3CQQA

Human sod1 g85r variant, structure ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
134
Chain Sequence
TKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGRHVGDLRNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the G85R Variant of SOD1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 32
structure length 134
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3cqqA00
2WKOF 3GTVA 3L9YA 2WKOA 3H2QA 1RK7A 3K91A 1JK9B 1PU0A 3F7KA 1SDAB 1JK9A 1IBFA 3MKGA 3GZQA 1PTZA 1Z9NA 1F1DA 2WZ5A 1TO5A 4BCZA 2XJLA 1CB4A 1MFMA 1S4IA 1SXZA 2AEOA 4A7GF 1FUNA 4A7QA 2K4WA 1JCVA 2Z7ZA 4U4IA 1P1VA 1XTLA 2ZKXA 3GQFA 3KBEA 2GBTA 1Q0EA 2ZOWA 4A7VA 1F1AA 2JCWA 1HL4A 3T5WA 2R27A 4OH2A 2Q2LA 1E9PB 3CE1A 4MCMA 1SXBA 2WYZA 3ECUA 4BD4A 2V0AA 4A7GA 2GBVA 1SXSA 3CQQA 2GBUA 1XSOA 2C9UA 1F1GA 2WZ0A 1TO4A 2JLPA 1XTMA 2AQNA 5KBKA 1UXLA 1DSWA 3H2PA 1COBA 3HOGA 3HFFA 1YAIA 1L3NA 1YAZA 4A7TA 5KBLA 1OZUA 2APSA 4L05A 2NNXA 3RE0A 2AF2A 3L9EA 5CU9A 1E9OA 1EJ8A 3KBFA 3KM2A 1U3NA 1OZTG 3QQDB 2WWNA 1IBDA 3ECWA 1E9QB 2E47A 2XJKA 1YSOA 2VR7A 3HW7A 1N18A 1SXAA 3F7LA 3PU7A 1HL5A 1EQWA 1UXMA 2AQTA 4BCYA 2SODB 2WYTA 1BZOA 1SXCA 2E46A 2ZKWA 1IB5A 2WZ6A 1Z9PA 3S0PA 2C9VA 3KH4A 1OAJA 4B3EA 3GZOA 3ECVA 3KM1A 1PZSA 1SXNA 2Z7YA 2Z7UA 4A7UA 2ZKYA 1KMGA 1IBHA 1SOSA 1OEZW 3CQPA 1ESOA 3GTTA 5KBMA 1SDYA 1E9OB 1SPDA 1IBBA 2LU5A 3LTVA 4A7SA 1SRDA 4MCNA 1B4LA 1B4TA 4N3UA 3SODB 2AQRA 1QUPA 2VR8A 3QQDA 1E9QA 2AQPA 4OJAA 1AZVA 3KH3A 2Z7WA 1BA9A 1F18A 1OALA 2C9SA 2AQQA 2WWOA 4FF9A 1CBJA 1DO5A 3GZPA 2AQSA 1N19A 2VR6A 1E9PA 4N3TA 3MNDA
chains in the Genus database with same CATH superfamily
5DVNA 2W38A 4GG6A 3UPAA 5KVFL 1G9NH 2Y5TA 3T8MA 2XVLA 3BDYL 1PD1A 4BFIA 5H35A 3V10A 1EHAA 3WXVL 2WQVA 2CGRH 1CFQA 3NGBB 2F18A 5FHBH 1YEKH 1JZ6A 1AJ7H 1T1WA 4ORGB 3SE9H 3P54A 1BLNB 3P9LA 3K2MC 3CHQA 3VFTA 4WWOA 1RZFH 2BP0A 3BZ4A 3SE8H 3BUDA 4UZUA 5DZPA 2OZNA 2Y5TB 2EZ0D 1BVZA 2R2CA 4G7VL 4PJ9B 4KTDL 4K3JH 3JWNC 1S3KH 2FT8A 4G43B 2J44A 1U8HA 4A7GA 2VT0A 1KXHA 5D7JB 1DVFC 3QR1A 1B4RA 4L5FL 2J5LC 2R51A 5HY9A 4LNVA 3UTZA 4AYID 5K9KA 4JHBA 1QW9A 1Q8MA 4WK0B 4NO5B 1JZ2A 1QR4A 4OZIA 2XYCA 3BPOB 4MA8L 2BM3A 5DI8A 3HFFA 2V7NA 3NN8B 2FWLB 1RUAL 1P2CB 5F1IB 5C0ND 5C07D 1ACCA 4O9HH 2XN9A 1KPUA 5AZUA 4X8GA 1F3DJ 4OZIF 1H3WM 2OR8A 4HOWA 1HZLA 1LO0L 5J1AA 1WWBX 4D0BA 1U92A 5BS0A 4NQCA 2XN0A 1OP4A 1LE5A 4G9FA 3FTVA 2BVPA 4BQCA 4PBVC 1MH5B 2DD8H 2VR4A 4H40A 1QFWH 2EIBA 1KWKA 5T1KA 3BT0A 1A6AB 2CALA 3WTVA 3QXWA 5KS9E 3I84A 5KJ4A 4M62H 4CA4A 2YXVA 5KYYB 2P5WD 4GY4A 1BZ9B 4XMPH 4U1KA 3EDFA 1DUYA 1S7WB 3NP4A 2OMYA 5L4IA 4KKNA 5CJQL 4DGYH 1MFNA 3LKNA 3CH1B 4H8HA 3B2VH 4LVOB 2EILB 1JNHB 1GGCH 4KJYA 4M03A 1VZHA 3S97C 4FFYA 1D9KD 2PR9A 5MEPB 4LVNC 4GRLB 3WD5H 1TYRA 4N3UA 3RP1A 3WE6B 4QRBA 1KOAA 3GIVB 5CBAB 3BGMB 4AQAA 1B9KA 4UDUB 1CK0L 2BSCA 4YFEA 3C5SB 1AZVA 3MLZL 3HLAA 2HPTA 2Y6SD 4DZBB 4PCTA 4LHUD 2AV1B 4QJ5B 2VDML 3OAZH 3VXMD 5I66A 3KGRA 1AZRA 5LQBL 5GRXG 5F71A 2EEXA 5TJWK 4PCKA 1UXWA 4PRAA 2F5AL 5E2UL 1WZ1H 4MKTA 4QHLB 5DK2B 2VE6A 4NRYA 1P7HL 3SQBA 3T0DA 1LDPH 1T7VA 4MD4B 2HFEB 4B60A 4DGIH 3W5NA 3CU1A 4YHPB 2AQ2A 1HNYA 1UM6L 5LUMA 2UY6B 5HGAA 3GHPA 1EMTL 5DK2A 4H2AA 7FABH 1GY2A 2MOVA 5I1AA 1NGZA 5DU7A 5CHNA 4Y5XA 3HIZA 3EOAB 3FT1A 5DD5L 4G6JH 3VFGH 4HAGA 1EBPA 4OLWH 1AHWC 4XMTA 5L0QC 3OKMB 1T1YB 1TZOA 2A1WL 1NGWA 2V7HB 3L48A 2XV0A 2NY0C 4FYRA 5EH1A 1XGQA 5KBKA 1I85C 2VR5A 5I75B 1COBA 1MHEA 4M7ZC 2V3FA 3TN0D 4OBRA 1DP0A 2MTPA 4I1PA 4YXKH 1G7PB 5IM7A 3BRGC 2XKSA 4U7KA 2XCMC 1NTDA 4LAQH 4MAZA 5ADOH 3NFPB 1TQBB 4M1DH 3I6GB 1KN4L 2I7OA 3NP3A 3P30H 4KJQD 4A55A 1RZPA 3OZ9L 4HKXA 4PRDA 2XA8L 3ZSTA 1AP2B 2HN7A 2EADA 2ORBH 1TQCB 3B3BA 1DQVA 4FZ8H 4PCYA 2G4EA 2LE9A 3DVGA 1T3FB 1N0LA 3F7QA 4FQQA 2YPKA 4JDZA 4O2CB 3O3AB 3SBPA 3BDYH 4IW4C 4EIBA 1BBDH 4ZUTB 3FOMA 5GGVL 2NRDA 1NFDF 5C7XH 2P5PA 4OUUA 3UZEA 4HCRL 4YN3A 2YBRA 4UYPA 3L1GA 1C7SA 1MFAL 1NC2A 5IVNA 2IAND 1VGKB 4TOYL 1ORQB 1SLVA 2CIKB 3HC3L 3V8OA 1BFVL 2P5WB 1XF3B 5BQDA 1HQRB 4RISH 4MMZC 4MDJA 4WHTA 1QLEB 4NWTL 4JG9A 4FQ1H 1R5VA 3GM0A 2FECI 3B2VL 1UACH 2D7NA 1B90A 1I8LC 2N56A 3TWYA 4NRXA 3LH9A 3IBOA 4QYAA 4Y4KB 3TJPA 2FQGA 3QISA 4PS8A 2YLHA 1IAIM 3L95B 4NQUA 5D96C 4LU5H 4R0LB 3QEQA 1MJ7H 4FG0A 4FS0A 1IAOA 3H3BC 1H8OA 3T2NL 4JKPH 3NBNA 4OZHA 3ISWA 4FZEL 1WAEA 2W9EL 2H26B 4C59B 1MF2L 4M7JL 2J88H 3ARGB 4B9GA 5AVVB 5L2JB 4K5PA 1T04A 3VI4E 4ZFOA 4MA1C 1J1OL 4HK3J 4MVBC 4TQHA 2VAAA 1NBZB 2WKOA 3BP7A 1KB9J 2ZJSH 4NUMA 5DTFA 2IH3A 4Q52A 3C60A 3E8UL 4A39A 4UQEA 2R23A 3KL5A 1ZGLM 2N4IA 5AB2A 4A37A 2PYFB 1S4IA 4P9ML 1M42A 4HFWB 4KK6D 4Y1AB 2WQWA 3C2AH 5FYKU 1TKWA 5H4ZA 3CIAA 5KSAB 2P8MB 3C5JB 1FZJA 1VJSA 4AVHA 5IEKB 1HWGB 3QZNA 2OJZL 5GJTH 3PAZA 1NQBA 3AQDA 1T21A 1TITA 1NPJA 4DPAX 1JZ3A 5FFGA 5KSBB 1T1WB 5HGBB 2GJ6D 3ETBF 4R3SB 5HYSB 4N6RB 1MRDH 3SDAD 4NLHA 4CVXA 1QHOA 4PJ7A 5ICXB 4NZUH 3LH2H 1LK2B 4I18C 5FEBA 1YPZF 4LLYB 3TT3L 1XCWA 2E27L 1JZFA 2N0MA 4O00A 5G5DA 1ZANH 2AF2A 2W92A 5GIRB 1HOEA 5I0VA 3IDIA 5LAPA 1Z9OA 2OP4H 1XD1A 4H13C 3NTCL 3HG0A 1GGBH 3ZKQD 1F3DH 