3CQXC

Chaperone complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
81
structure length
81
Chain Sequence
ESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 33
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqxC00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
1CUNA 4PK4A 3ZMSB 5ABFA 2AXDS 4ILBA 2XQ6A 4LF7T 1HX1B 4A98A 3K1SA 5JDGA 1FMWA 3CK6A 4H9QC 2UUCT 4B3ST 4I43B 4X65T 4NUUA 3AE4A 3RX6A 2WWVA 3FB2A 4GK0E 1ZEEA 1WYBA 2Q9QD 3KVAA 4ZI2D 5LMNT 5ABFB 4XAXB 3WAKA 1D1CA 1MMNA 2ES0A 4IGUA 3D0TA 3AA0B 5F5WA 4I0UA 2L8KA 2VVSA 2DLRA 3N9QA 1T7SA 3OKQA 3P7IA 4IDNA 3RPUA 2BG9B 3ZSTA 5LHIB 2VWAA 4MFRA 5AQQB 4B6XA 4DV5T 2XAQB 3SRZA 1KFYA 2W00A 3F57A 1J5ET 5IYZE 2XQ8A 4WYVA 4HFVA 3N9LA 3GWHA 3UQ4A 2IDOB 2BG9A 3AA1B 4QH1A 4ZZBA 2A9UA 3CX7B 3VKHA 3MXZA 3B57A 4G63A 1UGOA 3A8YC 4JEUB 3QB5A 3ZCIA 4EEDA 5LJNA 3AEAA 4NIQA 2HN1A 3LFMA 5JRCA 4EOZB 5AQSB 2PBIA 2HH7A 4L9IA 2D0TA 1BR4A 3EI0A 2PJQA 3KVBA 4JI7T 2QYWA 3OVUA 3IHRA 4Z90A 3RIUC 2IAKA 1J5WA 4UV9B 5ETWA 4ASKA 2YEVC 4OK0A 5HWYA 4YJ2E 4JI8T 2V7KA 2A3DA 4X1IE 1ZOYA 3FHNA 4AKRB 2IIUA 3ETUA 3RKGA 2H3RA 2H88A 2WY2A 3RYCE 4CN6A 5AQIB 5CFBA 3JADA 4HWDA 5HEGA 1KNPA 2WZHA 2XAJB 4E7ZA 5JR9B 2HHHT 4ZHQE 2C0SA 2X0YA 5HXRA 4K0KT 1MIVA 2FJBA 3GA8A 2G0UA 3JAFA 5HYAA 4HFIA 3VRBA 2QRXA 5JTGA 1D1BA 3P50A 3FZMB 3WI3A 1KK7A 1XNRT 3IEEA 3RH3A 3T1YT 2MAWA 3AA6B 3CQCB 4WZXA 2EHOD 2VKJA 5LBMA 1MNDA 2NW7A 3Q2MA 3RI5A 3PU8A 5H6RB 4JV5T 3U78A 3C50A 3CWZB 4O2BE 3ZLIA 1MIYA 2YDRA 1VCSA 3RIAA 1BR1A 2Q9QB 5AQOB 2VVNA 5AQNB 1I94T 3ANWA 2HPLA 2E8IA 3PJAJ 4JEHB 1L0VA 5LMUT 3L8RA 4GYSA 1D0YA 3PV0F 2LE8A 3E0ZA 4PAGA 2XAGB 3A5XA 2XZEA 1ZV4X 2R6GF 3AE2A 3O1HA 1HNZT 1FJGT 3CKDA 5JVDE 1FMVA 4K0UA 4DV3T 2CHOA 2WMOA 3NRYA 4QX7B 2MBGA 2ZM8A 2CCQA 3S4UA 3UTKA 4DBRA 1HFAA 2OA5A 2PG8A 4LF6T 3VU7H 2N1GA 4TNWA 1OXZA 4ZI2C 3RIFA 3EVYA 1W9RA 4QKNA 5AQJB 3OBVE 2CXLA 2EHOB 4IE5A 4ZS3A 5JQGE 3BQIA 4YTPA 5ABHA 4I55E 2E2AA 2LSKA 3OYZA 5FXVA 5HEHA 4BAYB 4AIUA 2UXDT 4LFBT 2EHOC 3Q5XA 2F4VT 2X9YA 3KV4A 4OX9T 2JRKA 3M3ZB 4HTEA 2RP4A 4MLKA 3ZYKA 4CZZB 2RA1A 3AECA 2UXCT 4U3CA 4O2AE 4P0BA 2E9XD 1SHZC 5J0ZA 2KWIB 3TLTA 5L3CB 2H7VC 2NWBA 4EZ4A 2MPKA 5KX5E 3LK42 4DR4T 4LFAT 3UUMA 3VKGA 1IZNB 4O4JE 5KXJA 3AA7B 1FEWA 3AE6A 3AE7A 1AJ3A 1N33T 1ZHCA 3FZHB 3Q9DA 3RYFE 5L3DB 2YKSA 2DI4A 2V6XA 2XQ4A 3K3NA 3CX6B 3EHZA 4U7YA 3A7MA 3TLSA 4YJ3E 1D0ZA 5DQVA 4X66T 5M4YA 3LDQB 2HPJA 2K24A 2V5DA 2C5JA 1HCIA 4YTNA 4AKIA 2ODUA 3EUHA 5JDFA 3HL6A 3CMLA 3ZKRA 2L3LA 2X66A 1IBKT 3FZKB 1LRZA 3FXEB 4FI5A 2IMLA 2V7IA 3UUNA 4OHFA 1H7CA 2ZMAA 4JUYA 2JQ9A 4PJLA 2WBLA 5AQGB 4AISA 5AFUL 5LYJE 4LF5T 1T8BA 4JYAT 2A72A 1R8IA 4DUZT 3HR0A 2UU9T 3MZKB 3E22E 4DMWA 4TX5A 4Z91A 4OYKA 4WBOA 4IDOA 5LA6E 4DR2T 1IBMT 5AQKB 4GKJT 3SFDA 4JI5T 2BDEA 1O3XA 4YSXA 4YXDA 1M62A 3ZN1B 3KV9A 2EHOA 3FZLB 2X51A 3AE5A 4GK5E 4UEMA 5FXZA 2ZM6T 2FJDA 2N2NA 4ANJA 2M6BA 2Z6EA 3AEGA 3FZFB 3P4PA 2XASB 2KXPB 2LSJA 2XJ7A 2I6HA 1MMAA 3HKDE 4IHJE 4QWNB 3CVRA 4QHOA 3UU5A 1E1HB 3KFWX 2V1DB 3RC8A 3W15B 2KZ7B 3I9YA 2JJ9A 2VB6A 3N9OA 5L3FB 4DV4T 5HCJA 4WNKA 1UCUA 2IC6A 4ADZA 3AAEB 2VKHA 2IUBA 2SPCA 5HAXA 5CB4E 1NAFA 3DP7A 3GMIA 1JNRA 1S94A 1LVFA 1LKXA 2Y8DA 3AEEA 3BQKA 3G06A 3AVSA 3IA3A 3K8PC 2JPFA 3NZPA 4KMCA 4KI0F 4X20E 3UULA 5LGUB 4PFOA 3TLUA 2XTLA 1X79A 1SA0E 4PJNA 3RRWA 1XZYA 2BG9C 3ZC1A 3M65A 2BBHA 4IL4A 3ZT5A 2YOEA 3AE9A 4U2ZA 4AQYT 3N2GE 3J9X1 4JLEA 4IREA 3AEBA 4DMVA 5AQVB 2JQKA 4HWIB 3DJBA 3N9MA 4QH4A 4LF4T 5LOVE 3RQUA 2UXNB 1HNXT 3RHWA 1M7KA 4ZOLE 2LOPA 2LT3A 3AXJB 1HX8A 3R6NA 3KBTA 2DCFA 3QK6A 1KEYA 2KINB 2W62A 5C2TA 1S35A 3HKCE 5L3BB 4NXMT 4DR7T 1GQEA 5EK3A 4CN4A 4DBQA 2W63A 3L3PA 5KMGP 1N36T 2JIWA 4U33A 3LSVA 3PUQA 5TAOA 3ZMZB 4V1Av 4IDZA 3N2OA 1QLBA 2WB5A 4L5GA 5HXCA 1QUUA 5LP6E 4X62T 5AQMB 2J47A 4ZI3D 5CA1E 1BR2A 1Z0PA 4GOUA 5IHYA 3JAEA 1T98A 4U72A 2W67A 3PUWF 1UK5A 2BVLA 4IE6A 4IIJE 4TV9E 4LF8T 5FMNA 5BMVE 4O4LE 3LJCA 4DV0T 1NWMX 2LM2A 4XBFB 3PURA 4B3TT 3PUVF 4CI1B 1G73A 3AVRA 4PW8A 4U2YA 2M67A 2V6YA 4A97A 3O4XE 2X9XA 2WAUA 5HXHA 2K5BB 3H3AA 5ABEA 3QUJA 4ILAA 3B5MA 2XQ5A 3UQ7A 2LRLA 3JC6C 2NR4A 2J4GA 3AB3B 3AEDA 4GIWA 4XZCA 4O4HE 2WU5A 3HKEE 4JI2T 1WFDA 1YXRA 4UELA 3RKOA 3RQWA 4DO0A 2KT9A 