3CQQA

Human sod1 g85r variant, structure ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
134
Chain Sequence
TKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGRHVGDLRNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structures of the G85R Variant of SOD1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 134
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3cqqA00
2Z7ZA 1XTMA 1HL4A 2ZKYA 3PU7A 2AQQA 2AQTA 3ECWA 3QQDB 5KBLA 1CBJA 1IBDA 1F18A 1E9PA 2GBTA 2SODB 3MNDA 1F1AA 2Z7YA 1S4IA 2NNXA 1TO5A 1SXAA 1IBBA 3CQQA 3RE0A 1RK7A 1BA9A 1YAZA 1DO5A 2AF2A 1XSOA 1UXMA 2VR7A 1SDAB 2WWNA 2JCWA 1UXLA 2GBUA 2AQPA 3KM2A 2ZKXA 3MKGA 1E9PB 3ECUA 1JK9A 1N18A 1Z9NA 1EJ8A 2E46A 1AZVA 3F7KA 3GZQA 1E9QA 3HOGA 4MCNA 1PZSA 2R27A 2APSA 2WZ0A 1B4TA 5CU9A 1OAJA 4A7TA 4BD4A 2LU5A 2ZOWA 5KBMA 1PTZA 2ZKWA 1SPDA 1SXSA 4B3EA 1TO4A 4A7SA 4L05A 1IBHA 1E9OB 2AQSA 1JK9B 1IB5A 2VR8A 2AQNA 4N3TA 1P1VA 1IBFA 3L9YA 1E9QB 1F1DA 2K4WA 3KH4A 2C9VA 2WZ5A 3GZOA 4A7QA 4A7UA 1L3NA 2V0AA 4BCYA 1SXZA 1KMGA 1QUPA 1YAIA 3KBEA 3H2PA 1ESOA 2WKOF 1SXNA 3HW7A 1Z9PA 2Q2LA 1SXCA 1SXBA 3GZPA 3KH3A 3K91A 1XTLA 4OH2A 1HL5A 1MFMA 3HFFA 4MCMA 1N19A 1SRDA 1Q0EA 3F7LA 4OJAA 1DSWA 3CE1A 2AQRA 4U4IA 2JLPA 1YSOA 3S0PA 4A7GF 1OZTG 2GBVA 1SDYA 2C9UA 2WKOA 2Z7UA 3T5WA 2XJLA 3CQPA 3H2QA 3GQFA 2AEOA 2VR6A 2WWOA 2WYZA 3ECVA 3GTVA 3KM1A 1OALA 1FUNA 4BCZA 2Z7WA 1F1GA 2E47A 1U3NA 3QQDA 1EQWA 1COBA 4A7VA 1BZOA 2WYTA 4FF9A 2XJKA 3GTTA 5KBKA 1JCVA 4A7GA 1PU0A 1SOSA 3SODB 1OEZW 1CB4A 1B4LA 3KBFA 2WZ6A 3LTVA 4N3UA 2C9SA 3L9EA 1OZUA 1E9OA
chains in the Genus database with same CATH superfamily
4HULB 2V2TB 4LEXH 4WWKC 2Z4QA 1WZLA 5TPWL 1NCCH 3IMSA 3ZXAC 4MJIB 4S1RL 3T8MA 1RPUA 1NC2D 1WFIA 3Q44A 4ZX5A 5CUSL 4MS8C 1HHIB 5JR1L 3GGWB 3RKDC 1C08B 4Y4FD 5ETUA 1V7NL 4HQQL 2BSBA 3TTSA 2ICEA 1FF5A 4DP6X 5C0EA 4FTVA 4CW1A 1OTTC 5JO5B 2HKFL 1NEZG 5CILL 2J8OA 3HS0A 3MACL 1R0AH 2AC0A 4NI3A 4IMLA 3BT2H 4S1SH 5E03A 1YY9C 3QO1A 4XN4A 3ET9F 4CC4A 3UZQB 4N8VG 4RNRA 2OL3A 4YHLL 5CN1A 4H20L 1SBSH 2ARWA 1OAZH 2XN2A 3FUIA 4ZXBC 4H8WC 3WE1A 1FZKA 3TPUB 1XGYL 4WFFD 2GJ6A 2VH5H 5IVZB 3FHEA 3RX9A 3M1OA 4WHCA 5KBMA 3LX9A 1E4KC 5D7SL 1OGAA 2NY4C 3OZ9L 5B1JA 1T2QL 4E9QA 1DJZA 3L4TA 4QXGL 4DGUA 4JFOB 3PDDA 1HX0A 3CH1B 1U8CA 2RB8A 4AENA 3O9WA 1DEEA 2K1MA 3EYQC 1ITCA 3NCJL 5E9AA 3EH1A 4H4NA 2YSSA 1DQLL 3I9AA 4PMEA 1TZ8A 1CG9B 1I7UA 2AK1H 1OB0A 4GSUA 5CZVL 2OSXA 3VMNA 3EXJA 4MXQD 1BZDA 2ZSWB 1MNNA 4P8QA 2R69L 4GIOA 4PVNA 3PXJA 1A1OA 4B5EA 3ZE0E 2OXGA 4J8RA 1ZWIB 3A21A 3OTTA 1MFUA 4KUCF 4R0LA 3FT4A 5K9KB 1I1AC 2G0KA 1KELL 1IGTB 5AAPA 1X7SA 3CHQA 3DVFA 3MGOA 3EFOB 4BXSV 5DJXA 5IB3B 1MW0A 1WBZA 3JVFC 4S1QL 3WE6A 3DOSA 2FO1A 4M3KB 3H3PL 5FUOH 1XZWA 3VSUA 5C0AE 5E94B 2VR6A 3PWNB 3RBSA 3GTVA 5HGDB 4P2YA 5CZXC 4OZFB 1RJCA 2H32B 3KYNB 4JKPH 3KYKH 3RY4A 4OLYL 5JXEA 2LW3A 1ERNA 5T1KA 3WSQL 3NSCA 4ZPTA 4ZW3A 4XP9L 1DFBH 1E50A 2PPCA 3HS9A 2Z3FA 2EYRB 3ZW3A 2WOYA 1EH9A 1SN2A 1EX0A 1JPGA 4HXAH 1W91A 1V05A 3TJEL 4NO5A 4M1CC 1N4XL 3J7HA 4GP5B 4BELD 5I9QC 4KZDH 4Y4KB 5JIHA 1EEQA 3GMPB 3FS9A 4K3HA 5BRZE 5DMJB 1DQML 1NSNL 1GC1C 3CLWA 4Q9QH 2R29A 1CT8B 3OKNA 2OAAA 3TFKD 1HDMA 1Z2KA 3IWUA 5E70A 5GSVB 5C0ND 5BMFL 1RZGA 4LBEB 5IQ9B 2CXGA 4FTVD 4KBPA 2FTAA 3VYNA 5AD0A 3ARUA 1DBAL 5EO9A 4NQCD 4ATTA 4KRPD 4U49A 2Z35B 4FQXC 3BAIA 3AC0A 4JY5L 5EZOL 4OZGB 3OLEA 1CURA 4PTTA 5FA4A 1BOYA 4WI9A 3ABLB 3ZQ9A 4R96A 4M6OH 3KGRA 1BVKA 3NFSL 4QAWA 1IGJB 4FXGC 2B1AL 4UIKL 2GJ6D 2QR0B 4ENZA 5IW1A 1T6VN 3HR5A 2W95A 1WZ1H 6TAAA 1OGAD 4FXKC 3EIFA 2VCOA 1GS7A 3ZKXC 2YPLE 3REVB 5EUOB 4WFFE 1CTNA 4P2OB 3NZUA 2C1OA 4B9FA 5I1CH 3APDA 5I1LA 1D5IL 1IZJA 3O9WD 2CH8A 4OI9A 5F96H 4CSZA 1KJ3L 2XXGA 3KVQA 5K5YA 2H8PB 3UBXI 1OLZA 2P47B 1ZT1A 1B2WL 2FL5B 3DVGB 1RK1A 2AV1B 5FHBL 3IE4A 4YX2H 1WFNA 4DP7X 4XMZA 2R4RL 3DC0A 4JKMA 2FBOJ 1A65A 3MUY1 3O3BB 3U6RA 5I0ZA 1FCGA 1PAZA 3TA3C 4ZUSB 1KBPA 5KS9A 2J5WA 1AI1L 2KZWA 4KO5A 4X5XB 1W8NA 1ZAGA 4S11A 3MU3A 3S5LA 3VD1A 2JK5A 3PNRB 2FX7H 2J44A 2UWEE 2I9LA 2V7NB 3QZMA 5E1HB 3WTXA 3PWUB 3RFZB 2I32A 4OTXH 5DURB 1N9PA 4HIHA 4CVXA 4LAQH 1T7XA 2QGEA 2QSVA 3RY5A 3Q8FA 4XPHH 1N0LB 2EH8L 4Y5XB 1MRCL 4BCZA 3VSVA 3DHMA 5FA3B 4P2QA 5D72H 1HWHB 3BAWA 1H3TA 5KVGH 4GKNB 4XP6L 2VLJB 4OAWA 5JXED 4K7PL 3SDAB 4YLCA 5DTFA 5T1KD 5LGJB 2ATPA 2FGZA 5F71A 3QIWD 1QAWA 4AUYA 4OLZH 4V1DB 3QP3A 2PP8A 5GS0C 4ODBD 5E1IA 3P4MA 4OU3A 1IM9B 1WD8A 5IVOA 1K6QH 3G08B 3VFTA 1QASA 1Q9KB 2XVLA 1NANH 2DEYX 1SF5A 2R83A 1N59A 3WMSA 2H26A 4ES8A 4OGQC 5DS1A 3MFFA 4XH2A 4IOFD 1R3HB 1I75A 4ZD3H 1RK7A 2OMXB 3AJ7A 2VGLM 1IEHA 2WZPA 1VADA 4M7JL 4FL4B 2E7MA 5F72S 3MJ7B 1UWXK 1AR2A 3MRFB 1OPGH 2DYPB 4M62H 4NO3B 5CEYA 4R3SA 1QPPA 2XA8L 2CMRL 4HKZA 2CGRL 2ZD0A 4UZSA 5CBAB 1U8JA 4C83B 5A6IA 3HOGA 1QLEL 2QKIA 4X6BA 2VWEE 4H0GA 2CIIA 3P3RA 3TV3L 4JDEA 4FTVE 1HKFA 2J57A 5B39G 4IRJB 2ZX6A 1N5YL 5E8PA 4UDTB 1GZPA 3PP3K 4EQ3A 5KSBF 2AK4A 3D07A 3UYRH 1CXLA 5KN5A 1GL4B 1MLCA 4FHJA 1KGYE 4Z7VA 1NL0L 1YDPA 3I6GB 4LSVL 5DUML 2SEBB 1UXWA 3GMOA 1MRDL 3ECBB 4U6TA 4K8RD 1Z9OA 2GJ6E 