1JSYA 3MJ6A 5EOCH 2HRGA 5DO2C 3Q06A 3JVGA 2CK2A 2GKIA 3L1EA 1EEZB 3LQAC 3UZVA 4CMHC 1O6VA 1FH2A 1G5GA 3S7GA 2F8XC 3ARQA 2D0FA 1MUJA 2OTPA 2DBJA 3ZGIA 3FZUD 3ZYIA 2IPTH 4N2DA 1D5ZB 1ED3A 1A6TB 2YD1A 1MZYA 1VEOA 3DRQA 4FQ2L 2GCYA 3BO8B 5HDWA 5DEGA 3EO9L 3VXSE 1BQHB 4R8WL 4YDLC 5ESAB 5FYJE 4Q6YA 4Q9BA 4LIQL 1CDHA 5DLML 1K5NB 3EUUA 5E6RB 1S2EA 1UATA 5B1KA 3GO1L 4I9XA 3ESOA 3RLSA 5DRXA 2DS4A 1V5JA 2G75B 3ULSA 32C2B 4XOCA 4HU8A 1QMUA 2QZQA 3X1BA 2FDBP 5F7WC 5ABAA 1Z9SA 2APXA 2MFNA 3IF1A 1T66D 3DC0A 1MCQA 2K3HA 3MJ9L 1X4YA 4X5XB 3NRFA 1CE6B 3OGOE 1YUKB 5GGQH 2A6JA 1PEZA 4Y19E 1RZ7H 4HZAA 5IMMA 5FAAA 4IK7A 3QPQD 5HVHB 3PQYB 1ADQA 3P4NB 5L2JA 4PWEA 1GJIA 3QCUH 4H20H 5CN1A 2F15A 4JUSA 3X1FA 1UHVA 5BZDA 2WLIA 4NKDA 1FNFA 2MCPL 4E41D 5BVJA 4Z7AA 4O58L 1RSYA 1QBBA 1L9OA 1AKJA 1C5DA 3M1OA 3RHWK 5CN2A 1X5FA 4LSVL 3MFFB 1C5CH 2WJ5A 1U4FA 3KL3A 3Q6GH 2DQFA 3G5XA 4H5SB 4A6YB 4H26A 4LQFL 2G3NA 3MRGB 1PLAA 1HL8A 3TN0A 3J2PA 1MVYA 3UIYA 1I9RL 4IDJH 2OCFD 2IGLA 3LNEA 5A16B 3S37H 3TTYA 4DT2A 2FL5A 5DDHB 4FRWA 2ADGA 3CXHJ 1MI5E 3WELA 1AGBA 4UV4L 3MBWA 2J1WA 4I0PB 4LU5L 4YDVA 4MJ6A 1T2XA 2FE0A 4OIAA 2FAUA 3H4FA 4OM1L 3SQRA 2CO7B 3ARXA 4L8DB 3IU3A 5CP7B 5JOPD 3N3EA 3UCRA 1CGSL 5D1XA 2P8LB 1MJ8H 2P80A 5E9DA 3VXOA 3ARFA 3GSQA 4LSTH 1W6WA 2VERN 5I73B 1DJWA 3TF7C 2AJ3A 1XMEB 3B2UC 4RX4A 4OCXL 3D08A 2MRYA 3O9WD 3H9SB 3DHPA 3IU3B 4GQPH 2YK1H 2ZKWA 3FL7A 4MDIA 4MXWL 3ZW3A 3PL6C 4BQ9A 5EC2B 4PRNB 3QDMA 1VF5C 2FWUA 3DARA 4PWJA 3MXVL 3N1MC 5F6HI 3RFZC 2KC0A 2QEJA 1DN2A 2VL4A 2YOCA 4AVJA 5FR3A 1CGWA 3P9MA 2EINB 3DXAE 3SYPA 1E9OB 1T5KA 1KN4H 2BSBA 4RMTA 4XXDB 3HTLX 5C0RL 5HI5D 3IBEA 4AEIH 4L9LA 2WHVA 3LSOB 3GSXA 3PV6B 3F58H 2H1XA 4XO9A 1MWAA 1QLRA 4AGOA 1AGEB 5IB3B 5MEOA 3W0WE 4WNQB 3B9KD 3L2MA 3EYFA 4HT1L 2PF6A 4QHLA 3MACH 4CGTA 3AZUA 2WINB 4ONFH 5F3HB 2H0JA 3QHZL 1VLXA 5EU6A 1YO4A 3FU7A 2NYZA 3DRTB 3TTSA 3PUCA 1PG7X 1QWHA 2NY0D 3HN5A 5IR1B 3DNKA 3ARZA 5HYJB 3K81A 5BPPA 4BSJA 3UYPB 4M6NH 4OGXH 5BZDB 1G7QA 1OW0A 5LBSA 3KJ4C 2D3NA 1AR1B 4AGMA 4UYQA 4APQA 5E4AA 4NO3B 3QI9B 3MLRH 4JFDB 1MSPA 3X1GA 3G6DL 5IMLA 3E3QC 3C9NB 3P11L 4NN7B 3TCXA 4HLZH 4BCXA 4FYQA 4PSPA 4ZX5A 3KPMA 2AK4B 4GW4A 1ZT4A 1TPXC 4HCRA 2QQKL 4KC3B 4NPYB 5L8JB 5EEZA 2NY3C 3JUYA 3KNBA 3BEVA 4APQB 3WLBA 4ZS7H 2FO1A 3I2CL 4HKBB 4G6FB 4NJAH 5EO0A 3A0OA 3RVVC 3NACH 3GLZA 1CFTB 2IF7A 1E7UA 2VLJD 4KZEH 5ANME 12E8H 2W0LA 3EO1A 1FAIL 5FXCH 1KY6A 4CGUB 5F88A 4Y5YA 3O6ML 2PPEA 3O2WH 1K9TA 1MCOL 2OMTA 4LOUD 1YJDL 4P9MH 3DVNB 5EOQL 2ZD0A 4KFZC 3D07A 4OV5A 4HUNB 2R9HC 1S5HB 5E23A 3QJOA 5EORH 3UZQA 2WVUA 4X98B 3GMRB 1QPKA 3SE3C 2IWGA 2CA4A 4LE8A 2YGOA 4YO0A 2R69A 4XNQB 3Q48A 5DHEA 3ROLA 3ZT7A 1K4DA 2TRHA 2Y7NA 1XF2A 3VG0L 5ENWB 5C8JA 3A4AA 4M4RB 3ET9F 2CAKA 1NCIA 4HWBH 2X7LA 4WK4B 2GT9A 1ESOA 4HV8A 3VVWA 3K4AA 1YEIL 2X89A 1ZHKB 4OTXL 4RZCA 4BFNA 2HJFB 2FEDC 4AYEC 2XPZA 3WI9A 4IBLT 1A3LL 1NC4B 4XMKH 4BE5A 4HDIA 4Z7OF 2OMXA 2AQPA 2WUBL 1FYTE 3GPSA 4FQXC 3C5ZC 4XP4L 4JHAH 4BRJA 2Z31B 2WNXA 2Q8AH 5F1NA 1BG1A 2VAAB 3BIKB 5T5FH 5FK9B 1FNLA 3LZRA 4JHZA 4ZAKA 1JPFA 4M1DL 4I0KA 4WWKA 3BDBA 3KVDD 4ZUVB 3ZE1E 2H0PA 3GJFK 5TDNB 1AD0B 3VE0A 3V6BR 1H6EA 4L1HA 3S3CB 5C09A 1ZMYA 2AXGA 5C0AE 3TA3A 4EQ2A 3CHOA 5IVZB 1KCRH 2X53A 3FU9A 1MFMA 2R1XA 2RD0A 1Q94A 3ESPA 4NXKA 3DURA 4KMTH 2ADJB 1EFXD 3KBEA 5D1XC 4ZUVA 3SD5A 1CXFA 1H3GA 1SEQL 2XWTB 1IJNA 2MTAA 4MYPA 5E94A 5GZOD 1Q0YH 1YNLL 3ZXAC 5I30L 5D4JA 1WP6A 1RVFL 4FMKA 3E0GA 1AKJB 4G7YL 1LP9B 2DTMH 2KZKA 2WLLB 2Y3AA 1XL6A 3K4DA 4YIQA 1FBIH 4X5WA 2CWRA 3KPRD 3NJNA 5J3HC 4N26A 4P9HL 4UIKL 1TZHA 4BFKA 4JGJA 4HPOH 5MENA 1KFAH 4JFYA 5ALCL 3MRNA 1DSYA 1IGMH 2D3JA 2DDQL 4P3DA 1K5WA 3WFDL 3NG5A 4X5RA 3RY6A 2ZKHL 1CFVL 5AW5B 2ESVB 3TN0C 3KM2A 4AQ1A 4GMSH 2B16A 1U8PA 4BV1A 1F90H 2BVQB 2VZTA 1DEEA 3KLSA 1M7IB 4JAMB 3VFVB 5DRNB 1USQA 1INDL 2F19L 1L9SA 4L29B 2PMZA 2E9WA 2FZ3B 4JFYB 3N9GH 1CN4A 3QJVB 4EXPX 1SM3H 4C47A 5MHSD 2PW2A 1N3NA 3O6KH 5JXAL 4N1HB 3S3SA 1A6WL 2X4SB 1VEPA 1CICB 3RX7A 5DEGB 3NJGA 4N0UA 4MBRA 2RHEA 5D7IB 1IM9D 1J5DA 4BKLA 3LQZB 1O6SA 4Y4HB 3CQPA 4ZSOB 2JCCB 3J07A 3VXRB 5KVMC 2CR0A 4X7DC 5MHSE 2VGLM 2QQKH 3N55A 1AHWB 4G7SB 4F5CA 3JV5A 3RBGA 4XNYH 3WD5L 1WCBB 1Q9KB 4KTYA 2Y2TA 4HXBH 4WO4B 1V3KA 1BAFL 4NC1C 3W2DL 4ZMTA 3CFKA 3BZFA 3KXFE 4JFHD 2K70A 5FGCE 3SODB 4LVHC 1F4YL 4YSCA 1GPOL 5EIIA 5DD1H 3IMVA 2AXFB 2ZCKH 4JQIA 5EG6C 4DP9X 1NCAL 4Q7DA 2WVTA 3WUWG 3HUJB 1QSZA 2X0UA 2JJUA 1PY4A 3ZDYB 1A7PH 3SJVB 2A77H 4Q56A 1HILB 1MRDL 1EK3A 1YMMA 5IROC 5T1DL 1JNNL 5AVTB 1OTTC 4NQTA 3FSAA 1HH9B 3NZHL 2DZEA 2Q7AA 3FN9A 3WS3A 4Z7WF 3AITA 1IT9H 4TQEL 5B1AB 2FT6A 5I8KL 4FXGC 2FIRT 4IOFD 2ZCHH 2IAMD 3BFOA 3RGVB 1X9RA 2K0RA 2W0PA 3KDPB 4WUUA 4O9HL 2Q8BH 1GYUA 3CG8A 5I6XC 2EABA 5FO9A 5ITBH 4J4PC 1ACYH 1LO2H 3GBML 5CINH 1LWJA 2ATKB 4YHLH 1CD1B 4FI6A 4LEEA 2JIXA 1V3JA 5H8DA 4MB1A 3NH7L 1E2ZA 2DOCA 2IDUA 3EW3B 3MUJA 3MV7A 2WQSA 2BK8A 5F9WB 1MDAA 2AP2A 3V7AG 5IWLA 3SE4C 4YBHA 4AJ0A 2JLPA 2FWSA 5F7AA 1YCSA 3DSFH 4OZ4B 5EU6E 3TONA 1E6OL 3UXFA 3ULUL 1H0DB 3EFOB 4IKLA 2ZX9A 4MD5A 2IBBA 