3CQXC

Chaperone complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
81
structure length
81
Chain Sequence
ESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 33
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqxC00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
5BMVE 1E1HB 3P50A 4WW0A 4XAXB 1HNXT 3SFDA 3P4RA 3IF8B 4GK0E 5HYAA 3KINB 2IDOB 5EZYE 4NXNT 4DV3T 2V1DB 1WYCA 3ONXA 2ES0A 3JAEA 3ZSTA 5AQVB 3GN5A 2V7MA 4DV6T 5EK2A 2X9YA 3PV0F 2Q9QD 3FB2A 5FXXA 1FMVA 2E9XC 1ZP0A 5C2TA 2PTFA 3SRZA 1MMNA 2K9AA 2NOXA 2OV9A 3FZHB 4COFA 3E08A 4XZCA 1UX5A 3IHRA 4ISTA 2JPFA 4TWHA 1KFYA 4ZI2D 3QK6A 4YT0A 3JADA 1HR0T 4GK5E 2IMLA 1WR6A 5LHIB 3PTRB 3BQLA 4ANJA 2X0LB 2WWUA 4DBQA 1S35A 4JI5T 3AA1B 5FVLA 2L9QA 4XBFB 3JCFA 2BDEA 4UF0B 4K0UA 2X9HA 5HEGA 2BS3A 4QH4A 4U2ZA 3CKDA 2IC6A 4PK4A 3K1SA 3TLVA 3RQWA 4ZI3C 4EXTA 2E8IA 2X0YA 4TN7B 3G06A 1G8XA 3O4XE 2XJ7A 3NKZA 5HEJA 2JQQA 2VWAA 2XHEB 2E9XD 3I0QA 5JDMA 2J62A 4JYAT 5JVDE 2XY8B 2X51A 3ZT5A 4WNKA 4KI0F 4X1YE 3NVOA 4IHJE 3OKQA 3AE3A 5CFBA 2W63A 5L4HA 1IAPA 3AVRA 4DV4T 4ERRA 1W09A 2PJQA 4YTMA 2I59A 3RKOA 1HTJF 4PFOA 4DR7T 2V6YB 2D0TA 3NZQA 5LBMA 4N78D 4NUUA 4LF9T 3AA7B 3RH3A 4JUYA 3AE5A 2OA5A 4EIWA 3R6NA 4X1KE 4IE0A 4X62T 4O2BE 4EEBA 3AEFA 3ZJ1A 3T8OA 5ABEA 1YD8G 2X67A 1L0VA 2H7VC 2RP4A 2WY2A 2VKJA 2XASB 2BVMA 4HTEA 3KBTA 3UFGA 3BQIA 3LSVA 2VK9A 4ZI3D 3H3MA 3IBPA 5FL1A 3UUNA 5HXHA 3TLUA 3L39A 4IGUA 1X9BA 1J1JA 3PUQA 1XNQT 3ONJA 3AEAA 4O4LE 2ZM2A 1E7PA 3AA0B 5L3EB 5J2TE 3ABVA 1X79A 1HG5A 2V7LA 1IJ6A 2ODUA 4TV8E 4H9RC 3P8CD 2VURA 2WB5A 2CLYC 4HWDA 2K3WA 5CJ5A 5FY1A 4O4IE 2AXDS 4HFEA 2V8SV 5FKYA 2M6BA 2CEAA 2VVSA 4JV5T 2UUBT 3I1AA 4FJOA 2YU2A 4EYUA 3IA3A 2XZEA 1VOMA 1MNEA 4PNIA 5A1LA 2YINA 4NIQA 5AQKB 1QSDA 2VQFT 3AVSA 2K5BB 1SA0E 1NEKA 2YK0A 4IE4A 2PG8A 3U78A 4JI2T 4QX7B 2NW9A 1KNPA 2VVNA 2C5JA 2IUBA 2LM9A 4X64T 4LMLA 2WS3A 1S94A 4U7IA 2L8KA 4O2AE 5HAXA 4H9SE 5J0ZA 3ZSSA 4Z91A 3TLSA 4ILBA 3RHWA 3OPCA 5CGMA 4U74A 2WDRA 5HEUA 4YSYA 5L3BB 4YJ3E 2UXCT 3UU8A 2YDQA 3FHNA 4AIUA 4X5TA 4P0AA 2JMKA 2ODVA 2LSGA 3AAIA 3VRBA 2UXDT 5F8PA 1UUSA 2NW8A 3ZPOA 2LOSA 4EV6A 2CBIA 2LE8A 4O8SA 4LF8T 1T98A 3F2EA 4IE5A 5LJNA 4QKNA 3MXZA 2XSBA 3NZPA 4JI7T 2BG9C 2X68A 5FXZA 3J9X1 3RYFE 3ONLC 3N9PA 2B76A 4YLHA 1D1BA 5FY0A 3T1HT 2DWGA 3OJAA 2VL8A 4YHJA 5KDMC 4UF0A 3FZMB 4HFBA 5JQGE 4I55E 2K24A 3EDVA 4H9OC 2A2FX 4LFCT 3I0OA 4CN1A 4EGWA 3AE1A 3UQ4A 3CX7B 4C91A 2XM1A 2KINB 4H9NC 3FXEB 3ZYMA 2WDVA 2VASA 5ETWA 2CXLA 2JQHA 3L09A 3AE4A 1J5WA 3ZCIA 4J2CA 1MNDA 3EABA 4HWHA 2UUCT 2W0GA 3UULA 2YDRA 3Q5XA 4HFIA 4DR4T 2EHOB 2DLRA 2WSSV 2XQ8A 1VRBA 2C5IT 1QLBA 3AECA 1OXZA 2H88A 2XQ7A 4QH5A 2BKPA 2FJBA 5ABHA 4V1Av 5JR9C 3LFMA 2A3DA 5C3JA 3KV9A 3EAMA 4ZZCA 4AKLA 1O3XA 1T72A 3K3QC 3AB3B 3AE2A 2MOZA 2LSYA 3QUJA 3H3AA 1M7KA 2H89A 4KP3C 5FL0A 3U3IA 2VL0A 3PDYA 3QNUA 2V6YA 1OEDB 5JR9A 3O9XA 2W2UA 1JNRA 1Z8UA 2WMNA 2XM2A 4GYSA 2H7OA 2JQKA 4A98A 5HXCA 4UVAB 5FVKA 3N5LA 1MIYA 4HFCA 3B57A 2MPKA 5J2UE 4KMCA 4YTPA 3KV6A 4KX6A 1E2AA 5EK4A 2XSAA 2HH7A 1MIVA 3OYXA 3LG7A 4CI2B 4Z90A 3ZC1A 3RPUA 3RYHE 3RC3A 1H7CA 4IIJE 2CMRA 3E22E 4ISSA 1YKEB 4CZZB 3FZLB 4UR9A 5HEHA 3C4WA 4X65T 3RC8A 1OEDE 2D9DA 4IL4A 5HWYA 3QC9A 3C51A 4QWNB 3X1DA 1XNRT 3ZMTB 2CHOA 5LG4A 4UV8B 4JLEA 4OK0A 5AQHB 4TUYE 4HFDA 4TZ4C 3K3OA 3UUMA 4LFBT 3MACA 2H3RA 4OX9T 1AJ3A 5M4YA 3ANWB 4DV7T 3ESLA 2QRXA 3KVAA 3D0TA 2G0UA 5DQWA 3N2OA 3UT5E 1WLXA 3T1YT 3RKGA 5AQPB 4H9PC 2UXNB 4KHPT 1I94T 2V5CA 4MBQA 3RYIE 2CWYA 2HPLA 4IDNA 1LKXA 3OYZA 4BA9A 5LA6E 5HEOA 3MZKB 2HPJA 3AAEB 4P1NA 2LM2A 4PJMA 2XQ4A 3HKDE 5AFUL 3MK7C 3TKLB 2WWVA 4IDZA 2Q9QB 3ZYLA 4F8HA 3ZYKA 4PJLA 1WR0A 1HNWT 4OFZA 4HWFA 1ZHCA 2QVAA 4DMVA 1U5PA 1N33T 3N2GE 3PUWF 2CXFA 4PK5A 2DCFA 2L3LA 3PU3A 3UTKA 3JC6C 2P9BA 3N9QA 2M6IA 2DL1A 4IL9A 3LK2B 4U31A 5BR8T 2ZM0A 3AAAB 4FI5A 5IYZE 2VB6A 1ZV4X 2NP9A 3RGLA 2YDSA 3RF1A 3ZLIA 5FNVE 2LEHA 3AEEA 4ZXLA 2RA1A 1LVFA 5JDHA 4TX5A 4H9QC 3EVYA 3ZT7A 5FY7A 3PUXF 1YQ4A 5LNKA 4ZI7E 4AQYT 2XQYA 3KV5A 2XUEA 1KNZA 2XAQB 4JI3T 5ADXL 2W00A 1Y01A 3UU3A 2D5UA 3C4ZA 2E5LT 2WU2A 2LRKA 1US7B 4MHCA 3C4XA 3SFEA 1CUNA 3AXJB 4G63A 3RLFF 1XDOA 1HX1B 5EK3A 2WP9A 2V7JA 2EHOC 2LSIA 3NWIA 3AEDA 4LMJA 2E9XB 3O1HA 