5LXTE 3PJAA 4YY3T 2YK0A 1YW0A 2XQAA 2CE7A 1WLXA 3BQLA 2WDVA 1XMQT 2NTXA 1IJ5A 1NEKA 2B1EA 2V7LA 4EIWA 2JMKA 3O9XA 3UT5E 4YHJA 4LMLA 1UX5A 1YKHB 4COFA 2KLQA 2XQ3A 2V7MA 3ZEFB 2KNDA 4QX8B 2MYSA 2V7JA 5FL0A 5CJ5A 2C5IT 4DUYT 3QOFA 2VQFT 1HG2A 1SUMB 2KSRA 4KUMB 2NW9A 1WR0A 4UXNB 1FIOA 2VL8A 2WWUA 5FY1A 3RYHE 5JREA 1N34T 2LJLA 2FJEA 1OEDB 2BBJA 2X68A 4FJOA 2I59A 3P4RA 1Z8UA 2LSIA 4M1PA 4ZEYA 3C4WA 1U4QA 1EZ3A 2XPKA 2YDQA 2YU2A 3BK9A 4HWHA 2ACZA 4IE4A 2V8SV 3LBXB 2YINA 4UVAB 4DV2T 3MACA 2W4XA 3J7Yq 3EAMA 1B7TA 3FXDB 4UF0A 2E9XB 2GK9A 2FBWA 4IL9A 5FP3A 3RIUA 4L0RA 2WZIA 3EDVA 3PUGA 4X1YE 1KF6A 1MNEA 3NRXA 3MKDA 5ADXL 4NUVA 2J62A 2A2FX 2X9WA 1YKEB 3NBXX 4EGWA 4F6RC 3AAIA 2H89A 3UU6A 2LLYA 3ANWB 3CIRA 4ILCA 4DV1T 3HI2A 5LG3A 5LNKA 2PTFA 3L09A 1Y01A 2BVMA 3ZJ1A 5BR8T 4CI2B 1DU2A 4DV7T 4WW0A 2V6YB 4I4TE 1IBLT 3EDUA 2CLYC 3TKLB 2FJAA 4HFEA 3T1HT 2JQQA 5EK4A 2WS3A 2YN6A 4H63H 1E2AA 2CLYB 3I9WA 4NPPA 4PK5A 5DJQC 3UU8A 5FVKA 5AQFB 4PK6A 5EZYE 3ZT7A 4X64T 5ABGA 3NWIA 1Y64B 2B76A 4HE8A 4HEAA 5JDQA 3L39A 4DR5T 1XWMA 4IE7A 2VKDA 4TWHA 3LK2B 5FY0A 2M6IA 1BR0A 1HTJF 4TUYE 1HG5A 1YQ4A 2CBIA 3PDYA 2PFVA 2BG9E 2UUAT 4HN9A 1SE7A 3AEFA 5L3EB 4ZZCA 3Q5DA 5AQTB 4H9RC 1WRDA 4TZ4C 4HKAA 5F3JA 4TWFA 1XMOT 1HS7A 3AE3A 1MIWA 2IC9A 3RLFF 3SOLA 2LSYA 4B3MT 2UXXB 1NENA 3IF8B 3MK7C 4P1NA 5LG4A 4LMJA 4MHCA 2KMFA 4OFZA 2Y48B 3B13A 2BZBA 2DWKA 2DNXA 3LBXA 4TN7B 5EK2A 3LK3B 3RGLA 2CXFA 2NW8A 2WQYA 2XY8B 4YTMA 4ERRA 4B3RT 3OYXA 2KWHA 2X0LB 4J2CA 2LRKA 2JMHA 3E08A 4ISSA 4U31A 5GONE 2WCAA 1UX4A 2LKHA 2BS2A 2CBJA 1VOMA 2XHEB 3TLWA 4CXWA 2K48A 4QXHB 5HWXA 5HXEA 4O4IE 2XSBA 4H9NC 3UFEA 4UF0B 2BS4A 4LFCT 2CWYA 3N9NA 5LGNB 3P4WA 1HF8A 2NP9A 3PUZF 3ZMUB 1W0AA 4HFBA 4LMKA 1MMDA 3SWHA 1MMGA 3ZT6A 3IBPA 5JDNA 4DV6T 1UUSA 1ZP0A 3X1DA 1W0BA 4PFPA 4ISTA 5JR9C 3C51A 4DR1T 1KNZA 4P0AA 2XUEA 3KBUA 4AI6A 4KHPT 2XM1A 3RRCA 4GYRA 4HFDA 3ZJ2A 4HFHA 4PJJA 5E0OA 3OJAA 4ZS2A 4EAHA 1QSDA 4G2AA 5J1GA 2CM0A 1JNZA 3P4SA 3N9PA 4KX6A 4X5TA 4ZXLA 2XAHB 2BKPA 3N5LA 5F8PA 5J2TE 4JI3T 1I6ZA 3N2KE 2YDSA 4BA9A 5FKYA 1UURA 2XSAA 5DQWA 3QB5K 3C64A 2P9BA 3C98B 4EYYR 3GN5B 2Y6XA 2HN2A 3PUAA 4H9PC 4PJMA 4DNDA 5AQRB 2VURA 2MTQA 3HKBE 4HWFA 2MOZA 2X0HA 4H63V 1E7PA 3K3OA 2W0GA 4QXCB 2L9QA 2VKOA 5FXXA 3FBZA 4BJMA 2V5CA 2OV9A 5HXSA 1XNQT 2VK9A 2RPAA 5FY7A 4C91A 3RYIE 4AQGA 2VQET 4O8SA 3Q5EA 4IDPA 1IJ6A 2VASA 5IWAT 3I0QA 5AQLB 3PUYF 4ZI7E 2UUBT 2E9XC 2WDQA 3LG7A 4HFCA 3PUSA 3ZMVB 2BS3A 3NKZA 3WAJA 1G8XA 3H3MA 4X1KE 4AXPA 4AQFA 2XM2A 3ONLC 1WYCA 3NZQA 5CA0E 4EB6E 1D1AA 1VRBA 3ONXA 4DIDB 3PUXF 3JC6D 4A56A 3KV5A 4KBMB 3ZN0B 3ETVA 3I0OA 5HEOA 2CMRA 4U7IA 2ZM0A 3SFEA 2VL0A 5CGMA 5J2UE 5L4EA 2D5UA 2LHNA 3AE8A 3KV6A 2CHNA 2LKGA 3CQXC 4UV8B 4U74A 5LB7B 5LGTB 4YLHA 2X67A 3ABVA 3ESLA 3F2EA 3FBLA 2XQYA 5JDHA 3AE1A 3PU3A 5JDLA 4HWCA 2ZM2A 5L3GB 4ZI3C 5LHGB 5C3JA 4H9SE 4F8HA 4YHHT 4N78D 3VR9A 4A5XA 1XDPA 3ZPOA 1YQ3A 1OEDE 3ZMTB 5JDMA 3ONJA 2YU1A 4H9OC 3MJXA 4UR9A 2DHRA 3UU4A 3U3IA 2LOSA 4JBWF 3C4XA 4MBQA 4EV6A 4LF9T 2IW5B 4JI4T 4TV8E 4AKHA 5L2LA 3R84B 5LBQB 3ZC0A 2J1DG 2W66A 1LVKA 3SS1A 4JI0T 4Z8XA 2CXDA 3RC3A 1WR6A 4IDQA 4CQIA 2JQHA 2BKNA 4Q25A 5HCMA 3ZYLA 5FXWA 2E5LT 5JR9A 2CA5A 2AE9A 4DR6T 5JRCB 3OTOT 4EZHA 4AKGA 4ILUA 1ZKEA 3ZYMA 1OWAA 3P8CD 3OPCA 3TLVA 3V5SA 3HA4A 4PNIA 4DVDA 4CXXA 4BJNA 1CHUA 4JI1T 3V5UA 2Q9QC 2WSSV 1US7B 2WDRA 3CX8B 4UVCB 3ZSSA 2ZLYA 1V9DA 2CPTA 3JCFA 3UFGA 3C4ZA 2K3WA 5C8YE 5L47A 3CQGB 3T8OA 3NVOA 4NXNT 1OEDA 2CEAA 2UXBT 2Q9QA 2W61A 1WCRA 2BKOA 3DTOA 2WMNA 1HR0T 4UIGA 1HNWT 3ZCJA 2LM9A 5LHHB 4AKLA 3I1AA 4EXTA 5A1LA 2H7OA 3QNUA 2C5KT 2D9DA 2ODVA 2LHRA 2LSGA 2XQ7A 3PE0A 3UU3A 1VCTA 4OYJA 2X9HA 4WBNE 4C90A 1KNRA 3P4QA 4E7SA 5LJMA 4YSYA 2QA7A 2I0MA 2E5VA 2K9AA 3VHLA 2FUPA 4GKKT 3MA9A 2QGSA 3QC9A 2DWGA 4HGAA 4CI3B 3F31A 1T72A 3PTRB 3UUBA 2NTYA 5FVLA 4CN1A 2WM9A 4TWDA 5AQHB 4JI6T 2CWOA 3Q5WA 5L4HA 4P09A 2V26A 5FL1A 1IAPA 3GN5A 2CRBA 4IE0A 4I50E 4CXYA 4YFSA 5HEJA 4IT4A 4AQFC 5AQPB 3VR8A 4DR3T 2W2UA 4TNVA 1D0XA 3VRAA 1W09A 4EEBA 1OEDC 2D0UA 3AAAB 5HEUA 5LCYA 5JH7E 2ACXA 2QVAA 2DL1A 2NOXA 1U5PA 4QH5A 1XDOA 3H37A 3UUXB 2D2SA 2OLTA 4MALA 5IUXA 1N32T 2XQ9A 4YT0A 5FNVE 4YSZA 3K3QC 5H6QB 5KDMC 2IHR1 3RF1A 5FYMA 2XAFB 3KINB 4KP3C 4KHZF 2WU2A 3CPZA 1YD8G 2WP9A 1X9BA 2E9XA 2N9DA 3AXJA 3O1JA 3KDSE 1J1JA 5DABA 4UVBB 4QXBB 5AQUB 4EYUA 3O1IA 2LEHA 3EABA