4N0FA 1I9JH 4NUGH 4QYOA 4XE5B 4FTVE 1I9IL 4N2LA 2J2ZA 3QGVA 3ULUC 1G6VK 3JXAA 5B1JA 2WTPA 4X9HA 4XZ4A 3VD9A 3EFDH 2XX0A 1AOHA 1T5WB 1TQSA 4KXZH 1AQKL 3CZSA 3T6QC 1CICD 2O6EA 4PGBB 2HRHA 3EH4B 3S3BB 2AHIA 3FU5A 2LT9A 4P5TB 4AW7A 4LRIC 3PXJA 3EHBB 1BFVH 4NKMB 1U6AH 1BQUA 5BCAA 4G9FD 3AGVA 1JYNA 2CLVA 1ZLSH 3OB0H 5BOPA 2PLTA 1JRHL 2QGCA 4PRPD 2VO5A 3A6CL 3CGTA 4ODXB 4QRRA 2BNRA 4RA0C 1BPVA 4P2QB 4XCEA 1OM3H 4APXA 3P0VH 1H8SA 4ZAKB 3KLKA 1B88A 3BUIA 1F6AA 2AAVA 5GS1A 1WRFA 5MP6H 2VM3A 4M4PA 3STZB 4IMKC 4B95C 2VO8A 3ARPA 3ETBJ 5F9DC 7PCYA 5MENE 2F54D 3SD2A 4ANUA 3WU1A 2XVKA 3K8LA 3PWPD 4B9IA 1GMIA 3N42F 2FECL 2X4QB 3LN5A 5FX3A 1QFUL 2DM3A 4RMVA 5GS2D 1TFHA 3B83A 4IHOA 4QLWA 4L4VB 2IH9A 1SUHA 4RNRA 3ZR5A 7FABL 5H35B 3MRKA 4KK8C 4LLMA 3DRTA 2OYKA 4NO0B 4KVNH 5I8EA 5F9JB 5HDRA 4BK4A 5SV3A 3MAWA 1BLNA 4NEHB 3VFTB 3QJUB 4OJEH 4OAWA 3AVEA 3BH8A 2VXSL 5T1LB 1U8QB 1ZIAA 2BRQA 2W9DH 1FRGL 4R90L 4AM0A 2F53B 1LP9E 4FG4A 2A9NH 4Y2DC 1ND0B 3O8XA 3SDDB 1JGDB 3FTXA 3I6KA 1AZUA 5BRQA 1KN2H 4NWUH 2YPVA 3AQYA 4KJPD 3GSUA 4KNQA 4LBEA 3DTUB 3TWCH 2K4WA 1I1FA 1BXXA 3CZNA 2X4PB 4ATTA 4HWNA 4OZFH 1RJCA 5C0BD 4M1CC 4HISA 3OL2A 4KO7A 5T1KD 4KOBA 1KJ3H 1FYTA 4PB9L 4ZDHA 4J4PD 2KLTA 3ZTDC 3KS0H 4X6EB 4EZJA 3HNVH 2HTLD 5C09B 2FB4L 2DYPB 3OXRB 1S9XA 3VSVA 1IE4A 3TOPA 1H15A 1TMCB 2CPUA 2J6EA 2X4OB 3V4PL 3N1PC 1ETZB 5D7JD 4LOEA 3ARDB 3HAEH 4RZKA 3NFNA 3VO0A 2CMRH 2QFPA 1YAIA 1N3NB 5AW3B 1NC4D 4N24A 2EEFA 1T6WA 4GSUA 5AOMA 3X3GL 3KYNB 2V9UA 2L8AA 5DVMA 4OT1L 5HGHB 1QHQA 2C3GA 2H4EA 4KK6C 4JZOA 2WIMA 2YN3A 4ECNA 4JM2D 1XIWC 3H3PL 4HIEA 4JPVL 1OXYA 3QZMA 1SJMA 1W72A 1ZLWH 4HKJB 1WC7A 1ZJAA 4IKJA 3WCYA 5IHZA 3APDA 2CDFA 4HJSA 3G6AB 3U1SH 3C6LC 3AADB 2EDKA 3KVPA 1MCEA 1E65A 3V5KA 5DJ6A 4KDVA 5IKCB 5C08D 1F41A 1UWGL 2KZBA 3LNIA 3V8CA 5I1KH 5E56A 4DETA 2X70B 4Y9FA 4UM8B 2C4XA 3GZOA 1IFHL 4HC1A 4HJEA 1NMAH 1T1XB 2WAQA 3U79A 5F96H 2CLVB 2G2PA 1GKEA 1Q1JL 4F33A 5GS2H 4GRWB 2X2JA 1GJWA 2OBGA 3UAJC 3VFNA 1PLBA 4DP7X 3O6FD 1Z3GH 3UG4A 4IOIA 2CBQA 2VDQB 4LZKA 3UROR 3GXIA 5E8NA 1QSEB 1X5LA 2WTRA 3O3BA 3FF7A 1XWVA 4JRXE 1HSBB 5D7KE 2M2DA 2H2PD 4NI6A 1YMHB 4YGVA 3SOBH 4AKPA 1J86A 5KSUA 3QQ4A 4Y4FB 1UOKA 1IAKA 4Z7NE 5T3XE 5F7UA 1TLKA 1A02N 1KJMA 3KLDA 3P40A 1QSEA 1QFUH 5LXGH 2E7LC 4CBPA 4WSJA 2ZSWB 4ONHB 3IMRA 3NN8A 1CD1A 1N7ML 1U2YA 5DT1H 2WKOF 4IMKA 1N26A 1TJMA 2DH3A 4FNTA 2WXPA 1QZNA 2XPYA 5JHBA 1G4MA 3WJMB 2WKLA 3W0WD 4X7SL 4JZJB 4K07A 5DUBA 5INDA 3T0EC 2EXYC 4JFPB 1CG9B 2F7PA 3ZKXB 3O2DL 1ZK9A 3GSNA 1KLFA 4YX2L 3O4LE 3VWKA 1J1PL 1AIZA 4NHCL 4L48A 4OZFB 2N0KA 1A6VL 3GGWB 2GTZA 3WAJA 1EEYB 4YHNB 1E3ZA 3GSVA 5EORL 3QJRB 2D31A 4UT6H 4A66A 4AYBA 4F2MA 3K72A 2FQEA 1QSFB 2PP7A 3FW6A 4U7MA 3DI3B 4YIQB 1FA4A 4N8UA 1LM8V 5ABZA 4PRHD 3B9KB 4KQ3H 2WVVB 2UZXA 4D9RE 1FLTX 4GI8A 1X9QA 5JHMA 4NP4L 1USZA 2X2UA 4K7PX 4PJXF 4ZMXA 4Z1PA 4S1RL 3NYKA 3TFBA 5JOEA 3O4OB 1GTFA 1Q0XH 3MOQA 5I8KH 2FLBT 2GCYB 3BO8A 4AITA 3QZPA 5ABDE 3MUZ1 1SJHA 5IF0A 3L9EA 4OGYH 1CS6A 4ZUWA 1CYGA 1NJ9A 4CW1A 3J7HA 3HBQA 3Q2CA 3TX4A 2AJXL 3B34A 2V8LA 2VLMD 3OKLB 5DFTA 4EN3A 3KVQA 5C6PB 1P4IL 1M6OA 1UTDA 3NH7H 2N7AA 4ODWA 4WFGE 2HFTA 4J3OC 3KYKH 1E5YA 3PHQB 5D2LF 4KRPD 3MOBH 4GKSA 1HEJC 3AY4C 2MMXA 1J12A 1ZCRA 3STBA 1EHLH 1TMQA 2A6JB 3RA7H 3TWCL 1DL7L 1BEXA 1YN6B 3PWVB 4K9EH 3HKZA 3DGDA 2BSSA 3PGCA 2YPLA 1QSVA 4LMQE 4RMUA 4F7KA 4YSQA 1ZOXA 2OP4L 2ZYRA 4N2KA 4PWKA 3B8SA 5DD5H 1DJSA 4FLHA 5C0NC 4W68A 4OCYL 3VI3B 5L9DH 4F80A 4A7SA 1NOFA 1GGYA 1NCUA 1KYDA 3CFCL 3DTXA 5E2UH 4N2OA 4PG2A 2OW7A 1R3JB 3WAKA 1UCBH 4ELMB 4NNPL 1NAMH 1V8HA 2AI0H 3IDGA 3NZUA 3GHBH 2X9XA 2V7HA 1NGWB 2AJZA 4HOXA 4YXHH 3QCVH 5C70A 1YMMB 1F6AB 5CEZD 3L3OC 3GS7A 5HDQL 3BKCL 4ZDHB 1RURH 2Y06H 2A2QT 5DLMH 3WFDH 5B4MC 1N6QL 5T5FA 2KT6A 3UTTD 4Z76B 4GUPB 4KRNA 4WNJA 1KUMA 2M83A 3CFCH 2ZE0A 3WMSA 1JXDA 2OJ1A 5D7LB 1OTUC 1FGNL 5TQ2H 3TYFB 3DX9B 1AYRA 2EVJA 1KACB 3VI3E 4GP4B 3TEUA 2OV0A 3LMJL 2WBJB 3MCYA 4BJLA 1I8KB 1MAML 2SEBB 3PPSA 5EOCJ 4TVUA 2UXTA 3KPOB 4GNKB 4TQIA 1RPKA 5D7LA 4PJ5D 1SZNA 3MLUH 3KPSD 1IBZA 4Y19A 5FYKL 1QW8A 5E2TL 1JGDA 1M7UA 3I6KB 4KI5E 2Y25A 1LLAA 3U7AA 3FSOA 3MR9A 1S7QA 3SY0A 4AUJA 1TR7A 4PRNA 1TDQA 3QDMB 3QUKA 2QHLA 5T8IA 3QIWB 1OSEA 1UA6H 3L3JB 2HTLC 3UTQA 3Q05A 4NIYE 5IBLD 2YR3A 4L4JA 5HJDA 1JZ4A 4GAJL 3EH5B 5IGXH 5C86A 3IJSB 4H8UA 1KF9B 4HIXH 4N8CH 4Y2DA 3VACA 5I8CA 3ZHKA 4Y9EA 5DHVH 5DD6B 4K5MA 2VMDA 3CFEB 3E7JA 4GFTB 4UNUA 5J7CC 4L1DA 2P7TA 2EIKB 1TJGH 2A99A 2DBLH 3GBEA 3D87B 2CNZA 5EUKA 1AO7E 5IOKA 4TNGA 2WLKA 4HJJL 4Y2DD 4S1QL 1YVLA 1T04B 5ESAA 3U2IA 1YY9D 4QRRB 5GRUL 5C0BB 2K7QA 3NDYE 4B3EA 3HE7D 2OS7A 3Q6FB 4KXZI 4M8QA 4NO2A 4KHTL 4JO4H 2XWCA 3PWVA 3WJJC 4P2OB 3WFEH 4CAGA 5KBMA 4D9QE 3CZLA 4P4KC 2VMCA 4WI3A 5EZLA 5J1TC 4CSZA 3P2TA 3BP6B 5FHBL 2CKBH 4O2EB 5E8PA 4YJZL 4RAUB 4WUKL 3RUGA 1EJ6A 1RZIB 3ECBB 1CLZH 4CRPA 3FFCA 3HZYA 3SE8L 2VLKA 4QF1A 1WA1X 1YEDB 4L4TD 4PJHE 4NT6A 4IRJC 1JD7A 1F2XK 3LXBA 5J9PA 3SO5A 3L3HA 1HSAB 4XB3A 3L4TA 2DI9A 2BWIA 2WLIB 2MCMA 1FE8L 5JQHC 1A7RL 3BH8B 4J8QA 4U1HA 2HUEA 2DQJH 5T1LA 4X8JA 