA 3CBKB 2DL2A 2VDNB 3NJNA 3IJYA 1VEPA 2O26U 1G7QB 4AUJA 2VDKL 3FH5A 2DS4A 3SDCA 1NC4B 1HZLA 4CW1B 5C7ZA 4GW4A 4B7IA 1O5PA 4NO2A 2W94A 4JFXA 4W9IC 2Z3FA 3EH2A 1HOCA 2VDKH 1JXFA 2R1WB 1FQ9C 3WGUB 2VDRB 2Q10A 3H2PA 3P9WB 4MB4A 5KBLA 4A55A 4J23A 2Q6WA 2CO6B 4JN1H 4KWUA 4F2ME 3D1MC 2EEBA 4JPWL 3REVA 1V7ML 3WI9A 1IL1B 3QZOA 4HUWA 4Y2LA 4GW1B 3W9EB 1HXYA 1HI6A 1IM9D 2XG5B 3Q9PA 5IMOA 4ZMXA 5LWYL 4RWYL 4M7LL 1ROWA 3R1GH 1VFMA 4ACPA 4DVRL 3PJSB 3DX6A 4HMDA 1A7PL 3EGDA 3EADA 3QFJD 1T6BX 3PUUA 2COQA 4M7LH 2K4WA 4WU7A 3MHZA 4NKOB 5KSUA 5ACZA 5DEZA 2V9TA 3SBWC 4FGMA 3OWEA 5F7HA 3LNFA 1ZAGA 4E5XA 4GMSL 1AZCA 1G6VK 2FWLB 5EIIA 3HI1B 4YHOL 1IM3D 1AGDA 8FABA 1IM9A 2O5YH 3K8KA 1U3NA 5B39A 3LRSA 4GMSH 5CJXA 3P4OA 1E4KA 3DX1A 4YHOH 2XZCH 4HF5L 3FU9A 1R24A 3JV5A 4MD0A 3QFJA 2EDDA 5E70A 3RNKB 4LBAA 1P2CA 2VIRB 1FNGA 4OZGF 4JAMA 4HIIB 4HF5H 4DP2X 3O6FC 3Q3GA 3O3BA 4W68A 5CIPH 1A9BA 5HD8C 2AF2A 3O4OC 4G70B 4JG1L 5DJCB 4IOFC 2HTLC 2FWOA 3LKRB 1UOWA 5KSBF 3O6FD 1OKEA 1B2YA 1IM3A 3UG5A 5A3ID 3LN9A 3SBWA 4XPBL 4IOFD 1AQDA 4Z77B 3EDFA 4I8DA 2A4CA 1P4BH 2PTVA 5FDYA 4BE6A 5C09E 1IGCL 3VNYA 1COBA 2Q0ZX 1RZ8B 3N85L 3QJFB 4XNZC 3NG5A 2IBGA 4BXVA 2ODIA 3PQYE 1NC2B 1IGCH 3ZHFA 1CI5A 4YDLB 2VW7A 2VW4A 2FYYB 3C9NA 4PJHE 5L4IA 5JW5A 1DL7H 1W8OA 1BIIB 4FL4B 1GOFA 3O6FA 3FB5B 4QUOA 5DEJA 5GGUB 4MZRA 3JZYA 3LB6C 3VTMA 3DOIA 5DJAA 1NUFA 4IRZA 2WWOA 3OLIA 1VERA 4S1QL 1TQUA 3RX5A 4FAAB 2BINA 1CR9L 1YEHL 1NOFA 1L9OA 3ULUH 3CZKA 3SPIA 4S1QH 3KDPB 3UYPA 3P4NA 1JNHB 2B20A 1CR9H 1YEHH 4KY2A 3T2NH 1E4HA 5KYXA 3EW3B 4YSPA 3WO4C 1WBXB 2ZPKH 3FUNA 4LOUD 3V4PH 3K1KC 1N0XL 3NCYP 5LCVL 4ZTPL 5GGVH 4DP9X 1JE6A 4FKEA 1N10A 1UOKA 4YHNB 3MRNA 5ESQA 1WZMA 4YHMH 5IF0A 4KUZL 1WS8A 4JREC 1N0XH 2FSEB 4NQTA 4WW2F 2A6DB 5LCVH 3SN6N 4NENB 1WT5C 1N68A 4JM2C 4KUZH 1ZLVH 1L7IL 1NBZB 5E5LA 4DKAA 3BYTA 4DPAX 1ND0B 2CUAA 