chains in the Genus database with same CATH topology
1CUNA 4PK4A 3ZMSB 5JDGA 1FMWA 4H9QC 4I43B 4NUUA 3RX6A 3FB2A 4GK0E 1ZEEA 1WYBA 2Q9QD 3KVAA 4ZI2D 4XAXB 3WAKA 1D1CA 1MMNA 2ES0A 4IGUA 3D0TA 3AA0B 2L8KA 2DLRA 3N9QA 3OKQA 3RPUA 5LHIB 2VWAA 4MFRA 4B6XA 2XAQB 3SRZA 2W00A 3F57A 5IYZE 4HFVA 3N9LA 3GWHA 3AA1B 3CX7B 3VKHA 3MXZA 3B57A 4G63A 4JEUB 3ZCIA 5JRCA 5LJNA 3LFMA 4EOZB 2PBIA 2HH7A 4L9IA 2D0TA 1BR4A 3KVBA 2PJQA 4ASKA 4ZI7E 3IHRA 2IAKA 4UV9B 5ETWA 2YEVC 4OK0A 5HWYA 4YJ2E 2V7KA 2A3DA 4X1IE 3FHNA 4AKRB 3ETUA 2H3RA 4E7ZA 2XAJB 5JR9B 4ZHQE 2C0SA 5HXRA 1MIVA 3GA8A 2G0UA 5HYAA 1D1BA 3WI3A 1KK7A 3IEEA 3RH3A 3AA6B 3CQCB 2EHOD 2VKJA 5LBMA 1MNDA 2NW7A 3Q2MA 3PU8A 5H6RB 3U78A 3C50A 3CWZB 4O2BE 3ZLIA 1MIYA 1BR1A 2Q9QB 3ANWA 2HPLA 2E8IA 4JEHB 4GYSA 1D0YA 2LE8A 3E0ZA 4PAGA 2XAGB 3A5XA 3O1HA 1ZV4X 3CKDA 5JVDE 1FMVA 4K0UA 3NRYA 2WMOA 4QX7B 2MBGA 2ZM8A 2CCQA 3S4UA 3UTKA 4DBRA 1HFAA 2OA5A 2PG8A 3VU7H 2N1GA 1OXZA 4ZI2C 3EVYA 4QKNA 3OBVE 2CXLA 2EHOB 4IE5A 4ZS3A 5JQGE 3BQIA 4AKHA 4I55E 2LSKA 3OYZA 5FXVA 4BAYB 2EHOC 3Q5XA 2X9YA 3KV4A 2JRKA 4HTEA 4MLKA 2RP4A 3ZYKA 4CZZB 2RA1A 4O2AE 4P0BA 2E9XD 1SHZC 2KWIB 5L3CB 2H7VC 2NWBA 4EZ4A 5KX5E 3LK42 3VKGA 3UUMA 1IZNB 4O4JE 3AA7B 1FEWA 1AJ3A 1ZHCA 3Q9DA 3RYFE 5L3DB 2DI4A 3K3NA 3CX6B 4YJ3E 1D0ZA 5DQVA 5M4YA 2HPJA 2K24A 2C5JA 1HCIA 4AKIA 2ODUA 3EUHA 5JDFA 3HL6A 3CMLA 2L3LA 2X66A 1LRZA 3FXEB 4FI5A 2V7IA 3UUNA 4OHFA 1H7CA 2ZMAA 4JUYA 4PJLA 2WBLA 5AFUL 5LYJE 2A72A 3HR0A 3MZKB 3E22E 4DMWA 4TX5A 4OYKA 4WBOA 5LA6E 2BDEA 1O3XA 3ZN1B 3KV9A 2EHOA 4GK5E 2X51A 4UEMA 5FXZA 2N2NA 4ANJA 2Z6EA 2XASB 2KXPB 2LSJA 3HKDE 1MMAA 4IHJE 4QWNB 3CVRA 4QHOA 1E1HB 3KFWX 2V1DB 3RC8A 3W15B 2KZ7B 3I9YA 2JJ9A 2VB6A 3N9OA 5L3FB 4WNKA 1UCUA 2IC6A 4ADZA 3AAEB 2VKHA 2SPCA 5HAXA 5CB4E 3DP7A 1NAFA 3GMIA 1LVFA 1S94A 3K8PC 1LKXA 2Y8DA 3BQKA 3NZPA 3P7IA 3AVSA 4KMCA 2JPFA 4X20E 3UULA 5LGUB 4PFOA 2XTLA 1X79A 1SA0E 4PJNA 3RRWA 3ZC1A 3M65A 3N2GE 3J9X1 4JLEA 4DMVA 3DJBA 3N9MA 5LOVE 2UXNB 4ZOLE 2LOPA 2LT3A 3R6NA 1HX8A 3KBTA 2DCFA 3QK6A 2KINB 2W62A 1S35A 3HKCE 5L3BB 5EK3A 4DBQA 2W63A 3L3PA 5KMGP 3PUQA 5TAOA 3ZMZB 4V1Av 4IDZA 3N2OA 4L5GA 5HXCA 1QUUA 5LP6E 4ZI3D 5CA1E 1BR2A 1Z0PA 4GOUA 5IHYA 1T98A 4U72A 2BVLA 4TV9E 4IE6A 4IIJE 5FMNA 5BMVE 4O4LE 3LJCA 1NWMX 4XBFB 3PURA 4CI1B 1G73A 3AVRA 4PW8A 5HXHA 2M67A 3O4XE 2X9XA 2WAUA 2K5BB 3H3AA 3QUJA 3JC6C 4XZCA 3ZMVB 3AB3B 4GIWA 3RKOA 4O4HE 3HKEE 4UELA 4DO0A 2KT9A 5LXTE 2YK0A 1YW0A 2CE7A 1WLXA 3BQLA 2NTXA 1IJ5A 2B1EA 2V7LA 4EIWA 2JMKA 3O9XA 3UT5E 4YHJA 1UX5A 1YKHB 2KLQA 3ZEFB 2V7MA 2KNDA 4QX8B 2MYSA 2V7JA 2C5IT 1HG2A 4KUMB 2NW9A 5JREA 4UXNB 1FIOA 2VL8A 2WWUA 5FY1A 3RYHE 2LJLA 4FJOA 2X68A 2I59A 2LSIA 4M1PA 3C4WA 2YU2A 1EZ3A 1U4QA 3BK9A 1KNZA 4IE4A 3LBXB 2YINA 4UVAB 3MACA 3J7Yq 1B7TA 3FXDB 4UF0A 2E9XB 2GK9A 5FP3A 4L0RA 3PUGA 3EDVA 4X1YE 1MNEA 3NRXA 3MKDA 5ADXL 4NUVA 2A2FX 2X9WA 1YKEB 3NBXX 4F6RC 3AAIA 3ANWB 3HI2A 5LNKA 3L09A 2BVMA 3ZJ1A 4CI2B 4WW0A 4I4TE 3EDUA 2CLYC 3TKLB 2JQQA 5EK4A 4PK5A 4H63H 5DJQC 2CLYB 3I9WA 4PK6A 5EZYE 1Y64B 4HE8A 4HEAA 5JDQA 4IE7A 2VKDA 3LK2B 5FY0A 1BR0A 1HTJF 4TUYE 1HG5A 3PDYA 2PFVA 4HN9A 5L3EB 4H9RC 1WRDA 4TZ4C 4HKAA 5F3JA 1HS7A 1MIWA 2IC9A 3SOLA 2LSYA 2UXXB 3IF8B 3MK7C 5LG4A 4MHCA 2KMFA 4OFZA 2Y48B 4TN7B 2BZBA 2DWKA 2DNXA 3LBXA 5EK2A 3LK3B 2CXFA 2NW8A 4ERRA 3OYXA 2KWHA 2X0LB 4J2CA 4ISSA 2JMHA 3E08A 5GONE 1UX4A 2XHEB 4CXWA 1VOMA 2K48A 4QXHB 5HWXA 5HXEA 4O4IE 4H9NC 3UFEA 4UF0B 2CWYA 3N9NA 5LGNB 1HF8A 2NP9A 3ZMUB 1MMDA 3SWHA 1MMGA 5JDNA 3IBPA 5JR9C 4PFPA 4ISTA 3C51A 4P0AA 2XUEA 3KBUA 4AI6A 3RRCA 4GYRA 3ZJ2A 4PJJA 5E0OA 3OJAA 4ZS2A 4EAHA 1QSDA 4G2AA 5J1GA 2CM0A 3N9PA 2XAHB 3N5LA 5F8PA 5J2TE 3N2KE 4BA9A 5DQWA 3C64A 2P9BA 3C98B 4EYYR 3GN5B 2Y6XA 3PUAA 4H9PC 4PJMA 4DNDA 2MTQA 3HKBE 2MOZA 4H63V 3K3OA 2W0GA 4QXCB 2L9QA 2VKOA 5FXXA 3FBZA 4BJMA 5HXSA 2VK9A 5FY7A 4C91A 3RYIE 4AQGA 4O8SA 1IJ6A 2VASA 3I0QA 2E9XC 3LG7A 3PUSA 3WAJA 1G8XA 4X1KE 4AXPA 4AQFA 5CA0E 1WYCA 3NZQA 4EB6E 1D1AA 1VRBA 3ONXA 3JC6D 4A56A 3KV5A 4KBMB 3ZN0B 3ETVA 3I0OA 2CMRA 2ZM0A 5J2UE 2D5UA 2LHNA 5LGTB 