2IEPA 1QTSA 3VGEA 4F2MB 3M17A 1QTYT 1DJGA 3MFFA 4PJ8D 4MXQC 2YJLA 3HAEA 3P4LA 3NQIA 3MA9H 3RWEB 3B9KA 1JNLH 1XF4A 3JVGC 4JB9L 3RZCD 3PNRB 1FFNB 4F15C 3IMWA 5AYQA 5IV2B 5B38G 5IFJB 3C5XA 2E86A 4Z3IA 3EYUH 4G9DA 4KKPA 3O2WL 4M6OH 4WGVB 1AXSB 4LGSB 4ODTH 4X6DF 4XODA 2OMVA 4OZFG 1T5XB 3EJJX 4S1DC 3ETSA 4XPFH 1BM3H 5E6YA 3HFMH 3NMEA 3V4VA 1BPLB 2DN7A 5JHAA 4EIUA 4EN3C 2VDKH 3GEWB 1RIVL 4JFPA 3V9FA 4CKQA 3HVDA 5HYQA 1XZWA 4TQPA 4YR6A 3QSKB 5CP7A 3CLFH 1OSPH 1ADWA 1B0RB 3G6DH 1JGVL 1AH1A 5EZOL 3AFLA 4Z7VB 5T5NG 2EDXA 3BZEB 5KSBE 2Y9RT 4Y2OA 2WBWB 1JVOA 1NEZG 5AKVA 5E08L 4NB7A 2IH1B 4M7ZB 5DFWH 3H9HA 3MV8D 5DS1A 1NMBL 2MHAA 3Q8CA 3VXQB 2V17H 3APFA 5BXFA 4ZOAA 3H2WA 1N12A 2L7UA 3ATAA 5B8CC 4Y5VA 1P6WA 4G7YH 4EBQL 4EOWL 3QEUB 1R5WB 3FQYA 2XNAB 1P4IH 3VAEA 2X05A 4K3GA 4DP4X 2CCVA 2W8CA 2ITDB 1UB6A 5CWSA 1BP3B 5IJKC 4ZRGA 1H8LA 1CXKA 1R0AH 2IBZY 5BXFB 3AREB 3P4MB 4MLIA 2A9DA 3EDDA 5GRZA 3R1GH 3NJMA 5BVJB 1EFQA 1VPOL 4QXGL 3MRPB 2VE6B 1FPTL 1A6UH 3GTTA 2E4FA 5T33H 4GSDL 1GGUA 2QGEA 4MQTB 1S7VA 2YUWA 4PS4L 1YG9A 1LJMA 4C56A 5DJ2B 3X3FH 4HOZA 3ZTNH 5FS5A 3V7AE 4RSYA 3I9GH 1HCFX 1NGQH 3PAUA 5IB1A 2VNCA 4M3HA 4EUPB 5MEQB 4OFIA 3ILPA 4AYGA 3B7SA 2IH3B 3ZL1A 4N2HA 4L1BA 4PJ8C 4A2FA 4WI5A 3TIDA 5FHAH 4N8VB 1GC1H 4PS7A 1JD9A 2DLFL 4G8GA 4FLOA 5KSAA 1DUZA 1W0VB 4PP1C 1E9PA 5CEZL 3TVMD 4MJ6B 5FCUL 3K6DA 2P28B 1MHEB 4GEIA 5BUPA 3B3IB 1A7OL 1BIIA 1EUTA 3MV9A 3WJLA 5F2FA 1UWXK 1GC1C 4XN9A 1H3TA 5FIEA 1L3WA 3BIBX 1Z0MA 5JA9A 3WIFA 2B77A 4DP6X 4Y4HD 5L2KD 4A7GF 2XQYK 1FUNA 3U83A 3H85A 4U0RB 1XBRA 3MXVH 1TZIB 3NSJA 5KS9F 3B3IA 4DZ8B 4YVNA 3K80A 2BHZA 1YEHL 4PJ6A 5DA0B 4WEEA 1FGVH 1H5BA 3K1KC 5F7FA 3QFJB 4R83A 2CDGB 2Y72A 1XR9B 4H0LC 4IBUA 5KUMA 1RH8A 3OQRA 5JPMA 1LTXA 2I9TB 1NC2B 4KH2A 5JOFB 1UQSA 1TO4A 1VGKA 2OMNA 2BVOB 1I31A 4JUTA 1L9MA 3GXNA 4OF0A 2ZXEB 4C54A 1I7UB 1X5MA 4D8PB 3Q1EA 4O58H 2A6DB 3PV7A 3REVA 1URZA 4M93B 3V0JA 1D5MA 1ZJBA 2Z0BA 3GMOA 4M56A 4F2FA 4RRPM 4PJDA 5FM8A 3DVFA 4TVPL 1FJ1A 3OXSA 3RRQA 1BVLB 4QUOA 2D9CA 4YE0A 5K39A 3LRSA 4UQ3A 1CFNB 4P48A 3QQDB 4PJCA 3L45A 4K15A 4J1UB 2VSCA 3GXMA 2OMYB 1UM5L 4Z3HA 4UB0L 1N18A 2QJDA 5H94B 2KL6A 5JW4Q 4AGQA 2YAQA 1OGPA 2VZ1A 3PREA 5TK2A 5IHUH 1NDGB 1QABA 5I6OA 4OKVB 3D4YA 4JKPL 3PXHA 3GIZL 4XBPA 3VFUB 5F7HA 2ZNWA 3SBRA 5K9QI 5EF2A 1FG9C 3VQ1C 2AEQL 4LVHB 3U48A 1C9SA 4JFSA 5HYJE 4OSUH 1N67A 3LZLA 4LEXH 1OWWA 4PAZA 2JXMB 1SGKA 2WGXA 4FQXA 4R26L 1SDYA 4KY2A 1SPDA 3WTUA 2VUOA 1G7HB 3F00A 3KZ8A 3A5VA 1S7UA 1UVQB 1YYML 4WUKH 5IW1B 3SSGA 2EDYA 4XVTH 2X9ZA 4J8RB 2AK4E 2Y7LA 2VC2B 2AQRA 2XU9A 5BZWA 3WEBA 1XGZA 1PG7W 1HDMA 3ROOB 2EDOA 1KGCE 5BV7H 4LXFA 3SQBB 4M02A 2HFEA 3KHQA 4G8FB 4OVUA 1U4EA 3O6MH 3POCA 1GS6X 1L6ZA 3L4YA 4QJ3B 2RMNA 2R29A 1BGXH 2EKSA 1FSKC 1DR9A 2RGSA 4IBWA 2VN4A 1TG8A 5J4MA 2XKUA 3H56A 4PY8J 4PJ7B 5ICXA 2DWSA 2MPAL 2YN5A 3ZYZA 4DO4A 4RRPA 2V3DA 1T20B 3FRUA 4N8VG 1GPOH 5F6IB 3HMXL 2QVFB 1SDAB 3FQTA 2G2RB 3MV9B 4JY4B 4WI2A 3TBYA 1D6EA 1PTZA 5TD4A 3NESA 1JHKL 1P6AB 5C0JB 5D2NE 5AENA 1U42A 5JO5B 4OIIL 3BUBA 4FI8A 3K6SB 4KWUA 4S2SA 4FULA 3D50A 1L9QA 1K6QL 3D69A 5FLUA 3GLDA 1T0OA 2AV7A 4N8PA 5GGSA 1Q0EA 1W0WB 1F1AA 1PZ3A 3TASA 3DX3A 4AKQA 4N2IA 3VCLB 2XA3A 4JPWL 2NNFA 1FVCB 3R19A 5GZOC 2OXHA 1JZ7A 2DQEH 1PIFA 3S5YA 2EIMB 2IALB 1PL3A 2A4ZA 4XWGH 1YDPA 4AQ1C 3BE1H 5HI3C 4L37B 4NAQA 5B1CA 3O2DA 3F12B 4ZBJA 4LSSL 4ZPTB 3VTMA 4AIXA 5BJTB 3RTQA 1FL3A 2ROYA 4KKAD 1AI1L 2WLZA 5FW6A 1U30A 3AJ7A 1MFBH 3BAEL 3Q9QA 3OJDB 3ARBA 4OKDA 4WHCA 5GGTA 3GUTA 5D5MA 1WA2X 3E2HB 5HYFA 3UJJH 1PG7L 2NW3B 3HI5H 3ECWA 3HFML 5JDSA 2OJEA 4M5TA 1YSOA 2EC9U 4MQ7A 3HB3B 2QELA 4MA7H 3WNKA 1A1OB 1IIKA 1JZEA 1MVUB 2CUMA 2H5UA 4KK5C 5C0BA 4TSBH 1AGDB 2C34A 4ELDA 5AB9A 5I8OL 1ORSA 2ITCA 5JPNB 2O72A 2CE6A 2IH1A 1NCOA 1RJZB 1AZCA 3TIDB 3ATEA 4JFUA 4Y2LA 2KKQA 1SOSA 4O2FA 5D1ZA 1U8IA 2VDPL 4LCYB 1BBJA 2YFOA 1IQDB 5CR8A 5KYUB 1KGUA 2DMGA 4LHQB 4WNSA 4NFCA 4WEBL 1WT5A 4HC1L 5HHOE 4KTEL 1S7SB 3EYVA 3VX0A 2FX7L 2DMCA 4GW1A 3J27A 3RIFF 4P59H 2WMPB 3P9LB 1A25A 1GIGH 2IGFL 4XMLL 4UQ2B 5I1LB 1M9WA 1ZT7A 3T71A 1OGAB 2HFGH 4JVPA 4TOYH 2PKDA 5D6CA 2V5MA 2VXUL 4NZJA 3HG1D 1DO5A 3SDXE 3MNZA 3HAEB 2G5UA 1G7PA 1BQLH 2EKSB 4P2RB 4WY7H 1WJ3A 2QSCL 3V4UH 5JZ7D 3MBWB 1QNZH 3RL1A 5BO0D 2FJGB 1BFTA 1P5UB 4IRZL 4PR5B 2HT4C 3GMQA 5JPMB 4X4YA 4UV7H 4XCCL 4JFFD 5A6LA 5IHBA 3QIUB 4YBQC 3WFHB 3SKUD 4L2YA 3MRRB 3T4YB 1JFQH 1L9RA 1SMDA 5TTRA 3O6FA 4DK5A 5ADPL 1YECH 4F1SA 3ZZLA 4IMLB 2WLHA 2XN9B 2H45A 2D8KA 3S6CA 1UURA 5IFAH 1A0QH 3TPKA 3HHMA 1NBYB 3ZE0B 1NGXB 4OI9A 3MXWL 4POZC 1U8NA 2ZOLB 3WY2A 1XF3A 2JSFA 3EOTL 5D7IA 5JMOC 2Q76A 5KVGL 3SE4A 5C92A 1WAPA 3LNHA 4HHWA 4UM8A 1UM4L 3HOGA 4YUEH 4XBPB 1UA6L 4U49A 1AHWA 1HXMA 1A14L 2UYLB 3WFEL 3HRPA 4F33B 3DO4A 1A6VH 3W0WA 3QAZC 1WBYB 2XKNA 4KUCD 2FBRA 1D2PA 4RMQA 1I85A 1YZZA 2R4SH 1FFOA 1FCGA 1CDCA 2HKHH 1BD2E 5I6PA 2F5AH 3P1VA 4P46C 1T1ZB 2DWDA 2ZYHA 1LILA 4LCIH 3CFDA 3BCFA 3U6RB 3AS3A 3LJ3A 1AAJA 4BZ1H 1HCVA 1S7TB 4K9JA 3L1FA 4PV1C 4UBDC 5D2NC 4FXGA 1Z5YD 4MJID 3BVTA 1Z9PA 5C3TA 2C9VA 4E2OA 4TSBL 2VZOA 