4AKGA 4B3RT 3UFEA 2PBIA 4DR2T 3LK42 4MFRA 3ZEFB 4DR6T 2Y6XA 3ZKRA 4CN4A 1SUMB 3R84B 3JC6D 2EHOA 3C64A 2JIWA 4ZS3A 4UELA 3PJAJ 2V6XA 3VHLA 3F31A 4DR3T 4I0UA 4UVBB 1OEDC 4A97A 4TNVA 2WAUA 4CXXA 4BJNA 4DV1T 4IREA 1W0BA 3SOLA 4YSZA 1HG2A 3CWZB 2X66A 1J5ET 2GK9A 4LF7T 4H63H 4PJJA 5AQQB 3I9YA 1OEDA 3LBXB 1VCTA 4TNWA 1UURA 5KXJA 4JEUB 4KHZF 2LRLA 3UU5A 4YFSA 2F4VT 1B7TA 2BKOA 2JJ9A 2LJLA 2BVLA 2AE9A 2BBHA 1XZYA 2J1DG 2XTLA 3AA6B 4CXWA 5JDLA 4E7ZA 1KEYA 2E5VA 2FJAA 3EHZA 4MALA 4E7SA 4IDOA 3CQCB 5C8YE 3VKHA 3WAJA 5JDQA 5L3GB 2IW5B 5LHGB 3LDQB 2W66A 2EHOD 3L3PA 3HKBE 1U4QA 5ABFB 4ZEYA 2LT3A 4AQGA 2HN2A 1ZOYA 1N36T 3M65A 4U7YA 5JDNA 3PUGA 5HXRA 2XAJB 2VQET 4QXBB 3Q5DA 4O4HE 4EZ4A 1IBKT 1V9DA 2FJEA 2VKOA 2X9WA 2XPKA 5FXWA 1IZNB 2MAWA 5AQJB 2ZLYA 3KVBA 4P09A 1KNRA 2WMOA 3KFWX 3AE8A 2RPAA 2ZM8A 3TLWA 4BJMA 5HCMA 3VU7H 3P7IA 4I50E 3ANWA 1WFDA 2C5KT 3FBLA 2K48A 2BS2A 1LRZA 1UK5A 2XAFB 3PUYF 3H37A 3P4WA 4HEAA 3ZCJA 2LKHA 5AQMB 3RQUA 2LKGA 4HWIB 2LHRA 4DMWA 2D0UA 2UXXB 3FZKB 2CBJA 2XQAA 3NBXX 3PURA 2KWHA 1HS7A 5AQOB 1BR4A 5LB7B 3AEGA 2J4GA 4AQFC 3KV4A 4TWDA 5FP3A 3W15B 2CA5A 3QB5A 3Q5WA 5L4EA 1BR0A 3C50A 3OBVE 4L0RA 4I43B 2W4XA 2WU5A 4UVCB 4QHOA 4AQFA 2QGSA 2XQ5A 2KLQA 3ETVA 4WYVA 2Q9QA 1I6ZA 2FBWA 5F3JA 4YY3T 4C90A 5IWAT 5LYJE 3UUBA 4EYYR 3AE7A 4U2YA 4X66T 4CQIA 5HXSA 3GA8A 2DI4A 5JRCB 3EDUA 3RIUC 4WBOA 5LGTB 2CRBA 3SWHA 4LF4T 3K8PC 3OVUA 5H6RB 2CE7A 4GKJT 1NAFA 2LOPA 3RIUA 3B5MA 3DJBA 3N9OA 3P4SA 2NR4A 4EAHA 1BR1A 4DV5T 2UXBT 2WQYA 1WCRA 4I4TE 2V7IA 2V5DA 4ILUA 2UU9T 4CI3B 5LXTE 5LBQB 3PUAA 3Q9DA 2FUPA 4PFPA 3E0ZA 5LGUB 3HKCE 3QOFA 3BK9A 3RYCE 3ZMZB 2CCQA 2YKSA 3UU6A 5LOVE 3PE0A 4DUYT 1BR2A 3ZN1B 3OTOT 4X1IE 2JQ9A 5H6QB 3BQKA 2MBGA 4LF5T 1YXRA 1YW0A 3Q5EA 4YHHT 3AXJA 2X0HA 4AXPA 5AQSB 4A56A 1IBMT 2B1EA 1XWMA 1IJ5A 3M3ZB 3A7MA 3B13A 4YSXA 4LFAT 2E9XA 2XAGB 3VR9A 4AISA 4DIDB 5L2LA 4WBNE 5JH7E 3FXDB 3RI5A 5HCJA 4F6RC 3N2KE 1MIWA 2I0MA 2IHR1 4Q25A 2C0SA 5GONE 5AQUB 4ASKA 3HI2A 2KSRA 4ZOLE 3HA4A 3I9WA 4ZZBA 2E2AA 3QB5K 2NTYA 4U33A 2LLYA 4JI8T 3HR0A 4DR5T 1HF8A 2WCAA 1T7SA 2UUAT 4HFVA 3KDSE 5JTGA 4HKAA 2BG9B 1UX4A 3AE9A 2WM9A 3LBXA 2WDQA 3HL6A 4DVDA 4TWFA 2NWBA 5CA1E 2CXDA 4DUZT 1G73A 1W0AA 1MMAA 1Y64B 4CXYA 2WZIA 2BZBA 3ZMSB 3V5UA 3A5XA 3ZN0B 2PFVA 1SHZC 5TAOA 4ADZA 1N32T 2XQ6A 5KMGP 3JAFA 3ZT6A 4JI6T 4OYKA 1WRDA 5LG3A 4IDPA 5DJQC 3N9LA 2A72A 2N9DA 1KK7A 3O1IA 3IEEA 3DTOA 3TLTA 2VKHA 5IUXA 3PU8A 5ABFA 2BG9E 2LHNA 3HKEE 4UIGA 3C98B 4U3CA 5JDGA 3PUSA 2W61A 3VKGA 5L3CB 4G2AA 3J7Yq 3ZJ2A 5IHYA 5AQLB 5JR9B 4H63V 5AQRB 3P4PA 2M67A 4AKRB 2FJDA 3A8YC 1T8BA 5AQTB 1D0XA 1HCIA 4GIWA 2DWKA 2XAHB 3DP7A 4PW8A 2KZ7B 3L8RA 2KXPB 3GN5B 2CM0A 3O1JA 2BKNA 3LK3B 5AQNB 3PJAA 2NTXA 3RRCA 4DO0A 5LMNT 4B3TT 3CK6A 2LSKA 1MMGA 3WI3A 1R8IA 2Y48B 4UV9B 1M62A 4YXDA 1SE7A 4K0KT 1D0ZA 2N2NA 4HFHA 5CA0E 5LJMA 4LMKA 2KMFA 4IT4A 3N9MA 1XMQT 1XDPA 4P0BA 2QYWA 5LMUT 5AQFB 4WZXA 3NRYA 2A9UA 5L3FB 4Z8XA 2HN1A 4NXMT 4AI6A 1FEWA 4IE6A 2JRKA 1JNZA 2YU1A 4DNDA 2D2SA 1D1AA 4GYRA 5HXEA 5CB4E 3RIFA 4JBWF 1UCUA 4A5XA 4EB6E 3K3NA 4MLKA 3RX6A 4YJ2E 3EI0A 3MKDA 3KBUA 4JI4T 3PUVF 5JRCA 4U72A 3CVRA 4ILAA 4M1PA 3V5SA 4B3MT 2HHHT 1KF6A 2CPTA 3ZC0A 4CN6A 4QH1A 4DV2T 4KBMB 2KNDA 4AKHA 2XQ3A 3CX6B 4DBRA 3FBZA 1ZKEA 2YEVC 5E0OA 3CX8B 2OLTA 5L47A 3UU4A 1VCSA 4KUMB 3AE6A 5JREA 4NUVA 2Y8DA 2XQ9A 3LJCA 4ZHQE 5AQGB 4L9IA 4QXCB 3WAKA 2IC9A 1N34T 1LVKA 3P4QA 1W9RA 2QA7A 3CQGB 1DU2A 2R6GF 3MJXA 2DHRA 3ZMVB 3N9NA 2KT9A 2V7KA 1HFAA 2MTQA 5FXVA 2YN6A 2BS4A 3MA9A 4PK6A 4PJNA 4JI1T 5F5WA 3NRXA 1FIOA 2CHNA 5KX5E 3PUZF 2ZMAA 1Z0PA 1YKHB 5AQIB 2Z6EA 4TV9E 4HGAA 3CQXC 4BAYB 2JMHA 4DV0T 4EEDA 4QXHB 4OYJA 4IDQA 2SPCA 1FJGT 1QUUA 4EOZB 4HN9A 1NWMX 2J47A 2CWOA 3UUXB 4JI0T 4HWCA 3GWHA 4UXNB 4AKIA 5JDFA 5ABGA 5L3DB 3ETUA 5HWXA 2W62A 1CHUA 2W67A 2BBJA 1GQEA 2V26A 1XMOT 3Q2MA 4YTNA 1HNZT 4NPPA 4CI1B 4L5GA 2LSJA 3GMIA 1HX8A 2I6HA 2VKDA 4ZS2A 4EZHA 2NW7A 3SS1A 2BG9A 1IBLT 4LF6T 5LP6E 3S4UA 3AEBA 1D0YA 2X9XA 2Q9QC 4JEHB 1UGOA 2ZM6T 4O4JE 4IE7A 3EUHA 2IAKA 3RRWA 3UQ7A 2N1GA 4B3ST 3CMLA 2DNXA 1NENA 3VR8A 4HE8A 2KWIB 4OHFA 4UEMA 4QX8B 3ZMUB 4X20E 1FMWA 2WZHA 5LHHB 3CIRA 4GOUA 3VRAA 2YOEA 2ACZA 3F57A 2CLYB 5LCYA 1D1CA 4ZI2C 1WYBA 4B6XA 4ILCA 5DQVA 5FYMA 2ACXA 2IIUA 3CPZA 5LGNB 5J1GA 2MYSA 1YQ3A 3FZFB 1ZEEA 2WBLA 1MMDA 3RIAA 5DABA 4PAGA 4DR1T 1EZ3A 5FMNA 1OWAA 4GKKT