3KV6A 3CQXC 4UV8B 4U74A 4YLHA 2X67A 3FBLA 3ESLA 3F2EA 2XQYA 5JDHA 5JDLA 3PU3A 2ZM2A 5L3GB 4ZI3C 5LHGB 4H9SE 2LEHA 4N78D 3ZPOA 5JDMA 3ZMTB 2YU1A 4H9OC 3MJXA 2DHRA 3U3IA 2LOSA 3C4XA 4MBQA 2IW5B 4TV8E 5L2LA 3R84B 5LBQB 3ZC0A 2J1DG 1LVKA 3SS1A 4Z8XA 2CXDA 3RC3A 1WR6A 4CQIA 3ZYLA 5FXWA 5JR9A 2CA5A 4AKGA 5JRCB 4EZHA 4ILUA 1ZKEA 3ZYMA 1OWAA 3P8CD 3V5SA 3HA4A 4PNIA 4DVDA 4CXXA 4BJNA 3V5UA 2Q9QC 2WSSV 1US7B 3CX8B 4UVCB 2ZLYA 1V9DA 5C8YE 3C4ZA 3CQGB 3T8OA 2CEAA 2Q9QA 2W61A 3DTOA 2WMNA 4UIGA 3ZCJA 2LM9A 5LHHB 4AKLA 3I1AA 4EXTA 5A1LA 2H7OA 2C5KT 2ODVA 2LHRA 2LSGA 3PE0A 4OYJA 2X9HA 4WBNE 4C90A 5LJMA 4E7SA 2QA7A 2K9AA 3VHLA 3MA9A 2QGSA 3QC9A 2DWGA 4HGAA 4CI3B 3F31A 3PTRB 2NTYA 2WM9A 2CWOA 3Q5WA 4P09A 2V26A 1IAPA 3GN5A 4IE0A 4I50E 4CXYA 4YFSA 4AQFC 1D0XA 5LCYA 2D0UA 3AAAB 5JH7E 2ACXA 2NOXA 1U5PA 3H37A 3UUXB 2D2SA 4MALA 5FNVE 3K3QC 5H6QB 5KDMC 5FYMA 2XAFB 3KINB 4KP3C 3CPZA 1YD8G 2E9XA 2N9DA 3O1JA 5DABA 3KDSE 4UVBB 4QXBB 3RYCE 4EYUA 3O1IA 3B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 1CUN A;  4PK4 A;  3ZMS B;  5ABF A;  2AXD S;  4ILB A;  2XQ6 A;  4LF7 T;  1HX1 B;  4A98 A;  3K1S A;  5JDG A;  1FMW A;  3CK6 A;  4H9Q C;  2UUC T;  4B3S T;  4I43 B;  4X65 T;  4NUU A;  3AE4 A;  3RX6 A;  2WWV A;  3FB2 A;  4GK0 E;  1ZEE A;  1WYB A;  2Q9Q D;  3KVA A;  4ZI2 D;  5LMN T;  5ABF B;  4XAX B;  3WAK A;  1D1C A;  1MMN A;  2ES0 A;  4IGU A;  3D0T A;  3AA0 B;  5F5W A;  4I0U A;  2L8K A;  2VVS A;  2DLR A;  3N9Q A;  1T7S A;  3OKQ A;  3P7I A;  4IDN A;  3RPU A;  2BG9 B;  3ZST A;  5LHI B;  2VWA A;  4MFR A;  5AQQ B;  4B6X A;  4DV5 T;  2XAQ B;  3SRZ A;  1KFY A;  2W00 A;  3F57 A;  1J5E T;  5IYZ E;  2XQ8 A;  4WYV A;  4HFV A;  3N9L A;  3GWH A;  3UQ4 A;  2IDO B;  2BG9 A;  3AA1 B;  4QH1 A;  4ZZB A;  2A9U A;  3CX7 B;  3VKH A;  3MXZ A;  3B57 A;  4G63 A;  1UGO A;  3A8Y C;  4JEU B;  3QB5 A;  3ZCI A;  4EED A;  5LJN A;  3AEA A;  4NIQ A;  2HN1 A;  3LFM A;  5JRC A;  4EOZ B;  5AQS B;  2PBI A;  2HH7 A;  4L9I A;  2D0T A;  1BR4 A;  3EI0 A;  2PJQ A;  3KVB A;  4JI7 T;  2QYW A;  3OVU A;  3IHR A;  4Z90 A;  3RIU C;  2IAK A;  1J5W A;  4UV9 B;  5ETW A;  4ASK A;  2YEV C;  4OK0 A;  5HWY A;  4YJ2 E;  4JI8 T;  2V7K A;  2A3D A;  4X1I E;  1ZOY A;  3FHN A;  4AKR B;  2IIU A;  3ETU A;  3RKG A;  2H3R A;  2H88 A;  2WY2 A;  3RYC E;  4CN6 A;  5AQI B;  5CFB A;  3JAD A;  4HWD A;  5HEG A;  1KNP A;  2WZH A;  2XAJ B;  4E7Z A;  5JR9 B;  2HHH T;  4ZHQ E;  2C0S A;  2X0Y A;  5HXR A;  4K0K T;  1MIV A;  2FJB A;  3GA8 A;  2G0U A;  3JAF A;  5HYA A;  4HFI A;  3VRB A;  2QRX A;  5JTG A;  1D1B A;  3P50 A;  3FZM B;  3WI3 A;  1KK7 A;  1XNR T;  3IEE A;  3RH3 A;  3T1Y T;  2MAW A;  3AA6 B;  3CQC B;  4WZX A;  2EHO D;  2VKJ A;  5LBM A;  1MND A;  2NW7 A;  3Q2M A;  3RI5 A;  3PU8 A;  5H6R B;  4JV5 T;  3U78 A;  3C50 A;  3CWZ B;  4O2B E;  3ZLI A;  1MIY A;  2YDR A;  1VCS A;  3RIA A;  1BR1 A;  2Q9Q B;  5AQO B;  2VVN A;  5AQN B;  1I94 T;  3ANW A;  2HPL A;  2E8I A;  3PJA J;  4JEH B;  1L0V A;  5LMU T;  3L8R A;  4GYS A;  1D0Y A;  3PV0 F;  2LE8 A;  3E0Z A;  4PAG A;  2XAG B;  3A5X A;  2XZE A;  1ZV4 X;  2R6G F;  3AE2 A;  3O1H A;  1HNZ T;  1FJG T;  3CKD A;  5JVD E;  1FMV A;  4K0U A;  4DV3 T;  2CHO A;  2WMO A;  3NRY A;  4QX7 B;  2MBG A;  2ZM8 A;  2CCQ A;  3S4U A;  3UTK A;  4DBR A;  1HFA A;  2OA5 A;  2PG8 A;  4LF6 T;  3VU7 H;  2N1G A;  4TNW A;  1OXZ A;  4ZI2 C;  3RIF A;  3EVY A;  1W9R A;  4QKN A;  5AQJ B;  3OBV E;  2CXL A;  2EHO B;  4IE5 A;  4ZS3 A;  5JQG E;  3BQI A;  4YTP A;  5ABH A;  4I55 E;  2E2A A;  2LSK A;  3OYZ A;  5FXV A;  5HEH A;  4BAY B;  4AIU A;  2UXD T;  4LFB T;  2EHO C;  3Q5X A;  2F4V T;  2X9Y A;  3KV4 A;  4OX9 T;  2JRK A;  3M3Z B;  4HTE A;  2RP4 A;  4MLK A;  3ZYK A;  4CZZ B;  2RA1 A;  3AEC A;  2UXC T;  4U3C A;  4O2A E;  4P0B A;  2E9X D;  1SHZ C;  5J0Z A;  2KWI B;  3TLT A;  5L3C B;  2H7V C;  2NWB A;  4EZ4 A;  2MPK A;  5KX5 E;  3LK4 2;  4DR4 T;  4LFA T;  3UUM A;  3VKG A;  1IZN B;  4O4J E;  5KXJ A;  3AA7 B;  1FEW A;  3AE6 A;  3AE7 A;  1AJ3 A;  1N33 T;  1ZHC A;  3FZH B;  3Q9D A;  3RYF E;  5L3D B;  2YKS A;  2DI4 A;  2V6X A;  2XQ4 A;  3K3N A;  3CX6 B;  3EHZ A;  4U7Y A;  3A7M A;  3TLS A;  4YJ3 E;  1D0Z A;  5DQV A;  4X66 T;  5M4Y A;  