3CQXC

Chaperone complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
81
structure length
81
Chain Sequence
ESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 33
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqxC00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
2WZIA 1DU2A 4HFDA 2LOSA 2IDOB 4UV9B 2RP4A 2V7JA 2I59A 1YXRA 4M1PA 3RC8A 2UXNB 2XAGB 2IAKA 2DWGA 4O4LE 5L4HA 2UU9T 1FEWA 4ZOLE 4IE0A 3IA3A 2IIUA 3Q5WA 1MMAA 4DVDA 5JDHA 5BMVE 1N32T 2ACZA 4H63H 2ES0A 5FMNA 2XQ4A 1KNPA 1E1HB 1BR1A 1HX1B 2D2SA 2I6HA 2QGSA 3AAAB 3PDYA 4O4HE 4XBFB 2L8KA 3HKDE 3WAKA 5FL0A 1Y64B 2UUCT 2W0GA 2X0LB 3LJCA 1G73A 3ZT7A 4COFA 2LSKA 3J9X1 4YHJA 2ODVA 2V7LA 4DBRA 3I0OA 2E9XB 3AVRA 3UUMA 4WYVA 2PTFA 2WWVA 4JLEA 4HWCA 3ZPOA 4YHHT 2ZM0A 5L2LA 3RGLA 4ZI7E 4FI5A 1HS7A 3NKZA 5JTGA 5AQGB 2AE9A 4UVCB 2BG9C 2CXFA 2WMNA 2E8IA 4QKNA 2E9XA 3C50A 4YTPA 5HXEA 4P0AA 1HNZT 4EGWA 3PUXF 4IDQA 1NENA 3L39A 5EK4A 3ZEFB 2V6YB 3ZT6A 3NZPA 4JEUB 4TWHA 2X9WA 3AAIA 2OV9A 5L3DB 4U7YA 5ABEA 5ABGA 3RQWA 2K48A 3PUWF 4G63A 1W0BA 4KMCA 4QH5A 5J2TE 4QH1A 2CBJA 3PUQA 2WDVA 2XSAA 4YT0A 4HGAA 2PFVA 4DV6T 3K3OA 1KK7A 2XAFB 5CGMA 3LK3B 3ZT5A 2CLYC 5AFUL 4YXDA 3RYFE 2JQQA 5LCYA 2WMOA 3KDSE 4CXXA 4ANJA 5DQWA 4TZ4C 3RRWA 3UFGA 1W9RA 3MXZA 1Z8UA 4HE8A 4IDOA 5JDFA 3ZC1A 5HEJA 3PV0F 3F31A 1HG2A 3UQ7A 2DL1A 2X9HA 4TV8E 3BQKA 4B6XA 4UV8B 3OVUA 4PAGA 4DR1T 2J1DG 2H3RA 2XQ7A 1VOMA 3S4UA 4JI3T 3ZC0A 3PUAA 2WP9A 1S94A 2I0MA 4IL9A 2CA5A 2EHOB 2FBWA 3U78A 2K24A 2Q9QB 3P4SA 5FVKA 1JNRA 3OPCA 3RF1A 5C2TA 1YKHB 4DR2T 5AQUB 3P4WA 3ETVA 4B3RT 1QUUA 4DIDB 2BVLA 2N9DA 4AIUA 2E5LT 2CPTA 4GOUA 5CA1E 3WI3A 2XASB 2VKJA 3AEFA 5HEOA 3SWHA 2G0UA 5C8YE 4MLKA 5J2UE 3P4PA 4P0BA 5L47A 4DR6T 4DV2T 2PBIA 2V5CA 4CN1A 3OYXA 4H9OC 4P1NA 4QX8B 4ZZCA 5F3JA 4YTNA 3KV9A 4PNIA 3L8RA 3RKOA 4OYJA 3TLSA 3V5UA 2VWAA 5DJQC 2YK0A 3AE2A 4O4IE 5HCMA 4A97A 2MTQA 2WDQA 2VURA 5AQQB 3PUVF 3I9YA 1T8BA 5KMGP 4DR4T 1KFYA 4EEDA 1D0ZA 4KUMB 3PE0A 1T72A 2J47A 3AE5A 2DLRA 2NW8A 4IL4A 4X64T 4AKGA 4H9RC 5DABA 4JI2T 2RPAA 2FJDA 3UUBA 3RYHE 2E5VA 5AQRB 4GYSA 3PUZF 3OBVE 2CCQA 3AEGA 2BDEA 2VL8A 1VCSA 3CX7B 3M3ZB 4NUUA 5AQVB 3U3IA 2LHRA 2WB5A 3EVYA 1EZ3A 3QB5K 4ZI2C 5LMUT 2J4GA 4QXHB 5A1LA 4UVBB 3P4QA 2FJEA 2Y48B 5AQFB 4KHPT 4H9PC 3N2KE 3QK6A 3RI5A 4DUZT 4U72A 5LGNB 2BVMA 2YEVC 4HKAA 4X1YE 4AQFA 4NPPA 2BS3A 4QH4A 3ZMZB 5LYJE 2XQ6A 5LXTE 4CI3B 5KX5E 3UULA 3C4XA 2JPFA 3AEEA 2JJ9A 2IC9A 3RLFF 2Q9QC 3MZKB 2K5BB 3EUHA 3R84B 3ZYMA 4DMVA 4YSXA 1B7TA 5J1GA 5J0ZA 3H3MA 2YDSA 3UU8A 3MK7C 3ESLA 1ZP0A 5JRCB 5KDMC 4HFIA 2NTXA 5CJ5A 3ONJA 5ETWA 5FYMA 3AEDA 3VR9A 5HWYA 3ZKRA 4JYAT 5AQMB 3EABA 1XWMA 5LHIB 1U4QA 1WR0A 4NXNT 3ZYLA 2KXPB 3N2OA 2V6XA 4GK5E 4UIGA 5FXWA 2BKNA 2LSJA 4KP3C 4DV5T 1SA0E 5HAXA 3RYIE 2R6GF 4PJNA 1NWMX 3IEEA 3K3QC 4EIWA 2HN2A 2WWUA 3FZFB 1JNZA 2E2AA 2NP9A 2XQAA 4I55E 2YDQA 4K0UA 5CB4E 4E7ZA 4GKJT 4BJNA 2WZHA 4PK4A 5JDNA 2NOXA 2A3DA 2YN6A 2KINB 5FY0A 4ILBA 5AQJB 2PG8A 3AE8A 3TLTA 1E2AA 2M67A 4DMWA 4GKKT 3AE9A 3Q9DA 4JI5T 3E22E 3ONLC 1IAPA 2VK9A 2ZMAA 4U33A 4O2AE 3NZQA 5EZYE 4TV9E 2N2NA 1U5PA 2CM0A 2BG9B 3GMIA 3QC9A 4DO0A 3RIFA 1E7PA 3MKDA 4MHCA 3ZCJA 4ERRA 5F5WA 2HH7A 2H88A 4I0UA 2UUAT 3AE3A 2XAHB 3UU5A 5JDQA 3R6NA 2X0HA 4JEHB 3UU6A 4AXPA 4AI6A 2E9XC 5HWXA 2W2UA 3NWIA 5AQNB 2LSIA 3QOFA 5LBMA 3CQXC 5CFBA 4PFPA 5HXSA 5ADXL 4QX7B 3OJAA 4U2YA 4OFZA 2LRLA 4ZZBA 4IE7A 1AJ3A 2DNXA 1XDPA 4MALA 3QUJA 2WY2A 2X68A 3AE1A 3PU8A 4JI6T 4IDZA 2IW5B 2YKSA 4CN6A 2CBIA 4IREA 2CWOA 2K9AA 3I0QA 4ISTA 3UUXB 2JQKA 2V7MA 3O1HA 5AQPB 1UUSA 1XDOA 5FY1A 2LT3A 4X1IE 4CXYA 5LG3A 2ZM6T 2NR4A 2X0YA 3AAEB 3HR0A 3J7Yq 5AQSB 4UF0A 3VU7H 4UR9A 4EB6E 4GIWA 4YSZA 4QHOA 2DHRA 2VKHA 1W09A 4L5GA 4U2ZA 2JIWA 3KV6A 2XJ7A 5F8PA 1Z0PA 3PUYF 3FZMB 2BS4A 1X79A 5H6QB 5LHGB 4ASKA 2XQYA 2NWBA 1HFAA 2DWKA 5HXCA 4DR5T 4JI4T 1IJ5A 3ZLIA 2HHHT 5LA6E 2LM9A 3EI0A 3PJAJ 1GQEA 3MACA 1ZV4X 2P9BA 2XY8B 1OEDC 3F57A 3LSVA 1D1BA 4ZI3D 2LM2A 5AQKB 3RIUC 3CX6B 1WFDA 3HKEE 3KV4A 3FBZA 3L3PA 4HFHA 2A2FX 5JVDE 3TLUA 2LRKA 3ZN0B 3VKHA 2YU1A 1KEYA 5HXHA 4B3ST 1OEDB 3N9MA 2IHR1 3FHNA 4LMJA 4B3TT 2V6YA 5LB7B 2B1EA 5AQIB 4DV3T 4DR7T 3KINB 4ZI3C 1FIOA 4HEAA 1OXZA 2UUBT 4H63V 5AQTB 2YOEA 3NBXX 1FMWA 