1KB5B 5F7BA 5D7EA 3RFZB 3KLHD 4JM2D 5H4YA 1AQHA 3OLGA 1L7IH 4JN2A 2W81C 5DD3H 4KTDH 4XMUA 4YDJB 1SJHA 3P9MB 1DE4A 1PIGA 2XXGA 1BW8A 3DX8A 5E8NA 4OUUA 1QACA 3MNDA 5E56A 4CGTA 1TQTA 4MDRA 1MW1A 3M46A 4QRUB 2EH8L 1BFVL 1NL0L 3RIAK 3WMQA 2KS0A 4AG4L 4QXGH 2VDQB 3TURA 1WT5A 2EH8H 2VDNL 1BFVH 2IWGA 3PE9A 1T0NB 4E9RA 4JM2A 2QSVA 5EU6B 2VDLB 4KTEL 5TPWL 3SKNA 1PD1A 4YNYB 2VDNH 3U0WL 3V4UL 2IANB 4OGQC 1AD9A 1RHHA 4W9FC 5C0IA 4PJ6A 2YRLA 4F9LC 2HKFH 5TPWH 3GO1H 5K9OB 4LCYA 5E2WL 1Z5YD 1EEYA 3ULVL 4IRSC 1VGEH 2PPFA 1BJMA 1ETZB 2YPLE 3FONA 4U7MA 1KXTA 4IOIB 4L8SC 1HIMH 1Z32X 3F58H 1A6ZA 3BP4A 3QFDB 3QDJD 1G7LB 1NGZA 4QJ3B 3PS6A 2VDRH 3C75A 2WBJA 2HN7B 2Z8VC 4I0PD 5CCHE 4GG8B 1DN0B 1CDJA 1WTLA 4IIQB 4NYLB 2Y36L 3GMPB 5D5MF 1UADC 1HQRA 3MJ9A 1JCVA 2F53E 1HHKA 2BNQD 3GTNA 5A6LA 5LXGL 1NDGA 3MJWA 4JPVH 1MG2C 4OKDA 1GCFA 5EEXA 1NMBH 2NUPB 2WXLA 3LIZL 5ECJE 5IM7B 1OARL 1R3LB 7TAAA 3QDJA 4X9HA 5A2AA 4C83A 3VAEA 5E2UH 3LIZH 2YARA 2CIIB 2VERA 4I0PA 5I0VA 2CRMA 2EIMB 2XDHA 3TJPA 5K1JA 3DVNB 4WJG3 2IEPA 2LU3A 5F9JA 3LCYA 5ITFB 4EZKA 3OPUA 3T0EE 1VPOL 3HVDA 1I4FB 1SDYA 2GSGB 4H8HA 4IDJL 4IBWA 5IKCB 2YPVH 2BNQA 4P3DB 5KBDA 1GZPB 5CILL 5D2NB 1VPOH 1OK0A 1MVYA 3LS4H 2PPAA 3QCVL 4IBYA 2J25A 4IDJH 4IKNA 4B9PA 3CX5K 3N43B 5CILH 1RY7B 1SYVA 1JK9A 1KY6A 4D3CH 4XB8A 3ZKMC 4N8VB 1ZKAA 1KLGB 1Z0MA 4PJ7B 5HY9A 3H0TB 1PYWB 2GSIB 4EVNA 3ZKMD 2A73B 4MZ2A 2DOCA 1HAWA 5E1QA 5I75B 4DN3H 4LRIA 2DD8L 4EIUA 1DQTA 3RGVB 3RBSA 4W1TA 3ROOB 4FA7B 4I0CC 1XGUA 1M71A 1NA8A 1E67A 1MCLA 4MCMA 5C2BH 2DD8H 1C1EL 3AWFA 2XV6B 1YEJL 1MJJA 3VSUA 4BH8B 4MMYA 1E7VA 2OMUA 3UTTD 3AS0A 5J13B 3D2UB 3SDXF 3BH8A 1C1EH 5BW7C 3TT1H 5EEYA 1PPIA 2L7UA 4XPAL 3E3QE 3WKYA 4LSSH 1A02N 3LEXB 2D3LA 1B2WH 4TULH 2Y6TE 1S7XB 3BGAA 3CSYB 1RK7A 4XVJL 5DSCA 4AZUA 1RERA 1GMIA 4PVNA 5E23A 1KYOJ 3ZKNC 4ONHA 2OMWB 4PJ5B 3RLSA 3BAIA