4OF6A 1MIMH 5CEZL 5MEOA 5FUZL 2X9XA 2DS4A 3K8LA 3QULA 4G9DB 2ALAA 5CUSH 1OGAE 4JLRA 4R6UA 1WBYA 1XD1A 1PZ5A 2HJKB 3LD8B 1NDGA 3OF6A 5E6RB 2ZUVA 1NDMB 1NCIA 4HQQH 1CF8H 4K2UL 4LO9A 4ZSOA 4Y4HC 5GIRB 4I0PC 5ALCH 2HKFH 5EF1A 4IBVA 1AGBB 4N5ED 1MZYA 3LNIA 4GW1A 4PJBB 3PFUA 2BMKA 1WYJA 1TQWA 3HI1B 4TM9A 4KNTA 4N24A 3VXQB 5B7EA 5TE6L 1NCHA 4YHLH 2BVQB 3H9SB 4UT9L 1U3JA 1RJYB 1YC7A 3G5YA 1J1XL 2WK2A 1D6VL 1JYVA 2HXAA 5E4OA 1V7MH 3OAUH 3O2DA 2IV8A 2UZYB 1KYAA 3RHWF 1NUDA 4P2QD 1BXVA 1T2QH 4ZFOA 1T1ZB 5IB4B 1TVBA 1AGDB 3SE9H 2YPKA 3U79A 3M46A 3ZRSA 1OZUA 5F93C 3REWB 3SQBA 5IMOB 4K3JH 4OJFL 4QY8A 1UM6H 3GJFH 2H3XC 5GGVH 3GJEB 3FFCA 4LSPL 1ECZA 3X1BA 5CZVH 3O3DB 2HTKC 1U3HB 2BINA 1Z5LB 2R69H 1WUNT 3I3EA 4QLWA 2VW6A 4KQ3L 2UXFA 4MA1C 4RGMB 1YEIL 3H55A 4RISH 2FX9H 2LE9A 4UYQA 4IS6A 4DK6A 1J9CT 5JLZA 3SDCC 4WHYH 1LEKB 1UD6A 5IVNA 1YPZB 3GSXB 5FCSH 5GGUA 1NIFA 3KWWB 3O2VH 2EYTA 2WZPD 5DDHA 1JK9A 3U36A 5C6WH 2BSSB 1NGPH 2RA1A 3MMEA 4Q52A 2XXMB 4S1QH 1AZVA 3QORA 2XNAB 3GNML 1H3WM 1UJ3B 1P84J 2WTOA 1FNSH 2R27A 5C7ZA 3K74B 1G9MC 4O2CB 3B9VA 3MLVH 4RZKA 2APTA 4XMPH 5I1HL 1A3QA 4QRTB 4QUOA 1BD2A 2GSIB 1XH1A 3ML8A 4YC2B 4C4UA 2W07B 5F1NB 3LB6D 4FCAA 2H7WA 3RVVC 5LBSH 2JB5L 2B1OA 4BDVA 5A16A 4DKFL 1D5XA 4J23A 4TNWF 3V10A 5DK0B 2AK4D 3FULA 2JFCA 4I4WA 4RIRB 3GSVA 2H2SC 3D34A 1OM3L 3FT2A 4LSSL 3VFPA 2XG5A 3MV7A 4NHCL 1A21A 1QUNB 2CUAA 2O6PA 3IFNH 4XHQA 5EN2B 3A6CH 3IFOB 2LU4A 4AJVA 3PWPB 3QFJA 2LLNA 1JL8A 2JCCA 4HC1L 3VGDA 3CFTA 4LLWA 5F0LB 4PRHB 1DQMH 2VDRB 2WKLA 3OF6D 2XFGB 4YSRA 1UCTA 1ADQA 3SJVA 4IK7A 1ZLVH 4R90L 3RVXC 3L4VA 5BMFH 1X3DA 2XWRA 4AYSA 1MI5A 3VX1A 1P7QB 2EE2A 5EZOH 3HAEA 1JIBA 3HE7C 4PUBH 1IILE 4N90D 1MWAB 3PWJA 1UB6A 4JDTH 3V4VA 5DD3L 3WFZA 2HG5A 4XAWH 3WY3A 4M48L 4NNPL 1AKJA 4WW2A 3O6MH 4GG6B 1AQHA 2OTWB 4WI0A 4FJZA 4UIKH 5KS9E 2BX5A 2QVIA 4V11A 5FPIA 3QZOA 4RRPA 2UYLB 2UZXB 2EKSB 4KY2A 1THCA 2NQDA 3RI5F 4M1DL 1OARL 4JM0A 2EC8A 2V4LA 3PRZA 4JKNA 1G84A 2ZWZA 3MRLB 4JRYA 4N8VA 3FO2A 1DQDL 4Q6YA 1FL5A 4G8IA 4ZT1A 5GZNC 4P2QE 3DMMB 5T5NF 1AS8A 3D52A 4ZTOL 3FFCD 4P9MH 4IKLA 1XXFC 3R06A 5E9NA 3X13A 1I8UA 4HU8A 5FK9B 5H37H 4NZUH 4M56A 5IFHH 2FJFB 1OAUL 1OF2B 4MJ6A 5D71H 3MLTA 3TIDA 2YEZA 3TWCH 2FIKB 2NY5H 5CCJA 1HQ4A 4NKMB 4PJIA 1AI1H 3MUHL 3A67L 3VWKA 1NAMH 4K7PX 3TF7C 3GXDA 4RMVA 4EUPH 4JX0A 4RETB 3VI3B 4PJXA 4WO4B 3INUH 4AEHL 4Z7NF 4PFEA 3O0RL 3F12B 4PR5B 4ZFZA 1T89A 2FQDA 3SPCA 3T6XA 5DD1L 1CD1B 3BOVA 4IGBB 4NENB 3WFBH 2CO3A 2GUYA 3TN0A 3L4CA 1MRCH 5FO7B 4DP9X 2A4EA 2C7UB 2VITB 2QZ5A 4XP6H 2IBZX 4J7RA 1G9EA 3KPLA 4NAQA 1BD2D 4Y2OB 1FYTA 1HCZA 2FEJA 1NCUA 2HT3C 4XNZB 5F7HA 2X5PA 5H8DA 2XU9A 4ZZFA 4AXWA 3L4UA 5KJ4A 2DLFH 1UEYA 3FFOA 2XDHA 4J27A 3SBPA 4AVHA 5KOMC 2WTRA 3O6FA 1T66D 4ZPVA 1UENA 5D7JA 3NIFE 1EFXD 2G75B 2HLFD 4YSDA 1XGTB 3FU7B 3UAJC 2GFBA 1D7DA 5I8EB 2BIIA 2ZXDA 2Y22A 1VA9A 5IB5B 4QJ5B 1B0IA 2AK4E 1VIWA 2AGJL 3S36L 2KHAA 3BGFB 3QEUB 4J3TA 4Z7VE 4PG9B 1XF5A 4AE0A 3QUHA 2CU9A 4OIIL 3SJVD 4MNHA 3VTTA 1A02N 1PLBA 2XIBA 5DYOA 3WLWC 4M7JH 1MI5D 3CMOH 4W9LC 3AT0A 1N5AB 1J9RA 3D18B 3QGVA 4R5TA 1DBKH 4MX7B 4XCNA 4JUTA 1QLEH 3U30B 1NFDF 1AIFB 3LKSA 1XL4A 2XIDA 4ZSOE 3WKNA 1J86A 1O7DC 2K3TA 1AKJD 1J10A 2XZAL 4UTAL 1T1YB 1WS7A 4XOEA 3IB4A 4NO0D 5J1AA 3NK3A 1S7RB 4EI5B 4N90E 4ZOAA 2X0WA 3S37H 3O11A 3TWYA 3FN0H 3O8XB 1KV7A 1LK2B 4Y5VA 2R9HC 3FUJA 1CYGA 5LNDA 1ZVHA 5JOFA 4PIRF 4HCFA 3WN5B 2RQEA 5K9OA 1MW3A 1JPSH 2P5EB 3GPSA 4HGKC 2OSLA 4I1NB 4D9LL 5FUZH 1DLHA 4JRYD 4KVCL 3TZVB 1IE5A 4AVKA 1VHPA 1FE8L 2APFA 2DWEB 2O4EA 1JVLA 1BLNB 1VFBA 3VD7A 1AZNA 1ZS8A 2Q8BL 1JG9A 1AMXA 4A39A 5T1MB 5JIDA 4RMQA 4UOW1 3TVMA 1INDH 4Z3EA 1CL7L 3WD5H 4ZJ9A 4GW5B 3RL1A 5GPRA 3L3OB 1E30A 5ICUA 3S35L 5FHAL 4BV1A 4IMKC 3I3BA 3VWKD 3FFCE 3BAYA 1KWKA 5E6SB 1S9XB 1MCDA 2CDFB 2GT9A 3CJJA 5E2WL 1AHWC 3EJUA 4PJFA 4AI7A 5HGHB 4JW3A 1S78D 3FQNB 3GUTA 5HYQA 5BQ7B 3CZUB 1G6RB 1B6DA 3CUPB 4XCYA 1J18A 4ETQA 3NCWA 2ZP0T 3TN0D 3I9PA 3IDGA 3NACL 1U8IB 4HWZB 4JPKL 3RDTA 1R24A 3Q3GA 2ZUXA 3AB0B 3DV6A 4E68A 1S7XA 1NBZB 4G7VL 5E4EB 4OF8A 1FYTD 1CK0L 1SLXA 1IBFA 3QPQD 4DZBA 4GT0A 5D7IF 4Z7OF 4NRXA 3GXFA 2YGQA 3W3BA 5EEZA 4FEMA 5ADOL 1R33A 2WBKA 4U7KA 4XCFL 2H0PA 2VXQL 3GI8L 3STBA 1SXZA 2J6EL 4LSPH 2XA3A 2A74A 3UABA 1IGYA 3GSUB 5IJCC 3ZE0B 1BD2E 3FQ1A 2LAGB 5D7JD 2LVEA 5CJ8A 1SHMA 4ODSH 3SBRA 1FLRH 3HFMH 1MPAH 1X5HA 4AZ8B 1CICC 3AXLA 5FYJL 3GSRA 3GHPA 2H3NA 2BOBA 3AU0A 4ZMZA 4AYGA 4NQQA 4M03A 4HS6B 3TYFA 4R2GB 1UD5A 1RSFA 3CDZA 2B15A 3IETA 4JFQA 2P26A 1MELA 4J3XA 1X44A 2BH0A 1A6UL 4WJ5A 1PSKL 5C0GA 3L3IB 2NUPB 3MRGB 2Z8RA 1YSOA 5H2BB 1KXTB 3HPLB 5C0AB 4WV1C 1U8QA 1H3PL 2YK1H 4L8DB 1DN0A 4TULL 3BCDA 1E2WA 3ATAA 1M9SA 4XRCB 1KLUB 3ZUNC 3QFJE 5CCGE 1LWJA 2OMWB 3I6KB 2ATKB 2JCCE 3NJNA 4KMTL 4OW6A 3V9CA 1Z66A 2XFXB 3PAVA 4LCCB 2ZUSA 4X98A 5FV1L 5G55A 1B0RA 5LGHH 2VDPH 1XCXA 2WQRA 1MNUL 3SJVE 4FS0A 1XVSA 1BZ9A 5FF6B 3VRJA 2JKRM 3RVUD 1MI5E 4E42B 3US1A 3S5YA 4Y9GA 2ZF8A 4K5OA 2Q9OA 2V5SA 4ZO6A 1HXKA 5I6MA 3K1KC 3PDOA 4FX5A 4MDRA 4N3UA 5DF0A 3DURA 4JFVA 1OCOB 3UEZA 3WXWL 3BFOA 