4YFSA 1D0XA 3UT5E 5LJNA 2ZLYA 2KSRA 5FNVE 3VHLA 4CXWA 2LJLA 1MNEA 5AQHB 2M6BA 3C64A 3AEAA 5JDGA 2MOZA 3JCFA 3KVBA 2JRKA 2OLTA 4UF0B 2JMHA 5HCJA 5LNKA 4O2BE 4HWIB 2WU5A 4UVAB 4A98A 4EZHA 1MNDA 4DR3T 2XTLA 3AE7A 4PJLA 2LE8A 3HI2A 4A5XA 2LEHA 3FB2A 4X62T 2MAWA 4DV7T 4X65T 4PJMA 2MBGA 1YW0A 2Y8DA 2UXXB 3FZHB 1J5ET 4ZI2D 3ZMSB 3KBTA 1LVKA 2W67A 2LLYA 2LKHA 3IHRA 3DJBA 4HWFA 1IBKT 2UXDT 4HFBA 5JH7E 3N9LA 4DV4T 4OK0A 3KV5A 3AVSA 4C91A 3TLVA 4MFRA 1HNWT 3BQIA 2H89A 5FP3A 1H7CA 3ONXA 4WBOA 1N34T 4E7SA 2XM1A 4EYYR 3W15B 1OWAA 2VVNA 4BJMA 1J5WA 4JUYA 3E0ZA 4WNKA 3CPZA 3ZJ2A 2CHOA 1KNRA 2KT9A 2F4VT 2YDRA 2Y6XA 2VL0A 3FBLA 3PU3A 4TNWA 1SE7A 2WQYA 1UURA 3VR8A 2NW7A 5LOVE 1HR0T 4LF9T 2WSSV 4XZCA 1HF8A 4EV6A 5M4YA 1T98A 3NRYA 4H9QC 4CZZB 4WBNE 3ZSTA 4BA9A 3MJXA 3CQCB 4LMKA 2M6IA 2C5KT 5BR8T 2KZ7B 1D0YA 3P4RA 4EZ4A 4H9SE 5FVLA 4EOZB 3Q5DA 2W4XA 4AKRB 2FJBA 3CVRA 3UUNA 1WRDA 2BBHA 4JI8T 2XQ9A 4UEMA 3KVAA 4I50E 3GN5A 1D1AA 5H6RB 1NAFA 3C4WA 3AECA 3C4ZA 5HEHA 4EEBA 2V5DA 5L3FB 1ZKEA 4X1KE 5FXVA 2A9UA 2LOPA 4J2CA 5JDMA 4EXTA 3JADA 4AISA 3GN5B 1QSDA 3UU3A 3ZYKA 3OYZA 2CLYB 2WM9A 2VQET 3TKLB 4LFBT 4KBMB 4BAYB 1MIYA 2DI4A 3LK2B 4IT4A 2XUEA 1WYBA 3CIRA 4PFOA 2SPCA 1LVFA 3B57A 1UX4A 4TUYE 5GONE 4PK6A 4LF5T 1I6ZA 3AEBA 3LBXA 3KFWX 1Y01A 3FZLB 4ILCA 3EDUA 2JMKA 3L09A 3UQ4A 4DBQA 2CMRA 1VCTA 3E08A 4Q25A 3VRBA 3C51A 2QA7A 3ZMVB 4N78D 5TAOA 3LDQB 1HNXT 1HTJF 5ABFB 4EYUA 3LFMA 2L9QA 3HKCE 2XQ8A 3LBXB 4HTEA 3FXDB 3ZMTB 4I4TE 5L3CB 1XMQT 2VKOA 2X66A 4P09A 5FY7A 3NVOA 4QXBB 2W63A 4PK5A 3ETUA 4IE5A 5AQOB 5C3JA 3M65A 1LRZA 3N5LA 3V5SA 5ABHA 4C90A 1YKEB 3CMLA 3OTOT 4X20E 3AE6A 3NRXA 5JR9A 5JREA 4LF4T 2B76A 3ANWB 1IBMT 2QYWA 2V26A 4B3MT 3RIAA 3EDVA 2X9YA 2ZM8A 5EK3A 5FL1A 3CQGB 1MMNA 4IDNA 2LHNA 1QLBA 2KWIB 2VB6A 2XM2A 3FZKB 3H3AA 4PW8A 4WZXA 3SS1A 4O8SA 2CWYA 1J1JA 5JQGE 5LGUB 3ANWA 3K1SA 3RYCE 3Q2MA 4U3CA 1VRBA 1BR2A 4TN7B 4AKIA 4IDPA 3ZSSA 2IUBA 1N36T 2FUPA 2EHOA 2K3WA 2XSBA 5HYAA 2X9XA 4K0KT 2AXDS 3CKDA 4IGUA 2KWHA 1XNQT 2UXBT 5FKYA 1D1CA 2XHEB 4H9NC 5IWAT 2WU2A 4YJ2E 3B5MA 2PJQA 4MBQA 3X1DA 1X9BA 2C0SA 2XAQB 4NUVA 2EHOC 4KHZF 4ZXLA 4AQFC 2ACXA 3SOLA 5CA0E 4Z91A 3N9NA 1LKXA 3FXEB 4YTMA 1UK5A 2N1GA 5FXZA 5AQLB 1XMOT 1N33T 4JV5T 2H7OA 3AE4A 3AB3B 4YY3T 3CK6A 3Q5EA 2V1DB 1CUNA 2XQ5A 1ZHCA 1BR4A 3AXJB 2HN1A 2CXDA 2CXLA 3O4XE 1YQ3A 3RKGA 3UFEA 1WCRA 2WDRA 4OHFA 4TNVA 4I43B 4WW0A 3TLWA 1ZEEA 2VQFT 1FJGT 1SHZC 3JC6C 1MMDA 2W61A 3PJAA 1W0AA 3EAMA 3G06A 5HEGA 4LF8T 3AXJA 4G2AA 4CI2B 1I94T 3N9QA 4ZHQE 3H37A 3WAJA 2XZEA 4X5TA 2ZM2A 4QWNB 3RX6A 4AQGA 1WR6A 3RQUA 1BR0A 4F6RC 4QXCB 3KBUA 4U74A 2D9DA 5LHHB 4UXNB 4IIJE 4U31A 3AA7B 2NTYA 2BG9A 2A72A 2KLQA 1R8IA 3ZCIA 4AKLA 3JC6D 5L3GB 4AQYT 4ADZA 4ZS3A 5JDLA 3T1YT 2MYSA 3P8CD 4ISSA 5JR9B 2KMFA 3RH3A 2VASA 1IBLT 5IUXA 3SFEA 5JRCA 3HKBE 3A7MA 4AKHA 4UELA 2J62A 4HFVA 4DNDA 2VKDA 1YD8G 1OEDE 1M7KA 1WYCA 3ABVA 2XQ3A 3T8OA 5L4EA 3T1HT 2LSGA 2Z6EA 1O3XA 4Z8XA 2LSYA 3IF8B 5LGTB 3DP7A 2H7VC 4YJ3E 4ZEYA 2X67A 3N2GE 4OYKA 2WBLA 3SRZA 4DV1T 4JI1T 1XZYA 2FJAA 3AA0B 3OKQA 2YU2A 4A56A 4EAHA 4OX9T 3HA4A 5IHYA 1HX8A 1KF6A 4YLHA 2GK9A 4LF6T 1WLXA 1G8XA 3DTOA 4L0RA 3RRCA 5KXJA 3P50A 2OA5A 1MMGA 2W66A 1US7B 3QB5A 4LMLA 4L9IA 2W00A 2XPKA 4Z90A 5DQVA 4U7IA 3UTKA 3O9XA 2RA1A 4XAXB 4YSYA 4JI7T 3BQLA 1UX5A 3EHZA 3PURA 4IE6A 4V1Av 4NIQA 5HEUA 2C5IT 3B13A 1IZNB 2BZBA 2D0UA 2IMLA 2QRXA 3JAFA 3K3NA 2CRBA 4GK0E 4TWFA 4LFCT 3UU4A 3ZMUB 4F8HA 2D0TA 3ZN1B 2V8SV 1MIVA 3BK9A 4FJOA 4KX6A 2V7IA 3PUSA 2E9XD 3HL6A 1OEDA 3P7IA 3SFDA 4X66T 3GA8A 1UGOA 3I1AA 3D0TA 2X51A 3N9PA 3CX8B 2LKGA 3A5XA 2CHNA 4HFCA 1L0VA 5JR9C 5LG4A 1MIWA 1FMVA 2D5UA 1ZOYA 2JQ9A 2VVSA 3N9OA 3ZJ1A 1HCIA 2CE7A 2JQHA 4HN9A 4LF7T 2BS2A 1HG5A 2BG9E 2NW9A 2QVAA 1UCUA 3A8YC 5HXRA 3RC3A 4CI1B 3VKGA 1KNZA 1M62A 4DV0T 1V9DA 3QNUA 3VRAA 5FXXA 3PTRB 5IYZE 3CWZB 5E0OA 3LG7A 4CQIA 2BKOA 2L3LA 3MA9A 2WCAA 2BBJA 5LP6E 2WS3A 4JBWF 2YINA 4TWDA 2IC6A 4ILAA 5LJMA 4ZS2A 3PUGA 4CN4A 3Q5XA 3RIUA 4PJJA 3IBPA 1S35A 5L3EB 3I9WA 4JI0T 1T7SA 3JAEA 2WAUA 3GWHA 4NXMT 3AA1B 2ODUA 2CEAA 3AA6B 4HFEA 2HPLA 3LK42 4HWDA 2UXCT 4IHJE 2KNDA 2W62A 1IJ6A 4TX5A 5L3BB 1NEKA 2BKPA 2V7KA 5LBQB 3RPUA 3K8PC 4O4JE 2Q9QA 3O1IA 4HWHA 3C98B 1CHUA 4LFAT 2EHOD 5EK2A 4GYRA 2Q9QD 4KI0F 3F2EA 2HPJA 5ABFA 1XNRT 2XAJB 3RHWA 4DUYT 2MPKA 1SUMB 4IE4A 5LMNT 2C5JA 1YQ4A 2DCFA 4ILUA 3O1JA