3RVTC 4WI4A 4EIGB 3AB0B 4LESA 5J89A 3HE6A 1RJZA 3RDJA 4M1CD 5DMYA 1SFHA 3H53A 4GIPD 1HEZA 2I24N 1PF3A 4JDVB 4JY5L 4K71B 4I5BA 5B21A 3UBGA 4JQIH 1I1RA 5GS1C 4B97A 2E3VA 3D85B 4KJPC 2XQYG 4MNGA 3GPEA 1F3JB 3IJYB 1FORL 1C1EH 2NUTB 5DS8A 5B22A 1A66A 3SPIA 1NIAA 4IU2B 5FUOL 1N59A 4NM8L 3BISA 2R1WA 4UI2A 1KB5H 4JZJC 3T0EB 4ZD3H 3X2QB 1A2YB 1N5AB 1QASA 2MJWA 1CBJA 1QSFA 3PF2A 1LO4L 4QTIL 1BVKB 1H0DA 1WZLA 3EFOA 3PNWB 5A40E 4MD5B 1SOKA 3WFBL 1YC8A 3D05A 5HVHC 3IVKB 3AGWA 1G7MA 2JB5L 4DPCX 2DWYA 3IK2A 4G8AC 2Q86A 3A6OA 2IALA 4X7FC 1KXVA 1S8DB 2YPLD 1TUPA 3BD4A 3BLBA 1FBIL 4ERSH 2JIXD 2HX8A 4RFOH 5DHDA 2CIIB 1KXQA 3F85A 3RFZB 5DVKA 2OR7A 4WTZA 1OCCB 5SX5H 3NJVA 3UJTH 5AEAA 4QOKE 3SYQA 3UO1H 1RUAH 2OQJB 3PWLA 2Z91B 3MBEB 5CEYB 4KMLB 4D0CB 3O6LH 3DDFA 2D03H 5IVXE 3BP5B 5IESL 5DZVA 3DROB 5AQ0A 1KBGH 1A7NH 1QSFE 2ESVA 3ISYA 2X40A 2A9CA 5K5YA 3Q1SL 1ILSA 1BXAA 3MLVL 5D1XB 3K5SA 3QIUC 2ZSVB 4KGLA 4R84A 3S96B 3E1F1 4KHXL 1AKPA 3W37A 1JHTB 3G6JF 1OAQH 1XF2B 1PZ2A 4OTXH 8FABA 2Q2EB 1J1PH 3B9EA 2XVGA 1SN2A 1OCZB 3C6LB 3EGSB 1EO5A 3BW9B 3C08H 3RUGE 2AJSL 5FECA 2W9EH 3RE0A 3N43B 4WENB 5L6YH 1DLFL 3HC4H 5AVUB 5E8DH 1XGTB 2QVIA 4MDJB 4WHTB 4QO1B 1MFDH 4PJEF 2YD9A 4WI8A 4BEIA 2B2XL 1N5YH 1PLCA 4ZSOA 2YD2A 4WY7L 3SDAB 3A6CH 3WLWC 4TVPE 4OV6F 3L4VA 3JT0A 1S46A 1SDDA 5EOTB 1WGVA 4WO4C 2WIIA 1U93B 2Y5EA 3EGSA 2CZNA 4LOUC 4PVLA 4ETYA 1FDLH 3Q2NA 1KJVA 2IC2A 3QNXB 2BH0A 3FQWA 1RUQH 1T66C 4RESB 4PP1D 1W8OA 5L0QB 1KEMH 5FK9A 2R29H 4MMYB 2DLFH 2R56L 3VD2A 1UFGA 3RWCA 4K5NA 5KVDL 1GOGA 5ESQB 1NPUA 2Y06L 2ARJQ 3P69A 5CD3A 1ITCA 1EXGA 2EIZB 4XP5L 4KO9A 3B37A 4KNTA 4HH9B 3EGDB 3BVNA 4HGWB 3BE1L 4Y16B 3ORJA 2BSEA 4LHUA 2APBA 5ACZB 5AD0A 3QZBA 3VXMA 3NJLA 4ZQKA 4JFZH 2A9AA 4O5LL 4J6RL 1M7XA 1EHXA 1KEML 2J1XA 1VFUA 3HPJB 2NQ3A 1E27A 4A2EA 5ADOL 1FZJB 4Z5RB 4WUUB 4NOBA 1AHKA 3AQZA 3ZKSD 1FNGB 4ZMQA 4XCYB 1BVKA 3PNWA 1YEEH 5D1QD 1WT5C 5CD5D 4UQCA 2IANA 4IM8A 1HNFA 3QH3B 4JRYB 4PJIB 4OJCA 5E2JA 3VFSB 4Y2NA 1E28B 4UTAH 2WUCL 3ZL2A 5B38A 2GJZB 4GRLC 4WW1B 1C5BL 3GXFA 1NGYB 4I13B 4TRPL 5D9SA 4AIZA 3IT8D 3MLPA 5G5DB 2IANB 4N20A 4NUGL 2VRAA 3DUUB 3PCYA 3BJLA 1B0WA 1NGPH 3EO1B 1VA9A 1BZ8A 3UMTA 1VIWA 3RGVC 2GIYA 4ZMAT 3F7VA 3LN9A 1NKGA 2X3CA 3CDYA 1KCBA 2VDRH 3FSWA 4OZIE 2VLRE 2M8XA 3CVDA 4X42A 3S96A 4NS0A 2BP5M 3N40F 4N0UB 5TDOA 4E9YA 3MLYL 1HE7A 5F0LB 3ARBC 3P3YA 1DANT 1CLYL 1NUGA 1OWRM 4MA1B 1W72H 1AOZA 3VXUE 2PN5A 1KN2L 1WK0A 2IOOA 2HUHA 1OQOA 3ULVH 2PWDA 5EDXA 3TGXA 2BP8B 3PWJB 1IFHH 5C08A 2E8YA 1EBAA 1HI6A 4XVSL 2LU7A 4EVNB 3ZZSA 4ODXA 4MS6A 1KYOK 1V55B 2OXGA 4XRCB 2C7UB 2E47A 3KXFD 4Z0BL 2VQ1A 2IWKA 2FBJH 4QXVA 1KYFA 1BDYA 4G5AA 4UT9L 3CUPA 2JKWA 4F7MB 1RKRA 1WPCA 2CUHA 3O6KL 2Y3NA 2HP4A 3P02A 4ORGA 4HPHA 4AW4A 4HWUA 1JHKH 4LCYA 4TNVF 1SXNA 2UZYA 5A2FA 1A2YA 1N5AA 4WU7B 5CJ5A 3RWCB 3WS3B 1AS6A 1C08A 3E3QE 1G7IA 2ZG3A 1PW3A 4F9PC 3CZUB 3QEQD 5CLWA 2VXVH 3MRQB 1A9EA 4JQIL 4KX8A 3SBWA 4CVWA 4HA1A 5CP3H 1KCUH 1BWMA 2ZG2A 3MA9L 3RWDA 1BAFH 4UU9B 4Z7UF 4NQSB 2JKIS 4AIEA 2R4RL 5C0FA 3T4AB 1JN6A 2AFNA 1XCTB 2EDJA 5ACLA 2VXTH 3VD5A 1KT2B 3SDDA 5C2UB 4NENB 3IDMA 5A2BA 3MREB 1CURA 3QR2A 3PHOA 2NY1D 1V3MA 1J1XH 2C9SA 5D7IE 3EZ8A 2EECA 1CO1A 1TJIL 4NDMB 4C56E 1BLIA 3K8MA 3PXLA 2DJUA 2OA9A 1TVHA 4LCIL 3BP5A 4NQDB 4GRLD 3WFHA 2Y23A 4RGMB 4LDEB 5CNHA 1ORQA 1RULH 2PCPA 2ZSVA 4MTMA 4KUZL 4P4KA 3QH3A 1E5CA 1I8UA 3QT2A 4WSKA 1CDYA 1CFMA 1H6UA 3OKOA 5D5MF 5KSBF 4ZFGL 1LO5B 2Q5BA 1E67A 2NXYD 1VACB 2E4TA 2NUPB 3FT2B 3GS0A 5CMAB 1OTTD 1PCXA 1UOWA 1FVEB 2Z7ZA 1J18A 1XTLA 4HJGB 1WIPA 3KDMB 1H19A 1DVUA 1Y18B 3KYNA 1HX0A 4I77H 1I1AA 4D9LL 1L6XA 4LLWA 3S98A 5E4IA 3OAZK 1CDJA 2Q2LA 2VQTA 3D0VA 4E9RA 4KKCD 3FAXA 2WYZA 3ECUA 4JJ5B 3DOIA 3VXSA 2FGWH 2GI0A 1S8DA 4J3TA 2VUKA 3EJZD 4LSUL 1DVXA 1I8IA 3BWZA 1E42A 5MEPA 5JORB 5E6IC 1J5HA 6CGTA 2PR4L 4ZFOB 1T83C 3QNXA 4JFED 3VRLF 3WEOA 5CSZB 2WXNA 3BPCA 1B0GA 3MLYH 4UUJA 5KG9A 3WS6A 4JM4L 6PAZA 1ET8A 2ZUQC 5C07B 3C08L 1LNUA 4D0DB 1VPOH 4TV3A 2AXWA 2JJWA 1HYSD 3PGDA 5AW9B 1IILE 3UPRA 2E6PA 4MJHA 2P49B 2WD0A 1SF5A 3ARTA 4BKLB 3DIFA 3I9GL 1AS8A 2IOIA 3DX2A 5FM4A 2YAHA 5E8NB 4WWKB 4N0CD 1EAPA 5DK3A 1XGUB 4JANA 5DI8B 4GINA 4GRMB 5DQDL 4F7MA 5LGJB 3ZZQA 3UO1L 4PJ9D 4H44C 4BFOA 1SLXA 2BSED 2R0LL 4WKZB 4HIPA 2VIRA 1DJYA 4KQ4H 4XMXA 5FGSA 5KVFE 4RQQB 5EUOE 4HG4J 1ASPA 1N0XL 1MWOA 2B4CH 4C83B 4OZGF 4I1RA 4BWTA 1FNGA 1RAMA 2Z8WC 4MMXB 1EX0A 1GKOA 1TNNA 1TU2A 4WFGD 2JTYA 1DQML 4EI0A 3EF7A 1ZLDA 4HK0B 2GTWA 1N6QH 3G7TA 1DN0B 2YSTA 2IJ0C 3L3KA 1O5PA 3PDOB 2Q6WB 4L1LA 4J6RH 1MW3A 3GD1C 1MREH 5AALA 3UTTA 4JCWA 4U6YB 4XB8A 5TK4A 3O9WA 2GJ6E 3WHXA 3TEXA 1GS7A 2VLRD 43CAA 5GS0H 1CI5A 2F54A 2XQBL 4MAYB 4FMFA 1XR9A 5GHWH 3X3FL 1T03H 1BZEA 1BAWA 1F00I 1LK3L 2PWGA 3OPUA 5I75C 3UERA 2L7EA 3QWRD 5IV2A 1TVHB 5D2NA 3SBQA 3ARDA 4PSRA 4ONGH 1UQSB 3IMTA 3P30L 1KELH 2BP3A 2BVOA 3BT2L 4RGOH 1MVFA 4UZSA 4XHJC 1SBSL 4WWNA 1LDPL 4BSWA 4EQ3A 3W39A 1S5IH 4P23B 2R29L 4WQOA 4XPBH 1K8DA 4U3XA 2Z1KA 4WFHE 4M7KH 4AUYA 4OQTA 4UQ9A 3I85A 3KHOA 3O4LB 3BEWB 1YNTB 4PYGA 2ZF8A 3S4SB 5E7FA 