1B4JH 1XGQA 3MBXL 4A38A 1MF2L 2Z0BA 3GBEA 4JRXB 4N68A 2DMGA 3Q2WA 5L4IA 2YA0A 5BRZB 1KJ2H 3ARGB 5JW4N 2CKNA 2ADJB 4FKKA 4H2CA 1SJVA 4HC1H 2X4NB 5B39A 2MIZA 2O61A 2NY1C 2FCBA 4JG5A 4FFZL 4GQPH 4YDIL 4R90H 4N0YL 4MRCA 4NXSA 4NIKB 4FQHB 5FX3A 4IBYA 1RZIB 2MOGA 4JRYE 4Y4FB 1T0PB 4UTCA 5DUPL 3TVMD 2UZIL 4YSEA 2EYSB 2QADC 5DZVA 2XETA 4HK0B 3OZLA 4KAQL 2WWKO 4W93A 4MCNA 1IC7H 2FR4B 3DJSA 4AEEA 2HPOA 4N2HA 4NRYB 3ATDA 4HG4K 4JE0A 2PO6B 3QWOA 5J6GB 3B2DC 1HZHH 3CU1A 4MA8L 1PTZA 3PHOB 1INEL 3M07A 3PV6B 1Q0XL 2GITB 3LRSA 4PJIE 4UBDD 4BEIA 2WXQA 4MS6A 2YPLB 4IU2A 4LVHB 4M7ZC 4OZHF 2O6CA 5CWSA 2AJ3A 3RDTD 4UMGA 4PJXE 1OWRM 4MDJB 43C9A 4M1DH 5J12B 1KEGH 4WKXA 1MAJA 2WLIB 4J3BA 3EZJB 3GMMB 5C9KA 1PAMA 1S5IL 2EIEA 1KIUB 1QFUL 1D5BB 3BSZL 3IJYB 1DQDH 4JFDA 4Q0XL 2BFGA 2IDUA 3U0PA 1URLA 3RBGA 3UMNA 4EI0A 2HKHH 2FGWH 3UP6A 4BE5A 1CVSC 1FYTE 1I3GH 4MKTA 3N85H 3GSQB 3PCYA 1ZANL 4NRZB 1CFSB 3INOA 5C0RH 1A9EA 4Q2ZA 1IAOA 1NOFA 2UWEB 4KJPD 1BLIA 4DCQA 4NHUB 4J6IA 5MP6H 1TTUA 5EZPA 1DVXA 5M7QA 5T5FA 4C59B 2C9RA 1EGJL 5F2FA 2P9RA 1OB1B 2WYHA 1X5MA 5BO1L 1JZ5A 1AYRA 1EO8L 1H3UA 3DO3A 3UCRA 3O0RH 2OQJA 1P7KA 3QCTL 1VFUA 1DVSA 3IDJB 3OHMB 5A2LH 4OUUB 4GLRI 5DD1H 5FLUA 4XWOC 4Y2DC 3SPGA 1HCFX 2W0KA 1LDSA 3ULUD 1I82A 3N3EA 2IQAA 3RIFK 4YL9A 3VFRA 4G8FB 2VRKA 4DW2H 1E8XA 1QFHA 1EEZB 3L5XH 2ETWA 5L0QB 3S36X 5DJZB 5I18H 1CE6B 4X5WB 2CJUL 2X3CA 2X4PA 3T4AB 1FL3B 1KXVC 5IHHA 3CPLB 3G6AB 4ZS7L 3EOAA 2H0JA 4N1CA 1A3LH 1L9TA 1NJ9A 4N87A 1DJGA 1KJMA 1QI5A 1G7QA 2F0CA 2W9DH 3L1OL 3RWJA 4PYGA 1G7JA 1RHHA 2VRQA 4LIQH 4M43H 4QXUL 2VC2H 2XQYK 3S36H 2ICCA 3IAQA 3T0XA 2Z4QB 3ZHKA 5EU7E 3WJMA 3DX7A 1JXGA 2DQGH 2CM5A 1YQVL 4YMPA 3F6LA 1II4E 2R23A 2ZKXA 1OHQA 3FUKA 4G1EB 1MY5A 5ETUB 4D7PA 5C0EB 2ICEB 1OANA 3IBEA 4FTVB 1WDAA 4FP8H 4CW1B 1EAOA 3Q5OA 3KWUA 2H1PH 3D09A 3HS0B 4PP1D 2BVUA 5DUBB 3OPZL 4IMLB 2XZAH 3QO1B 1H8SA 1KLGA 3HMXL 3HUJF 4GRMA 3NCYS 2Y7OA 4RNRB 2OL3B 4XP5H 4GW4A 1VGKA 3MJ9L 5G4OA 2YZ1A 4Z78A 2I5YH 1OSZA 1FZKB 3QNZA 4PM1A 4UU9A 4CA4A 1QRND 4KDTA 3WO3B 4K0OA 2GJ6B 2F5AH 2HX7A 3BDBA 4PJFE 3AM8C 2X2YA 3TEWA 3ZVVA 1OGAB 3KAAA 4QGYA 1NFIA 4PHXA 5JIMA 3SSGA 2WPGA 1QUPA 4KVCH 2YWYA 4PBDA 1F4YH 4JFDD 2WLMA 2YSTA 3Q06A 4ODTH 4WKZA 4RSYA 5KBDA 1U8CB 4AMKL 4AENB 4JB9H 4EKXA 3O9WB 4JFFA 1DEEB 4MB4A 3CVHH 2H5UA 4LE8A 5SV4A 3HFFA 4GXUN 5F3BB 4AITA 2MFNA 2YSSB 4V33A 2RMNA 1I7ZA 3BVDB 1I7UB 1N7MH 1EV2E 1L6ZA 3KS0H 3JWNG 1EMTL 5SX5H 1BZ7A 1A1OB 2HFEB 3BI9X 4LSRL 4APQA 2OXGB 2R2HA 4J8RB 3C2SA 2J25A 2HYMA 2FBJL 3ABMB 4A66A 3SO3B 4AJWA 4GJTB 1FH5L 5T33H 2VR9A 3FT4B 4AL8C 5JMRA 3RRQA 1IKFL 5F9JA 1KENH 2GK0A 3NACH 3ZL4L 4KUCD 3MGOB 2I60H 4TQEH 5DJXB 1OO2A 1RLWA 1WBZB 1KCWA 2P5PA 3DOSB 3F7VA 4K3DL 4RVBA 1JNHA 4YGAB 4G9FA 3WNNA 2IH9A 4JGJA 1B88A 4BZYA 2VN4A 1K4DA 3UGXA 1YNKL 1P2CA 5ADOH 3D3VA 5H4YA 3ULUE 3DHJA 4XCFH 4MNGA 3D85A 3GI8H 3SKJL 5T1KB 4XVJL 3KS0J 4DKDC 3KNBA 1EXUA 1N0XL 1Z0MA 2YMOA 2UUDH 2VERN 4ZPTB 1DBML 3LAFA 1BF5A 5DFVC 3MNDA 2GJZA 4AJYV 2PXYA 3D1MC 1UKTA 2KUTA 2C3VA 2Z31C 1JPGB 3PAZA 5I2IA 1QPKA 2OM5A 5INCA 3VYPA 2OMZA 4DK5A 4MBOA 4LSUH 1KB5L 1OAKH 1PSKH 2BZCA 4HJIA 1FFTB 4UM9A 4BCXA 5TD4A 5AVZB 1KCRL 3OKNB 1HDMB 1RZGB 4JM2D 3V0IA 4FLHA 5AD0B 2JLLA 3QIBD 1MCQA 5IQOA 5EO9B 2YKLL 4YBHA 3UTPD 4UV4L 4KHTL 5LGYA 1A6ZA 2DTSA 2KZKA 5CLWA 4NZTL 4PTTB 5D1XC 5FA4B 1FGVL 2CO6A 4PJCF 4R96B 3CC5A 1TNMA 2JJWA 3DETD 4WU7A 3T3MF 1BVKB 3U7AA 4UUJA 1TQVA 2EC9T 5IB1A 3MBXH 5IW1B 1MF2H 3S48A 1NGZA 1EERB 3HR5B 4LRIA 5IFAH 4AQ1A 3O4OC 4RGOL 3LH2L 4AQ8C 2R0KL 5KSBA 1UT9A 1QRNE 1S8DA 5C0BA 3ZYJA 5JHAA 1UCBL 4PJ6A 3FZUC 4JJ5A 4JY6B 4UAHA 3ZKQD 2C1OB 2YMTA 4W9HC 2B59A 3EFDL 3L3JA 4XHJD 2NXZD 4JFFD 5I1LB 1PG7L 2ZP9A 5HHQB 3FUDA 1IQWH 2MRYA 2X2JA 2RAMA 1VB9A 1ZT1B 2DDQL 4LVNC 1RK1B 2UZIH 1XH2A 1KN2L 4AOFA 1OD9A 4JFDE 5FYKU 5IESL 2F68X 2PUQT 4C8XA 4CGTA 2R15A 1JTTA 2YARA 1DL7H 3U6RB 1HYSD 3B6SA 3ESVF 5CLTA 1U95A 1UUSA 2BDNL 2I26N 1YEFL 4NOFA 5KS9B 5EMYA 5GZOC 4FI7A 4LBAA 3D2TA 3ILPA 4APXA 1MUJA 4K15A 3S5LB 3D4YA 4PLKC 4ZFGH 2H6UA 2I9LB 3FTYA 2CUMA 4HJ1A 1VZIA 2DM7A 1CXEA 4NGHH 3F7PC 4HIHB 4GKZA 4CVXB 3SODB 1TXKA 1KZYA 1P0SE 3UZVA 3VG9B 1K2DB 2I69A 5CAYB 1S5IH 5DWPA 4YPGA 2IG2H 3D3VD 4OAWB 1E8WA 5CD3B 5D8JL 1JFQH 2ZUWA 4F24A 5DTFB 3BDXA 2IH3A 1UACL 2YAPA 2ATPB 3NN8A 3U4AA 3ZPDA 4X6FA 5A3ID 2PYEA 4BUHA 4F9LA 3KLQA 2PXYD 4DEPB 1DSFH 5HY9A 3GBDA 4ABQA 5ES4B 4U1SB 1DLFL 1IX2A 3P4MB 4IEFA 1ZE3H 2JCWA 4JL1A 1HAWA 3T0BA 5KW9H 2CKBA 2QGDA 3VFTB 3MC0A 1EGJH 3FN3A 1OGSA 5EBGA 4GRLA 1N59B 2MTAA 2H26B 3MDJA 3X17A 2V17H 1YNLL 4UM9D 1ZKAA 3MFFB 2Y7LA 1OAXH 2MHAA 2NMSA 4XH2B 3DSFL 5FEBA 1NBYA 1EJOL 3ZL2A 2YXVA 4YSAA 5BUGA 2C5DC 5CM1A 3V7MA 2AJYL 1VADB 4HK3J 4XOAA 1DR9A 4BHUI 1N10A 1THAA 4B53A 2Y06L 5CEYB 4K5LA 3B9KA 4R3SB 1G9NH 1JUFA 1OQOA 4HKZB 1U8JB 2BVYA 2P44B 2CJUH 3MOBH 2QKIB 3N9GH 3NVQA 4X6BB 3ZU8A 4QJ4B 2AJXL 2A99A 5IHZA 4JDEB 3NIFB 1L9RA 3UTPE 5FW6A 1HJBC 4XB3A 1C8PA 4LK4A 5E8PB 4PREA 1GZPB 1XGRA 3ALXA 4R4FH 2AK4B 3ZZQA 4F2EA 3RDJA 1JF1A 5FO2A 4CAGA 5KN5B 3MCKA 1MDTA 4N25A 3FQXA 4Z7VB 1YDPB 