chains in the Genus database with same CATH topology
2LOSA 4UV9B 2RP4A 2V7JA 2I59A 4M1PA 3RC8A 2UXNB 2XAGB 2IAKA 2DWGA 4O4LE 1FEWA 4ZOLE 4IE0A 4DVDA 3Q5WA 5JDHA 1MMAA 5BMVE 4H63H 2ES0A 5FMNA 1E1HB 1BR1A 3AAAB 2D2SA 2QGSA 3PDYA 4O4HE 4XBFB 2L8KA 3HKDE 3WAKA 1Y64B 2W0GA 2X0LB 3LJCA 1G73A 2LSKA 3J9X1 4YHJA 2ODVA 2V7LA 4DBRA 3I0OA 2E9XB 3AVRA 3UUMA 4JLEA 3ZPOA 2ZM0A 5L2LA 4ZI7E 4FI5A 1HS7A 4UVCB 2CXFA 2WMNA 2E8IA 4QKNA 2E9XA 3C50A 5HXEA 4P0AA 5EK4A 3ZEFB 3NZPA 4JEUB 2X9WA 3AAIA 5L3DB 2K48A 4G63A 4KMCA 5J2TE 3PUQA 4HGAA 2PFVA 3K3OA 1KK7A 2XAFB 3LK3B 2CLYC 3RYFE 2JQQA 5LCYA 2WMOA 3KDSE 4CXXA 4ANJA 5DQWA 4TZ4C 3RRWA 3MXZA 4HE8A 5JDFA 3ZC1A 5LG4A 3F31A 1HG2A 2X9HA 4TV8E 3BQKA 4B6XA 4UV8B 4PAGA 2J1DG 2H3RA 3ZC0A 1VOMA 3S4UA 3PUAA 1S94A 2CA5A 2EHOB 3U78A 2K24A 2Q9QB 1YKHB 3ETVA 1QUUA 2BVLA 2N9DA 4GOUA 5CA1E 3WI3A 2XASB 2VKJA 3SWHA 2G0UA 5C8YE 4MLKA 5J2UE 4P0BA 2PBIA 5F3JA 3OYXA 4H9OC 4QX8B 5JH7E 3KV9A 4PNIA 3RKOA 3V5UA 4OYJA 2VWAA 5DJQC 2YK0A 4O4IE 2MTQA 3I9YA 5KMGP 1D0ZA 4KUMB 3PE0A 2DLRA 2NW8A 4AKGA 4H9RC 5DABA 3RYHE 4GYSA 3OBVE 2CCQA 3U3IA 2BDEA 2VL8A 3CX7B 2LHRA 3EVYA 1EZ3A 4ZI2C 4QXHB 5A1LA 4UVBB 2Y48B 4H9PC 3N2KE 3QK6A 4U72A 5LGNB 2BVMA 2YEVC 4HKAA 4X1YE 4AQFA 3ZMZB 5LYJE 5KX5E 3UULA 3C4XA 2JPFA 2JJ9A 2IC9A 2Q9QC 3MZKB 2K5BB 3EUHA 3R84B 3ZYMA 4DMVA 1B7TA 5J1GA 3MK7C 3ESLA 5JRCB 5KDMC 2NTXA 5ETWA 5FYMA 5HWYA 5LHIB 1U4QA 3ZYLA 2KXPB 3N2OA 4GK5E 4UIGA 5FXWA 2LSJA 4KP3C 1SA0E 5HAXA 3RYIE 4PJNA 1NWMX 3IEEA 3K3QC 4EIWA 2WWUA 4I55E 4K0UA 2NP9A 4E7ZA 5CB4E 4BJNA 4PK4A 5JDNA 2NOXA 2A3DA 5FY0A 2KINB 2PG8A 2M67A 4DMWA 3Q9DA 3E22E 1IAPA 2VK9A 2ZMAA 4O2AE 3NZQA 5EZYE 4TV9E 2N2NA 1U5PA 2CM0A 3GMIA 3QC9A 4DO0A 3MKDA 4MHCA 3ZCJA 4ERRA 2HH7A 2XAHB 5JDQA 3R6NA 4JEHB 4AXPA 4AI6A 2E9XC 5HWXA 2LSIA 5LBMA 5HXSA 3CQXC 4PFPA 5ADXL 4QX7B 3OJAA 4OFZA 4IE7A 1AJ3A 2DNXA 4MALA 3QUJA 2X68A 3PU8A 4IDZA 2IW5B 2CWOA 2K9AA 3I0QA 4ISTA 3UUXB 3O1HA 2V7MA 5FY1A 2LT3A 4X1IE 4CXYA 3AAEB 3HR0A 3J7Yq 4UF0A 3VU7H 4EB6E 4GIWA 4QHOA 2DHRA 2VKHA 4L5GA 5F8PA 3KV6A 1Z0PA 1X79A 5H6QB 5LHGB 4ASKA 2XQYA 2NWBA 1HFAA 2DWKA 5HXCA 1IJ5A 3ZLIA 5LA6E 2LM9A 3MACA 1ZV4X 2P9BA 3F57A 1D1BA 4ZI3D 3CX6B 3L3PA 3HKEE 3KV4A 3FBZA 5JVDE 3ZN0B 2A2FX 3VKHA 2YU1A 5HXHA 3N9MA 3FHNA 2B1EA 3KINB 4ZI3C 1FIOA 4HEAA 1OXZA 4H63V 3NBXX 4YFSA 1FMWA 5LJNA 1D0XA 3UT5E 2ZLYA 5FNVE 3VHLA 4CXWA 2LJLA 1MNEA 3C64A 5JDGA 2MOZA 3KVBA 2JRKA 5LNKA 4UF0B 2JMHA 4O2BE 4UVAB 4EZHA 1MNDA 2XTLA 4PJLA 2LE8A 3HI2A 2LEHA 3FB2A 4PJMA 2MBGA 1YW0A 2Y8DA 2UXXB 4ZI2D 3ZMSB 3KBTA 1LVKA 3IHRA 3DJBA 3N9LA 4OK0A 3KV5A 3AVSA 4C91A 4MFRA 3BQIA 5FP3A 1H7CA 3ONXA 4WBOA 4E7SA 4EYYR 3W15B 1OWAA 4BJMA 4JUYA 3E0ZA 4WNKA 3CPZA 3ZJ2A 2KT9A 2Y6XA 3FBLA 3PU3A 2NW7A 5LOVE 2WSSV 4XZCA 1HF8A 5M4YA 1T98A 3NRYA 4H9QC 4CZZB 4WBNE 4BA9A 3MJXA 3CQCB 2C5KT 2KZ7B 1D0YA 4EZ4A 4H9SE 4EOZB 4AKRB 3CVRA 3UUNA 1WRDA 4UEMA 3KVAA 4I50E 3GN5A 1D1AA 5H6RB 1NAFA 3C4WA 3C4ZA 5L3FB 1ZKEA 4X1KE 5FXVA 2LOPA 4J2CA 5JDMA 4EXTA 3GN5B 1QSDA 3ZYKA 3OYZA 2CLYB 2WM9A 3TKLB 4KBMB 4BAYB 1MIYA 2DI4A 3LK2B 4PFOA 2XUEA 1WYBA 2SPCA 1LVFA 3B57A 1UX4A 4TUYE 5GONE 4PK6A 3LBXA 3KFWX 3EDUA 2JMKA 3L09A 4DBQA 2CMRA 3E08A 3ZMVB 3C51A 2QA7A 4N78D 5TAOA 1HTJF 4EYUA 3LFMA 2L9QA 3HKCE 3LBXB 4HTEA 3ZMTB 3FXDB 5L3CB 4I4TE 2VKOA 2X66A 4P09A 5FY7A 4QXBB 2W63A 4PK5A 3ETUA 4IE5A 3M65A 1LRZA 3N5LA 3V5SA 4C90A 1YKEB 3CMLA 4X20E 3NRXA 5JREA 3ANWB 2V26A 3EDVA 2X9YA 2ZM8A 5EK3A 3CQGB 1MMNA 4PW8A 2LHNA 2VB6A 2KWIB 3H3AA 3SS1A 4O8SA 2CWYA 5JQGE 5LGUB 3ANWA 3RYCE 3Q2MA 4AKIA 1VRBA 1BR2A 4TN7B 2EHOA 5HYAA 2X9XA 3CKDA 4IGUA 2KWHA 1D1CA 2XHEB 4H9NC 4YJ2E 2PJQA 4MBQA 2C0SA 2XAQB 4NUVA 2EHOC 4AQFC 2ACXA 3SOLA 5CA0E 3N9NA 1LKXA 3FXEB 5FXZA 2N1GA 2H7OA 3AB3B 2V1DB 1CUNA 1ZHCA 1BR4A 2CXDA 2CXLA 3O4XE 3UFEA 4OHFA 4I43B 4WW0A 1ZEEA 1SHZC 3JC6C 1MMDA 2W61A 4G2AA 4CI2B 3N9QA 4ZHQE 3H37A 3WAJA 2ZM2A 4QWNB 3RX6A 4AQGA 1WR6A 1BR0A 4F6RC 4QXCB 3KBUA 4U74A 5LHHB 4UXNB 4IIJE 4AKLA 3AA7B 2NTYA 2A72A 2KLQA 3ZCIA 5L3GB 3JC6D 4ADZA 4ZS3A 5JDLA 2MYSA 3P8CD 4ISSA 5JR9B 2KMFA 3RH3A 2VASA 5JRCA 