chains in the Genus database with same CATH topology
2EHOC 2LSIA 5BMVE 2NWBA 5CA1E 2CXDA 1E1HB 2E9XB 3O1HA 2LE8A 4O8SA 4WW0A 1G73A 4XAXB 1MMAA 4AKGA 1Y64B 1T98A 4CXYA 3F2EA 2BZBA 4IE5A 3ZMSB 5LJNA 3V5UA 3UFEA 3IF8B 3A5XA 4GK0E 2PFVA 2PBIA 3KINB 4QKNA 1SHZC 5EZYE 3MXZA 5TAOA 4ADZA 5HYAA 3LK42 3NZPA 4MFRA 2V1DB 1WYCA 3ONXA 2ES0A 3ZEFB 5KMGP 2Y6XA 3R84B 3JC6D 2EHOA 3GN5A 3C64A 4ZS3A 2X68A 5FXZA 4OYKA 3J9X1 3RYFE 4UELA 1WRDA 2V7MA 3N9PA 4YLHA 3VHLA 5EK2A 3F31A 1D1BA 5DJQC 3N9LA 2X9YA 5FY0A 2A72A 2N9DA 2DWGA 4UVBB 1KK7A 3OJAA 2VL8A 4YHJA 5KDMC 2Q9QD 4UF0A 5JQGE 3O1IA 3IEEA 3DTOA 2WAUA 4I55E 3FB2A 2K24A 5FXXA 1FMVA 2E9XC 2VKHA 3EDVA 4H9OC 3PU8A 2A2FX 4CXXA 4BJNA 3I0OA 3ZN0B 2LHNA 3SRZA 3HKEE 1MMNA 3SOLA 3CX7B 4UIGA 3C98B 1HG2A 2K9AA 3CWZB 4C91A 2X66A 2GK9A 5JDGA 4H63H 4PJJA 2KINB 2NOXA 4H9NC 3I9YA 3PUSA 2W61A 3FXEB 3ZYMA 5L3CB 3VKGA 3LBXB 4G2AA 2VASA 5ETWA 3J7Yq 2CXLA 3ZJ2A 5IHYA 5JR9B 4H63V 3L09A 4JEUB 2M67A 4AKRB 3E08A 4XZCA 1UX5A 4YFSA 3IHRA 4ISTA 2JPFA 3ZCIA 1D0XA 1B7TA 1HCIA 2JJ9A 4J2CA 2BVLA 1MNDA 2LJLA 4ZI2D 3QK6A 4GIWA 2J1DG 2DWKA 2XTLA 3AA6B 4CXWA 4GK5E 2XAHB 3DP7A 4E7ZA 5JDLA 4PW8A 2KZ7B 1WR6A 2W0GA 3UULA 3PTRB 5LHIB 3Q5XA 2KXPB 3BQLA 2EHOB 2DLRA 4ANJA 3GN5B 2CM0A 3O1JA 2WSSV 2X0LB 2WWUA 1VRBA 1S35A 2C5IT 4DBQA 3LK3B 4MALA 4E7SA 2NTXA 3RRCA 3CQCB 1OXZA 3AA1B 4DO0A 5C8YE 3VKHA 3WAJA 5JDQA 5L3GB 2L9QA 2IW5B 2LSKA 1MMGA 4XBFB 3WI3A 2BDEA 2Y48B 5JR9C 4V1Av 4UF0B 4UV9B 3LFMA 5LHGB 4K0UA 2A3DA 3KV9A 3L3PA 2EHOD 4AKLA 1O3XA 2X9HA 3HKBE 1U4QA 3K3QC 3AB3B 2MOZA 2LSYA 1D0ZA 3H3AA 3QUJA 2LT3A 2N2NA 4KP3C 3CKDA 2IC6A 4PK4A 4AQGA 3U3IA 5CA0E 5LJMA 2KMFA 3M65A 3PDYA 3PUGA 5JDNA 5HXRA 2XAJB 3N9MA 4QXBB 5JR9A 3O9XA 4O4HE 4ZI3C 4EXTA 4EZ4A 2E8IA 1V9DA 2WMNA 4GYSA 4P0BA 4TN7B 2VKOA 2X9WA 1G8XA 5FXWA 3O4XE 1IZNB 2H7OA 3NRYA 5HXCA 2ZLYA 3KVBA 4P09A 4UVAB 2JQQA 5L3FB 3KFWX 2WMOA 4Z8XA 2VWAA 3N5LA 2ZM8A 1MIYA 4BJMA 4AI6A 1FEWA 3B57A 4IE6A 2XHEB 3VU7H 2JRKA 2E9XD 5J2UE 4KMCA 3KV6A 2YU1A 4DNDA 5EK4A 3P7IA 4I50E 2D2SA 2HH7A 1D1AA 1MIVA 3ANWA 3I0QA 4GYRA 3OYXA 5JDMA 2C5KT 5HXEA 3FBLA 3LG7A 5CB4E 2K48A 1LRZA 4CI2B 1UCUA 2XAFB 3H37A 3ZC1A 4EB6E 4HEAA 5JVDE 3ZCJA 3RPUA 3K3NA 4MLKA 3RX6A 3RYHE 4YJ2E 3RC3A 3MKDA 2LHRA 2X51A 1H7CA 3KBUA 4DMWA 2D0UA 4IIJE 2CMRA 3E22E 4ISSA 4WNKA 5JRCA 2UXXB 1YKEB 4X1YE 4IHJE 4CZZB 4U72A 3OKQA 3NBXX 3CVRA 3PURA 4M1PA 3V5SA 2W63A 2KWHA 1IAPA 1HS7A 3AVRA 4ERRA 2PJQA 3C4WA 3RC8A 3ZC0A 3RKOA 2I59A 1BR4A 1HTJF 5HWYA 3QC9A 4PFOA 4KBMB 2KNDA 3C51A 4QWNB 4AKHA 2D0TA 4AQFC 3NZQA 5LBMA 3ZMTB 3CX6B 4N78D 5LG4A 3KV4A 4NUUA 3FBZA 1ZKEA 2YEVC 5E0OA 4DBRA 4UV8B 3CX8B 3AA7B 4JLEA 4OK0A 4JUYA 5FP3A 3RH3A 3W15B 2CA5A 3Q5WA 4TUYE 1BR0A 2OA5A 3C50A 4TZ4C 3R6NA 4EIWA 4KUMB 4X1KE 3OBVE 5JREA 4L0RA 3K3OA 4NUVA 4I43B 2Y8DA 4IE0A 4O2BE 3UUMA 3LJCA 4ZHQE 3ZJ1A 4UVCB 4QHOA 3T8OA 4AQFA 2QGSA 3MACA 4L9IA 2KLQA 1YD8G 2H3RA 3ETVA 2X67A 2H7VC 2RP4A 4QXCB 1AJ3A 5M4YA 3ANWB 2VKJA 3ESLA 2XASB 3WAKA 2BVMA 3KVAA 2IC9A 4HTEA 3D0TA 1LVKA 2G0UA 2Q9QA 3KBTA 5DQWA 3N2OA 5F3JA 2QA7A 3CQGB 3UT5E 3BQIA 1WLXA 3MJXA 4C90A 2VK9A 2DHRA 2UXNB 4H9PC 3ZMVB 4ZI3D 3N9NA 5LYJE 2KT9A 4EYYR 2V7KA 1HFAA 2MTQA 4CQIA 5HXSA 5FXVA 3GA8A 2DI4A 3IBPA 5JRCB 3EDUA 3UUNA 5HXHA 4MBQA 4WBOA 3RYIE 4IGUA 3MA9A 4PJNA 4PK6A 5LGTB 3PUQA 2CWYA 3SWHA 2HPLA 3NRXA 1FIOA 1LKXA 3OYZA 3K8PC 4O4LE 5KX5E 2ZM2A 3AA0B 5H6RB 4BA9A 2ZMAA 5LA6E 5L3EB 5J2TE 1Z0PA 1YKHB 2CE7A 2Z6EA 1X79A 4TV9E 1NAFA 4HGAA 2LOPA 3MZKB 1HG5A 2V7LA 2HPJA 3AAEB 3CQXC 1IJ6A 2JMHA 3DJBA 4BAYB 2ODUA 4TV8E 3N9OA 4H9RC 4EAHA 1BR1A 3P8CD 4PJMA 2CLYC 4QXHB 4OYJA 4I4TE 2SPCA 1QUUA 2V7IA 4EOZB 3HKDE 5FY1A 5AFUL 4HN9A 1NWMX 3MK7C 2CWOA 4O4IE 3TKLB 3UUXB 4ILUA 4IDZA 3GWHA 4UXNB 4CI3B 5LBQB 5LXTE 2Q9QB 3ZYLA 4AKIA 3ZYKA 3PUAA 4PJLA 4OFZA 5JDFA 3Q9DA 4PFPA 5L3DB 2CEAA 1ZHCA 3ETUA 3E0ZA 5HWXA 2W62A 4DMVA 3HKCE 5LGUB 3BK9A 1U5PA 3RYCE 3ZMZB 2V26A 3I1AA 2CCQA 3N2GE 3Q2MA 4FJOA 5LOVE 2YU2A 4CI1B 3PE0A 4EYUA 1BR2A 2CXFA 4PK5A 4L5GA 3ZN1B 4X1IE 2DCFA 2L3LA 2LSJA 3PU3A 3GMIA 5H6QB 1HX8A 3UTKA 1VOMA 3BQKA 2MBGA 