5IQLA 3E8VA 1FV1A 4XX1G 5IB2B 1QVOB 1TTRA 3B7RL 4GB9A 4ANWA 1XR8A 4L4TA 2W65A 2XICA 3SDYL 4U1SA 1KIPB 1U95B 3T0EE 5C3IA 4Y4HA 3VFSA 3FN0H 3KD4A 3OKDA 2L7JA 4NO2B 4LL1A 1UJTA 3EYOA 1OK0A 2W95A 1FQ9C 1VFAA 1XH3B 3FU3A 5DQJA 1ODUA 4UTBA 1AQHA 1PKQB 2QVMA 3U4EA 1TCRB 1KSRA 5FYJL 2FHCA 3OHXA 3RWJB 1SFDA 3KYMB 1AE6L 1KENH 4RGND 3VB9A 1Y6NR 2X6CA 1EDQA 4POUB 4O02A 1U8KB 1ZSDB 1RVFH 2YD6A 3WNNA 1YNLH 2VZUA 3PGCB 4IBYA 2RB8A 1IM3D 5CGMA 4I1NB 4EDWH 5IMOB 3LKRB 1E2WA 3KLAB 2B59A 1E0OB 5E6IB 1BBDL 5CJ8A 5GGVH 1UXMA 1SEBB 4MMYA 2DTML 4UM9B 2KLRA 4OCRH 4UOW1 2WXGA 1QO3B 2PPFA 3M17B 3MRHB 1FZKA 5BV7L 1BD2D 2YRZA 1IM3A 5CF3A 1E30A 4EI5B 1ZGLB 4K8RH 3F5WA 3LQAH 2FL5B 3PWJA 2XIBA 3ZKMC 2ADGB 4DN4H 1ZT1A 1XF4B 1MIML 3OM3B 3UH8A 2WNWA 3TA3D 4WK2B 3UJJL 5FA3B 4QRAA 3QIBC 4X9GA 4LCCC 4Z7IA 2WXOA 3L7FB 4LLQA 4PJ7F 4RRPG 2GBAA 4XCFH 4EEEA 3RGBA 5I8OH 3K6IA 5E2VH 2NZ9C 3U9UB 4NM8H 1BJMA 3L4XA 4GW5A 3SDXF 4FNLH 3T1FA 3QJFA 5F6HJ 1C08B 1J8KA 4WSGA 3ZE2E 3PWUA 1ZHBA 5AWNH 4Z77A 3FTUA 4MWFA 5DEZA 2XA8H 2WQAA 3MRFB 4XNYL 3FQNA 3VSQA 4GBXB 2YRLA 5EC2A 5DT1L 4Z7VA 4Z7VE 2PO6B 4QOKD 5KUKA 1DDHB 1FFQA 2NT0A 4UNTA 2WCSA 3FB8B 4OLYL 3ELAT 3C6EA 1Y0LA 3GMPA 4Q58C 4PVNA 2WZ5A 4HS6B 3CHRA 3WS6C 4GJTB 3ZTJG 5F9AC 3ZDXE 3I6GA 4DCQA 5DHVA 1JGEA 3ZKMD 1MLCB 4AMKL 4PLJC 4NPJA 4FHBD 5ESVB 2V5YA 1U8PB 1I7UA 4D8PA 2X0WA 1R3IH 3LZNA 4PIBA 2I5YL 5F89A 1UH3A 3B6SA 1AG6A 4AV4A 1OP9A 4H2CA 3OKDB 1CDIA 3E6FA 2YGVA 4FJ6A 2AMGA 5L9DL 1A4KA 5EU6B 5D8JL 1NEUA 3CBKB 2BOCA 4GRMA 4BH8A 5LGJA 4IU3B 1YC7A 2CGYA 4QD2E 3VW3H 4QI3A 3GHBL 4MNQB 4IGBB 7CGTA 1U3HB 1T03L 4L8BB 2KPNA 5JHDB 3CNKA 4XWGL 5DHXB 4Y4KA 1T1XA 1O7DE 4BRVA 3KW8A 1JPTH 1XXDC 3ASWA 2PPCA 3L08A 1JV2A 3O8XC 3WMQA 1QPXA 2B0SL 2Z0UA 3CFKB 4LEBA 4PWIA 2WLMA 5D72H 5BZXA 3BPCB 3QCUL 4H20L 5GZNA 4DK3A 4UUJB 5KG9B 5E1AA 2BCMA 3EBAA 4UOW0 3QUYD 3UPCA 3L81A 4FQXB 4ZK8A 2F7RA 3R0MA 4OZIB 1FIEA 4BZYA 1TZAA 1WAAE 4A6YH 4MHHI 1ZT1B 1WHPA 1CLVA 4J3OH 5F1IA 2QQLH 4FHJA 4DN3H 1VFMA 2FO4B 3QHZH 3NIDB 3NA4A 1WUNT 4R2GD 4P04A 1LD9A 3RVTD 1KV7A 1YPZA 3GI8L 5IVXF 5B39G 3FONB 3K8KA 1U33A 2EDWA 4HX1A 3IKCB 3TS8A 4MNQE 1Z66A 2VC2H 4F7PA 5JW3L 4FG6D 5A2IH 1P1ZB 4EUPG 1G87A 4PGCB 3BKJL 5DRWB 5FO9B 2NX5D 1RLWA 5GQBA 1KJ2B 3D2UD 2AQSA 3HB3C 4O51A 3OKEA 3P9WB 3VXRE 4AZ8A 2RBLA 4B9ZA 3K2IA 3KBPA 1X5IA 1FFPA 3WKNA 3MCLH 3S2AA 5MP6L 1SNRA 2G3XA 3WSQL 1RUKL 1XIWA 2H6PA 4AYSA 1XGRA 3O3DA 2R69L 1O75A 3T9WA 4JRLA 4MLSA 4MS8D 1CE1H 5C0CE 3VXTA 3FCTA 1R5IA 3DV4A 1HQ4A 3VFPB 1P1VA 2WWKT 1UH4A 4G6AD 2V3EA 1HL4A 3DX0A 2YUZA 2Q20A 3DX6A 2V2TA 3F12A 2F1AA 1WZAA 4XVJL 4HF5L 3FKUS 4AENA 1KGWA 1J0IA 5AW6B 1AQDB 3W39B 3HG1E 3IETB 4L3AA 1I3GH 2Z31A 2GITB 2XZCH 3RG1C 5TF1L 5TPWH 5T3ZD 4RAHA 3F64A 2HSIA 4JRXB 1SN0A 5D1ZD 2X87A 2HTKD 4IOIB 3CFQA 5IG7A 4JHWL 4W4OC 4G80B 3PFQA 4Z9KB 2R4RH 4ZO7A 3X17A 5I1CL 1P4BH 3M8OL 4R5VA 4V11A 1IC0A 4QXUH 1HH6A 1NINA 1FAIH 4U3CA 3ZT5A 3TEYA 2VXVL 5JHLH 2KDYA 2R2BA 3PP4L 4H0IA 3VGHA 2PNDA 2YPVL 1TQCC 2KQNA 4TYUA 4XVJH 1TJIH 1OF2A 5GSVB 3AACA 5DTFB 4NUQA 4TLTA 1JK8A 4M48H 1BMWA 3NZHH 2CHNA 3ML8A 1YEJL 5IR1A 2DIBA 4HFWA 3ESMA 1GL4B 3SZ6A 2Y24A 4D2NA 3WKPA 4GQ9H 1A7RH 1OGSA 1U8KA 1BX2B 5JIQA 2WLLA 1F45A 1GZHC 1ZHBB 4Z77B 3QUXC 3JWDC 3HG3A 5EN3A 3X14A 4XXCC 2GHWB 1JL8A 1I4FA 4ZO9A 3S37X 2OULB 3EJYD 4NHUA 2VERA 2XZQL 3IXTA 4DN3L 3QUMH 1DBMH 1EFXA 2X2HA 3TBVA 1G9HA 2H7WA 3L54A 4A63A 3DJSA 2BWQA 1F4XL 2AMUA 4PRHE 3ML9A 2QPUA 1RFDH 3SKOB 1MNNA 3FCUB 3K2UH 1FYTD 1F56A 3F58L 3GSUB 3SQOH 2HMID 3IDIB 2XOTA 4TVSa 2Y69B 3C6SB 4QR7A 1RZ7L 1P5UA 4PR5A 4Y5YB 4LDLB 4M5YL 1JJUA 3DYOA 5IESH 4QLRA 2PTVA 1WH0A 3OKEB 3CMGA 4R4FL 1EGJA 4F24A 2DV6A 1K8DB 4NM4L 3BUPA 4XP9L 2VLME 4ORZC 4OGAC 2ADFH 2QPEB 5FYKE 3RVWD 3NABH 3UTSB 1O7VA 3G5VA 2HVJB 1MHHB 2Q87A 3LN4A 1AXTH 2WXJA 2I26N 3SGKA 2ZOWA 4BXSV 5IZ7A 1OHZA 3QI9C 3EH2A 4FKEA 2G3ZA 2WO4A 4XH2A 5E6UB 3UTQB 5A1AA 5EF0A 5DS2A 1D2OA 3N43F 2GT9B 4HV8B 2XYBA 2BSSB 3PL6B 2ZKMX 1N4XL 5BUAA 4PJEB 2NY2D 3PFUA 5HYJA 2H6OA 2HJFA 3LNFA 4PUBL 5EIVA 1KGXA 2H32B 2WUCH 3VI3A 3KPLA 2XXGA 5C08E 5IG7B 3JWOH 4NQCD 1J5IA 1SJEB 5T3XH 3AXLB 3QG7L 4YZFF 4LP8A 5I71C 2RQEA 5I1CH 2K7PA 3R06B 3QIBD 4FP8H 1U6AL 3B5HA 2ICWJ 4W70A 3LV3B 2XRAL 1PQZB 3BP4B 3VGAB 2BX5A 4DGYL 35C8L 3LSOA 5IEHB 2K4AA 4NZUL 2Y1AA 1A1MA 5TDNA 2IO5A 2XV6B 3U9WA 1J0YA 5I76A 2Y22A 2YC1A 4OZGA 5JYMA 1J8HE 2IV8A 3FH5A 2TRYA 2NR6D 2I5YH 3VXUA 4Y16C 1D5XB 4NC0B 3VFMB 3CC1A 3DVIA 3K74B 2J4WH 5EEVA 3D3VB 4Z5RA 5I1IH 1TTGA 2F53E 4GUCA 4BM7A 1TF4A 1E3FA 5C0GB 4R5TA 2Z4TA 3MGAA 1LXMA 4AZ8B 4HS8L 4IDLA 4FA7B 4PU2A 3K7UA 2IPUK 5EF1A 1CBVH 3L5WA 3IPFA 2ARJA 1GGTA 2N7BA 1UZ6F 3WNMA 3U25A 3UL4A 4JFDA 4IRZH 4UTAA 5HD8C 4X5WB 5FYKD 4WEUD 5C0JA 2YD3A 3ARFB 2QDVA 3GSQB 3NCCB 3KPMB 1FFNA 3NFPA 4JHAL 3UBXG 4KK5D 5I1IL 5ENWA 3RVXC 3MRNB 5E8EA 5EC1B 1IEAA 2V2TB 4KKRA 1M7DB 1BFSA 1PZDA 1KLGA 4H8PA 4M29A 5T3ZE 2H47C 2IG2H 5JYLA 2G3MA 2J12B 4B5ZA 5CEXA 4S1SH 3NVQA 4G8GD 4IOSA 4NBXB 5T1DH 4XVUD 2BW5A 2I7SA 4PRIB 5DD0L 5C0DA 2EYSA 5AAMA 4BCZA 1RJLB 3WFCH 5BS0D 4HYTB 4YFLI 3DVNA 