3HKBE 4AKHA 4UELA 4HFVA 4DNDA 2VKDA 1YD8G 1WYCA 3T8OA 2LSGA 2Z6EA 1O3XA 4Z8XA 2LSYA 3IF8B 5LGTB 3DP7A 2H7VC 4YJ3E 2X67A 3N2GE 4OYKA 2WBLA 3SRZA 3AA0B 4EAHA 3OKQA 2YU2A 4A56A 3HA4A 5IHYA 1HX8A 4YLHA 2GK9A 1WLXA 1G8XA 3DTOA 4L0RA 3RRCA 2OA5A 1MMGA 1US7B 4L9IA 2W00A 5DQVA 3UTKA 3O9XA 2RA1A 4XAXB 3BQLA 1UX5A 3PURA 4IE6A 4V1Av 5AFUL 2C5IT 3B13A 1IZNB 2BZBA 2D0UA 4GK0E 3K3NA 4NUUA 5JR9A 4CI3B 5LXTE 3ZMUB 2D0TA 3ZN1B 1MIVA 3BK9A 4FJOA 2V7IA 3PUSA 2E9XD 3HL6A 3P7IA 3GA8A 3I1AA 3D0TA 2X51A 3N9PA 3CX8B 3A5XA 5JR9C 1MIWA 1FMVA 2D5UA 3N9OA 3ZJ1A 1HCIA 2CE7A 4HN9A 1HG5A 2NW9A 1UCUA 3RC3A 5HXRA 4CI1B 3VKGA 1KNZA 1V9DA 5FXXA 3PTRB 5IYZE 3CWZB 5E0OA 3LG7A 4CQIA 2L3LA 3MA9A 5LP6E 2YINA 2IC6A 5LJMA 4ZS2A 3PUGA 3Q5XA 4PJJA 3IBPA 1S35A 5L3EB 3I9WA 3GWHA 2WAUA 3AA1B 2ODUA 2CEAA 3AA6B 2HPLA 3LK42 4IHJE 2KNDA 2W62A 1IJ6A 4TX5A 5L3BB 2V7KA 5LBQB 3RPUA 3K8PC 4O4JE 2Q9QA 3O1IA 3C98B 2EHOD 5EK2A 4GYRA 2Q9QD 3F2EA 2HPJA 2XAJB 4IE4A 2C5JA 2DCFA 4ILUA 3O1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 2WZI A;  1DU2 A;  4HFD A;  2LOS A;  2IDO B;  4UV9 B;  2RP4 A;  2V7J A;  2I59 A;  1YXR A;  4M1P A;  3RC8 A;  2UXN B;  2XAG B;  2IAK A;  2DWG A;  4O4L E;  5L4H A;  2UU9 T;  1FEW A;  4ZOL E;  4IE0 A;  3IA3 A;  2IIU A;  3Q5W A;  1MMA A;  4DVD A;  5JDH A;  5BMV E;  1N32 T;  2ACZ A;  4H63 H;  2ES0 A;  5FMN A;  2XQ4 A;  1KNP A;  1E1H B;  1BR1 A;  1HX1 B;  2D2S A;  2I6H A;  2QGS A;  3AAA B;  3PDY A;  4O4H E;  4XBF B;  2L8K A;  3HKD E;  3WAK A;  5FL0 A;  1Y64 B;  2UUC T;  2W0G A;  2X0L B;  3LJC A;  1G73 A;  3ZT7 A;  4COF A;  2LSK A;  3J9X 1;  4YHJ A;  2ODV A;  2V7L A;  4DBR A;  3I0O A;  2E9X B;  3AVR A;  3UUM A;  4WYV A;  2PTF A;  2WWV A;  4JLE A;  4HWC A;  3ZPO A;  4YHH T;  2ZM0 A;  5L2L A;  3RGL A;  4ZI7 E;  4FI5 A;  1HS7 A;  3NKZ A;  5JTG A;  5AQG B;  2AE9 A;  4UVC B;  2BG9 C;  2CXF A;  2WMN A;  2E8I A;  4QKN A;  2E9X A;  3C50 A;  4YTP A;  5HXE A;  4P0A A;  1HNZ T;  4EGW A;  3PUX F;  4IDQ A;  1NEN A;  3L39 A;  5EK4 A;  3ZEF B;  2V6Y B;  3ZT6 A;  3NZP A;  4JEU B;  4TWH A;  2X9W A;  3AAI A;  2OV9 A;  5L3D B;  4U7Y A;  5ABE A;  5ABG A;  3RQW A;  2K48 A;  3PUW F;  4G63 A;  1W0B A;  4KMC A;  4QH5 A;  5J2T E;  4QH1 A;  2CBJ A;  3PUQ A;  2WDV A;  2XSA A;  4YT0 A;  4HGA A;  2PFV A;  4DV6 T;  3K3O A;  1KK7 A;  2XAF B;  5CGM A;  3LK3 B;  3ZT5 A;  2CLY C;  5AFU L;  4YXD A;  3RYF E;  2JQQ A;  5LCY A;  2WMO A;  3KDS E;  4CXX A;  4ANJ A;  5DQW A;  4TZ4 C;  3RRW A;  3UFG A;  1W9R A;  3MXZ A;  1Z8U A;  4HE8 A;  4IDO A;  5JDF A;  3ZC1 A;  5HEJ A;  3PV0 F;  3F31 A;  1HG2 A;  3UQ7 A;  2DL1 A;  2X9H A;  4TV8 E;  3BQK A;  4B6X A;  4UV8 B;  3OVU A;  4PAG A;  4DR1 T;  2J1D G;  2H3R A;  2XQ7 A;  1VOM A;  3S4U A;  4JI3 T;  3ZC0 A;  3PUA A;  2WP9 A;  1S94 A;  2I0M A;  4IL9 A;  2CA5 A;  2EHO B;  2FBW A;  3U78 A;  2K24 A;  2Q9Q B;  3P4S A;  5FVK A;  1JNR A;  3OPC A;  3RF1 A;  5C2T A;  1YKH B;  4DR2 T;  5AQU B;  3P4W A;  3ETV A;  4B3R T;  1QUU A;  4DID B;  2BVL A;  2N9D A;  4AIU A;  2E5L T;  2CPT A;  4GOU A;  5CA1 E;  3WI3 A;  2XAS B;  2VKJ A;  3AEF A;  5HEO A;  3SWH A;  2G0U A;  5C8Y E;  4MLK A;  5J2U E;  3P4P A;  4P0B A;  5L47 A;  4DR6 T;  4DV2 T;  2PBI A;  2V5C A;  4CN1 A;  3OYX A;  4H9O C;  4P1N A;  4QX8 B;  4ZZC A;  5F3J A;  4YTN A;  3KV9 A;  4PNI A;  3L8R A;  3RKO A;  4OYJ A;  3TLS A;  3V5U A;  2VWA A;  5DJQ C;  2YK0 A;  3AE2 A;  4O4I E;  5HCM A;  4A97 A;  2MTQ A;  2WDQ A;  2VUR A;  5AQQ B;  3PUV F;  3I9Y A;  1T8B A;  5KMG P;  4DR4 T;  1KFY A;  4EED A;  1D0Z A;  4KUM B;  3PE0 A;  1T72 A;  2J47 A;  3AE5 A;  2DLR A;  2NW8 A;  4IL4 A;  4X64 T;  4AKG A;  4H9R C;  5DAB A;  4JI2 T;  2RPA A;  2FJD A;  3UUB A;  3RYH E;  2E5V A;  5AQR B;  4GYS A;  3PUZ F;  3OBV E;  2CCQ A;  3AEG A;  2BDE A;  2VL8 A;  1VCS A;  3CX7 B;  3M3Z B;  4NUU A;  5AQV B;  3U3I A;  2LHR A;  2WB5 A;  3EVY A;  1EZ3 A;  3QB5 K;  4ZI2 C;  5LMU T;  2J4G A;  4QXH B;  5A1L A;  4UVB B;  3P4Q A;  2FJE A;  2Y48 B;  5AQF B;  4KHP T;  4H9P C;  3N2K E;  3QK6 A;  3RI5 A;  4DUZ T;  4U72 A;  5LGN B;  2BVM A;  2YEV C;  4HKA A;  4X1Y E;  4AQF A;  4NPP A;  2BS3 A;  4QH4 A;  3ZMZ B;  5LYJ E;  2XQ6 A;  5LXT E;  4CI3 B;  5KX5 E;  3UUL A;  