3JC6C 2VKDA 1MNEA 2P9BA 4ZS2A 4PNIA 4EZHA 2NW7A 5A1LA 2YINA 3SS1A 3N9QA 1YW0A 3LK2B 5LP6E 3S4UA 4AXPA 2ZM0A 4A56A 1D0YA 2B1EA 2X9XA 1QSDA 3AAAB 2Q9QC 4JEHB 1IJ5A 3AVSA 4FI5A 2K5BB 5IYZE 3B13A 4O4JE 4IE7A 2VB6A 3EUHA 1SA0E 1ZV4X 2IAKA 2N1GA 2NP9A 3RRWA 2YK0A 4IE4A 2E9XA 2XAGB 3ZLIA 5FNVE 5L2LA 4WBNE 2LEHA 2PG8A 3CMLA 3U78A 5JH7E 3FXDB 2RA1A 2DNXA 4QX7B 3N2KE 1MIWA 4F6RC 1LVFA 2NW9A 5JDHA 4TX5A 4HE8A 2KWIB 2C5JA 4OHFA 4UEMA 4H9QC 2LM9A 3EVYA 4QX8B 3ZMUB 4X20E 1FMWA 5LHHB 4GOUA 5FY7A 2C0SA 1S94A 3F57A 2L8KA 4O2AE 5HAXA 4H9SE 2CLYB 5GONE 5LNKA 4ZI7E 5LCYA 4ASKA 3HI2A 4ZOLE 1D1CA 4ZI2C 2XQYA 3KV5A 1WYBA 2XUEA 3HA4A 1KNZA 4B6XA 2XAQB 3I9WA 5DQVA 5FYMA 5ADXL 2ACXA 2W00A 2NTYA 4U74A 2D5UA 3C4ZA 3CPZA 5L3BB 3HR0A 5LGNB 1HF8A 4YJ3E 1US7B 4HFVA 3KDSE 3FHNA 5J1GA 4HKAA 4P0AA 1UX4A 4MHCA 2MYSA 2JMKA 2ODVA 3C4XA 1CUNA 1ZEEA 2WBLA 1MMDA 2LSGA 3AAIA 4G63A 2WM9A 3LBXA 5DABA 4PAGA 1EZ3A 5F8PA 5FMNA 2NW8A 3ZPOA 5EK3A 1OWAA 3HL6A 4DVDA 2V7JA 2LOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 5BMV E;  1E1H B;  3P50 A;  4WW0 A;  4XAX B;  1HNX T;  3SFD A;  3P4R A;  3IF8 B;  4GK0 E;  5HYA A;  3KIN B;  2IDO B;  5EZY E;  4NXN T;  4DV3 T;  2V1D B;  1WYC A;  3ONX A;  2ES0 A;  3JAE A;  3ZST A;  5AQV B;  3GN5 A;  2V7M A;  4DV6 T;  5EK2 A;  2X9Y A;  3PV0 F;  2Q9Q D;  3FB2 A;  5FXX A;  1FMV A;  2E9X C;  1ZP0 A;  5C2T A;  2PTF A;  3SRZ A;  1MMN A;  2K9A A;  2NOX A;  2OV9 A;  3FZH B;  4COF A;  3E08 A;  4XZC A;  1UX5 A;  3IHR A;  4IST A;  2JPF A;  4TWH A;  1KFY A;  4ZI2 D;  3QK6 A;  4YT0 A;  3JAD A;  1HR0 T;  4GK5 E;  2IML A;  1WR6 A;  5LHI B;  3PTR B;  3BQL A;  4ANJ A;  2X0L B;  2WWU A;  4DBQ A;  1S35 A;  4JI5 T;  3AA1 B;  5FVL A;  2L9Q A;  4XBF B;  3JCF A;  2BDE A;  4UF0 B;  4K0U A;  2X9H A;  5HEG A;  2BS3 A;  4QH4 A;  4U2Z A;  3CKD A;  2IC6 A;  4PK4 A;  3K1S A;  3TLV A;  3RQW A;  4ZI3 C;  4EXT A;  2E8I A;  2X0Y A;  4TN7 B;  3G06 A;  1G8X A;  3O4X E;  2XJ7 A;  3NKZ A;  5HEJ A;  2JQQ A;  2VWA A;  2XHE B;  2E9X D;  3I0Q A;  5JDM A;  2J62 A;  4JYA T;  5JVD E;  2XY8 B;  2X51 A;  3ZT5 A;  4WNK A;  4KI0 F;  4X1Y E;  3NVO A;  4IHJ E;  3OKQ A;  3AE3 A;  5CFB A;  2W63 A;  5L4H A;  1IAP A;  3AVR A;  4DV4 T;  4ERR A;  1W09 A;  2PJQ A;  4YTM A;  2I59 A;  3RKO A;  1HTJ F;  4PFO A;  4DR7 T;  2V6Y B;  2D0T A;  3NZQ A;  5LBM A;  4N78 D;  4NUU A;  4LF9 T;  3AA7 B;  3RH3 A;  4JUY A;  3AE5 A;  2OA5 A;  4EIW A;  3R6N A;  4X1K E;  4IE0 A;  4X62 T;  4O2B E;  4EEB A;  3AEF A;  3ZJ1 A;  3T8O A;  5ABE A;  1YD8 G;  2X67 A;  1L0V A;  2H7V C;  2RP4 A;  2WY2 A;  2VKJ A;  2XAS B;  2BVM A;  4HTE A;  3KBT A;  3UFG A;  3BQI A;  3LSV A;  2VK9 A;  4ZI3 D;  3H3M A;  3IBP A;  5FL1 A;  3UUN A;  5HXH A;  3TLU A;  3L39 A;  4IGU A;  1X9B A;  1J1J A;  3PUQ A;  1XNQ T;  3ONJ A;  3AEA A;  4O4L E;  2ZM2 A;  1E7P A;  3AA0 B;  5L3E B;  5J2T E;  3ABV A;  1X79 A;  1HG5 A;  2V7L A;  1IJ6 A;  2ODU A;  4TV8 E;  4H9R C;  3P8C D;  2VUR A;  2WB5 A;  2CLY C;  4HWD A;  2K3W A;  5CJ5 A;  5FY1 A;  4O4I E;  2AXD S;  4HFE A;  2V8S V;  5FKY A;  2M6B A;  2CEA A;  2VVS A;  4JV5 T;  2UUB T;  3I1A A;  4FJO A;  2YU2 A;  4EYU A;  3IA3 A;  2XZE A;  1VOM A;  1MNE A;  4PNI A;  5A1L A;  2YIN A;  4NIQ A;  5AQK B;  1QSD A;  2VQF T;  3AVS A;  2K5B B;  1SA0 E;  1NEK A;  2YK0 A;  4IE4 A;  2PG8 A;  3U78 A;  4JI2 T;  4QX7 B;  2NW9 A;  1KNP A;  2VVN A;  2C5J A;  2IUB A;  2LM9 A;  4X64 T;  4LML A;  2WS3 A;  1S94 A;  4U7I A;  2L8K A;  4O2A E;  5HAX A;  4H9S E;  5J0Z A;  3ZSS A;  4Z91 A;  3TLS A;  4ILB A;  3RHW A;  3OPC A;  5CGM A;  4U74 A;  2WDR A;  5HEU A;  4YSY A;  5L3B B;  4YJ3 E;  2UXC T;  3UU8 A;  2YDQ A;  3FHN A;  4AIU A;  4X5T A;  4P0A A;  2JMK A;  2ODV A;  2LSG A;  3AAI A;  3VRB A;  2UXD T;  5F8P A;  1UUS A;  2NW8 A;  3ZPO A;  2LOS A;  4EV6 A;  2CBI A;  2LE8 A;  4O8S A;  4LF8 T;  1T98 A;  3F2E A;  4IE5 A;  5LJN A;  4QKN A;  3MXZ A;  2XSB A;  3NZP A;  4JI7 T;  2BG9 C;  2X68 A;  5FXZ A;  3J9X 1;  3RYF E;  3ONL C;  3N9P A;  2B76 A;  4YLH A;  1D1B A;  5FY0 A;  3T1H T;  2DWG A;  3OJA A;  2VL8 A;  4YHJ A;  5KDM C;  4UF0 A;  3FZM B;  4HFB A;  5JQG E;  4I55 E;  2K24 A;  3EDV A;  4H9O C;  2A2F X;  4LFC T;  3I0O A;  4CN1 A;  4EGW A;  