1TTGA 3KEHA 3QUYD 1MHHA 2OTUB 4XNXH 5DJAB 1UXWB 3GMOB 3U0WH 1LVEA 1GS8A 5C0BD 3WGVB 4BXVA 4PGZA 3VXUA 4TUKL 4F1SA 4KZEL 4ZNCD 4Q89A 3LVTA 3QULB 4DP4X 4OT1L 4JLRB 1S6NA 1WBYB 4KROC 1PZ5B 4LKXB 1NDGB 5IG7A 4ODVL 3QYMA 2OS7A 2YMXL 4ZSOB 2BVEA 3P69A 4GMTL 3RWIA 5CF3A 4JFFE 4H1LH 2VDKB 4GW1B 1RIHH 2YQGA 2BMKB 3EJZC 3M1CA 5B38G 1G0YR 1X7TA 3BMVA 4YHKL 2WMPA 4KTGA 3NSXA 2NY0B 1R3LB 3RVTC 4NKIH 1JCVA 5E5RB 2Q7AA 3G5YB 5AZEH 4FG4A 1MRFL 4FI8A 4NQEA 1AQKL 1E43A 4UZUA 2GK2A 1L9QA 1X5JA 4Z23A 3MLUH 5J7CC 4FQPA 1H8LA 4JJHA 1OP3H 4ZFOB 3UTQB 1TVBB 3LDBB 4YK4B 4KFMA 1AHMA 2ZXQA 3MROA 2YPKB 2NNXA 3DLQR 2AITA 3SQBB 3ULVH 5AWNL 4QY8B 2PYED 2WC7A 4FE9A 3QCVH 2QMJA 3FFCB 2ESVA 1NMAH 4OD3L 5B3NA 3D3VE 3PNWA 3ARFB 1HFUA 3DGDA 4MNGE 5EA0L 3NJMA 4IIZA 2F5BL 4LSRH 2YXWA 4N2OA 5F7DA 4GRLD 2H3KA 1I8LA 3JWDC 1SMDA 4AQAA 4NLHA 3SPHA 1NLBH 4IS6B 4XB7A 4K73A 4A7TA 5JLZB 4OSUL 2ICWJ 2WIMA 4ELMF 2PTTA 5GGUB 1IKFH 4GO9A 3NSFA 4HOZA 5I6KA 3ZL4H 4IK6A 2EYTB 5DDHB 1JK9B 3U36B 3MMEB 2VZ3A 4MZ2A 3QORB 1FO0L 2AABL 3QBTB 1A7OH 8CGTA 3B9KD 2Y1YA 4K5MA 1YNKH 1Q8MA 5FM8A 5LBSA 5FO9B 1BD2B 3FFDA 2X2HA 5I5MA 5I6NA 4TLTA 3GZKA 3RFRA 1HAUA 4BDVB 5A16B 4YLBA 1D5XB 5D70L 3VSTA 2J1WA 4RBPH 4XMLL 4I4WB 3NRPA 1PBYA 2IBBA 3GSVB 4P5TA 5DWUH 1Q9LA 2X89A 5E08H 3FT2B 4P5MA 3VFPB 2XG5B 3MV7B 2WCPA 3ZZLA 4HUNB 3CK0H 2J1ZA 2QHRH 5CS7A 3DRQB 3GKWL 5FKPA 3VXUD 3FUNA 4PIBA 1EDHA 3QFJB 4UM8A 4PVMA 2JQMA 4LLWB 2BM3A 5D6CA 1ETZA 2YN5A 3QUXC 4KK6D 1HHKA 2L0DA 1GCYA 1N8ZA 3CBJB 3FU8A 3F5WA 5EOQL 3MREA 1UUNA 3SJVB 5KSBE 3FSAA 2IDSA 5C0BE 3V95A 1JNJA 1WQVT 3E0GA 3U48A 3HAEB 4J3UA 3DDGA 4EIUA 3C87A 5L7XH 3PWJB 1FGVH 1UB6B 3V4VB 5HHPA 2HG5B 2NNFA 3MOAL 4H44C 3OG6B 4ZMQA 3DO4A 4HKBA 1PG7X 2NXYC 1AKJB 1MFBL 2MQCA 4MZRA 4WW2B 1BSIA 1QSVA 5JPMA 4WI0B 3SYCA 2F53A 3GKZA 1NFDA 4NC2B 5I1IH 2CO7A 1HN1A 4NPYA 4NQED 5J11B 5ESQA 4WK2B 3ULVF 1DQJA 2XY2A 3IJEA 2VR3A 5D2NB 3T4YA 1QHQA 5HHOA 4HBQA 1USQA 3HJ0A 4RGOH 2GUOB 1FFRA 4KK8D 1AZCA 2PR4L 2R0KH 3V6FB 2WSDA 1KY6A 2C4FU 5LCVA 4G70B 5KVGE 3DV4A 4JRYB 4N8VB 3FO2B 3IDYB 1PG7H 2F19L 4G8IB 3POHA 5JW4Q 2ESVD 1KT2A 3R06B 3X13B 4PD4J 2BNQA 3LN4A 4A2GA 1KN2H 3HZVB 3GXMA 3FU9A 4N86A 1DZBA 3HG0A 3FUMA 4HXBH 1EAQA 4MJ6B 5A2JH 1NAMA 1BZEA 2OR8A 2BOLA 3TIDB 2YEZB 5E4IA 5I1KH 1JNNL 1HQ4B 2XBDA 2PYEE 1JD7A 4FQCH 4PJIB 2ZNXA 3VWKB 4C47A 3SE8H 1NM4A 5AVUB 2ZUQC 3WHE1 1TMCB 3T04D 2CRIA 4L05A 3FTXA 4PJXB 2ENJA 3D69A 1J1OL 5JIQA 3NPSB 4QXWA 4ZFZB 5KANG 4BSVB 3SE6A 1CCZA 1NCNA 5KJ7E 2DQEL 5E8DH 3TN0B 1DVFA 4LCUA 3IRCA 4ANUA 4L4VA 3C8KA 3SE4C 2QPSA 5F9WB 4Y2LA 1WT5A 2ZPKL 4R5VA 1FA4A 1V8HA 4ENEC 5D8JH 1FYTB 3EJJX 3PG2A 5F3HA 2FWOA 3QR1A 1T5WA 3WEXA 1IGML 2B7DT 3KZ8A 3KCWA 2X88A 4AXWB 4H0LC 4I3RL 3BZEB 4AYDC 3KYOA 4HS8L 5D7IA 4D2NA 4KH9A 4P5TD 1RZFL 5L2JA 2Y3AA 3O6FB 2EIKB 4ZPVB 4BFIA 4HAFA 4NYLA 5D7JB 2QQNL 5C3TA 4D3CL 2JLPA 2GFBB 2JJSA 1QSZA 2K45A 5FAAA 2X38A 3MFGB 3P40A 1XZ0A 5I5RA 2DI9A 4ZMWA 2K8QA 2PCFA 5C09A 4UV7H 1CD0A 1I9IL 3QYNA 1SN5A 1XF5B 4NN7C 2F58H 2E5EA 2EEDA 1Y07A 2ENQA 4FG0A 1KPRA 2VDQL 1FWXA 3FT3A 4MNHB 5DYOB 1UM4H 3VXUE 1KYDA 2EH7L 5ADPL 5GGTH 2Z0UA 4TPRL 4P4KA 1HJCA 4NM8H 4JVWA 5TF1L 4XCNB 1O9VA 5CN2A 4F58H 5IOPA 1CI5A 2AVFA 1CDCA 2H9GA 3LKSB 1KB9K 3ZQWA 2OMVA 1NWOA 2X3BA 1ZIBA 3Q6FA 4FNLL 3KLDA 3ECWA 3V52H 2F53D 5J1AB 4HP5A 2D7MA 3L7FB 4L9LA 4OGYL 4GSQA 3VMPA 2X12A 3CN2A 1NC4D 5HHOD 4Y5VB 3K7UA 1MCNA 4BFGA 1E8ZA 4X5RA 5EC2A 1YNTF 3C5ZC 4YQXL 2VIRA 5EHFA 3O45A 1QG3A 3CH8A 4W9FC 5K9OB 5IT2H 4CL7A 4NX0A 1G94A 4NQEE 5DHXB 1W0WA 1XH3A 2WWNA 1DLHB 1G7HB 4LQ1A 5D1ZD 3EDFA 4U1KB 4P07A 4F8LA 4OT1H 4JPWH 1NCOA 2A6JA 1JJUA 3EO9H 3VXMD 1VFBB 2VDNL 1ZS8B 1BQHG 2GTQA 2BNQD 3IDIA 3DHPA 4BGLA 1G7IA 3ARBC 1S2EA 2APSA 3TVMB 3W9EA 3RL1B 3MLYL 1MFCH 1UWEL 2PP7A 1LO2H 5FGSA 4H25A 3O3AA 1E4XI 2ESVE 2NCMA 1Q90A 5FGRA 3C09C 2XKNA 4K23L 4NJAL 2GT9B 2EIDA 2CCVA 4PJFB 3ZR6A 1KCVH 1RD6A 2NY2C 2OK0L 1U8HB 2VSMB 2EIBA 8FABA 5HYQB 3JTTA 3GUTB 1I7TA 4XCYB 4Y19A 4ETQB 1AQKH 1DVFD 4AUJA 2GIMA 3NJLA 3IDGB 3ZX1A 4XWGH 4MXWL 1JRHI 3UBFA 3RDTB 3RZWA 1JAEA 1R24B 3Q3GB 2HAZA 2YUVA 3DV6B 3VFMA 4L3FA 3FHAA 2Y36L 1S7XB 1TU2A 4OZHA 4OY9A 1CGXA 3BP5A 2O6DA 4UT6L 2VKXA 5BJTB 1SUJA 1UWGL 2Y1VA 2Q87A 2X4UA 5EBMA 1XF2A 4EPSA 5DRZA 4O2EA 3NTCL 4FFYH 2A74B 1A7NH 2XWXA 1IGYB 4HV8A 5E1QA 2EVIA 1NKOA 1FVCA 3WUZA 3IVKA 1S46A 1PVHA 3TH2T 3I75A 4OLUL 5DQDL 1RZKL 2XXCB 5A6MA 4O00A 3AXLB 3N42B 3QRBA 1NUFA 3GSRB 4AX3A 4UNVA 1ROCA 2H3NB 1IC0A 2BOBB 3M6DA 1NCBH 4FEIA 4WEBL 3GEWB 1GYVA 1PL3A 4NERA 5C09D 3TYFB 3F2LA 3RVWC 3CDZB 3IETB 3K2UL 4NDMA 3BVVA 1O6SB 4LEEA 2BWDA 4WJ5B 5BZZA 4F93B 3N40F 1NICA 2VERA 4MQ7A 3VNZA 5C0GB 4KJWC 4OCRH 4NPJA 1Z9SA 2J21A 3BPOB 1U8QB 3Q0HA 1P4IL 3Q48A 1DN0B 3EHBD 4G6AD 1V55B 4M4RA 4AGMA 3M8OH 1A7RH 3V9FA 3CN3A 2FH8A 1JZFA 4FYSA 4X98B 1TQCB 1B0RB 5B7FA 1PNDA 4BM7A 1C5DA 2Y69B 2ZKYA 4HJGA 4CKQA 3ELAT 4U6YA 2PYFA 3VRJB 4ODHL 1BM7A 4P3CH 2RALA 2PCYA 3WEAA 4N9OB 1UM5L 3OMAB 4J8QA 5BZDA 2VM9A 3PDOB 4JRLA 4MAYC 1CIUA 3DURB 3IU4H 4IJTA 1ZCRA 5EU3B 3F65A 5BOJA 1XGQB 4FNPA 5BZXA 2XBZA 