3C4X A;  2JPF A;  3AEE A;  2JJ9 A;  2IC9 A;  3RLF F;  2Q9Q C;  3MZK B;  2K5B B;  3EUH A;  3R84 B;  3ZYM A;  4DMV A;  4YSX A;  1B7T A;  5J1G A;  5J0Z A;  3H3M A;  2YDS A;  3UU8 A;  3MK7 C;  3ESL A;  1ZP0 A;  5JRC B;  5KDM C;  4HFI A;  2NTX A;  5CJ5 A;  3ONJ A;  5ETW A;  5FYM A;  3AED A;  3VR9 A;  5HWY A;  3ZKR A;  4JYA T;  5AQM B;  3EAB A;  1XWM A;  5LHI B;  1U4Q A;  1WR0 A;  4NXN T;  3ZYL A;  2KXP B;  3N2O A;  2V6X A;  4GK5 E;  4UIG A;  5FXW A;  2BKN A;  2LSJ A;  4KP3 C;  4DV5 T;  1SA0 E;  5HAX A;  3RYI E;  2R6G F;  4PJN A;  1NWM X;  3IEE A;  3K3Q C;  4EIW A;  2HN2 A;  2WWU A;  3FZF B;  1JNZ A;  2E2A A;  2NP9 A;  2XQA A;  4I55 E;  2YDQ A;  4K0U A;  5CB4 E;  4E7Z A;  4GKJ T;  4BJN A;  2WZH A;  4PK4 A;  5JDN A;  2NOX A;  2A3D A;  2YN6 A;  2KIN B;  5FY0 A;  4ILB A;  5AQJ B;  2PG8 A;  3AE8 A;  3TLT A;  1E2A A;  2M67 A;  4DMW A;  4GKK T;  3AE9 A;  3Q9D A;  4JI5 T;  3E22 E;  3ONL C;  1IAP A;  2VK9 A;  2ZMA A;  4U33 A;  4O2A E;  3NZQ A;  5EZY E;  4TV9 E;  2N2N A;  1U5P A;  2CM0 A;  2BG9 B;  3GMI A;  3QC9 A;  4DO0 A;  3RIF A;  1E7P A;  3MKD A;  4MHC A;  3ZCJ A;  4ERR A;  5F5W A;  2HH7 A;  2H88 A;  4I0U A;  2UUA T;  3AE3 A;  2XAH B;  3UU5 A;  5JDQ A;  3R6N A;  2X0H A;  4JEH B;  3UU6 A;  4AXP A;  4AI6 A;  2E9X C;  5HWX A;  2W2U A;  3NWI A;  5AQN B;  2LSI A;  3QOF A;  5LBM A;  3CQX C;  5CFB A;  4PFP A;  5HXS A;  5ADX L;  4QX7 B;  3OJA A;  4U2Y A;  4OFZ A;  2LRL A;  4ZZB A;  4IE7 A;  1AJ3 A;  2DNX A;  1XDP A;  4MAL A;  3QUJ A;  2WY2 A;  2X68 A;  3AE1 A;  3PU8 A;  4JI6 T;  4IDZ A;  2IW5 B;  2YKS A;  4CN6 A;  2CBI A;  4IRE A;  2CWO A;  2K9A A;  3I0Q A;  4IST A;  3UUX B;  2JQK A;  2V7M A;  3O1H A;  5AQP B;  1UUS A;  1XDO A;  5FY1 A;  2LT3 A;  4X1I E;  4CXY A;  5LG3 A;  2ZM6 T;  2NR4 A;  2X0Y A;  3AAE B;  3HR0 A;  3J7Y q;  5AQS B;  4UF0 A;  3VU7 H;  4UR9 A;  4EB6 E;  4GIW A;  4YSZ A;  4QHO A;  2DHR A;  2VKH A;  1W09 A;  4L5G A;  4U2Z A;  2JIW A;  3KV6 A;  2XJ7 A;  5F8P A;  1Z0P A;  3PUY F;  3FZM B;  2BS4 A;  1X79 A;  5H6Q B;  5LHG B;  4ASK A;  2XQY A;  2NWB A;  1HFA A;  2DWK A;  5HXC A;  4DR5 T;  4JI4 T;  1IJ5 A;  3ZLI A;  2HHH T;  5LA6 E;  2LM9 A;  3EI0 A;  3PJA J;  1GQE A;  3MAC A;  1ZV4 X;  2P9B A;  2XY8 B;  1OED C;  3F57 A;  3LSV A;  1D1B A;  4ZI3 D;  2LM2 A;  5AQK B;  3RIU C;  3CX6 B;  1WFD A;  3HKE E;  3KV4 A;  3FBZ A;  3L3P A;  4HFH A;  2A2F X;  5JVD E;  3TLU A;  2LRK A;  3ZN0 B;  3VKH A;  2YU1 A;  1KEY A;  5HXH A;  4B3S T;  1OED B;  3N9M A;  2IHR 1;  3FHN A;  4LMJ A;  4B3T T;  2V6Y A;  5LB7 B;  2B1E A;  5AQI B;  4DV3 T;  4DR7 T;  3KIN B;  4ZI3 C;  1FIO A;  4HEA A;  1OXZ A;  2UUB T;  4H63 V;  5AQT B;  2YOE A;  3NBX X;  1FMW A;  4YFS A;  1D0X A;  3UT5 E;  5LJN A;  2ZLY A;  2KSR A;  5FNV E;  3VHL A;  4CXW A;  2LJL A;  1MNE A;  5AQH B;  2M6B A;  3C64 A;  3AEA A;  5JDG A;  2MOZ A;  3JCF A;  3KVB A;  2JRK A;  2OLT A;  4UF0 B;  2JMH A;  5HCJ A;  5LNK A;  4O2B E;  4HWI B;  2WU5 A;  4UVA B;  4A98 A;  4EZH A;  1MND A;  4DR3 T;  2XTL A;  3AE7 A;  4PJL A;  2LE8 A;  3HI2 A;  4A5X A;  2LEH A;  3FB2 A;  4X62 T;  2MAW A;  4DV7 T;  4X65 T;  4PJM A;  2MBG A;  1YW0 A;  2Y8D A;  2UXX B;  3FZH B;  1J5E T;  4ZI2 D;  3ZMS B;  3KBT A;  1LVK A;  2W67 A;  2LLY A;  2LKH A;  3IHR A;  3DJB A;  4HWF A;  1IBK T;  2UXD T;  4HFB A;  5JH7 E;  3N9L A;  4DV4 T;  4OK0 A;  3KV5 A;  3AVS A;  4C91 A;  3TLV A;  4MFR A;  1HNW T;  3BQI A;  2H89 A;  5FP3 A;  1H7C A;  3ONX A;  4WBO A;  1N34 T;  4E7S A;  2XM1 A;  4EYY R;  3W15 B;  1OWA A;  2VVN A;  4BJM A;  1J5W A;  4JUY A;  3E0Z A;  4WNK A;  3CPZ A;  3ZJ2 A;  2CHO A;  1KNR A;  2KT9 A;  2F4V T;  2YDR A;  2Y6X A;  2VL0 A;  3FBL A;  3PU3 A;  4TNW A;  1SE7 A;  2WQY A;  1UUR A;  3VR8 A;  2NW7 A;  5LOV E;  1HR0 T;  4LF9 T;  2WSS V;  4XZC A;  1HF8 A;  4EV6 A;  5M4Y A;  1T98 A;  3NRY A;  4H9Q C;  4CZZ B;  4WBN E;  3ZST A;  4BA9 A;  3MJX A;  3CQC B;  4LMK A;  2M6I A;  2C5K T;  5BR8 T;  2KZ7 B;  1D0Y A;  3P4R A;  4EZ4 A;  4H9S E;  5FVL A;  4EOZ B;  3Q5D A;  2W4X A;  4AKR B;  2FJB A;  3CVR A;  3UUN A;  1WRD A;  2BBH A;  4JI8 T;  2XQ9 A;  4UEM A;  3KVA A;  4I50 E;  3GN5 A;  1D1A A;  5H6R B;  1NAF A;  3C4W A;  3AEC A;  3C4Z A;  5HEH A;  