3AE1 A;  3UQ4 A;  3CX7 B;  4C91 A;  2XM1 A;  2KIN B;  4H9N C;  3FXE B;  3ZYM A;  2WDV A;  2VAS A;  5ETW A;  2CXL A;  2JQH A;  3L09 A;  3AE4 A;  1J5W A;  3ZCI A;  4J2C A;  1MND A;  3EAB A;  4HWH A;  2UUC T;  2W0G A;  3UUL A;  2YDR A;  3Q5X A;  4HFI A;  4DR4 T;  2EHO B;  2DLR A;  2WSS V;  2XQ8 A;  1VRB A;  2C5I T;  1QLB A;  3AEC A;  1OXZ A;  2H88 A;  2XQ7 A;  4QH5 A;  2BKP A;  2FJB A;  5ABH A;  4V1A v;  5JR9 C;  3LFM A;  2A3D A;  5C3J A;  3KV9 A;  3EAM A;  4ZZC A;  4AKL A;  1O3X A;  1T72 A;  3K3Q C;  3AB3 B;  3AE2 A;  2MOZ A;  2LSY A;  3QUJ A;  3H3A A;  1M7K A;  2H89 A;  4KP3 C;  5FL0 A;  3U3I A;  2VL0 A;  3PDY A;  3QNU A;  2V6Y A;  1OED B;  5JR9 A;  3O9X A;  2W2U A;  1JNR A;  1Z8U A;  2WMN A;  2XM2 A;  4GYS A;  2H7O A;  2JQK A;  4A98 A;  5HXC A;  4UVA B;  5FVK A;  3N5L A;  1MIY A;  4HFC A;  3B57 A;  2MPK A;  5J2U E;  4KMC A;  4YTP A;  3KV6 A;  4KX6 A;  1E2A A;  5EK4 A;  2XSA A;  2HH7 A;  1MIV A;  3OYX A;  3LG7 A;  4CI2 B;  4Z90 A;  3ZC1 A;  3RPU A;  3RYH E;  3RC3 A;  1H7C A;  4IIJ E;  2CMR A;  3E22 E;  4ISS A;  1YKE B;  4CZZ B;  3FZL B;  4UR9 A;  5HEH A;  3C4W A;  4X65 T;  3RC8 A;  1OED E;  2D9D A;  4IL4 A;  5HWY A;  3QC9 A;  3C51 A;  4QWN B;  3X1D A;  1XNR T;  3ZMT B;  2CHO A;  5LG4 A;  4UV8 B;  4JLE A;  4OK0 A;  5AQH B;  4TUY E;  4HFD A;  4TZ4 C;  3K3O A;  3UUM A;  4LFB T;  3MAC A;  2H3R A;  4OX9 T;  1AJ3 A;  5M4Y A;  3ANW B;  4DV7 T;  3ESL A;  2QRX A;  3KVA A;  3D0T A;  2G0U A;  5DQW A;  3N2O A;  3UT5 E;  1WLX A;  3T1Y T;  3RKG A;  5AQP B;  4H9P C;  2UXN B;  4KHP T;  1I94 T;  2V5C A;  4MBQ A;  3RYI E;  2CWY A;  2HPL A;  4IDN A;  1LKX A;  3OYZ A;  4BA9 A;  5LA6 E;  5HEO A;  3MZK B;  2HPJ A;  3AAE B;  4P1N A;  2LM2 A;  4PJM A;  2XQ4 A;  3HKD E;  5AFU L;  3MK7 C;  3TKL B;  2WWV A;  4IDZ A;  2Q9Q B;  3ZYL A;  4F8H A;  3ZYK A;  4PJL A;  1WR0 A;  1HNW T;  4OFZ A;  4HWF A;  1ZHC A;  2QVA A;  4DMV A;  1U5P A;  1N33 T;  3N2G E;  3PUW F;  2CXF A;  4PK5 A;  2DCF A;  2L3L A;  3PU3 A;  3UTK A;  3JC6 C;  2P9B A;  3N9Q A;  2M6I A;  2DL1 A;  4IL9 A;  3LK2 B;  4U31 A;  5BR8 T;  2ZM0 A;  3AAA B;  4FI5 A;  5IYZ E;  2VB6 A;  1ZV4 X;  2NP9 A;  3RGL A;  2YDS A;  3RF1 A;  3ZLI A;  5FNV E;  2LEH A;  3AEE A;  4ZXL A;  2RA1 A;  1LVF A;  5JDH A;  4TX5 A;  4H9Q C;  3EVY A;  3ZT7 A;  5FY7 A;  3PUX F;  1YQ4 A;  5LNK A;  4ZI7 E;  4AQY T;  2XQY A;  3KV5 A;  2XUE A;  1KNZ A;  2XAQ B;  4JI3 T;  5ADX L;  2W00 A;  1Y01 A;  3UU3 A;  2D5U A;  3C4Z A;  2E5L T;  2WU2 A;  2LRK A;  1US7 B;  4MHC A;  3C4X A;  3SFE A;  1CUN A;  3AXJ B;  4G63 A;  3RLF F;  1XDO A;  1HX1 B;  5EK3 A;  2WP9 A;  2V7J A;  2EHO C;  2LSI A;  3NWI A;  3AED A;  4LMJ A;  2E9X B;  3O1H A;  4AKG A;  4B3R T;  3UFE A;  2PBI A;  4DR2 T;  3LK4 2;  4MFR A;  3ZEF B;  4DR6 T;  2Y6X A;  3ZKR A;  4CN4 A;  1SUM B;  3R84 B;  3JC6 D;  2EHO A;  3C64 A;  2JIW A;  4ZS3 A;  4UEL A;  3PJA J;  2V6X A;  3VHL A;  3F31 A;  4DR3 T;  4I0U A;  4UVB B;  1OED C;  4A97 A;  4TNV A;  2WAU A;  4CXX A;  4BJN A;  4DV1 T;  4IRE A;  1W0B A;  3SOL A;  4YSZ A;  1HG2 A;  3CWZ B;  2X66 A;  1J5E T;  2GK9 A;  4LF7 T;  4H63 H;  4PJJ A;  5AQQ B;  3I9Y A;  1OED A;  3LBX B;  1VCT A;  4TNW A;  1UUR A;  5KXJ A;  4JEU B;  4KHZ F;  2LRL A;  3UU5 A;  4YFS A;  2F4V T;  1B7T A;  2BKO A;  2JJ9 A;  2LJL A;  2BVL A;  2AE9 A;  2BBH A;  1XZY A;  2J1D G;  2XTL A;  3AA6 B;  4CXW A;  5JDL A;  4E7Z A;  1KEY A;  2E5V A;  2FJA A;  3EHZ A;  4MAL A;  4E7S A;  4IDO A;  3CQC B;  5C8Y E;  3VKH A;  3WAJ A;  5JDQ A;  5L3G B;  2IW5 B;  5LHG B;  3LDQ B;  2W66 A;  2EHO D;  3L3P A;  3HKB E;  1U4Q A;  5ABF B;  4ZEY A;  2LT3 A;  4AQG A;  2HN2 A;  1ZOY A;  1N36 T;  3M65 A;  4U7Y A;  5JDN A;  3PUG A;  5HXR A;  2XAJ B;  2VQE T;  4QXB B;  3Q5D A;  4O4H E;  4EZ4 A;  1IBK T;  1V9D A;  2FJE A;  2VKO A;  2X9W A;  2XPK A;  5FXW A;  1IZN B;  2MAW A;  5AQJ B;  2ZLY A;  3KVB A;  4P09 A;  1KNR A;  2WMO A;  3KFW X;  3AE8 A;  2RPA A;  2ZM8 A;  3TLW A;  4BJM A;  5HCM A;  3VU7 H;  3P7I A;  4I50 E;  3ANW A;  1WFD A;  2C5K T;  3FBL A;  2K48 A;  2BS2 A;  1LRZ A;  1UK5 A;  2XAF B;  3PUY F;  3H37 A;  3P4W A;  4HEA A;  3ZCJ A;  2LKH A;  5AQM B;  3RQU A;  2LKG A;  4HWI B;  2LHR A;  4DMW A;  