5HHME 3MPCA 3CDZB 3IGUA 3SPGA 3UBHA 1MHCA 4KZCA 3RTQB 2XTJD 3KE0A 5FO2A 3UZQB 4GKNB 3SYCA 2QR0A 2ZX7A 2A74C 3VXRA 2VZVA 1XBDA 4U6TA 2B9AA 1IGYB 2BIHA 3PV6A 4P2OA 1XGRB 2BSDA 3HE6B 1AD0A 4QHUA 2F08A 3ARYA 5TQ2L 3MJ7A 1EUUA 3QPKA 4IU3A 4ZW5A 4Z23A 3OLGA 4QRFA 2QBWA 4PP2B 3GRWL 4A7TA 2YQ2A 2C5DC 3TV8A 3HI6H 3VWJD 3H9SE 5EN2A 1YPZE 6PCYA 3WDIA 3TIEB 5K59E 4Q14A 5KYXB 5D1QB 5GRVK 3NEEA 3BN9D 1AMYA 1G0XA 3VD1A 3DPBA 1KEGL 1G7QB 5F8QC 3TBSB 5CS7A 1BM7A 3A3YB 5DC4B 1EVUA 3OJVC 1BSIA 1JFHA 2MKWA 1MQKL 1RIUH 3UC2A 1S7VB 4K7PY 12E8L 3BPOC 3CN2A 1JTPA 3S0PA 1NLBH 5EUOA 4IRSC 1WIOA 5HHXH 5D1QA 2IADB 2ZWZA 2J20A 5I17B 5DUPH 3A23A 3B9KC 2CK0H 2BS9A 2Q86B 2D7MA 3ZUCA 4MGXA 2P5EE 2NPLX 2X44D 3FRUB 1ZTXH 2BSRB 1NAKH 2ZYSA 4J12A 4L8DA 3ZO0A 4R7DB 3SDCB 1JPEA 4XNZC 1AGCB 4S0HA 1QR1A 3FFDA 1C7TA 3RDTA 3U36A 1T0MB 4KDTC 3MLTB 4OLYH 4UT7H 5IVXA 5EO9B 4OFVA 2NY7H 2EC9T 1A3QA 1HU8A 5L4FA 1Q9LA 1J1OH 1XB6A 4LLUA 3MLWL 2D3LA 1NCBH 2EO1A 4LLYA 1I8AA 2DYSB 3WIAA 4XP1H 4KAQH 5AOJA 4OZ4A 4PJHB 5DD1L 1NLBL 5BVPL 1DO6A 1MI5D 2CIKA 3BVVA 3DETC 4PS3A 4DP0X 2YKKA 4JRYA 4XP6L 2LV4A 1CYWA 3BZEA 1C8PA 4YVUA 3M88A 2X70A 5SWSE 2CCWA 1IAII 1YQVH 2H1PH 4L8SB 2EQDA 4CC1A 3M07A 3A24A 5JORA 5KBNC 2ZWNA 2VWEE 3CQFA 1KIUA 4JM2A 3DBSA 3BVUA 2C9AA 4LKCA 4ELKB 3VA6A 1EGJL 4HUWA 2IXQA 2FH6A 1JCVA 1I7ZB 3I02B 2Y1VA 1PZ5B 4LMQI 3I75A 1GGIL 3O3AA 1ZIBA 4AVKA 3QC6X 1ZHKA 4K3DL 3BCDA 2A6DA 3IAGC 1XF5B 3TNNA 5GXBB 4DAGH 1ZLVK 2F58H 1FFOB 1NA8A 3MRPA 1KJ3L 1FJ1B 4P4RA 1XEUA 1NIBA 1AY1H 2C9XA 3AG4B 4OLVH 5F93C 4I3SL 2C9PA 2FB4H 3L3DB 1QZ1A 2JCCE 2OYLA 3GJEB 5HVWA 3LIZH 4DEPC 2NDGA 1D5XA 4RCAA 5F3FA 3TZVC 5I9QC 5HXMA 4ATWA 3U4KA 4G8IA 4M93C 4JKLA 3IRCA 3Q5TA 4X0KB 3GMLB 3KYOB 2GIMA 2EUZA 1FN4A 3II3A 4XNMB 1A1NA 1UEMA 3LXAA 4A04A 3OAUH 5EEUA 3IDJB 5DMGD 1YNKL 3O41A 4O4YL 1AS7A 3FQ1A 1S3KL 1C12A 1UFUA 3RUGB 4FC3E 4EJ1C 3D85A 4MNGB 3TH4T 1FGNH 1CFTA 1A1NB 3S3PA 4MAYA 3L9RB 2BDNH 2CH8A 1MRFL 4PJIA 2I85A 1MXGA 4U4BA 1OANA 4P4KD 2C26A 2HVKB 1OEZW 2X09A 3PIQB 2NXZD 4QTHB 5D2NB 1OAXL 4NCDA 4AL8C 3SGJA 4NRZB 2XXCB 1NAMA 1ULVA 1WYJA 2BMKA 3Q3GA 5F96L 3U9PL 2ZUWA 4U1IA 3BQVA 1JGLL 3HNTL 4XCFL 3THMH 4AVIA 4RGOL 5I23A 4IRZA 3CFMA 3DK0A 1WO2A 4FNPA 3KWTA 4Y1AA 5HHMD 1Z3GL 5K69A 1IGJB 3UADA 2P8PB 4QHKJ 1L9NA 5TDPA 4YDVB 4ZFQA 3O11A 1G7LA 4MJ2A 4QGTA 1GYVA 3QA3A 4QTHA 3FQRB 3PS6A 2KQMA 3TBYB 3HCVB 1XAKA 3P4OA 1EHKB 1UB5A 4GAJH 2BDNL 2PCPB 4KI5D 2ZOLA 4B9JA 3N44B 1U95A 2XPGB 4IRSD 3FS9A 4FQJL 1INEH 4GKSB 4H8QA 2I9LA 4XCEB 1A4JB 2V2WB 3Q8BA 2ZF9A 4YAQB 2BIMA 1NSNL 3EYOB 2EH7H 4Z7OB 5DO2D 1JE6A 2FIKB 4QHUB 4G6AC 4MMZA 4ZODA 1ECZA 3AG3B 5ANMB 3REWB 3FOLB 2XX1A 5ICUA 4LL9A 3DKHA 4HJTA 4Y2OB 5LB1A 1F58L 1CTMA 1MCWW 1GC1L 1E4KA 3VGBA 5HVFB 1M7DA 1LEKB 2ZNXA 3PQYA 4PB9H 4CU6A 1INEL 1CFSB 4A2MA 3VXQA 1WAAF 3U1PA 3HNSH 1PBYA 4HUUB 2QPDB 1N68A 1E4XH 4TNFA 5EU7E 3VWJA 2OCCB 1XZ0B 4JPIB 4N5UA 3GYRA 1BZDA 1A64A 4WU7A 3FB6B 2H2SD 3JWNG 3K71A 2F53A 3V0VB 2B3IA 2XZQH 1FZKB 5J06A 5L7XL 2JE8A 4JCLA 4EI5A 4IKKA 3RY6C 2WLJA 4XP1L 1A6PA 5FC9A 1WDAA 2DQMA 5KYWB 1KIQA 4RFEA 2UY7B 4BFEA 4OT1H 4L3ED 4JFFB 3RVVD 1DQDL 4K9EL 1OARL 2WB7A 2ZG1A 2XSKA 3CVIH 3QO1B 4EI5D 4TTDD 3CFBA 1L5GA 4JDEA 1HINL 3KG5A 2C4FU 3TBCA 3VG9B 2EVGA 1TQWA 4XMVA 2A9NL 2XQYA 4CVZA 3DMMD 4ZYKB 4HGMA 4L3EE 2CHDA 5EA0L 1RLBA 5MEND 3W5MA 4LO9A 3LHAA 3D3VA 3SQOL 3CZEA 5ACZA 1JMXA 4KVCH 1JF1B 1BFOA 3QI9A 3I6LD 3IDYB 2AEIT 5C0GA 5CJXA 1KC5L 2Z7YA 2P8LA 3FFCE 1ZDSA 2B1AH 1LWRA 1DQDH 1JS4A 1R6VA 3CDGB 2VLKD 4MFHA 1AANA 1JUFA 4Z8FL 1J7VR 5AKRA 2CGRL 2WXMA 2H3NB 3ZHDA 3QUHA 4EZKA 3F3HA 1AZZC 2UX7A 2ZCLH 2XN9E 4OCSH 5DHYA 4QGYA 2HYMA 5DJAA 1MI5B 2K9FB 4LBEB 3IMUA 1HHGA 5K9QG 1KXTA 3QCTL 5JLZB 4GI6A 4YL9A 1YDPB 4WCYH 5F3BB 4NCC2 3ZO9A 1QBLH 2JF1A 4DN4L 1PJ9A 3FXIC 4QRPB 4TUKL 1KLGB 3BQUA 1CICA 3JT2A 5DUPL 4HPYL 3WUWA 2CJSA 4LARH 5BJTA 3TV3H 3FPXA 2OL3H 5B7MA 3G3LA 5CSZA 3IU4H 5LBVA 2I9LB 3D0LA 1OM9A 4JO2H 2W07B 5D6DC 1FZOA 5AAWC 2QL1A 2D73A 5J6GB 1G7JB 2MPVA 1HVXA 4XNXH 3CX5J 4PRBB 2EDRA 2NTFB 2EH7L 3FUDA 3HUJF 3NSXA 4X6CB 4XPTH 3CXDL 2C4FT 2K9UA 5ECGA 3T3PB 3EXLA 3CD4A 5LG6A 2YO3A 3EYQC 5TH2B 5DRXB 4MSWB 4U0QB 3QDGD 4WLCA 1G9NC 1ZAGA 5GS1B 4ANVA 2GUYA 5C0CD 3RVUD 1MIEL 3EOTH 3LPOA 4ABVA 5CIPA 4QHPA 3JSSA 4XP6H 3BKYL 4Y4HC 3VDAA 3TU6A 3VXPA 3PUUA 1U8IB 3TO4D 4WKZA 2JKRM 1RUKH 2WGNB 5B39A 3VWJB 3A67L 2ALWA 3HI1A 3MX0B 5EO1A 2VOTA 3HHRB 1UD6A 3SZKC 1CGUA 2QVKA 2XWRA 3M46A 4PWGA 3GBMH 2PTUA 3QARA 5CINL 3L5XH 1WBZB 1F97A 4AC4A 4JY6A 5FWRA 4Z18A 3MV9D 5CFAA 4W9HC 4QHKI 2QZ5A 1I7TB 1NEZB 4M00A 3TBWA 3MYJA 1U41A 3SYOA 2VJ8A 1G7IB 1FPTH 2IWFA 4TTDC 5GGSY 2O6DA 1O9ZA 2A1WH 3INUL 3LEXA 5C07E 3BT2H 1WBZA 2AABL 4JY6B 3SN6N 2VKXA 3QUZD 4LSSH 1SHXA 3ALWA 1NUNB 1P0SE 4QXWA 4PJBF 1DANU 1HHJA 2WZ6A 1JF1A 4J4PA 4DNLA 1DQJB 2AK1H 2Y6TE 4CSPA 1OAJA 2A74B 3DYPA 1Q1JH 4R7DA 2MSPA 2Q8BL 3T65A 3HCVA 3P4OB 3NZ8A 2X42A 5I24A 1MREL 1NCWH 2J71A 4QNPF 2UUDK 2CDEB 3TP4A 1BF8A 4Q6KA 1EIBA 2IAMA 3GSNL 4Q9QL 5AAPA 5DJZB 2DY2A 1HHIB 2HX9A 2Z34A 4I89A 4MA3B 5FUZL 2WVSA 2GG1A 5IMLB 2VZ3A 