4EEB A;  2V5D A;  5L3F B;  1ZKE A;  4X1K E;  5FXV A;  2A9U A;  2LOP A;  4J2C A;  5JDM A;  4EXT A;  3JAD A;  4AIS A;  3GN5 B;  1QSD A;  3UU3 A;  3ZYK A;  3OYZ A;  2CLY B;  2WM9 A;  2VQE T;  3TKL B;  4LFB T;  4KBM B;  4BAY B;  1MIY A;  2DI4 A;  3LK2 B;  4IT4 A;  2XUE A;  1WYB A;  3CIR A;  4PFO A;  2SPC A;  1LVF A;  3B57 A;  1UX4 A;  4TUY E;  5GON E;  4PK6 A;  4LF5 T;  1I6Z A;  3AEB A;  3LBX A;  3KFW X;  1Y01 A;  3FZL B;  4ILC A;  3EDU A;  2JMK A;  3L09 A;  3UQ4 A;  4DBQ A;  2CMR A;  1VCT A;  3E08 A;  4Q25 A;  3VRB A;  3C51 A;  2QA7 A;  3ZMV B;  4N78 D;  5TAO A;  3LDQ B;  1HNX T;  1HTJ F;  5ABF B;  4EYU A;  3LFM A;  2L9Q A;  3HKC E;  2XQ8 A;  3LBX B;  4HTE A;  3FXD B;  3ZMT B;  4I4T E;  5L3C B;  1XMQ T;  2VKO A;  2X66 A;  4P09 A;  5FY7 A;  3NVO A;  4QXB B;  2W63 A;  4PK5 A;  3ETU A;  4IE5 A;  5AQO B;  5C3J A;  3M65 A;  1LRZ A;  3N5L A;  3V5S A;  5ABH A;  4C90 A;  1YKE B;  3CML A;  3OTO T;  4X20 E;  3AE6 A;  3NRX A;  5JR9 A;  5JRE A;  4LF4 T;  2B76 A;  3ANW B;  1IBM T;  2QYW A;  2V26 A;  4B3M T;  3RIA A;  3EDV A;  2X9Y A;  2ZM8 A;  5EK3 A;  5FL1 A;  3CQG B;  1MMN A;  4IDN A;  2LHN A;  1QLB A;  2KWI B;  2VB6 A;  2XM2 A;  3FZK B;  3H3A A;  4PW8 A;  4WZX A;  3SS1 A;  4O8S A;  2CWY A;  1J1J A;  5JQG E;  5LGU B;  3ANW A;  3K1S A;  3RYC E;  3Q2M A;  4U3C A;  1VRB A;  1BR2 A;  4TN7 B;  4AKI A;  4IDP A;  3ZSS A;  2IUB A;  1N36 T;  2FUP A;  2EHO A;  2K3W A;  2XSB A;  5HYA A;  2X9X A;  4K0K T;  2AXD S;  3CKD A;  4IGU A;  2KWH A;  1XNQ T;  2UXB T;  5FKY A;  1D1C A;  2XHE B;  4H9N C;  5IWA T;  2WU2 A;  4YJ2 E;  3B5M A;  2PJQ A;  4MBQ A;  3X1D A;  1X9B A;  2C0S A;  2XAQ B;  4NUV A;  2EHO C;  4KHZ F;  4ZXL A;  4AQF C;  2ACX A;  3SOL A;  5CA0 E;  4Z91 A;  3N9N A;  1LKX A;  3FXE B;  4YTM A;  1UK5 A;  2N1G A;  5FXZ A;  5AQL B;  1XMO T;  1N33 T;  4JV5 T;  2H7O A;  3AE4 A;  3AB3 B;  4YY3 T;  3CK6 A;  3Q5E A;  2V1D B;  1CUN A;  2XQ5 A;  1ZHC A;  1BR4 A;  3AXJ B;  2HN1 A;  2CXD A;  2CXL A;  3O4X E;  1YQ3 A;  3RKG A;  3UFE A;  1WCR A;  2WDR A;  4OHF A;  4TNV A;  4I43 B;  4WW0 A;  3TLW A;  1ZEE A;  2VQF T;  1FJG T;  1SHZ C;  3JC6 C;  1MMD A;  2W61 A;  3PJA A;  1W0A A;  3EAM A;  3G06 A;  5HEG A;  4LF8 T;  3AXJ A;  4G2A A;  4CI2 B;  1I94 T;  3N9Q A;  4ZHQ E;  3H37 A;  3WAJ A;  2XZE A;  4X5T A;  2ZM2 A;  4QWN B;  3RX6 A;  4AQG A;  1WR6 A;  3RQU A;  1BR0 A;  4F6R C;  4QXC B;  3KBU A;  4U74 A;  2D9D A;  5LHH B;  4UXN B;  4IIJ E;  4U31 A;  3AA7 B;  2NTY A;  2BG9 A;  2A72 A;  2KLQ A;  1R8I A;  3ZCI A;  4AKL A;  3JC6 D;  5L3G B;  4AQY T;  4ADZ A;  4ZS3 A;  5JDL A;  3T1Y T;  2MYS A;  3P8C D;  4ISS A;  5JR9 B;  2KMF A;  3RH3 A;  2VAS A;  1IBL T;  5IUX A;  3SFE A;  5JRC A;  3HKB E;  3A7M A;  4AKH A;  4UEL A;  2J62 A;  4HFV A;  4DND A;  2VKD A;  1YD8 G;  1OED E;  1M7K A;  1WYC A;  3ABV A;  2XQ3 A;  3T8O A;  5L4E A;  3T1H T;  2LSG A;  2Z6E A;  1O3X A;  4Z8X A;  2LSY A;  3IF8 B;  5LGT B;  3DP7 A;  2H7V C;  4YJ3 E;  4ZEY A;  2X67 A;  3N2G E;  4OYK A;  2WBL A;  3SRZ A;  4DV1 T;  4JI1 T;  1XZY A;  2FJA A;  3AA0 B;  3OKQ A;  2YU2 A;  4A56 A;  4EAH A;  4OX9 T;  3HA4 A;  5IHY A;  1HX8 A;  1KF6 A;  4YLH A;  2GK9 A;  4LF6 T;  1WLX A;  1G8X A;  3DTO A;  4L0R A;  3RRC A;  5KXJ A;  3P50 A;  2OA5 A;  1MMG A;  2W66 A;  1US7 B;  3QB5 A;  4LML A;  4L9I A;  2W00 A;  2XPK A;  4Z90 A;  5DQV A;  4U7I A;  3UTK A;  3O9X A;  2RA1 A;  4XAX B;  4YSY A;  4JI7 T;  3BQL A;  1UX5 A;  3EHZ A;  3PUR A;  4IE6 A;  4V1A v;  4NIQ A;  5HEU A;  2C5I T;  3B13 A;  1IZN B;  2BZB A;  2D0U A;  2IML A;  2QRX A;  3JAF A;  3K3N A;  2CRB A;  4GK0 E;  4TWF A;  4LFC T;  3UU4 A;  3ZMU B;  4F8H A;  2D0T A;  3ZN1 B;  2V8S V;  1MIV A;  3BK9 A;  4FJO A;  4KX6 A;  2V7I A;  3PUS A;  2E9X D;  3HL6 A;  1OED A;  3P7I A;  3SFD A;  4X66 T;  3GA8 A;  1UGO A;  3I1A A;  3D0T A;  2X51 A;  3N9P A;  3CX8 B;  2LKG A;  3A5X A;  2CHN A;  4HFC A;  1L0V A;  5JR9 C;  5LG4 A;  1MIW A;  1FMV A;  2D5U A;  1ZOY A;  2JQ9 A;  2VVS A;  3N9O A;  3ZJ1 A;  1HCI A;  2CE7 A;  2JQH A;  4HN9 A;  4LF7 T;  2BS2 A;  1HG5 A;  2BG9 E;  2NW9 A;  2QVA A;  1UCU A;  3A8Y C;  5HXR A;  3RC3 A;  4CI1 B;  3VKG A;  1KNZ A;  1M62 A;  4DV0 T;  1V9D A;  3QNU A;  3VRA