3LDQ B;  2HPJ A;  2K24 A;  2V5D A;  2C5J A;  1HCI A;  4YTN A;  4AKI A;  2ODU A;  3EUH A;  5JDF A;  3HL6 A;  3CML A;  3ZKR A;  2L3L A;  2X66 A;  1IBK T;  3FZK B;  1LRZ A;  3FXE B;  4FI5 A;  2IML A;  2V7I A;  3UUN A;  4OHF A;  1H7C A;  2ZMA A;  4JUY A;  2JQ9 A;  4PJL A;  2WBL A;  5AQG B;  4AIS A;  5AFU L;  5LYJ E;  4LF5 T;  1T8B A;  4JYA T;  2A72 A;  1R8I A;  4DUZ T;  3HR0 A;  2UU9 T;  3MZK B;  3E22 E;  4DMW A;  4TX5 A;  4Z91 A;  4OYK A;  4WBO A;  4IDO A;  5LA6 E;  4DR2 T;  1IBM T;  5AQK B;  4GKJ T;  3SFD A;  4JI5 T;  2BDE A;  1O3X A;  4YSX A;  4YXD A;  1M62 A;  3ZN1 B;  3KV9 A;  2EHO A;  3FZL B;  2X51 A;  3AE5 A;  4GK5 E;  4UEM A;  5FXZ A;  2ZM6 T;  2FJD A;  2N2N A;  4ANJ A;  2M6B A;  2Z6E A;  3AEG A;  3FZF B;  3P4P A;  2XAS B;  2KXP B;  2LSJ A;  2XJ7 A;  2I6H A;  1MMA A;  3HKD E;  4IHJ E;  4QWN B;  3CVR A;  4QHO A;  3UU5 A;  1E1H B;  3KFW X;  2V1D B;  3RC8 A;  3W15 B;  2KZ7 B;  3I9Y A;  2JJ9 A;  2VB6 A;  3N9O A;  5L3F B;  4DV4 T;  5HCJ A;  4WNK A;  1UCU A;  2IC6 A;  4ADZ A;  3AAE B;  2VKH A;  2IUB A;  2SPC A;  5HAX A;  5CB4 E;  1NAF A;  3DP7 A;  3GMI A;  1JNR A;  1S94 A;  1LVF A;  1LKX A;  2Y8D A;  3AEE A;  3BQK A;  3G06 A;  3AVS A;  3IA3 A;  3K8P C;  2JPF A;  3NZP A;  4KMC A;  4KI0 F;  4X20 E;  3UUL A;  5LGU B;  4PFO A;  3TLU A;  2XTL A;  1X79 A;  1SA0 E;  4PJN A;  3RRW A;  1XZY A;  2BG9 C;  3ZC1 A;  3M65 A;  2BBH A;  4IL4 A;  3ZT5 A;  2YOE A;  3AE9 A;  4U2Z A;  4AQY T;  3N2G E;  3J9X 1;  4JLE A;  4IRE A;  3AEB A;  4DMV A;  5AQV B;  2JQK A;  4HWI B;  3DJB A;  3N9M A;  4QH4 A;  4LF4 T;  5LOV E;  3RQU A;  2UXN B;  1HNX T;  3RHW A;  1M7K A;  4ZOL E;  2LOP A;  2LT3 A;  3AXJ B;  1HX8 A;  3R6N A;  3KBT A;  2DCF A;  3QK6 A;  1KEY A;  2KIN B;  2W62 A;  5C2T A;  1S35 A;  3HKC E;  5L3B B;  4NXM T;  4DR7 T;  1GQE A;  5EK3 A;  4CN4 A;  4DBQ A;  2W63 A;  3L3P A;  5KMG P;  1N36 T;  2JIW A;  4U33 A;  3LSV A;  3PUQ A;  5TAO A;  3ZMZ B;  4V1A v;  4IDZ A;  3N2O A;  1QLB A;  2WB5 A;  4L5G A;  5HXC A;  1QUU A;  5LP6 E;  4X62 T;  5AQM B;  2J47 A;  4ZI3 D;  5CA1 E;  1BR2 A;  1Z0P A;  4GOU A;  5IHY A;  3JAE A;  1T98 A;  4U72 A;  2W67 A;  3PUW F;  1UK5 A;  2BVL A;  4IE6 A;  4IIJ E;  4TV9 E;  4LF8 T;  5FMN A;  5BMV E;  4O4L E;  3LJC A;  4DV0 T;  1NWM X;  2LM2 A;  4XBF B;  3PUR A;  4B3T T;  3PUV F;  4CI1 B;  1G73 A;  3AVR A;  4PW8 A;  4U2Y A;  2M67 A;  2V6Y A;  4A97 A;  3O4X E;  2X9X A;  2WAU A;  5HXH A;  2K5B B;  3H3A A;  5ABE A;  3QUJ A;  4ILA A;  3B5M A;  2XQ5 A;  3UQ7 A;  2LRL A;  3JC6 C;  2NR4 A;  2J4G A;  3AB3 B;  3AED A;  4GIW A;  4XZC A;  4O4H E;  2WU5 A;  3HKE E;  4JI2 T;  1WFD A;  1YXR A;  4UEL A;  3RKO A;  3RQW A;  4DO0 A;  2KT9 A;  5LXT E;  3PJA A;  4YY3 T;  2YK0 A;  1YW0 A;  2XQA A;  2CE7 A;  1WLX A;  3BQL A;  2WDV A;  1XMQ T;  2NTX A;  1IJ5 A;  1NEK A;  2B1E A;  2V7L A;  4EIW A;  2JMK A;  3O9X A;  3UT5 E;  4YHJ A;  4LML A;  1UX5 A;  1YKH B;  4COF A;  2KLQ A;  2XQ3 A;  2V7M A;  3ZEF B;  2KND A;  4QX8 B;  2MYS A;  2V7J A;  5FL0 A;  5CJ5 A;  2C5I T;  4DUY T;  3QOF A;  2VQF T;  1HG2 A;  1SUM B;  2KSR A;  4KUM B;  2NW9 A;  1WR0 A;  4UXN B;  1FIO A;  2VL8 A;  2WWU A;  5FY1 A;  3RYH E;  5JRE A;  1N34 T;  2LJL A;  2FJE A;  1OED B;  2BBJ A;  2X68 A;  4FJO A;  2I59 A;  3P4R A;  1Z8U A;  2LSI A;  4M1P A;  4ZEY A;  3C4W A;  1U4Q A;  1EZ3 A;  2XPK A;  2YDQ A;  2YU2 A;  3BK9 A;  4HWH A;  2ACZ A;  4IE4 A;  2V8S V;  3LBX B;  2YIN A;  4UVA B;  4DV2 T;  3MAC A;  2W4X A;  3J7Y q;  3EAM A;  1B7T A;  3FXD B;  4UF0 A;  2E9X B;  2GK9 A;  2FBW A;  4IL9 A;  5FP3 A;  3RIU A;  4L0R A;  2WZI A;  3EDV A;  3PUG A;  4X1Y E;  1KF6 A;  1MNE A;  3NRX A;  3MKD A;  5ADX L;  4NUV A;  2J62 A;  2A2F X;  2X9W A;  1YKE B;  3NBX X;  4EGW A;  4F6R C;  3AAI A;  2H89 A;  3UU6 A;  2LLY A;  3ANW B;  3CIR A;  4ILC A;  4DV1 T;  3HI2 A;  5LG3 A;  5LNK A;  2PTF A;  3L09 A;  1Y01 A;  2BVM A;  3ZJ1 A;  5BR8 T;  4CI2 B;  1DU2 A;  4DV7 T;  4WW0 A;  2V6Y B;  4I4T E;  1IBL T;  3EDU A;  2CLY C;  3TKL B;  2FJA A;  4HFE A;  3T1H T;  2JQQ A;  5EK4 A;  2WS3 A;  2YN6 A;  4H63 H;  1E2A A;  2CLY B;  3I9W A;  4NPP A;  4PK5 A;  5DJQ C;  3UU8 A;  5FVK A;  5AQF B;  4PK6 A;  5EZY E;  3ZT7 A;  4X64 T;  