3HC3L 4TVPL 1KJ2A 1SEQL 4LOUD 4WWOA 4KI5C 5KSAA 1L7IL 4Q8BA 3B2VH 1RZ8A 3O6LL 1NIDA 2F53E 3WAKA 1NFDE 5CP3H 1D2OA 2F8OA 3WIHA 2R0ZL 4WI6A 2VMEA 4X6DF 1D7FA 5LG6A 5HHOE 5B39B 1GXEA 3RX8A 2O61B 2VQ4A 2ROYA 1U2YA 4GKOA 1XWVA 4U6HA 4NIYE 3ARVA 3B5TA 2JKNA 3OAZH 4TL4A 4QGTA 3OSKA 5EIIG 4NN5B 3RUGE 3X11A 1OP9A 1JWUA 3GHEH 5DS2A 1PKOA 4PRAA 3V6OA 1EHXA 4N3TA 2M26A 4ISVA 2BNQE 2YIHA 2V3FA 2B5IB 4ZUVA 1P84K 2X6AA 1MFBH 3QWOB 3KH4A 3OMIB 4ZOBA 3NJVA 1JPST 3BH4A 4UILL 4XPTH 4XGZA 3LRSB 3GJFK 2D7NA 3BIBX 4IU2B 3S2CA 3KPSA 3LPGA 4AYID 4EZKA 2D7TL 1G7MA 2ZOTA 4IRSC 4LESA 2AJ3B 3KG5A 3HUJA 5CWSB 4G7YL 1XEUA 3S3BB 2OJEB 3EJYD 43C9B 1GKEA 1RPQA 2PR4H 3D12B 4U05A 3LQAL 3QHTC 2FYVA 3VGEA 4M6AA 1X7QA 1SHWA 5B38A 1KGJA 2EDWA 1YYML 4ILDA 1CBVL 1BMWA 1H6EA 2ZOLA 4OIAA 4JFDB 3AG3B 4ZFFA 2WBJA 4N22A 3AADB 2WV3A 3U0PB 4NO2A 3LRHA 3IDXH 3AUVA 2CLRA 5E56A 6PCYA 1CLYL 3BZ4A 4XN7A 2TSAA 3MCLL 1Q38A 1J9TA 3WS6A 3KGTA 4YDVA 2YFNA 1A9EB 4Q2ZB 1JNNH 1IAOB 3BAKA 3FSWA 4HD5A 4DCQB 1BF8A 3EBIA 3KL3A 4ELDA 3VD4A 5D7IE 4Z7OE 1N6UA 4N8CL 1JMZA 1PF3A 2DM4A 4IOSA 1XHHA 1S9YA 1P7KB 2AJSL 2OQJB 4I2XE 1O9WA 5C09E 5CKAA 4NB7A 4UIMA 1M6UA 4XC3L 1ODAA 4KU1A 2NCEA 3QI9C 2IQAB 3VFRB 4FJ6A 3LPOA 4Z7AA 4DH2A 4CU8A 4L29B 4HWBH 3JV6A 3NA4A 1TVHA 5DJDA 2A38A 3G5XA 3JYBA 3MGTA 4QHMA 5D7EA 2X4PB 3B2MA 4KQ4H 5AOMA 2VXSH 1KTJA 3IJSA 4CDGC 5EBLA 5KVMC 3HN8A 3HHMA 4YSQA 3EOAB 3I9GH 1KYOJ 1W15A 1OV8A 2HT4C 1NJ9B 1XSOA 1KJMB 3QZPA 1ZLVK 3P0VH 4AVIA 5DVOA 1G7QB 4GAGL 1RMFL 4MQSB 2QQNH 1AZZC 3RWJB 4GPVA 3IU3A 3TONA 1G7JB 1RHHB 2YPVH 3MRNA 5GJSL 3GSNH 5LNEA 5JQ6H 3DIFA 4DEUA 5CU9A 4MNQA 5DZAA 3WJMB 3DX7B 4PJEF 4HJJL 2GHWB 3ZKND 2PABA 3CXDH 3PS6A 2R23B 3WJLC 2ORBH 2VDOH 3HHSA 3OKKA 5TFSH 1P5UA 5I82A 1GPOH 4XO3A 2ED6A 3WO4B 3O4LA 5D2LF 5TF1H 3LEYH 1TJXA 4DZ8B 3WLBA 5D7LA 1PFCA 3CC1A 4UQBA 1XAUA 4I7ZC 4PJDF 5SWSA 5AAWA 4FNLH 3ZLQC 1KLGB 2D0FA 3EGXA 4GRMB 2K70A 5INDA 4GW4B 2A9NL 1ESOA 3FRPG 3L81A 2Q2LA 4Z78B 2VAAA 3KPSD 3QNZB 2A77H 4WEMB 4PJCA 4LPYA 2EXWD 3NCFB 4JFEA 2DM2A 2NZ9C 4K3EH 4AMWA 1NGQL 1DSWA 1NFIB 1BIHA 1QFWI 4QWWD 3BAEH 2I7SA 8PAZA 5HJ3B 5HXMA 3CVHA 2QPFA 1ZVNA 1P53A 2WBJD 4WKZB 4F2FA 4NQTA 4OCXL 4E9WA 3OC5A 3BISA 5D96B 4JFFB 4MMZB 1X5LA 4OZHE 2Z93A 4WEEA 4JL2A 4NBXB 3JVGA 1I7ZB 5JORB 3QWQB 1C5BL 3MLYH 1A9VA 3GM0A 4ZZKA 5J3HC 4P23A 3HE6C 3VGAC 1BZ7B 3MODH 4APQB 5EEYA 4XO8A 4I5BB 2R2HB 3WNPA 4LLUA 4KTYA 4LRNH 4WWKA 5SX4H 5D93C 4PJ8C 4YDMA 5TJWK 1WWBX 4WUKL 1BYNA 5KJRL 1DVZA 1XCTA 4UTBL 5E6YA 4X9FA 1ET7A 2OZ4A 2R1XA 3CBRA 2FQEA 5F9JB 1EK3A 3CZEA 2OR9H 4M02A 2GK0B 2ZP8A 3BQUA 5F7UA 1FAIH 4FGMA 2R0WL 3F7VB 2ADGA 1JNHB 1F6FB 4G9FB 1DQVA 5T1DH 1HC1A 3MUGA 4F57L 5AB2A 4GSXA 1OT4A 5AAMA 5EOCH 3N91A 2C26A 4OFIA 5C7XH 4UT6H 1P2CB 3ZE2E 5LDUA 1MFEH 2YZ8A 3D3VB 4Q74A 2QPUA 2PCPA 1GA2A 2AF2A 5HTSA 4MNGB 3IJ7A 3D85B 3QIUC 2EIMB 2ZJSH 3KNBB 1EXUB 4WDIA 1I9RL 4OV6F 3HBGA 2GJZB 5FYJU 2PXYB 1AO7D 4HH9A 2MMXA 4MDIA 2C3VB 3C8DA 4POZC 1E4KA 1G6RL 2HUEA 3Q8EA 5TQ0L 5I2IB 3BDYL 4ZUUA 5INCB 4HX1A 4XBGB 2Y6TE 2HT2C 1AQ8A 4KXZI 4UM9B 1CU4H 4LF3A 4X4MA 3P77A 3T9WA 3ZE1B 1AC0A 5F9AC 1Y6KR 5EOCJ 2QMKA 2QZQA 3LZLA 1S9VA 3O4LD 5D7LD 1VPOH 1JHKH 3APFA 3MV01 1I8AA 3AT9A 1AQDA 2E74C 3U7WH 2ILLA 4N2IA 5SWSD 5I16A 1E7VA 1E2VA 1IJNA 1E4JA 2CO6B 2NQCA 4GAAA 4HZ1A 4X4ZA 5BVJA 5I0YA 3CC5B 1JV5A 2CD0A 4JPVH 4NKQB 4WU7B 3V6OE 3N0PB 4X99A 4UUJB 5IB1B 2Q3ZA 3ZZ1A 2P8LB 3HC3H 4DQOL 3FH5A 5TF0A 1NGZB 2HH0L 3ETBJ 4JFED 5HGAA 1UH2A 1L7IH 1F56A 3QQNA 4FQ2L 1RK0A 5JXAL 1OOAA 1NMBL 4AQ1B 2NR6C 2R51A 3P3UA 4YE4L 5EV7A 3GLDA 3KPSE 3N1MC 5KSBB 1S8DB 2DBLL 2WLLA 3ESPA 1Z5YD 3HUJE 5C0BB 2E9JA 4JJ5B 4H26A 2B59B 3L3JB 2ZCLL 2YD9A 3QHZL 4UT7L 4F80A 1MHEB 2XPGA 1HNGA 4PBWD 1FDLL 2EDXA 3RNQA 1M1XA 1DANU 2CPUA 3KWXA 1UVQA 2AQ3A 1F02I 4PY8J 3V4PH 4U6VH 3N1QC 1H9DA 2B39A 2XZQH 5DMKA 2JIXA 4P23D 4LARH 4HCGA 3GDCA 3B6SB 5FCUL 1GR7A 2F2HA 1ZVSA 2HA1A 3GMRA 5C0JA 1T1WA 1C1EL 2AQNA 3FQWA 3FYIB 4WWKD 4YXKH 3M45A 4J1UA 1AP2A 2ZXAA 3EJRA 3ILPB 1MUJB 3NEEA 4APXB 1NKRA 2OMUA 2VXTL 2DN7A 3L9RA 1BQHA 5BW7C 4AEFA 5L6YL 4GINA 5IR1A 3BQUD 1HESA 1NOAA 4KXAA 1Q94A 1JGIA 3FQRA 4GKZB 4G7YH 1CDJA 2VDRH 3UERA 3ZT5A 2BLFA 3W37A 3WTTA 3UZVB 4BZ2L 2PW1B 4B0MB 4X9YA 4FNQA 2CSPA 4YPGB 2V8MA 5JTWA 3ETBF 1MWAH 2IH3B 3AW5A 5E00A 1ACCA 2DWDA 2IFFL 3NN8B 4Y4KC 5JHMA 3BUPA 3EOBA 3R19A 2PYEB 2YGOA 5CIPA 4FXGA 4B50A 4QRPB 5AOKA 5HY9B 5I1AA 3Q8BA 2WZ0A 4QEGA 2J4WL 2AZAA 5ITBH 2NY4D 5DYFA 3JTSA 3MBEB 3D48R 3EJSA 4IEFB 2I24N 1UFUA 2OX5A 4ZW7A 3V0AC 3KLHD 2CKBB 4LPWA 4N0UA 3X1GA 2B9AA 4GRLB 1HI6A 2YRZA 1NTDA 1AO7E 1U58A 2MHAB 4W81A 3GBML 1EBAA 2AJSH 1NBYB 4HCRL 1ITBB 3RWHB 4JGMA 5DQJA 2XTJE 3WEBA 1PFOA 4YEEA 5EC1B 3LIZL 1WIPA 4OFYA 3QEQA 4QCIA 4KKLD 4ELMA 1YAIA 2ADFL 2WQWA 3B9KB 2VLMD 4L8SA 3U9PH 5LJYH 1JUFB 1RV6X 4E5XG 3FCGA 3OC8A 4IBLT 1I3UA 1M42A 2JTDA 4NZRH 3TA3A 4FNTA 2BIPA 1QEXA 2F8VA 4GYBA 4M5YL 5IHZB 2XPYA 3RWCA 1QI3A 3OVUB 4P2OC 3O4LE 1XR9A 4NQUA 5D7LE 1QO3B 1LO0L 5F89A 4JANA 4PREB 3TESA 1XGRB 5DA0B 4WWID 3NA9L 5SWSE 1J1PH 2XVGA 4HWNA 5CGTA 1JF1B 3MCKB 3L1GA 