A;  5FXX A;  3PTR B;  5IYZ E;  3CWZ B;  5E0O A;  3LG7 A;  4CQI A;  2BKO A;  2L3L A;  3MA9 A;  2WCA A;  2BBJ A;  5LP6 E;  2WS3 A;  4JBW F;  2YIN A;  4TWD A;  2IC6 A;  4ILA A;  5LJM A;  4ZS2 A;  3PUG A;  4CN4 A;  3Q5X A;  3RIU A;  4PJJ A;  3IBP A;  1S35 A;  5L3E B;  3I9W A;  4JI0 T;  1T7S A;  3JAE A;  2WAU A;  3GWH A;  4NXM T;  3AA1 B;  2ODU A;  2CEA A;  3AA6 B;  4HFE A;  2HPL A;  3LK4 2;  4HWD A;  2UXC T;  4IHJ E;  2KND A;  2W62 A;  1IJ6 A;  4TX5 A;  5L3B B;  1NEK A;  2BKP A;  2V7K A;  5LBQ B;  3RPU A;  3K8P C;  4O4J E;  2Q9Q A;  3O1I A;  4HWH A;  3C98 B;  1CHU A;  4LFA T;  2EHO D;  5EK2 A;  4GYR A;  2Q9Q D;  4KI0 F;  3F2E A;  2HPJ A;  5ABF A;  1XNR T;  2XAJ B;  3RHW A;  4DUY T;  2MPK A;  1SUM B;  4IE4 A;  5LMN T;  2C5J A;  1YQ4 A;  2DCF A;  4ILU A;  3O1J A; 
#chains in the Genus database with same CATH homology
 2LOS A;  4UV9 B;  2RP4 A;  2V7J A;  2I59 A;  4M1P A;  3RC8 A;  2UXN B;  2XAG B;  2IAK A;  2DWG A;  4O4L E;  1FEW A;  4ZOL E;  4IE0 A;  4DVD A;  3Q5W A;  5JDH A;  1MMA A;  5BMV E;  4H63 H;  2ES0 A;  5FMN A;  1E1H B;  1BR1 A;  3AAA B;  2D2S A;  2QGS A;  3PDY A;  4O4H E;  4XBF B;  2L8K A;  3HKD E;  3WAK A;  1Y64 B;  2W0G A;  2X0L B;  3LJC A;  1G73 A;  2LSK A;  3J9X 1;  4YHJ A;  2ODV A;  2V7L A;  4DBR A;  3I0O A;  2E9X B;  3AVR A;  3UUM A;  4JLE A;  3ZPO A;  2ZM0 A;  5L2L A;  4ZI7 E;  4FI5 A;  1HS7 A;  4UVC B;  2CXF A;  2WMN A;  2E8I A;  4QKN A;  2E9X A;  3C50 A;  5HXE A;  4P0A A;  5EK4 A;  3ZEF B;  3NZP A;  4JEU B;  2X9W A;  3AAI A;  5L3D B;  2K48 A;  4G63 A;  4KMC A;  5J2T E;  3PUQ A;  4HGA A;  2PFV A;  3K3O A;  1KK7 A;  2XAF B;  3LK3 B;  2CLY C;  3RYF E;  2JQQ A;  5LCY A;  2WMO A;  3KDS E;  4CXX A;  4ANJ A;  5DQW A;  4TZ4 C;  3RRW A;  3MXZ A;  4HE8 A;  5JDF A;  3ZC1 A;  5LG4 A;  3F31 A;  1HG2 A;  2X9H A;  4TV8 E;  3BQK A;  4B6X A;  4UV8 B;  4PAG A;  2J1D G;  2H3R A;  3ZC0 A;  1VOM A;  3S4U A;  3PUA A;  1S94 A;  2CA5 A;  2EHO B;  3U78 A;  2K24 A;  2Q9Q B;  1YKH B;  3ETV A;  1QUU A;  2BVL A;  2N9D A;  4GOU A;  5CA1 E;  3WI3 A;  2XAS B;  2VKJ A;  3SWH A;  2G0U A;  5C8Y E;  4MLK A;  5J2U E;  4P0B A;  2PBI A;  5F3J A;  3OYX A;  4H9O C;  4QX8 B;  5JH7 E;  3KV9 A;  4PNI A;  3RKO A;  3V5U A;  4OYJ A;  2VWA A;  5DJQ C;  2YK0 A;  4O4I E;  2MTQ A;  3I9Y A;  5KMG P;  1D0Z A;  4KUM B;  3PE0 A;  2DLR A;  2NW8 A;  4AKG A;  4H9R C;  5DAB A;  3RYH E;  4GYS A;  3OBV E;  2CCQ A;  3U3I A;  2BDE A;  2VL8 A;  3CX7 B;  2LHR A;  3EVY A;  1EZ3 A;  4ZI2 C;  4QXH B;  5A1L A;  4UVB B;  2Y48 B;  4H9P C;  3N2K E;  3QK6 A;  4U72 A;  5LGN B;  2BVM A;  2YEV C;  4HKA A;  4X1Y E;  4AQF A;  3ZMZ B;  5LYJ E;  5KX5 E;  3UUL A;  3C4X A;  2JPF A;  2JJ9 A;  2IC9 A;  2Q9Q C;  3MZK B;  2K5B B;  3EUH A;  3R84 B;  3ZYM A;  4DMV A;  1B7T A;  5J1G A;  3MK7 C;  3ESL A;  5JRC B;  5KDM C;  2NTX A;  5ETW A;  5FYM A;  5HWY A;  5LHI B;  1U4Q A;  3ZYL A;  2KXP B;  3N2O A;  4GK5 E;  4UIG A;  5FXW A;  2LSJ A;  4KP3 C;  1SA0 E;  5HAX A;  3RYI E;  4PJN A;  1NWM X;  3IEE A;  3K3Q C;  4EIW A;  2WWU A;  4I55 E;  4K0U A;  2NP9 A;  4E7Z A;  5CB4 E;  4BJN A;  4PK4 A;  5JDN A;  2NOX A;  2A3D A;  5FY0 A;  2KIN B;  2PG8 A;  2M67 A;  4DMW A;  3Q9D A;  3E22 E;  1IAP A;  2VK9 A;  2ZMA A;  4O2A E;  3NZQ A;  5EZY E;  4TV9 E;  2N2N A;  1U5P A;  2CM0 A;  3GMI A;  3QC9 A;  4DO0 A;  3MKD A;  4MHC A;  3ZCJ A;  4ERR A;  2HH7 A;  2XAH B;  5JDQ A;  3R6N A;  4JEH B;  4AXP A;  4AI6 A;  2E9X C;  5HWX A;  2LSI A;  5LBM A;  5HXS A;  3CQX C;  4PFP A;  5ADX L;  4QX7 B;  3OJA A;  4OFZ A;  4IE7 A;  1AJ3 A;  2DNX A;  4MAL A;  3QUJ A;  2X68 A;  3PU8 A;  4IDZ A;  2IW5 B;  2CWO A;  2K9A A;  3I0Q A;  4IST A;  3UUX B;  3O1H A;  2V7M A;  5FY1 A;  2LT3 A;  4X1I E;  4CXY A;  3AAE B;  3HR0 A;  3J7Y q;  4UF0 A;  3VU7 H;  4EB6 E;  4GIW A;  4QHO A;  2DHR A;  2VKH A;  4L5G A;  5F8P A;  3KV6 A;  1Z0P A;  1X79 A;  5H6Q B;  5LHG B;  4ASK A;  2XQY A;  2NWB A;  1HFA A;  2DWK A;  5HXC A;  1IJ5 A;  3ZLI A;  5LA6 E;  2LM9 A;  3MAC A;  1ZV4 X;  2P9B A;  3F57 A;  1D1B A;  4ZI3 D;  3CX6 B;  3L3P A;  3HKE E;  3KV4 A;  3FBZ A;  5JVD E;  3ZN0 B;  2A2F X;  3VKH A;  2YU1 A;  5HXH A;  3N9M A;  3FHN A;  2B1E A;  3KIN B;  4ZI3 C;  1FIO