5ABG A;  3NWI A;  1Y64 B;  2B76 A;  4HE8 A;  4HEA A;  5JDQ A;  3L39 A;  4DR5 T;  1XWM A;  4IE7 A;  2VKD A;  4TWH A;  3LK2 B;  5FY0 A;  2M6I A;  1BR0 A;  1HTJ F;  4TUY E;  1HG5 A;  1YQ4 A;  2CBI A;  3PDY A;  2PFV A;  2BG9 E;  2UUA T;  4HN9 A;  1SE7 A;  3AEF A;  5L3E B;  4ZZC A;  3Q5D A;  5AQT B;  4H9R C;  1WRD A;  4TZ4 C;  4HKA A;  5F3J A;  4TWF A;  1XMO T;  1HS7 A;  3AE3 A;  1MIW A;  2IC9 A;  3RLF F;  3SOL A;  2LSY A;  4B3M T;  2UXX B;  1NEN A;  3IF8 B;  3MK7 C;  4P1N A;  5LG4 A;  4LMJ A;  4MHC A;  2KMF A;  4OFZ A;  2Y48 B;  3B13 A;  2BZB A;  2DWK A;  2DNX A;  3LBX A;  4TN7 B;  5EK2 A;  3LK3 B;  3RGL A;  2CXF A;  2NW8 A;  2WQY A;  2XY8 B;  4YTM A;  4ERR A;  4B3R T;  3OYX A;  2KWH A;  2X0L B;  4J2C A;  2LRK A;  2JMH A;  3E08 A;  4ISS A;  4U31 A;  5GON E;  2WCA A;  1UX4 A;  2LKH A;  2BS2 A;  2CBJ A;  1VOM A;  2XHE B;  3TLW A;  4CXW A;  2K48 A;  4QXH B;  5HWX A;  5HXE A;  4O4I E;  2XSB A;  4H9N C;  3UFE A;  4UF0 B;  2BS4 A;  4LFC T;  2CWY A;  3N9N A;  5LGN B;  3P4W A;  1HF8 A;  2NP9 A;  3PUZ F;  3ZMU B;  1W0A A;  4HFB A;  4LMK A;  1MMD A;  3SWH A;  1MMG A;  3ZT6 A;  3IBP A;  5JDN A;  4DV6 T;  1UUS A;  1ZP0 A;  3X1D A;  1W0B A;  4PFP A;  4IST A;  5JR9 C;  3C51 A;  4DR1 T;  1KNZ A;  4P0A A;  2XUE A;  3KBU A;  4AI6 A;  4KHP T;  2XM1 A;  3RRC A;  4GYR A;  4HFD A;  3ZJ2 A;  4HFH A;  4PJJ A;  5E0O A;  3OJA A;  4ZS2 A;  4EAH A;  1QSD A;  4G2A A;  5J1G A;  2CM0 A;  1JNZ A;  3P4S A;  3N9P A;  4KX6 A;  4X5T A;  4ZXL A;  2XAH B;  2BKP A;  3N5L A;  5F8P A;  5J2T E;  4JI3 T;  1I6Z A;  3N2K E;  2YDS A;  4BA9 A;  5FKY A;  1UUR A;  2XSA A;  5DQW A;  3QB5 K;  3C64 A;  2P9B A;  3C98 B;  4EYY R;  3GN5 B;  2Y6X A;  2HN2 A;  3PUA A;  4H9P C;  4PJM A;  4DND A;  5AQR B;  2VUR A;  2MTQ A;  3HKB E;  4HWF A;  2MOZ A;  2X0H A;  4H63 V;  1E7P A;  3K3O A;  2W0G A;  4QXC B;  2L9Q A;  2VKO A;  5FXX A;  3FBZ A;  4BJM A;  2V5C A;  2OV9 A;  5HXS A;  1XNQ T;  2VK9 A;  2RPA A;  5FY7 A;  4C91 A;  3RYI E;  4AQG A;  2VQE T;  4O8S A;  3Q5E A;  4IDP A;  1IJ6 A;  2VAS A;  5IWA T;  3I0Q A;  5AQL B;  3PUY F;  4ZI7 E;  2UUB T;  2E9X C;  2WDQ A;  3LG7 A;  4HFC A;  3PUS A;  3ZMV B;  2BS3 A;  3NKZ A;  3WAJ A;  1G8X A;  3H3M A;  4X1K E;  4AXP A;  4AQF A;  2XM2 A;  3ONL C;  1WYC A;  3NZQ A;  5CA0 E;  4EB6 E;  1D1A A;  1VRB A;  3ONX A;  4DID B;  3PUX F;  3JC6 D;  4A56 A;  3KV5 A;  4KBM B;  3ZN0 B;  3ETV A;  3I0O A;  5HEO A;  2CMR A;  4U7I A;  2ZM0 A;  3SFE A;  2VL0 A;  5CGM A;  5J2U E;  5L4E A;  2D5U A;  2LHN A;  3AE8 A;  3KV6 A;  2CHN A;  2LKG A;  3CQX C;  4UV8 B;  4U74 A;  5LB7 B;  5LGT B;  4YLH A;  2X67 A;  3ABV A;  3ESL A;  3F2E A;  3FBL A;  2XQY A;  5JDH A;  3AE1 A;  3PU3 A;  5JDL A;  4HWC A;  2ZM2 A;  5L3G B;  4ZI3 C;  5LHG B;  5C3J A;  4H9S E;  4F8H A;  4YHH T;  4N78 D;  3VR9 A;  4A5X A;  1XDP A;  3ZPO A;  1YQ3 A;  1OED E;  3ZMT B;  5JDM A;  3ONJ A;  2YU1 A;  4H9O C;  3MJX A;  4UR9 A;  2DHR A;  3UU4 A;  3U3I A;  2LOS A;  4JBW F;  3C4X A;  4MBQ A;  4EV6 A;  4LF9 T;  2IW5 B;  4JI4 T;  4TV8 E;  4AKH A;  5L2L A;  3R84 B;  5LBQ B;  3ZC0 A;  2J1D G;  2W66 A;  1LVK A;  3SS1 A;  4JI0 T;  4Z8X A;  2CXD A;  3RC3 A;  1WR6 A;  4IDQ A;  4CQI A;  2JQH A;  2BKN A;  4Q25 A;  5HCM A;  3ZYL A;  5FXW A;  2E5L T;  5JR9 A;  2CA5 A;  2AE9 A;  4DR6 T;  5JRC B;  3OTO T;  4EZH A;  4AKG A;  4ILU A;  1ZKE A;  3ZYM A;  1OWA A;  3P8C D;  3OPC A;  3TLV A;  3V5S A;  3HA4 A;  4PNI A;  4DVD A;  4CXX A;  4BJN A;  1CHU A;  4JI1 T;  3V5U A;  2Q9Q C;  2WSS V;  1US7 B;  2WDR A;  3CX8 B;  4UVC B;  3ZSS A;  2ZLY A;  1V9D A;  2CPT A;  3JCF A;  3UFG A;  3C4Z A;  2K3W A;  5C8Y E;  5L47 A;  3CQG B;  3T8O A;  3NVO A;  4NXN T;  1OED A;  2CEA A;  2UXB T;  2Q9Q A;  2W61 A;  1WCR A;  2BKO A;  3DTO A;  2WMN A;  1HR0 T;  4UIG A;  1HNW T;  3ZCJ A;  2LM9 A;  5LHH B;  4AKL A;  3I1A A;  4EXT A;  5A1L A;  2H7O A;  3QNU A;  2C5K T;  2D9D A;  2ODV A;  2LHR A;  2LSG A;  2XQ7 A;  3PE0 A;  3UU3 A;  1VCT A;  4OYJ A;  2X9H A;  4WBN E;  4C90 A;  1KNR A;  3P4Q A;  4E7S A;  5LJM A;  4YSY A;  2QA7 A;  2I0M A;  2E5V A;  2K9A A;  3VHL A;  2FUP A;  4GKK T;  3MA9 A;  2QGS A;  3QC9 A;  2DWG A;  4HGA A;  4CI3 B;  3F31 A;  1T72 A;  3PTR B;  3UUB