3FQXB 2GBVA 3RTQC 1IBGH 5GISH 2O6EA 3F8UB 4BE6A 1MHHB 5GJSH 4L0YA 4PJCE 1U33A 2EADA 1ILSA 2LU3A 4X7SL 3VXUB 3BWZA 4JFEE 4HJJH 1NCTA 3T3ME 2COVD 2WLYA 2KZBA 1ILUA 5CNHA 3WI9A 5IG7B 3C9NA 3VCLA 4JQXC 5E9DD 3CFJA 1FHNA 4UINH 1JHTA 4H1LA 1C8QA 4XI5C 1OEZW 2N7AA 3KBFA 3RWIB 1QX1A 2QQLL 3D87B 1E9OA 4ONFL 4HFWA 5AB0A 3QUML 1PY4A 4JQVA 5IHUH 4I1PA 2HTLD 3GC3A 1FC1A 4KI1A 3AWEA 5IB2A 3AREC 2WMPB 2A9NH 3KLSA 4GG8A 4LHUG 3SDAC 5DEGA 3VB9A 2BY3A 1HKLH 2ICWA 3RJQB 5TQ2H 3H9HA 2FJUB 2Y4SA 3MTRA 3MLZL 4NQEB 1P9MC 4FMFA 3CN1A 4GS7C 4MVBC 4RFOL 1TUPA 3BKJH 1BA9A 1UGKA 1SDAB 4JY4A 3L95A 1OLLA 4OD1H 3ME0A 4XBEL 2Q5BA 5GGQL 4LVEA 2J55A 4NBZB 2QQKL 4JHWH 4F7MA 1LMIA 3MROB 1A64A 1R46A 5HI4C 4NNYB 4GI6A 2LVCA 2YUXA 3P3YA 2E7HA 3B1TA 4TQHA 2IBGA 3S8WA 4TNVF 1QRKA 2ESVB 3PNWB 2ZKWA 3V0HA 2D7OA 1J5CA 1S9KC 1J87A 3NFPA 1E4WH 1OF0A 4AV4A 4FQJH 3N06B 3W2DL 5F7DB 3GXIA 2B8OT 1PZDA 4FABL 2MNJB 2Y3NA 4ABUA 3EOYG 4AQAB 1UZ6F 2MSPA 4OJDH 5L8KB 5EZIL 3GSWA 4WUKH 3NAAL 3WJJC 2EZ0D 1I8IA 1P4BH 2H6PA 3FO0L 2PTTB 3VD0A 4AKQA 3NGBC 4IRJC 4BKSC 5E7FA 3MRJA 3LNEA 3VVVA 4OFYD 3QEQD 4HJSA 3H54A 4Y4HA 4I0PA 4X4ME 5H35A 4PJ9A 4Z7NB 1SM3L 3SGJC 3A22A 5J13B 3ASWA 3CLEH 3TA3D 3S98A 2DEWX 3FFDB 2DQCL 1GOFA 3NP3A 3E8UL 4G7RB 1E7UA 4FKHA 2DICA 2ZG1A 5IZ7A 2VLME 4XXCA 2F54A 2J1YA 1SLWA 4X0KA 2YBRA 4P5TB 1Q9LB 4WW1A 3TEYA 5DMGC 4P5MB 1MJJB 4LPXA 5TQ0H 3VGGA 2NUTA 2DLEA 3BDYH 1SFDA 4MJ5A 1ICTA 2VXVH 5FKPB 1ND0A 3W1ZA 1KG0A 1K4CA 4XMXA 4UM8B 1WO2A 3CSYA 3TIEA 1XDTT 2O30A 2VQUA 2X4OA 5D6CB 3A6BL 1ETZB 2V2WA 1HHKB 1PU0A 1YY8A 1N8ZB 1RZKC 4YVNA 4DP8X 4I89A 3MREB 5GGRY 3QW9A 4U3HA 3L9BA 2DWTA 4YHYC 5AG9A 1YG9A 2W8CA 1QSFA 1KGUA 2YLKA 5HHPB 2GBTA 1E4HA 4AZUA 4FQIL 5E9DE 1YEGH 3MLSL 3ZYZA 4HKBB 3H0TB 4HUKB 1J9SA 4M1GL 3SY0A 5JPMB 3OB0H 2AHIA 3B2UD 2FQGA 4M5ZL 2F53B 3BKYH 1NFDB 1SFHA 4ZO9A 2CO7B 2OMYA 4G42A 4NPYB 4YXHL 2HH0H 3VTMA 5ESQB 3RGBA 1DQJB 2BVPA 3JBG7 3IJEB 4FQ2H 4GBXD 3T4YB 3QJUB 1R3IH 3QVAA 4O58L 5HHOB 1QBLL 4B41A 3MVSA 1ZLUH 5I73B 2JMRA 1L7TL 3BN9D 4XOCA 5SX5K 2R29L 3HNTH 2VRAA 3ULVD 2WVUA 2DBLH 3DV4B 3L4WA 3Q1SL 4C57C 4UT7H 1YNTA 2ZCLH 4ZUTA 3FRPA 1FFPA 1CDUA 5AQ0A 4Z7WE 4KXBA 2A83A 1XT5A 4ADIA 1KT2B 3WKPA 1JI2A 1U92A 2BNQB 3LN4B 5IMKA 1RCYA 3QUZD 4K71B 4RAVA 1NAMB 4DGIL 4JAMA 4D0CA 4H88L 4Z0BL 3ZMRA 4YDNA 2AXGB 4M6NH 3DO7A 1VRSA 2XVBA 3DK0A 1A6VL 4ABVA 4J12A 1NEUA 1A4JA 5C0CA 5IJBC 3UZEC 3D69B 2UXGA 2RFXA 4HA1A 3D30A 1EAPA 4XT1C 5EG6C 4N0UE 3UGUA 1R5WA 3SZKC 4PG2C 5ICZA 2XYCA 4K8RL 5LQBH 1DEDA 3P2DA 3OR6A 1OSPL 4Y4HD 1DVFB 2DWYA 4LCUB 5AL8A 4FN0A 4PJ9D 4BZ2H 4L4VB 3C8KB 4FFWD 2ID5A 4TUUA 5KYXA 5FM5O 1VCBC 2CUIA 3IAGC 4OGAC 3IJHA 4IYKA 4NQSA 2NY3D 3HG3A 5F8QC 1UKQA 5F3HB 1GJUA 2FWOB 4YBQC 1T5WB 2VSKB 3QEQE 3WEXB 4ELME 1K8IB 3PWLA 4HMDA 4L2LA 5GS1B 1UKSA 2F54D 1JVOA 3J27A 3LQAC 5D7IB 4Z7OB 3N0AA 4MJ4A 5L2JB 3ETSA 3VWJB 4BFIB 4NYLB 2E47A 4NP4L 4P3DA 4WNSA 3ZDZF 1U8KA 2FHBA 1ZV2A 1FNHA 1QQDA 2WYTA 1XZ0B 3IK2A 4NWTH 3ZO0A 3HNVH 3EYFB 5SWZA 4HWEH 5L4MA 4HVBA 3SCMC 3VG0H 5E8OA 1KPRB 3IAPA 3FT3B 2FSDA 3MLRL 2YO3A 1M3IA 3PL6D 4OKVA 4W68A 5FOJA 3SQOL 4Z3GA 1J48A 3LVEA 5DHYA 3WMQA 2HTKD 3EHBB 1F5WA 1G6VK 4QLRA 3TT1L 4P4KB 5LDSA 4XN2A 1QSFD 5IOPB 1UH4A 2EP6A 2P48B 2A0LC 2H9GB 4ZTPL 1BIIA 2Y7MA 2OMVB 4LMQE 3PV7A 1Z9LA 4XAKD 3BE1H 3TEUA 4K9EL 4P9HH 3DMMC 3IYLW 4MSWA 4L9LB 2KDYA 1TZAA 2FEDC 3QUGA 2N1KA 4XPBL 4CC1A 2O6FA 3EO1B 1NMCB 5HDQL 2VIRB 4G7SB 1KIQA 1QLRA 3L48A 1MJ7H 3JV4A 4X7SH 3WUWG 4LNVA 5F7NC 1OOWA 1W0WB 1XH3B 3ASNB 3GS0A 2GG1A 1SPDA 1H6TA 2IGLA 3H6AA 1GW0A 1RUKH 3S3SA 2VN7A 1C16A 3MRHA 5F7BA 5FW8A 1I31A 1DQKA 3JYCA 3KPOA 4WO4C 4LCVA 4UNIA 2ZCHH 4G6JL 3IDIB 4X6DA 1TENA 5FGBC 1X4ZA 3AMLA 3ULVE 1G7IB 4LCIH 2L7UA 1RZ7L 2GSGA 3C5JA 3JWOL 3W9EB 1WAAF 2O5NA 4Y7OC 4H25B 2GPZA 3O3AB 5B4MD 3F7QA 1G43A 4X80H 1U4FA 2XKNB 3CFQA 1JS4A 2B2XH 2W59A 1K3ZA 5C0CD 1J11A 4XNZC 4YDKL 3WELA 1BHGA 5HSFA 4FNUA 3RP1A 1JZJA 2P8PB 5BV7H 3JTTB 8FABB 3UO1L 5GGTA 1I7TB 1Q72H 3RVXD 4Y19B 4KMQA 3TC9A 3UH8A 1GGYA 5CHNA 3NH7L 1OM9A 1MJUL 2Z1PA 4PWIA 4A37A 3L5HA 2ZX7A 5TDPA 4JPSA 1JGLH 3VFMB 3CHSA 1TU2B 3GRBA 3ZRCC 4OZHB 5IEKA 3BP5B 3LSOA 3PDGA 1J8RA 4MTMA 4FFYA 4ZQKA 2ERJC 1FSKC 2X4UB 3BGFC 1C9SA 1XF2B 2VDKL 1L3WA 1AR1D 5IF0A 5DRZB 1YEKH 4O2EB 1CGSL 4HV8B 1HINL 2XCMC 4RZCA 1MXGA 1KN4L 3TPUA 1B9KA 3IVKB 4WFED 5ESAA 2OL3H 1R9FA 4PS4L 3I75B 4TSBL 2CR3A 5DZJA 1AG6A 2XKUA 1TFPA 3W2DH 5HD8C 1GGUA 4FABH 2F54E 3MX0A 3L54A 5F7MC 3THML 5HI3C 4J3OH 3O2DL 1SY6H 2Z7ZA 1UZ8A 4NDMB 4KTEL 5SWZD 4M7LL 4NN6B 2OR7A 3CH1A 4MQ7B 3HLKA 4HT1L 1WA1X 3VGHA 1Z9SB 4NP9A 4EI5C 2DKUA 4M4RB 3B5GA 5DEJA 5IBUG 3BXNA 4P2AA 4AG4L 2XN1A 4AKPA 4C56A 1C5DB 1AE6L 4IMKA 3PGDA 1SOQA 3L08A 4HJGB 3B3BA 3CVIH 1JWMA 4U6YB 2DQCH 5EU6A 3GLZA 2NNCA 3OLGA 1ZGLA 4HHWA 2MTPA 3L16A 3S3JA 2DD8L 3HB3D 3WFCH 4N5UA 1QSFE 5BZDB 5K9KA 1KEML 2MCMA 1U8NA 3GO1L 3H3KA 4MA7H 4ADJA 1MOEA 3GDBA 1B90A 5J11C 1KJ2B 5CP3A 5KUKA 5L8LB 1IAIL 3UC0L 1BJMA 4N6QA 5KSAB 2LU5A 4E5XA 1RZ8B 4XAKE 2VLKD 5E94A 3J07A 1DP0A 3PJSA 2X2UA 1RUMH 1E6OH 3T71A 2WUCL 3RURA 4U6HB 4YSCA 