2D0U A;  2UXX B;  3FZK B;  2CBJ A;  2XQA A;  3NBX X;  3PUR A;  2KWH A;  1HS7 A;  5AQO B;  1BR4 A;  5LB7 B;  3AEG A;  2J4G A;  4AQF C;  3KV4 A;  4TWD A;  5FP3 A;  3W15 B;  2CA5 A;  3QB5 A;  3Q5W A;  5L4E A;  1BR0 A;  3C50 A;  3OBV E;  4L0R A;  4I43 B;  2W4X A;  2WU5 A;  4UVC B;  4QHO A;  4AQF A;  2QGS A;  2XQ5 A;  2KLQ A;  3ETV A;  4WYV A;  2Q9Q A;  1I6Z A;  2FBW A;  5F3J A;  4YY3 T;  4C90 A;  5IWA T;  5LYJ E;  3UUB A;  4EYY R;  3AE7 A;  4U2Y A;  4X66 T;  4CQI A;  5HXS A;  3GA8 A;  2DI4 A;  5JRC B;  3EDU A;  3RIU C;  4WBO A;  5LGT B;  2CRB A;  3SWH A;  4LF4 T;  3K8P C;  3OVU A;  5H6R B;  2CE7 A;  4GKJ T;  1NAF A;  2LOP A;  3RIU A;  3B5M A;  3DJB A;  3N9O A;  3P4S A;  2NR4 A;  4EAH A;  1BR1 A;  4DV5 T;  2UXB T;  2WQY A;  1WCR A;  4I4T E;  2V7I A;  2V5D A;  4ILU A;  2UU9 T;  4CI3 B;  5LXT E;  5LBQ B;  3PUA A;  3Q9D A;  2FUP A;  4PFP A;  3E0Z A;  5LGU B;  3HKC E;  3QOF A;  3BK9 A;  3RYC E;  3ZMZ B;  2CCQ A;  2YKS A;  3UU6 A;  5LOV E;  3PE0 A;  4DUY T;  1BR2 A;  3ZN1 B;  3OTO T;  4X1I E;  2JQ9 A;  5H6Q B;  3BQK A;  2MBG A;  4LF5 T;  1YXR A;  1YW0 A;  3Q5E A;  4YHH T;  3AXJ A;  2X0H A;  4AXP A;  5AQS B;  4A56 A;  1IBM T;  2B1E A;  1XWM A;  1IJ5 A;  3M3Z B;  3A7M A;  3B13 A;  4YSX A;  4LFA T;  2E9X A;  2XAG B;  3VR9 A;  4AIS A;  4DID B;  5L2L A;  4WBN E;  5JH7 E;  3FXD B;  3RI5 A;  5HCJ A;  4F6R C;  3N2K E;  1MIW A;  2I0M A;  2IHR 1;  4Q25 A;  2C0S A;  5GON E;  5AQU B;  4ASK A;  3HI2 A;  2KSR A;  4ZOL E;  3HA4 A;  3I9W A;  4ZZB A;  2E2A A;  3QB5 K;  2NTY A;  4U33 A;  2LLY A;  4JI8 T;  3HR0 A;  4DR5 T;  1HF8 A;  2WCA A;  1T7S A;  2UUA T;  4HFV A;  3KDS E;  5JTG A;  4HKA A;  2BG9 B;  1UX4 A;  3AE9 A;  2WM9 A;  3LBX A;  2WDQ A;  3HL6 A;  4DVD A;  4TWF A;  2NWB A;  5CA1 E;  2CXD A;  4DUZ T;  1G73 A;  1W0A A;  1MMA A;  1Y64 B;  4CXY A;  2WZI A;  2BZB A;  3ZMS B;  3V5U A;  3A5X A;  3ZN0 B;  2PFV A;  1SHZ C;  5TAO A;  4ADZ A;  1N32 T;  2XQ6 A;  5KMG P;  3JAF A;  3ZT6 A;  4JI6 T;  4OYK A;  1WRD A;  5LG3 A;  4IDP A;  5DJQ C;  3N9L A;  2A72 A;  2N9D A;  1KK7 A;  3O1I A;  3IEE A;  3DTO A;  3TLT A;  2VKH A;  5IUX A;  3PU8 A;  5ABF A;  2BG9 E;  2LHN A;  3HKE E;  4UIG A;  3C98 B;  4U3C A;  5JDG A;  3PUS A;  2W61 A;  3VKG A;  5L3C B;  4G2A A;  3J7Y q;  3ZJ2 A;  5IHY A;  5AQL B;  5JR9 B;  4H63 V;  5AQR B;  3P4P A;  2M67 A;  4AKR B;  2FJD A;  3A8Y C;  1T8B A;  5AQT B;  1D0X A;  1HCI A;  4GIW A;  2DWK A;  2XAH B;  3DP7 A;  4PW8 A;  2KZ7 B;  3L8R A;  2KXP B;  3GN5 B;  2CM0 A;  3O1J A;  2BKN A;  3LK3 B;  5AQN B;  3PJA A;  2NTX A;  3RRC A;  4DO0 A;  5LMN T;  4B3T T;  3CK6 A;  2LSK A;  1MMG A;  3WI3 A;  1R8I A;  2Y48 B;  4UV9 B;  1M62 A;  4YXD A;  1SE7 A;  4K0K T;  1D0Z A;  2N2N A;  4HFH A;  5CA0 E;  5LJM A;  4LMK A;  2KMF A;  4IT4 A;  3N9M A;  1XMQ T;  1XDP A;  4P0B A;  2QYW A;  5LMU T;  5AQF B;  4WZX A;  3NRY A;  2A9U A;  5L3F B;  4Z8X A;  2HN1 A;  4NXM T;  4AI6 A;  1FEW A;  4IE6 A;  2JRK A;  1JNZ A;  2YU1 A;  4DND A;  2D2S A;  1D1A A;  4GYR A;  5HXE A;  5CB4 E;  3RIF A;  4JBW F;  1UCU A;  4A5X A;  4EB6 E;  3K3N A;  4MLK A;  3RX6 A;  4YJ2 E;  3EI0 A;  3MKD A;  3KBU A;  4JI4 T;  3PUV F;  5JRC A;  4U72 A;  3CVR A;  4ILA A;  4M1P A;  3V5S A;  4B3M T;  2HHH T;  1KF6 A;  2CPT A;  3ZC0 A;  4CN6 A;  4QH1 A;  4DV2 T;  4KBM B;  2KND A;  4AKH A;  2XQ3 A;  3CX6 B;  4DBR A;  3FBZ A;  1ZKE A;  2YEV C;  5E0O A;  3CX8 B;  2OLT A;  5L47 A;  3UU4 A;  1VCS A;  4KUM B;  3AE6 A;  5JRE A;  4NUV A;  2Y8D A;  2XQ9 A;  3LJC A;  4ZHQ E;  5AQG B;  4L9I A;  4QXC B;  3WAK A;  2IC9 A;  1N34 T;  1LVK A;  3P4Q A;  1W9R A;  2QA7 A;  3CQG B;  1DU2 A;  2R6G F;  3MJX A;  2DHR A;  3ZMV B;  3N9N A;  2KT9 A;  2V7K A;  1HFA A;  2MTQ A;  5FXV A;  2YN6 A;  2BS4 A;  3MA9 A;  4PK6 A;  4PJN A;  4JI1 T;  5F5W A;  3NRX A;  1FIO A;  2CHN A;  5KX5 E;  3PUZ F;  2ZMA A;  1Z0P A;  1YKH B;  5AQI B;  2Z6E A;  4TV9 E;  4HGA A;  3CQX C;  4BAY B;  2JMH A;  4DV0 T;  4EED A;  4QXH B;  4OYJ A;  4IDQ A;  2SPC A;  1FJG T;  1QUU A;  4EOZ B;  4HN9 A;  1NWM X;  2J47 A;  2CWO A;  3UUX B;  4JI0 T;  4HWC A;  3GWH A;  4UXN B;  4AKI A;  5JDF A;  5ABG A;  5L3D B;  3ETU A;  5HWX A;  2W62 A;  1CHU A;  2W67 A;  2BBJ A;  1GQE