A;  4HEA A;  1OXZ A;  4H63 V;  3NBX X;  4YFS A;  1FMW A;  5LJN A;  1D0X A;  3UT5 E;  2ZLY A;  5FNV E;  3VHL A;  4CXW A;  2LJL A;  1MNE A;  3C64 A;  5JDG A;  2MOZ A;  3KVB A;  2JRK A;  5LNK A;  4UF0 B;  2JMH A;  4O2B E;  4UVA B;  4EZH A;  1MND A;  2XTL A;  4PJL A;  2LE8 A;  3HI2 A;  2LEH A;  3FB2 A;  4PJM A;  2MBG A;  1YW0 A;  2Y8D A;  2UXX B;  4ZI2 D;  3ZMS B;  3KBT A;  1LVK A;  3IHR A;  3DJB A;  3N9L A;  4OK0 A;  3KV5 A;  3AVS A;  4C91 A;  4MFR A;  3BQI A;  5FP3 A;  1H7C A;  3ONX A;  4WBO A;  4E7S A;  4EYY R;  3W15 B;  1OWA A;  4BJM A;  4JUY A;  3E0Z A;  4WNK A;  3CPZ A;  3ZJ2 A;  2KT9 A;  2Y6X A;  3FBL A;  3PU3 A;  2NW7 A;  5LOV E;  2WSS V;  4XZC A;  1HF8 A;  5M4Y A;  1T98 A;  3NRY A;  4H9Q C;  4CZZ B;  4WBN E;  4BA9 A;  3MJX A;  3CQC B;  2C5K T;  2KZ7 B;  1D0Y A;  4EZ4 A;  4H9S E;  4EOZ B;  4AKR B;  3CVR A;  3UUN A;  1WRD A;  4UEM A;  3KVA A;  4I50 E;  3GN5 A;  1D1A A;  5H6R B;  1NAF A;  3C4W A;  3C4Z A;  5L3F B;  1ZKE A;  4X1K E;  5FXV A;  2LOP A;  4J2C A;  5JDM A;  4EXT A;  3GN5 B;  1QSD A;  3ZYK A;  3OYZ A;  2CLY B;  2WM9 A;  3TKL B;  4KBM B;  4BAY B;  1MIY A;  2DI4 A;  3LK2 B;  4PFO A;  2XUE A;  1WYB A;  2SPC A;  1LVF A;  3B57 A;  1UX4 A;  4TUY E;  5GON E;  4PK6 A;  3LBX A;  3KFW X;  3EDU A;  2JMK A;  3L09 A;  4DBQ A;  2CMR A;  3E08 A;  3ZMV B;  3C51 A;  2QA7 A;  4N78 D;  5TAO A;  1HTJ F;  4EYU A;  3LFM A;  2L9Q A;  3HKC E;  3LBX B;  4HTE A;  3ZMT B;  3FXD B;  5L3C B;  4I4T E;  2VKO A;  2X66 A;  4P09 A;  5FY7 A;  4QXB B;  2W63 A;  4PK5 A;  3ETU A;  4IE5 A;  3M65 A;  1LRZ A;  3N5L A;  3V5S A;  4C90 A;  1YKE B;  3CML A;  4X20 E;  3NRX A;  5JRE A;  3ANW B;  2V26 A;  3EDV A;  2X9Y A;  2ZM8 A;  5EK3 A;  3CQG B;  1MMN A;  4PW8 A;  2LHN A;  2VB6 A;  2KWI B;  3H3A A;  3SS1 A;  4O8S A;  2CWY A;  5JQG E;  5LGU B;  3ANW A;  3RYC E;  3Q2M A;  4AKI A;  1VRB A;  1BR2 A;  4TN7 B;  2EHO A;  5HYA A;  2X9X A;  3CKD A;  4IGU A;  2KWH A;  1D1C A;  2XHE B;  4H9N C;  4YJ2 E;  2PJQ A;  4MBQ A;  2C0S A;  2XAQ B;  4NUV A;  2EHO C;  4AQF C;  2ACX A;  3SOL A;  5CA0 E;  3N9N A;  1LKX A;  3FXE B;  5FXZ A;  2N1G A;  2H7O A;  3AB3 B;  2V1D B;  1CUN A;  1ZHC A;  1BR4 A;  2CXD A;  2CXL A;  3O4X E;  3UFE A;  4OHF A;  4I43 B;  4WW0 A;  1ZEE A;  1SHZ C;  3JC6 C;  1MMD A;  2W61 A;  4G2A A;  4CI2 B;  3N9Q A;  4ZHQ E;  3H37 A;  3WAJ A;  2ZM2 A;  4QWN B;  3RX6 A;  4AQG A;  1WR6 A;  1BR0 A;  4F6R C;  4QXC B;  3KBU A;  4U74 A;  5LHH B;  4UXN B;  4IIJ E;  4AKL A;  3AA7 B;  2NTY A;  2A72 A;  2KLQ A;  3ZCI A;  5L3G B;  3JC6 D;  4ADZ A;  4ZS3 A;  5JDL A;  2MYS A;  3P8C D;  4ISS A;  5JR9 B;  2KMF A;  3RH3 A;  2VAS A;  5JRC A;  3HKB E;  4AKH A;  4UEL A;  4HFV A;  4DND A;  2VKD A;  1YD8 G;  1WYC A;  3T8O A;  2LSG A;  2Z6E A;  1O3X A;  4Z8X A;  2LSY A;  3IF8 B;  5LGT B;  3DP7 A;  2H7V C;  4YJ3 E;  2X67 A;  3N2G E;  4OYK A;  2WBL A;  3SRZ A;  3AA0 B;  4EAH A;  3OKQ A;  2YU2 A;  4A56 A;  3HA4 A;  5IHY A;  1HX8 A;  4YLH A;  2GK9 A;  1WLX A;  1G8X A;  3DTO A;  4L0R A;  3RRC A;  2OA5 A;  1MMG A;  1US7 B;  4L9I A;  2W00 A;  5DQV A;  3UTK A;  3O9X A;  2RA1 A;  4XAX B;  3BQL A;  1UX5 A;  3PUR A;  4IE6 A;  4V1A v;  5AFU L;  2C5I T;  3B13 A;  1IZN B;  2BZB A;  2D0U A;  4GK0 E;  3K3N A;  4NUU A;  5JR9 A;  4CI3 B;  5LXT E;  3ZMU B;  2D0T A;  3ZN1 B;  1MIV A;  3BK9 A;  4FJO A;  2V7I A;  3PUS A;  2E9X D;  3HL6 A;  3P7I A;  3GA8 A;  3I1A A;  3D0T A;  2X51 A;  3N9P A;  3CX8 B;  3A5X A;  5JR9 C;  1MIW A;  1FMV A;  2D5U A;  3N9O A;  3ZJ1 A;  1HCI A;  2CE7 A;  4HN9 A;  1HG5 A;  2NW9 A;  1UCU A;  3RC3 A;  5HXR A;  4CI1 B;  3VKG A;  1KNZ A;  1V9D A;  5FXX A;  3PTR B;  5IYZ E;  3CWZ B;  5E0O A;  3LG7 A;  4CQI A;  2L3L A;  3MA9 A;  5LP6 E;  2YIN A;  2IC6 A;  5LJM A;  4ZS2 A;  3PUG A;  3Q5X A;  4PJJ A;  3IBP A;  1S35 A;  5L3E B;  3I9W A;  3GWH A;  2WAU A;  3AA1 B;  2ODU A;  2CEA A;  3AA6 B;  2HPL A;  3LK4 2;  4IHJ E;  2KND A;  2W62 A;  1IJ6 A;  4TX5 A;  5L3B B;  2V7K A;  5LBQ B;  3RPU A;  3K8P C;  4O4J E;  2Q9Q A;  3O1I A;  3C98 B;  2EHO D;  5EK2 A;  4GYR A;  2Q9Q D;  3F2E A;  2HPJ A;  2XAJ B;  4IE4 A;  2C5J A;  2DCF A;  4ILU A;  3O1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...