1AXTL 1AJ7L 5GQBA 3MRQA 2R2BA 4PJEA 4GIPD 2MH4A 5CSZA 3W39A 3X11B 1CICA 1JWUB 1T7WA 1LD9A 5T1LA 3HW7A 4PRAB 1OP3K 5TE7L 4QTIL 2HJFA 2HUHA 4ISVB 3W11D 2CDEA 4ZUVB 2WOBA 1YJDL 3U9UA 4M1GH 4MJID 3S8GB 1TF4A 5D2LA 2DW5A 3KXFA 4XVUC 5D55A 5CP7A 3GMPA 1LNUB 3AG4B 4XGZB 4XXWA 1A6WH 1PZ3A 3IMTA 2XWEA 3HIZA 3UAFA 2ZCKH 2BSRA 3T3PF 3KPSB 1KBWA 1CT8A 1QBAA 2AKRA 4B3VA 4OBRA 4PN6A 4R7LA 4TL5A 3HUJB 2FDBP 2R2EA 4Y16C 4IQHA 3N50A 5C0CE 2K7QA 4TXVB 1D3CA 2IQ9L 2WKGA 2WINB 4MHHG 2VZVA 1ADQL 4N0RA 1LWHA 1X7QB 5D1ZI 5B38B 1E6JH 2WWOA 3BVUA 5DD0L 4U6XA 4O5LL 2ZOLB 3M86A 2DIEA 1GAFL 2WBJB 2IOOA 3QFGA 2BP5M 4J3OF 2BW4A 4NO2B 3SYPA 1KCBA 2NX5A 4L2YA 2CLRB 5DJCB 4GMSL 1HNYA 1LQBC 1LDPL 3FU3A 5E0QA 4NUGH 2V33A 4KNUA 4YH6A 5AVSB 2XUWA 4FD0A 4YDVB 2E9BA 4LCCC 1BQSA 1WTLA 3E9TA 1J9QA 1MQKL 5AOJA 3CXHK 1TJGL 4WFEE 4P5KA 4W9CC 2F15A 2R1YA 2LFEA 1BJ8A 4JS7A 1S9YB 2Z7YA 4KTDL 2JQAA 4FFTA 4XO4A 5CINH 4RBPK 4F8OA 1B9ZA 3CQQA 4UIMB 2XQBL 2NW2A 1BZQK 4C56D 4HWBA 4PU2A 5SWZE 3DX6A 4RMSA 4LPTA 4OCYH 1CLVA 4FA8A 3N5AA 3JV6B 5DJDB 1TVHB 3ARGC 4JFZL 4JG0L 1XSJA 3G5XB 5EU6D 3MGTB 4QHMB 4WLCA 5J89A 1T83C 4DT2A 3IJSB 5EBLB 4B9GA 2N0KA 1NIAA 4JO4H 2DWSA 2OP4H 2XKSA 2PWHA 4Y4FC 2YPVA 4HFUH 3GSNA 3IU3B 4UCFA 4W9DC 1CLZL 4PD4K 1TFHA 2ZYSA 5AOZA 5C0IA 2XTJB 3MRNB 5I1JH 3L1EA 1NCDH 1E3XA 3DIFB 2WXIA 4MKMA 3CSPA 4MNQB 3I6SA 5F9OH 3IKKA 2K9UA 4YHPB 3VUAA 4PSPA 3SQOH 5HYSG 1CFVL 2VDMB 3LEVL 2VLKE 2BC4A 3HHSB 2UX6A 3OKKB 5DC0A 3Q7JA 4ZYKA 5IW3A 4JFUA 1P5UB 4OQ1A 1ZRUA 2DQMA 5DK2A 1CR9H 3I85A 3O4LB 5T1LD 4Q9BA 4L4TA 5D7LB 4ZW6A 3WLBB 3D4ZA 4X6DE 4ZTPH 3FQ2A 5SWSB 1VDGA 4YHZL 1SRDA 2Y6SD 5FV2A 4HUMB 3DOHA 1BOGA 1KULA 4OLWL 4HYTB 3KXFD 1JVKA 3EGXB 3OJMB 1DZ0A 5INDB 2GVYA 4UAOC 1OP5K 1WC7A 2VAAB 2C9UA 3J8F7 1TQBB 4XPBH 1UH3A 2YC1A 4MAUL 4PJCB 3TJHD 1XF1A 3GQFA 2WNGA 4JFEB 4MJIE 3Q2NA 5I30H 3T3MB 4DJMA 3P30H 1NGXA 2Z7WA 4MXQC 3JUYA 2P46B 1AGCA 4ONGL 3CVHB 4KI5F 1KXVA 2NX5D 3DVIA 5G4MA 3G9AB 2VDLH 3ZTJH 1NPJA 2FECL 2NY7L 2EXTA 4U0RC 2Z93B 4CILA 4AGQA 1O7DE 1UA3A 1RZ7H 2OCFD 1S5HB 4P23B 1BPVA 3MXVH 2DRUA 4NSKA 2V3EA 4QNPE 4WWKB 3SYAA 2Y24A 4LXFA 3KWTA 4A2FA 4PB9L 3EYOA 5DUJA 1E5BA 1XCTB 1EHAA 4G9DA 3UO1H 4L0ZA 1GYAA 2R1XB 3QWRA 3JT0A 2X1PA 4YR6A 1QFWL 3LPPA 1KWGA 5DR5L 5E1GA 3BQUB 3IF1A 1BFVL 3D51A 3WY1A 2P80D 1U3ZA 3E9UA 4D7BA 2ADGB 3M7OA 1LK3L 3MUGB 2XWTA 2MCAA 1JZ2A 4XN8A 3MLWH 4JRFA 1BQ5A 5DFAA 2FAUA 2IFGA 3F84A 1TIUA 3WFEL 4OV5A 4Z9KB 4I9XA 2PCPB 3V5KA 2VM4A 4N2FA 3VFGH 2VDKH 4C56E 5GXBB 2EUVA 2OYKA 5I5JA 4DVRH 3NSDA 1FI8C 4WDIB 3QT2A 4ZXBB 1HINH 1SQ2N 1OT1A 2GJPA 1S9WA 4H8QA 4JHZA 3SGKA 5EU6E 3VDBA 2OW7A 2AEPL 2KQMA 2DTML 2ZOOA 1A7QL 3US0A 4HH9B 2HWZH 4XR8C 1ACXA 2VWEC 2ICEC 3AM8A 4MDIB 5C0NC 3MQIA 1ZEAL 4YSOA 4WAFA 2NY4B 1FBIH 3BYYA 3THMH 1N3NA 4KRPC 3DROA 4WU5A 3O2DH 4ZUUB 2R0LL 4HX1B 1ET8A 1LL1A 3ILEA 1RUPH 1WBXA 5FGCB 1BXAA 5IQLA 2BP0A 4HT1H 4CC4C 1T03L 2DIAA 1X5GA 1TMQA 1Z9PA 2C7FA 3LYRA 4X7CC 1S7VA 2EDBA 1ZLEA 4W6XB 2BRRH 2ADIA 3GJEA 1W72H 1MFAL 1KIPB 1CI3M 1S9VB 3L5WA 1HTYA 2JSFA 3I74A 2E6JA 3IT8D 5FUCE 4L4TD 1RJZA 1YEHL 3PXHA 1AQDB 3B43A 5I16B 2I27N 5BVJB 1JZIA 2VYRE 4PJEE 1CFTA 3E3QE 1JV5B 5IVXF 3UACA 5LB1A 3CX2A 1N6QL 1KEMH 4X99B 3WTUA 1IBZA 1KZQA 4HKXA 1I1AB 2XRAL 3EJCA 4G5ZL 1ETJA 3EOTL 1YEJL 1IAIH 2F1BA 5HGAB 4HOWA 5HBBA 4X8JA 5D2LE 3KXFE 1RK0B 1LO5B 2IJ0C 1UJ3A 4OVVA 3P11L 1QPXA 1J5OH 5A2BA 3SQRA 2WLLB 3ULUL 2GSIA 5JYMA 3SOBL 3LTVA 1CS6A 4H26B 2QHLA 2G3ZA 2XPGB 5LWYL 1AXTH 1AJ7H 4R0LC 3V4PA 3GLEA 3EYUH 3RNQB 1M1XB 2CLVA 3FUEA 3ISRA 7TAAA 2C4FT 3K2MC 4S10A 4WI7A 1UVQB 5HGGS 5H94A 4N0FA 3ZTNL 1TJIH 4YFEA 5DMKB 2JIXB 2Z31A 2WN2A 3UBGA 2NX5E 3LQZA 1RUAH 1ZVSB 4KMLB 2F7IA 3GMRB 1BPLB 3ZGHA 1T1WB 4B96A 3FQWB 5C0JB 1IIIA 4J1UB 4P5RA 1AP2B 5I9QB 4G6FB 4QO1A 3V9EA 5JXEC 3MRRA 3L9RB 1BQHB 3AY2A 4PRHA 5GS3A 7PCYA 5IHWA 2GI0A 2L7JA 3C75A 2IAMA 2ZF9A 2NLJA 5IR1B 4DGWC 2PF6A 5KYYA 1Q94B 3FQRB 3LKRA 3QIWC 4GAJH 1CDYA 4BJLA 2IQ9H 4ANKA 4HPYL 4MXVF 4J3OG 1R47A 1KC5H 3R0MA 2A2QT 1ZMYA 5K1VA 1TJHH 3IN0A 5D1XA 2WIIA 4LL4A 4O5LH 3ULAB 3U46A 2NOYA 2OZNA 4GIAA 2QTEA 5FOBA 3TCXA 3LZFL 5E00B 3D9AL 4K7FA 1X5KA 2DWDB 3V4VH 3ZDXF 1F3RB 4GMSH 2OTWA 3EOBB 1UD8A 5DZPA 2FBRA 2Z92A 3F58L 5CIPB 4FXGB 3MV8A 1OIOA 5DJ0B 2N1TE 3VGBA 5I1AB 1VF5C 1PQZA 3GIZL 3JTSB 2WZ5A 1BMZA 2OX5B 3ZKXB 1MQKH 3HNSH 4N0UB 4AQ8A 2Q2EB 3QXUA 5FFGA 4HEMA 5ECGA 1TJGH 3FK3A 1MCRA 1R5IA 1WWAX 4JN1L 2WKOF 1HI6B 4XNUL 1U58B 1W80A 4OLXL 4UQEA 1SXBA 3EF4A 4PJ7F 2WXJA 3TOPA 5DQJB 3BT0A 1U3HD 1ZK5A 3QEQB 4QCIB 2YUZA 5PAZA 4ELMB 1WZMA 3T8VA 1V27A 4L8SB 3KPQA 4GXVL 4JG0H 4A7GF 4NKMA 3TA3B 1OTUD 2XIIA 1MAKA 3BUYB 4F7EA 3RWCB 4K8RC 2OBGA 2BY1A 3WXVL 1XR9B 2QFPA 4QHKI 4J6RH 4L4TE 5F89B 1OGPA 4JANB 1O7SA 1IGIL 3GBNH 5AOLA 3OAZK 4NENA 2CA4A 2Y2YA 1CLZH 2K3HA 4XPGL 1DYZA 1VAHA 3UBHA 3Q13A 5EO0A 4EMZA 3CLFH 4N5EC 4YWGL 4FYRA 4EZLA 4Q7DA 3UOAB 2AQTA 1NGWA 2DLTA 3LEVH 2AJUL 5B21A 3C9NB 4FERA 2DYRB 3OX8A 3CFJB 2BJMH 4XTRD 4GKSA 1JHTB 4H1LB 2N01B 1SYSA 3VI4F 4DK3A 2Z31D 1SOKA 2N3JA 3W81A 1SLUA 3FU7A 4PGCA 2MQ0A 4HFWB 2LTQB 