A;  2NTY A;  5FVL A;  4CN1 A;  2WM9 A;  4TWD A;  5AQH B;  4JI6 T;  2CWO A;  3Q5W A;  5L4H A;  4P09 A;  2V26 A;  5FL1 A;  1IAP A;  3GN5 A;  2CRB A;  4IE0 A;  4I50 E;  4CXY A;  4YFS A;  5HEJ A;  4IT4 A;  4AQF C;  5AQP B;  3VR8 A;  4DR3 T;  2W2U A;  4TNV A;  1D0X A;  3VRA A;  1W09 A;  4EEB A;  1OED C;  2D0U A;  3AAA B;  5HEU A;  5LCY A;  5JH7 E;  2ACX A;  2QVA A;  2DL1 A;  2NOX A;  1U5P A;  4QH5 A;  1XDO A;  3H37 A;  3UUX B;  2D2S A;  2OLT A;  4MAL A;  5IUX A;  1N32 T;  2XQ9 A;  4YT0 A;  5FNV E;  4YSZ A;  3K3Q C;  5H6Q B;  5KDM C;  2IHR 1;  3RF1 A;  5FYM A;  2XAF B;  3KIN B;  4KP3 C;  4KHZ F;  2WU2 A;  3CPZ A;  1YD8 G;  2WP9 A;  1X9B A;  2E9X A;  2N9D A;  3AXJ A;  3O1J A;  3KDS E;  1J1J A;  5DAB A;  4UVB B;  4QXB B;  5AQU B;  4EYU A;  3O1I A;  2LEH A;  3EAB A; 
#chains in the Genus database with same CATH homology
 1CUN A;  4PK4 A;  3ZMS B;  5JDG A;  1FMW A;  4H9Q C;  4I43 B;  4NUU A;  3RX6 A;  3FB2 A;  4GK0 E;  1ZEE A;  1WYB A;  2Q9Q D;  3KVA A;  4ZI2 D;  4XAX B;  3WAK A;  1D1C A;  1MMN A;  2ES0 A;  4IGU A;  3D0T A;  3AA0 B;  2L8K A;  2DLR A;  3N9Q A;  3OKQ A;  3RPU A;  5LHI B;  2VWA A;  4MFR A;  4B6X A;  2XAQ B;  3SRZ A;  2W00 A;  3F57 A;  5IYZ E;  4HFV A;  3N9L A;  3GWH A;  3AA1 B;  3CX7 B;  3VKH A;  3MXZ A;  3B57 A;  4G63 A;  4JEU B;  3ZCI A;  5JRC A;  5LJN A;  3LFM A;  4EOZ B;  2PBI A;  2HH7 A;  4L9I A;  2D0T A;  1BR4 A;  3KVB A;  2PJQ A;  4ASK A;  4ZI7 E;  3IHR A;  2IAK A;  4UV9 B;  5ETW A;  2YEV C;  4OK0 A;  5HWY A;  4YJ2 E;  2V7K A;  2A3D A;  4X1I E;  3FHN A;  4AKR B;  3ETU A;  2H3R A;  4E7Z A;  2XAJ B;  5JR9 B;  4ZHQ E;  2C0S A;  5HXR A;  1MIV A;  3GA8 A;  2G0U A;  5HYA A;  1D1B A;  3WI3 A;  1KK7 A;  3IEE A;  3RH3 A;  3AA6 B;  3CQC B;  2EHO D;  2VKJ A;  5LBM A;  1MND A;  2NW7 A;  3Q2M A;  3PU8 A;  5H6R B;  3U78 A;  3C50 A;  3CWZ B;  4O2B E;  3ZLI A;  1MIY A;  1BR1 A;  2Q9Q B;  3ANW A;  2HPL A;  2E8I A;  4JEH B;  4GYS A;  1D0Y A;  2LE8 A;  3E0Z A;  4PAG A;  2XAG B;  3A5X A;  3O1H A;  1ZV4 X;  3CKD A;  5JVD E;  1FMV A;  4K0U A;  3NRY A;  2WMO A;  4QX7 B;  2MBG A;  2ZM8 A;  2CCQ A;  3S4U A;  3UTK A;  4DBR A;  1HFA A;  2OA5 A;  2PG8 A;  3VU7 H;  2N1G A;  1OXZ A;  4ZI2 C;  3EVY A;  4QKN A;  3OBV E;  2CXL A;  2EHO B;  4IE5 A;  4ZS3 A;  5JQG E;  3BQI A;  4AKH A;  4I55 E;  2LSK A;  3OYZ A;  5FXV A;  4BAY B;  2EHO C;  3Q5X A;  2X9Y A;  3KV4 A;  2JRK A;  4HTE A;  4MLK A;  2RP4 A;  3ZYK A;  4CZZ B;  2RA1 A;  4O2A E;  4P0B A;  2E9X D;  1SHZ C;  2KWI B;  5L3C B;  2H7V C;  2NWB A;  4EZ4 A;  5KX5 E;  3LK4 2;  3VKG A;  3UUM A;  1IZN B;  4O4J E;  3AA7 B;  1FEW A;  1AJ3 A;  1ZHC A;  3Q9D A;  3RYF E;  5L3D B;  2DI4 A;  3K3N A;  3CX6 B;  4YJ3 E;  1D0Z A;  5DQV A;  5M4Y A;  2HPJ A;  2K24 A;  2C5J A;  1HCI A;  4AKI A;  2ODU A;  3EUH A;  5JDF A;  3HL6 A;  3CML A;  2L3L A;  2X66 A;  1LRZ A;  3FXE B;  4FI5 A;  2V7I A;  3UUN A;  4OHF A;  1H7C A;  2ZMA A;  4JUY A;  4PJL A;  2WBL A;  5AFU L;  5LYJ E;  2A72 A;  3HR0 A;  3MZK B;  3E22 E;  4DMW A;  4TX5 A;  4OYK A;  4WBO A;  5LA6 E;  2BDE A;  1O3X A;  3ZN1 B;  3KV9 A;  2EHO A;  4GK5 E;  2X51 A;  4UEM A;  5FXZ A;  2N2N A;  4ANJ A;  2Z6E A;  2XAS B;  2KXP B;  2LSJ A;  3HKD E;  1MMA A;  4IHJ E;  4QWN B;  3CVR A;  4QHO A;  1E1H B;  3KFW X;  2V1D B;  3RC8 A;  3W15 B;  2KZ7 B;  3I9Y A;  2JJ9 A;  2VB6 A;  3N9O A;  5L3F B;  4WNK A;  1UCU A;  2IC6 A;  4ADZ A;  3AAE B;  2VKH A;  2SPC A;  5HAX A;  5CB4 E;  3DP7 A;  1NAF A;  3GMI A;  1LVF A;  1S94 A;  3K8P C;  1LKX A;  2Y8D A;  3BQK A;  3NZP A;  3P7I A;  3AVS A;  4KMC A;  2JPF A;  4X20 E;  3UUL A;  5LGU B;  4PFO A;  2XTL A;  1X79 A;  1SA0 E;  4PJN A;  3RRW A;  3ZC1 A;  3M65 A;  3N2G E;  3J9X 1;  4JLE A;  4DMV A;  3DJB A;  3N9M A;  5LOV E;  2UXN B;  4ZOL E;  2LOP A;  2LT3 A;  3R6N A;  1HX8 A;  3KBT A;  2DCF A;  3QK6 A;  2KIN B;  2W62 A;  1S35 A;  3HKC E;  5L3B B;  5EK3 A;  4DBQ A;  2W63 A;  3L3P A;  5KMG P;  3PUQ A;  5TAO A;  3ZMZ B;  4V1A v;  4IDZ A;  3N2O A;  4L5G A;  5HXC A;  1QUU A;  5LP6 E;  4ZI3 D;  5CA1 E;  1BR2 A;  1Z0P A;  4GOU A;  5IHY A;  1T98 A;  4U72 A;  2BVL A;  4TV9 E;  4IE6 A;  4IIJ E;  5FMN A;  5BMV E;  4O4L E;  3LJC A;  1NWM X;  4XBF B;  3PUR