A;  2V26 A;  1XMO T;  3Q2M A;  4YTN A;  1HNZ T;  4NPP A;  4CI1 B;  4L5G A;  2LSJ A;  3GMI A;  1HX8 A;  2I6H A;  2VKD A;  4ZS2 A;  4EZH A;  2NW7 A;  3SS1 A;  2BG9 A;  1IBL T;  4LF6 T;  5LP6 E;  3S4U A;  3AEB A;  1D0Y A;  2X9X A;  2Q9Q C;  4JEH B;  1UGO A;  2ZM6 T;  4O4J E;  4IE7 A;  3EUH A;  2IAK A;  3RRW A;  3UQ7 A;  2N1G A;  4B3S T;  3CML A;  2DNX A;  1NEN A;  3VR8 A;  4HE8 A;  2KWI B;  4OHF A;  4UEM A;  4QX8 B;  3ZMU B;  4X20 E;  1FMW A;  2WZH A;  5LHH B;  3CIR A;  4GOU A;  3VRA A;  2YOE A;  2ACZ A;  3F57 A;  2CLY B;  5LCY A;  1D1C A;  4ZI2 C;  1WYB A;  4B6X A;  4ILC A;  5DQV A;  5FYM A;  2ACX A;  2IIU A;  3CPZ A;  5LGN B;  5J1G A;  2MYS A;  1YQ3 A;  3FZF B;  1ZEE A;  2WBL A;  1MMD A;  3RIA A;  5DAB A;  4PAG A;  4DR1 T;  1EZ3 A;  5FMN A;  1OWA A;  4GKK T; 
#chains in the Genus database with same CATH homology
 2EHO C;  2LSI A;  5BMV E;  2NWB A;  5CA1 E;  2CXD A;  1E1H B;  2E9X B;  3O1H A;  2LE8 A;  4O8S A;  4WW0 A;  1G73 A;  4XAX B;  1MMA A;  4AKG A;  1Y64 B;  1T98 A;  4CXY A;  3F2E A;  2BZB A;  4IE5 A;  3ZMS B;  5LJN A;  3V5U A;  3UFE A;  3IF8 B;  3A5X A;  4GK0 E;  2PFV A;  2PBI A;  3KIN B;  4QKN A;  1SHZ C;  5EZY E;  3MXZ A;  5TAO A;  4ADZ A;  5HYA A;  3LK4 2;  3NZP A;  4MFR A;  2V1D B;  1WYC A;  3ONX A;  2ES0 A;  3ZEF B;  5KMG P;  2Y6X A;  3R84 B;  3JC6 D;  2EHO A;  3GN5 A;  3C64 A;  4ZS3 A;  2X68 A;  5FXZ A;  4OYK A;  3J9X 1;  3RYF E;  4UEL A;  1WRD A;  2V7M A;  3N9P A;  4YLH A;  3VHL A;  5EK2 A;  3F31 A;  1D1B A;  5DJQ C;  3N9L A;  2X9Y A;  5FY0 A;  2A72 A;  2N9D A;  2DWG A;  4UVB B;  1KK7 A;  3OJA A;  2VL8 A;  4YHJ A;  5KDM C;  2Q9Q D;  4UF0 A;  5JQG E;  3O1I A;  3IEE A;  3DTO A;  2WAU A;  4I55 E;  3FB2 A;  2K24 A;  5FXX A;  1FMV A;  2E9X C;  2VKH A;  3EDV A;  4H9O C;  3PU8 A;  2A2F X;  4CXX A;  4BJN A;  3I0O A;  3ZN0 B;  2LHN A;  3SRZ A;  3HKE E;  1MMN A;  3SOL A;  3CX7 B;  4UIG A;  3C98 B;  1HG2 A;  2K9A A;  3CWZ B;  4C91 A;  2X66 A;  2GK9 A;  5JDG A;  4H63 H;  4PJJ A;  2KIN B;  2NOX A;  4H9N C;  3I9Y A;  3PUS A;  2W61 A;  3FXE B;  3ZYM A;  5L3C B;  3VKG A;  3LBX B;  4G2A A;  2VAS A;  5ETW A;  3J7Y q;  2CXL A;  3ZJ2 A;  5IHY A;  5JR9 B;  4H63 V;  3L09 A;  4JEU B;  2M67 A;  4AKR B;  3E08 A;  4XZC A;  1UX5 A;  4YFS A;  3IHR A;  4IST A;  2JPF A;  3ZCI A;  1D0X A;  1B7T A;  1HCI A;  2JJ9 A;  4J2C A;  2BVL A;  1MND A;  2LJL A;  4ZI2 D;  3QK6 A;  4GIW A;  2J1D G;  2DWK A;  2XTL A;  3AA6 B;  4CXW A;  4GK5 E;  2XAH B;  3DP7 A;  4E7Z A;  5JDL A;  4PW8 A;  2KZ7 B;  1WR6 A;  2W0G A;  3UUL A;  3PTR B;  5LHI B;  3Q5X A;  2KXP B;  3BQL A;  2EHO B;  2DLR A;  4ANJ A;  3GN5 B;  2CM0 A;  3O1J A;  2WSS V;  2X0L B;  2WWU A;  1VRB A;  1S35 A;  2C5I T;  4DBQ A;  3LK3 B;  4MAL A;  4E7S A;  2NTX A;  3RRC A;  3CQC B;  1OXZ A;  3AA1 B;  4DO0 A;  5C8Y E;  3VKH A;  3WAJ A;  5JDQ A;  5L3G B;  2L9Q A;  2IW5 B;  2LSK A;  1MMG A;  4XBF B;  3WI3 A;  2BDE A;  2Y48 B;  5JR9 C;  4V1A v;  4UF0 B;  4UV9 B;  3LFM A;  5LHG B;  4K0U A;  2A3D A;  3KV9 A;  3L3P A;  2EHO D;  4AKL A;  1O3X A;  2X9H A;  3HKB E;  1U4Q A;  3K3Q C;  3AB3 B;  2MOZ A;  2LSY A;  1D0Z A;  3H3A A;  3QUJ A;  2LT3 A;  2N2N A;  4KP3 C;  3CKD A;  2IC6 A;  4PK4 A;  4AQG A;  3U3I A;  5CA0 E;  5LJM A;  2KMF A;  3M65 A;  3PDY A;  3PUG A;  5JDN A;  5HXR A;  2XAJ B;  3N9M A;  4QXB B;  5JR9 A;  3O9X A;  4O4H E;  4ZI3 C;  4EXT A;  4EZ4 A;  2E8I A;  1V9D A;  2WMN A;  4GYS A;  4P0B A;  4TN7 B;  2VKO A;  2X9W A;  1G8X A;  5FXW A;  3O4X E;  1IZN B;  2H7O A;  3NRY A;  5HXC A;  2ZLY A;  3KVB A;  4P09 A;  4UVA B;  2JQQ A;  5L3F B;  3KFW X;  2WMO A;  4Z8X A;  2VWA A;  3N5L A;  2ZM8 A;  1MIY A;  4BJM A;  4AI6 A;  1FEW A;  3B57 A;  4IE6 A;  2XHE B;  3VU7 H;  2JRK A;  2E9X D;  5J2U E;  4KMC A;  3KV6 A;  2YU1 A;  4DND A;  5EK4 A;  3P7I A;  4I50 E;  2D2S A;  2HH7 A;  1D1A A;  1MIV A;  3ANW A;  3I0Q A;  4GYR A;  3OYX A;  5JDM A;  2C5K T;  5HXE A;  3FBL A;  3LG7 A;  5CB4 E;  2K48 A;  1LRZ A;  4CI2 B;  1UCU A;  2XAF B;  3H37 A;  3ZC1 A;  4EB6 E;  4HEA A;  5JVD E;  3ZCJ A;  3RPU A;  3K3N A;  4MLK A;  3RX6 A;  3RYH E;  4YJ2 E;  3RC3 A;  3MKD A;  2LHR A;  2X51 A;  1H7C A;  3KBU A;  4DMW A;  2D0U A;  4IIJ E;  2CMR