4GAFB 4CBZA 1RU9L 3PWPD 4N0CC 1JZ3A 2AJVH 4LEXL 4K94H 4JHAH 4GG8B 4PRHD 4LSTH 5DEGB 2HRGA 3FONA 4L3AA 2IAMD 2B9BA 2ICWB 3PP4H 3H9HB 4DEWA 4MJ2A 3LHAA 3TM6A 5EIIB 3BAJA 2NQ3A 2DQTH 1N6VA 1KGCD 1QABA 3P0YH 3OB8A 4RFNC 4XN9A 4DEPC 4ZX3A 4M7KH 4JY4B 3L95B 4LDLB 4UQCA 4Q4IA 3H4FA 5GS2H 1HU8A 3ME0B 3B7RL 3BPCA 5D1XD 4C58B 3LN9A 4K9EC 2BSDA 1AIFA 2DZEA 4NC1E 1R0AL 2AEQH 4MMYA 1CL7I 3BT2L 4S1SL 1KXQA 5I6OA 3EAKA 1T1YA 3IWVA 1RVFH 3UJIH 3CMGA 2GTWA 3MV8D 3WAJA 1F4WH 3AAZA 1OAZL 2IALA 3E8VA 5CSBA 4P59H 2CNZA 5ALBH 1FIGH 1LK2A 2P3YA 1C7TA 5IMMA 2VH5L 1QHPA 2LR4A 3FRUA 2YRBA 3KPNA 3KPTA 4CRPA 2BERA 4A2MA 1CD8A 1EEYA 2P5EA 5B1AB 4PW9A 5JHLH 1ANUA 2AQ2A 3LV3B 3BWUC 1I8IB 4Y1AB 5I5IA 2H6PB 3MKKA 5FWRA 4B60A 3JWOC 4FFVD 3X3GH 1CGVA 3MRJB 4XCEA 3IDMB 5F7AA 5JHBA 4Y4HB 4I0PB 1T3FA 4S0HA 5H35B 4PJ9B 4BFEA 1M1SA 2AK1L 5JOPE 5C86A 4KJQD 5CLYA 3VXTB 2NY3B 2X6UA 4K9JA 2C34A 2DLIA 3TCTA 1JDDA 1D7BA 5CJXA 3F64A 2ZG2A 5HGHA 1Z3GH 4UF7C 2Y7SA 3QRFM 3KW8A 1Q0YH 5FB8A 2YGVA 1GOHA 2EIZA 2DTMH 2BS71 3RAJH 1MCIA 4X0KB 1NUNB 3AGVA 4WW1B 2F18A 3RY6C 1ETB1 4HEPG 1R5VA 2NUTB 3MBWA 4MJ5B 4Y9CA 5FUOL 1ND0B 3RPBA 1K4CB 5GHWL 2AANA 3CSYB 3D0AA 3TIEB 4JKPL 1XMWA 2X4OB 1F18A 3OHXC 2UXVA 1F6AA 5IHLB 1YY8B 1PG7W 2VE6B 2VXUH 4C4KT 4YSUA 2J88H 2ZYHA 4LSDA 5EORL 3BPNC 5F7EH 2NSXA 4CVUA 2VM3A 3VD5A 2PTVA 1GIGL 1DFBL 3UL4A 4WTZG 1F58H 3BH9A 1DSYA 4BK8A 1QSFB 4MA1B 2CA3A 4HXAL 2JKXA 3KPPA 4HS6A 5HI5D 2P1YA 4B9ZA 2YBGA 4DP1X 5C2UB 2OFQA 4O4YH 1KCKA 2WQUA 4TVSa 3SY0B 1TT6A 3ZTJG 5HYSA 3SB3A 2QGBA 4R7NA 3X2QB 5F1KC 3GZQA 4R97B 4YLQT 4KZDL 3L45A 4DUXA 3CVDA 4DZBB 2J1KA 2OMYB 4G42B 4HPOL 3DX3A 4GT7A 1YEJH 1WFTA 4Q9QL 2BVPB 4WK4B 4RDQG 1VFOA 2OMWA 1CYWA 1MFDH 5GRXG 2J8UF 4QHLA 4PRHE 3UBXG 2A9ML 2H4EA 2D0HA 1XMEB 3DGCR 1F1DA 5FF6A 1A7BA 1TVDA 3A5VA 1YNTB 1CGUA 1KGCE 4ZUTB 5GRUH 3FRPB 4DGYH 1FFPB 3RYMA 2JKIS 1O5PA 2A83B 1D5RA 4HUXA 4M6OL 5BNXD 5D1XE 1U92B 3MNVA 5IMKB 3MSPA 2CJTA 2E6PA 4RAVB 1J0IA 4TTDD 4MMXA 4JAMB 4YXLH 1WZ1L 4D0CB 2NY6C 1L5GA 2IPTH 2P5ED 3MV8E 4HPHA 4XOBA 3TZVD 3GTNA 2J6EA 3DO7B 3CE1A 3SGDI 1WAAA 2LQRA 1U3YA 1VENA 3VDAA 1A4JB 3QUXA 2RFXB 3IPBA 5I1CL 1EAPB 2AXWA 4H40A 1R5WB 4TLSA 2X28A 5ICZB 1JNLH 4HEME 5HYEA 5F96L 3FTUA 4BH7A 1EVUA 2XN0A 1EZLA 1F86A 2BVTA 3OR6B 4GAYA 3MOQA 4RFEA 1DN2A 2VZTA 1YJDC 4YX2L 5KYXB 2HLFC 1A9BA 3IJHB 4NQSB 1U0QA 1UZ6E 2PN5A 2YQBA 4N1EA 4OI7A 4KXDA 2FR4A 3SZ6A 4NRYA 3D9AH 2CR0A 4AC4A 3PWLB 4XNDA 1CTMA 1A25A 3IGFA 1AR1B 2FX7L 5I71B 4OTXL 3T2QA 2AXHA 2F7RA 1ULVA 1U8KB 3DXAA 4LAQL 1PLGH 1LO4H 4XPHL 1MW1A 1ACYH 1QQDB 4LPUA 4LDEB 4AIXA 1IMHC 4Z7UF 5D72L 5KVGL 3GMMA 2SODB 3C60C 1BWMA 5DHVH 4NZJA 4KKZA 5SWZB 3HCVA 5HVHB 3DK2A 1TQSA 4PVLA 2PR9A 3G3LA 5E8OB 4WW2C 4OKVB 3S34H 5DHYB 2MEJB 1JFHA 2MNUA 4DOHE 1WV7T 4OLZL 1WTGT 2XQ0A 1IGFH 5E5LA 3IKCA 1Z32X 4JGUA 4R2GD 1DQTA 1BIIB 3BSHA 4O2FB 1K6QL 1X5XA 2B3IA 3WXVH 1UOWA 4EIBA 3IDYC 2MCPH 3HB3B 2CKBL 3GB7A 5T5FH 2H2PC 5DVPA 4ZD3L 4MSWB 3ZL1A 3X14A 2DEXX 3WBDA 5IMLA 4B9CA 1C7SA 3QAZB 4EN2A 3PAYA 4FA6A 2KYIA 5FECA 2QLYA 5HDBF 3UG4A 1KIQB 1OPGL 1QLRB 2RACA 5HHXL 3JV4B 5JDSA 1GMEA 4XN5A 4QRSA 3DJZA 3VWKC 1ZT7A 3BAXA 1C16B 3KDPB 3MRHB 4FXLA 1WFJA 3KPOB 1WAEA 4WK0B 1KXHA 3B9DA 4X6DB 2J3SA 1S78C 1FNAA 2W88A 4CDHA 4HKJA 1RERA 1CZ8H 2CDGA 4JRXD 3DNKA 2GSGB 3C5JB 1KXQE 4JFHD 3FB6A 5I74B 3UYRL 5I66A 4IBUA 2ARJA 1BX2A 3BUDA 5JNYA 1QNZH 2CBOA 4LQFH 43CAA 1MIML 4JM4H 2FZ3A 3LCYA 3W9DA 1WFUA 3B9EA 6FABL 2E7LC 4DPAX 5KOVC 2P5EE 1K8DA 4G1EA 5KBPA 4KKCD 5CHNB 5ERWA 1BQLL 1CF8L 3F7RA 1CVRA 2AZUA 1TYJA 5D7JC 5TDPB 5ALCL 3TBSA 3N1FC 3QQ9C 4NWUH 4E9XA 5A2AA 5IEKB 4UQ2A 1P4UA 5DUBA 1WZKA 2VT0A 3LSOB 3MLXL 4GUOA 2R8SL 4ZQKB 2PO6D 3QJVB 4XP4H 5KEZA 4KX8A 1NM9A 2YD5A 5IF0B 4FTDA 2YPLD 4MLSA 4ORZC 1MAMH 4RZCB 2ARJQ 2AJZA 3MCYA 3I6LD 5ESAB 1I7RA 3PF2A 3U0TA 5IQ7H 3DXAD 3APNA 1V7ML 3OAUL 4QT5A 1SY6A 4OCSL 5I24A 4QTFA 3AABA 3MX0B 1SMAA 4TS6A 4G7QB 2WVTA 1UZ8B 3L5JA 4OZFG 3RVUC 3KE0A 3SE9L 3U1QA 4U33A 4K3JL 3DECA 1GZQA 1UM6L 3TEXA 3T2NH 2WLKA 5F3BA 5GGVL 2IGFH 3ARBA 3ZDZE 1G0DA 3BXNB 4BINA 3HBPA 4GXFA 1ZS2A 4C56B 5EU7C 3VDCA 1NZRA 4XODA 3BUTA 1QKZH 3PGDB 3GSOA 4GLRH 2HFEA 1JWMB 5EU6B 2YN3A 1ZGLB 1ZV5A 4A2DA 2F9BT 4P5SA 2X6CA 4RISL 2FX9L 5B22A 1JOIA 3LEXA 2X4TB 4PJGF 1L0PA 1U8NB 1EZUA 2DQDL 2WSKA 3DUSA 1I85A 1ZJBA 3O2VL 3QR2A 1Q4NX 3FNKA 1NGPL 4CJ1A 3TVMC 4I48A 1EDQA 4E5XB 4MA3A 1QTPA 1FNSL 4G11A 5GHWH 4XMPL 3MJ9A 3MLVL 3PJSB 3WIIH 3X3FH 5F1SA 1JP5A 1NCGA 2C3GA 2DQJL 3N40P 5DRWA 2IPUK 1OCCB 4OB5L 2VW4A 1KY7A 2FD6H 5EORH 5LBSL 2B4CH 5HYJA 3RPIB 4AQZA 2K0RA 3MRQB 4UBDC 4U2ZA 1GIGH 4X8GA 2VW7A 2R2BB 2Z34A 4PJEB 4DN4L 5CSZB 3W39B 4F37K 5BPPA 3NESA 3ZO9A 1CICB 1FNGB 1Y6MR 1LD9B 5T1LB 2HJFB 5IEHA 1I1RA 3IFNL 1KBBA 1XIWA 2CDEB 3U9UB 3A6CL 4G1MA 1A22B 4JRXE 2APVA 5D2LB 4JFHE 3FU5A 3KXFB 1QR1A 5CP7B 1OALA 3OXRB 3NZ8A 4HPOH 4WV1B 2X2IA 4PJDB 3C6EA 1QNIA 2BSRB 2A74C 2AKRB 4RESB 1ZLSH 4NT6A 2R2EB 2Q20A 4DO5A 2QPDB 2A9MH 1AZRA 1WHPA 4PUBL 2BSEA 4KJPC 1IO4C 4X7TA 4IBQA 4U6XB 1NCJA 4JDTL 5AKRA 3V6BR 2QSTA 2X70A 3K80A 3SBQA 4G5AA 4XAWL