2AJYH 3EJYC 2QGBA 3PGFL 5D1ZC 1PSKL 4KY1L 3FRPA 1CCZA 3OQ3B 3T0VA 3LKNB 4C4BA 3KAAA 4K94H 5G2NA 5FFLA 3PP3K 1QRKA 3ZDZF 4P3DB 4POZD 1DDHA 1N8OE 1W0WA 3ZL4L 4QKTA 4XMZA 1AO7B 4GS7C 1X5JA 4YXHL 4JFOA 4JPQA 2UYLA 3SGJC 2VR6A 3W56A 4NQDE 2IOMA 1GOFA 5KS9B 3ZTJH 3P3SA 5DZNA 1J9QA 2YAPA 3LCYA 4I2XB 4QTFA 1UJ3C 4JPIA 4HWEL 2EUXA 3LS4H 3FB6A 5CCKH 1NL0H 1RK0A 4HGKC 5J6GA 4JMXA 4ZUSA 3MLZH 5IFHL 5J6HA 2XWBA 4HUXB 5DZJA 1TO5A 5KANG 1P7QB 3UTPE 4OV5B 5IHWA 5BOJA 3QW9A 4FN0A 3T3MF 4KVNL 3CZFB 3PWPE 2OMUA 1IGML 5F7MC 2R0WH 2GC4C 1PAZA 2V2WA 3O8XD 4WW2B 5M94B 1P7QD 5HHQB 1EO8L 4UTBH 2LVCA 3MN8A 1X4ZA 1TQVA 4N87A 4NO0A 4YHPA 4MMZB 2GBUA 4N8VA 1INDH 2AXGB 2XY1A 2ZJSL 5DHMC 1T0NB 2Q3ZA 1DVFD 1V7NH 1WFIA 4PJIE 4RAUA 5A7BA 1U8QA 5B4MD 3FTGB 3KJ4B 1MFCL 5LCVL 1JFQL 4CC0A 3KR3L 4YPGB 3QORD 2GK2A 3H54A 4PJGB 1E4KC 3FYEB 4IIQC 1E5ZA 2JK5A 4PFEA 2GSMB 2C3WA 1XDTT 5DVOA 3PWPA 3HZVB 3LQAL 3NCEB 2WN2A 3NIGE 4GIOA 4FFVD 1W8NA 2MH4A 3UJIL 1FE8H 2J6WA 4IRJB 4FTDA 1T7ZA 3VWJC 3WEAA 2EXWD 3MV01 3C9NA 4K3EL 4PJGA 5IM7B 2J4WL 5KYWA 4JN1L 5MERA 3IVKA 2FX8L 3QORB 1TZHB 3QIWA 3ESVF 2FO4A 5JW4R 2VQ4A 1ETZA 4K0OA 4NN5C 3I74A 4DVBA 2ICEC 5JOFA 3BQUC 3VI4F 1YEWA 4K7PH 2J5WA 4WFFD 4DKFL 1AE6H 1QRNB 3STLB 3QQNA 4JL1A 3FU0A 3N1GC 4MJIA 4Z7UE 4WJKB 1A3ZA 2DQDH 3EBGA 4CMHB 5L2KA 5I5IA 1BREA 3UGEA 5C7XL 3R7RA 3OPZH 2FHFA 1EDHA 1N2RB 3INOA 3ZPDA 4P49A 4BUGA 4OJYA 4G8GE 1JHTA 4LBAA 3AU1A 4BWWA 1O6SB 2R0KH 1I8KA 2SEBA 3WJJA 1VAHA 4M8QB 2OI9B 2H32H 3FF8A 3EJZC 3AM8C 4GQRA 4Y9CA 4ZO8A 4YAQA 5EEXA 3ASNB 1IE5A 3C6LA 3MCG1 3ZDZE 1NGYA 2IBGA 2ZPKH 4BH8B 2ORBL 4FZ8L 1C1EL 2FUQA 2VW7A 4K3JL 3HS8A 1I82A 2ARWA 1R3HA 1JVKA 3TZVD 1T7YA 3K91A 1KLUB 1H6FA 4LPYA 4JRYD 4MAYC 4BZ1A 5B39B 1K2DA 4UOZA 3CTTA 2H41A 4I4WA 3U46B 5I18H 1KGJA 1MQ8A 4Y9GA 3CXHK 4JM4H 5DJ0B 2HT2C 3RGHA 5IVOA 3GRWA 3CAFA 1QG3A 1MCLA 5EU4A 1ZHLA 3L5HA 5ITFB 3D39B 1A47A 1NBZA 3BP7B 4A7VA 4R4FH 3GTNA 5ISZA 2ILLA 5FYLD 3WY1A 3SDCC 3FHQA 4GMSL 3W9DA 3C60B 3L4CA 4HPYH 5EB9A 2NTFA 2YAEA 4KPHL 4NJAL 4YSRA 5AL8A 3MUHL 3OR6A 4RFEB 1EHNA 1DQQB 3D34A 2JI3A 3BVNB 4F8OA 3COOA 3PAVA 3B4NA 5GSRB 1C16A 2RFXB 2Z4QA 3Q2VA 3QRGH 1J9SA 1QACA 3FQXB 3TA3C 5CU9A 3QEGH 1JI1A 4GAFB 5IVZA 1U3JA 1BJ8A 2L04A 3BUYB 5C0AD 1TZGL 2YMOA 3HR6A 4B96A 3SGKC 3FUKA 4GIAA 4UOJA 3V6FA 5CEZH 4PJBA 1BX2A 1KJ2L 4YFDB 4ANXA 3WSQH 1MG3C 3BKYH 4NKIL 4HMEA 3UC0H 4GSRA 1KB5A 3MRQA 2KERA 3DDGA 4WI9A 4HEPA 2GK0A 3TJHD 3QFJE 3RBSA 2O6FA 3MV8E 2B9BA 2V37A 3GS4A 4QEGA 4HUKB 2G9KA 1GZPA 1YECL 3LRKA 4FLRA 3PRZA 2JTDA 1I8MB 5DJCB 4DVBB 5DJYB 5DUMH 1BXUA 25C8H 3MRCB 2VDKL 1R3LB 1N0XH 2XI9A 2B5IB 4XWOD 1WF5A 2ZTBA 3FUJA 2VDPB 4DJMA 4NQVA 1KV3A 2F68X 4HWZB 5MENB 4P5MA 4FQPA 3RVWC 1WFNA 4K7FB 4L9DA 1QUPA 4W9ZA 4LP5A 4DERA 4GKZB 4P5TC 4K55A 1R33A 3O0RL 4HUMB 4W9CC 2Z7WA 1N9PA 4JZOB 1D5MB 3GMOB 2F61A 4MA3A 4PD4J 4Z7NF 1CI3M 3VRJB 1GGBL 1XH3A 4WJ5B 4U3SB 1YA5A 2YPLB 4FL4B 1A4CA 1EO7A 4TXVB 1Z2KA 3I9AA 4AKOA 4NSKB 1T0NA 4DVRL 1KLUA 2WSPA 4NXSA 5F7BA 1VZGA 1G9NL 4JZNA 3FO9A 4K8RD 2J57A 1NH6A 4L5FE 4BSVB 2W88A 3V0WL 3BWUC 3FTZA 4BFFA 1Z6JT 3UX9B 5HHVH 1SYSA 3KPPB 2DF3A 4WO4A 5FKPB 4L0YA 2X2IA 3RZWA 1V54B 3PLYA 3BVXA 5I1EL 3ZUNC 3BGFB 3VFNB 2FGWL 3DX7A 1E9PB 5CN3A 1NWOA 2ZX6A 3LY6A 3BUTA 2VLKB 3ZRSA 5D6CB 3SE6A 4DH2A 3HS0C 1ND0A 3O8XB 1JTTA 1GHFL 1BIIB 3S35L 3F5WB 1BF5A 3E6HB 5HHNB 1C5CL 1AVAA 3WKML 4Z76A 1CGYA 2OZ4L 2NDFA 2YEZB 4GUPA 2IADA 1L3NA 1PMYA 3OMZA 2RALA 3MRMB 3JTBA 4LQFH 4MA8H 4M1GL 3ARSA 1OGTA 2ZUSA 1RZGB 2G30A 4HH8A 5DJXA 1S7XB 4C56B 3DMMB 1L4IA 3W1ZA 1MJUL 1ZKAA 2NY6B 2J8UA 3NJJA 3PJSA 5AVQB 2BO0A 4E42A 5CD3B 1YEEL 4HG4K 2JELH 2CXGA 4U1GB 2AANA 5IB1B 5HHMB 2K1MA 1OGTB 2A74A 2RAMA 3K0WA 1OAKL 5CJBA 3BAYA 2X41A 2P42B 3DVGB 4V1DE 4MMXA 3ULUE 3II2A 4OJDH 4DESA 5EEYA 4GBXA 1OO2A 3UC0L 1JPGA 2VM4A 1RL1A 4NZTL 1LHZA 2J56A 2CO3A 4OLEA 2R2EA 3QS2A 3JYBA 3AS2A 1GZPB 2FGZA 2WXQA 2Q7YB 4OD2B 3TFKD 2P24B 2P26A 4XAWH 2JNZA 3RURA 4X6FB 5DUML 4K8RC 1MY5A 3B7TA 2ADIA 4M5YH 4MAUL 2BCKA 5DZOA 3O81A 2R8SH 4ES8A 3WOVA 5AFAA 2UWEB 4F7EB 3WNOA 3IXAB 2FBJL 1BHGA 4GEJA 4ZOBA 3SEPA 3BUQA 4G3YH 4HCIA 5DMGC 3LB6D 2Y7QB 1NIFA 2P24A 5DSCA 2VDQH 2MNWA 4PGJA 1EAQA 1SJHB 4PJEA 5IF0B 4EN3D 1OPGL 2CK0L 2DLHA 2J1KA 4G7QB 2AEWA 4NN6C 3QNYA 3OB0K 1RUML 3ALXA 3O4LA 5DFAA 4GSDH 1SOQA 4XN2A 3US0A 4G6KH 1QA9B 4HUXA 1EH9A 4M43L 4F58L 4ZOCA 3TCLA 1UWFA 2NY7L 2ICEA 3E9TA 4Y1TA 5D7JC 1NGQL 5IY5B 3GRGA 1BQ5A 3FQUA 3MV11 3BAXA 5CBAA 5H4YA 3KYKL 3G6JB 1HWWA 5C09E 3OXSB 4H88L 5AVSB 1Y1DA 4PRHA 4LEOA 4DP8X 1OGAD 2CDFB 1K8IB 1JDDA 4JKNA 3AQXA 3TO4B 4E9VA 1TCRA 1SLWA 2K6YA 6FABH 4PP2A 2YPVH 5C6WH 1KTCA 4OZHF 4F7CA 5HDBE 2UZIH 3GLAA 1A7PL 5DUBB 4MJJA 4YHYB 5INDB 1AGFB 4ODVL 3FMGH 3LXCA 3M7OA 1JXGA 3I3DA 4UINH 1YYCA 1NCAH 3HBGA 2FSDA 3E8UH 4R96A 1OE2A 4ZXBB 4XC1L 4YNYA 4ZMVA 3ZVVA 5JQ6H 3IPBA 3PABA 2HVKA 5FA4A 3QULB 5DQ9B 1TTAA 5DJCA 3LKOA 2RCSH 5FUCC 2E9GA 4FABH 4CADA 3FK3A 2XXFA 3MGTB 3RNQA 3WE1A 3U2SA 3G6JE 5I16B 4WZ9A 4YHZH 4M5SA 2D3VA 4RMBA 3HE7C 5HHPB 1KCKA 3FULA 3NJHA 4UU9A 2IG2L 1KFGA 4NZ8A 4NQSA 1EQWA