A;  4CI1 B;  1G73 A;  3AVR A;  4PW8 A;  5HXH A;  2M67 A;  3O4X E;  2X9X A;  2WAU A;  2K5B B;  3H3A A;  3QUJ A;  3JC6 C;  4XZC A;  3ZMV B;  3AB3 B;  4GIW A;  3RKO A;  4O4H E;  3HKE E;  4UEL A;  4DO0 A;  2KT9 A;  5LXT E;  2YK0 A;  1YW0 A;  2CE7 A;  1WLX A;  3BQL A;  2NTX A;  1IJ5 A;  2B1E A;  2V7L A;  4EIW A;  2JMK A;  3O9X A;  3UT5 E;  4YHJ A;  1UX5 A;  1YKH B;  2KLQ A;  3ZEF B;  2V7M A;  2KND A;  4QX8 B;  2MYS A;  2V7J A;  2C5I T;  1HG2 A;  4KUM B;  2NW9 A;  5JRE A;  4UXN B;  1FIO A;  2VL8 A;  2WWU A;  5FY1 A;  3RYH E;  2LJL A;  4FJO A;  2X68 A;  2I59 A;  2LSI A;  4M1P A;  3C4W A;  2YU2 A;  1EZ3 A;  1U4Q A;  3BK9 A;  1KNZ A;  4IE4 A;  3LBX B;  2YIN A;  4UVA B;  3MAC A;  3J7Y q;  1B7T A;  3FXD B;  4UF0 A;  2E9X B;  2GK9 A;  5FP3 A;  4L0R A;  3PUG A;  3EDV A;  4X1Y E;  1MNE A;  3NRX A;  3MKD A;  5ADX L;  4NUV A;  2A2F X;  2X9W A;  1YKE B;  3NBX X;  4F6R C;  3AAI A;  3ANW B;  3HI2 A;  5LNK A;  3L09 A;  2BVM A;  3ZJ1 A;  4CI2 B;  4WW0 A;  4I4T E;  3EDU A;  2CLY C;  3TKL B;  2JQQ A;  5EK4 A;  4PK5 A;  4H63 H;  5DJQ C;  2CLY B;  3I9W A;  4PK6 A;  5EZY E;  1Y64 B;  4HE8 A;  4HEA A;  5JDQ A;  4IE7 A;  2VKD A;  3LK2 B;  5FY0 A;  1BR0 A;  1HTJ F;  4TUY E;  1HG5 A;  3PDY A;  2PFV A;  4HN9 A;  5L3E B;  4H9R C;  1WRD A;  4TZ4 C;  4HKA A;  5F3J A;  1HS7 A;  1MIW A;  2IC9 A;  3SOL A;  2LSY A;  2UXX B;  3IF8 B;  3MK7 C;  5LG4 A;  4MHC A;  2KMF A;  4OFZ A;  2Y48 B;  4TN7 B;  2BZB A;  2DWK A;  2DNX A;  3LBX A;  5EK2 A;  3LK3 B;  2CXF A;  2NW8 A;  4ERR A;  3OYX A;  2KWH A;  2X0L B;  4J2C A;  4ISS A;  2JMH A;  3E08 A;  5GON E;  1UX4 A;  2XHE B;  4CXW A;  1VOM A;  2K48 A;  4QXH B;  5HWX A;  5HXE A;  4O4I E;  4H9N C;  3UFE A;  4UF0 B;  2CWY A;  3N9N A;  5LGN B;  1HF8 A;  2NP9 A;  3ZMU B;  1MMD A;  3SWH A;  1MMG A;  5JDN A;  3IBP A;  5JR9 C;  4PFP A;  4IST A;  3C51 A;  4P0A A;  2XUE A;  3KBU A;  4AI6 A;  3RRC A;  4GYR A;  3ZJ2 A;  4PJJ A;  5E0O A;  3OJA A;  4ZS2 A;  4EAH A;  1QSD A;  4G2A A;  5J1G A;  2CM0 A;  3N9P A;  2XAH B;  3N5L A;  5F8P A;  5J2T E;  3N2K E;  4BA9 A;  5DQW A;  3C64 A;  2P9B A;  3C98 B;  4EYY R;  3GN5 B;  2Y6X A;  3PUA A;  4H9P C;  4PJM A;  4DND A;  2MTQ A;  3HKB E;  2MOZ A;  4H63 V;  3K3O A;  2W0G A;  4QXC B;  2L9Q A;  2VKO A;  5FXX A;  3FBZ A;  4BJM A;  5HXS A;  2VK9 A;  5FY7 A;  4C91 A;  3RYI E;  4AQG A;  4O8S A;  1IJ6 A;  2VAS A;  3I0Q A;  2E9X C;  3LG7 A;  3PUS A;  3WAJ A;  1G8X A;  4X1K E;  4AXP A;  4AQF A;  5CA0 E;  1WYC A;  3NZQ A;  4EB6 E;  1D1A A;  1VRB A;  3ONX A;  3JC6 D;  4A56 A;  3KV5 A;  4KBM B;  3ZN0 B;  3ETV A;  3I0O A;  2CMR A;  2ZM0 A;  5J2U E;  2D5U A;  2LHN A;  5LGT B;  3KV6 A;  3CQX C;  4UV8 B;  4U74 A;  4YLH A;  2X67 A;  3FBL A;  3ESL A;  3F2E A;  2XQY A;  5JDH A;  5JDL A;  3PU3 A;  2ZM2 A;  5L3G B;  4ZI3 C;  5LHG B;  4H9S E;  2LEH A;  4N78 D;  3ZPO A;  5JDM A;  3ZMT B;  2YU1 A;  4H9O C;  3MJX A;  2DHR A;  3U3I A;  2LOS A;  3C4X A;  4MBQ A;  2IW5 B;  4TV8 E;  5L2L A;  3R84 B;  5LBQ B;  3ZC0 A;  2J1D G;  1LVK A;  3SS1 A;  4Z8X A;  2CXD A;  3RC3 A;  1WR6 A;  4CQI A;  3ZYL A;  5FXW A;  5JR9 A;  2CA5 A;  4AKG A;  5JRC B;  4EZH A;  4ILU A;  1ZKE A;  3ZYM A;  1OWA A;  3P8C D;  3V5S A;  3HA4 A;  4PNI A;  4DVD A;  4CXX A;  4BJN A;  3V5U A;  2Q9Q C;  2WSS V;  1US7 B;  3CX8 B;  4UVC B;  2ZLY A;  1V9D A;  5C8Y E;  3C4Z A;  3CQG B;  3T8O A;  2CEA A;  2Q9Q A;  2W61 A;  3DTO A;  2WMN A;  4UIG A;  3ZCJ A;  2LM9 A;  5LHH B;  4AKL A;  3I1A A;  4EXT A;  5A1L A;  2H7O A;  2C5K T;  2ODV A;  2LHR A;  2LSG A;  3PE0 A;  4OYJ A;  2X9H A;  4WBN E;  4C90 A;  5LJM A;  4E7S A;  2QA7 A;  2K9A A;  3VHL A;  3MA9 A;  2QGS A;  3QC9 A;  2DWG A;  4HGA A;  4CI3 B;  3F31 A;  3PTR B;  2NTY A;  2WM9 A;  2CWO A;  3Q5W A;  4P09 A;  2V26 A;  1IAP A;  3GN5 A;  4IE0 A;  4I50 E;  4CXY A;  4YFS A;  4AQF C;  1D0X A;  5LCY A;  2D0U A;  3AAA B;  5JH7 E;  2ACX A;  2NOX A;  1U5P A;  3H37 A;  3UUX B;  2D2S A;  4MAL A;  5FNV E;  3K3Q C;  5H6Q B;  5KDM C;  5FYM A;  2XAF B;  3KIN B;  4KP3 C;  3CPZ A;  1YD8 G;  2E9X A;  2N9D A;  3O1J A;  5DAB A;  3KDS E;  4UVB B;  4QXB B;  3RYC E;  4EYU A;  3O1I A;  3B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...