A;  3E22 E;  4ISS A;  4WNK A;  5JRC A;  2UXX B;  1YKE B;  4X1Y E;  4IHJ E;  4CZZ B;  4U72 A;  3OKQ A;  3NBX X;  3CVR A;  3PUR A;  4M1P A;  3V5S A;  2W63 A;  2KWH A;  1IAP A;  1HS7 A;  3AVR A;  4ERR A;  2PJQ A;  3C4W A;  3RC8 A;  3ZC0 A;  3RKO A;  2I59 A;  1BR4 A;  1HTJ F;  5HWY A;  3QC9 A;  4PFO A;  4KBM B;  2KND A;  3C51 A;  4QWN B;  4AKH A;  2D0T A;  4AQF C;  3NZQ A;  5LBM A;  3ZMT B;  3CX6 B;  4N78 D;  5LG4 A;  3KV4 A;  4NUU A;  3FBZ A;  1ZKE A;  2YEV C;  5E0O A;  4DBR A;  4UV8 B;  3CX8 B;  3AA7 B;  4JLE A;  4OK0 A;  4JUY A;  5FP3 A;  3RH3 A;  3W15 B;  2CA5 A;  3Q5W A;  4TUY E;  1BR0 A;  2OA5 A;  3C50 A;  4TZ4 C;  3R6N A;  4EIW A;  4KUM B;  4X1K E;  3OBV E;  5JRE A;  4L0R A;  3K3O A;  4NUV A;  4I43 B;  2Y8D A;  4IE0 A;  4O2B E;  3UUM A;  3LJC A;  4ZHQ E;  3ZJ1 A;  4UVC B;  4QHO A;  3T8O A;  4AQF A;  2QGS A;  3MAC A;  4L9I A;  2KLQ A;  1YD8 G;  2H3R A;  3ETV A;  2X67 A;  2H7V C;  2RP4 A;  4QXC B;  1AJ3 A;  5M4Y A;  3ANW B;  2VKJ A;  3ESL A;  2XAS B;  3WAK A;  2BVM A;  3KVA A;  2IC9 A;  4HTE A;  3D0T A;  1LVK A;  2G0U A;  2Q9Q A;  3KBT A;  5DQW A;  3N2O A;  5F3J A;  2QA7 A;  3CQG B;  3UT5 E;  3BQI A;  1WLX A;  3MJX A;  4C90 A;  2VK9 A;  2DHR A;  2UXN B;  4H9P C;  3ZMV B;  4ZI3 D;  3N9N A;  5LYJ E;  2KT9 A;  4EYY R;  2V7K A;  1HFA A;  2MTQ A;  4CQI A;  5HXS A;  5FXV A;  3GA8 A;  2DI4 A;  3IBP A;  5JRC B;  3EDU A;  3UUN A;  5HXH A;  4MBQ A;  4WBO A;  3RYI E;  4IGU A;  3MA9 A;  4PJN A;  4PK6 A;  5LGT B;  3PUQ A;  2CWY A;  3SWH A;  2HPL A;  3NRX A;  1FIO A;  1LKX A;  3OYZ A;  3K8P C;  4O4L E;  5KX5 E;  2ZM2 A;  3AA0 B;  5H6R B;  4BA9 A;  2ZMA A;  5LA6 E;  5L3E B;  5J2T E;  1Z0P A;  1YKH B;  2CE7 A;  2Z6E A;  1X79 A;  4TV9 E;  1NAF A;  4HGA A;  2LOP A;  3MZK B;  1HG5 A;  2V7L A;  2HPJ A;  3AAE B;  3CQX C;  1IJ6 A;  2JMH A;  3DJB A;  4BAY B;  2ODU A;  4TV8 E;  3N9O A;  4H9R C;  4EAH A;  1BR1 A;  3P8C D;  4PJM A;  2CLY C;  4QXH B;  4OYJ A;  4I4T E;  2SPC A;  1QUU A;  2V7I A;  4EOZ B;  3HKD E;  5FY1 A;  5AFU L;  4HN9 A;  1NWM X;  3MK7 C;  2CWO A;  4O4I E;  3TKL B;  3UUX B;  4ILU A;  4IDZ A;  3GWH A;  4UXN B;  4CI3 B;  5LBQ B;  5LXT E;  2Q9Q B;  3ZYL A;  4AKI A;  3ZYK A;  3PUA A;  4PJL A;  4OFZ A;  5JDF A;  3Q9D A;  4PFP A;  5L3D B;  2CEA A;  1ZHC A;  3ETU A;  3E0Z A;  5HWX A;  2W62 A;  4DMV A;  3HKC E;  5LGU B;  3BK9 A;  1U5P A;  3RYC E;  3ZMZ B;  2V26 A;  3I1A A;  2CCQ A;  3N2G E;  3Q2M A;  4FJO A;  5LOV E;  2YU2 A;  4CI1 B;  3PE0 A;  4EYU A;  1BR2 A;  2CXF A;  4PK5 A;  4L5G A;  3ZN1 B;  4X1I E;  2DCF A;  2L3L A;  2LSJ A;  3PU3 A;  3GMI A;  5H6Q B;  1HX8 A;  3UTK A;  1VOM A;  3BQK A;  2MBG A;  3JC6 C;  2VKD A;  1MNE A;  2P9B A;  4ZS2 A;  4PNI A;  4EZH A;  2NW7 A;  5A1L A;  2YIN A;  3SS1 A;  3N9Q A;  1YW0 A;  3LK2 B;  5LP6 E;  3S4U A;  4AXP A;  2ZM0 A;  4A56 A;  1D0Y A;  2B1E A;  2X9X A;  1QSD A;  3AAA B;  2Q9Q C;  4JEH B;  1IJ5 A;  3AVS A;  4FI5 A;  2K5B B;  5IYZ E;  3B13 A;  4O4J E;  4IE7 A;  2VB6 A;  3EUH A;  1SA0 E;  1ZV4 X;  2IAK A;  2N1G A;  2NP9 A;  3RRW A;  2YK0 A;  4IE4 A;  2E9X A;  2XAG B;  3ZLI A;  5FNV E;  5L2L A;  4WBN E;  2LEH A;  2PG8 A;  3CML A;  3U78 A;  5JH7 E;  3FXD B;  2RA1 A;  2DNX A;  4QX7 B;  3N2K E;  1MIW A;  4F6R C;  1LVF A;  2NW9 A;  5JDH A;  4TX5 A;  4HE8 A;  2KWI B;  2C5J A;  4OHF A;  4UEM A;  4H9Q C;  2LM9 A;  3EVY A;  4QX8 B;  3ZMU B;  4X20 E;  1FMW A;  5LHH B;  4GOU A;  5FY7 A;  2C0S A;  1S94 A;  3F57 A;  2L8K A;  4O2A E;  5HAX A;  4H9S E;  2CLY B;  5GON E;  5LNK A;  4ZI7 E;  5LCY A;  4ASK A;  3HI2 A;  4ZOL E;  1D1C A;  4ZI2 C;  2XQY A;  3KV5 A;  1WYB A;  2XUE A;  3HA4 A;  1KNZ A;  4B6X A;  2XAQ B;  3I9W A;  5DQV A;  5FYM A;  5ADX L;  2ACX A;  2W00 A;  2NTY A;  4U74 A;  2D5U A;  3C4Z A;  3CPZ A;  5L3B B;  3HR0 A;  5LGN B;  1HF8 A;  4YJ3 E;  1US7 B;  4HFV A;  3KDS E;  3FHN A;  5J1G A;  4HKA A;  4P0A A;  1UX4 A;  4MHC A;  2MYS A;  2JMK A;  2ODV A;  3C4X A;  1CUN A;  1ZEE A;  2WBL A;  1MMD A;  2LSG A;  3AAI A;  4G63 A;  2WM9 A;  3LBX A;  5DAB A;  4PAG A;  1EZ3 A;  5F8P A;  5FMN A;  2NW8 A;  3ZPO A;  5EK3 A;  1OWA A;  3HL6 A;  4DVD A;  2V7J A;  2LOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...