3CQXC

Chaperone complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
81
structure length
81
Chain Sequence
b'ESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 33
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqxC00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
2W00A 5IYZE 2VKJA 5IWAT 1JNRA 1NEKA 4QXHB 4LF9T 2RP4A 4DV4T 3ZSSA 2WWUA 1V9DA 2X67A 4OFZA 4AKLA 1IBLT 4JI6T 1MIVA 4CN6A 1HNWT 4HFEA 5AQLB 2RA1A 4WBNE 3PE0A 4PJJA 3I9WA 1YKHB 2X0HA 3RYCE 2AE9A 4X65T 2PJQA 2BKPA 2ODUA 4DR7T 1D1CA 2VKDA 4O4JE 4YTNA 2LRKA 2YDSA 1QUUA 2XY8B 1FMVA 1UURA 5F8PA 2KLQA 1J5ET 2LKGA 4JI8T 3ZC0A 4ISSA 3ETUA 1OWAA 3GN5A 3M3ZB 3OYZA 4M1PA 3FBLA 3ZEFB 1I6ZA 2ZM0A 4BJMA 4EZHA 2LHRA 4AKRB 2E9XD 4QH1A 5JTGA 2UXDT 3ONJA 2XJ7A 3DJBA 4ANJA 1HNXT 2X68A 4K0UA 4UV8B 2VK9A 4TX5A 1WRDA 1H7CA 4AKIA 4HEAA 2DHRA 2WY2A 3TLWA 1FMWA 2XTLA 4EAHA 1FJGT 3AA6B 4HFHA 3LG7A 3OTOT 3VU7H 4GYRA 3VRBA 4IDPA 2BG9B 3PUWF 3C51A 1B7TA 2IDOB 5DQVA 4DNDA 4GK0E 5BMVE 3ZMSB 4EEDA 4P0AA 4IE0A 3E22E 1HNZT 1YQ4A 4U31A 3KVAA 3K1SA 4COFA 3QB5K 2XAHB 4O2BE 2ES0A 4U2YA 4DV5T 4AQYT 4OX9T 1LRZA 3ZYKA 2QYWA 3IF8B 2IC6A 5L3CB 4MALA 2FJDA 4ZZCA 5JDLA 5AQPB 4HWFA 1VOMA 2W4XA 2VL8A 5L4HA 2KWHA 2NTYA 1D0ZA 3LDQB 3QOFA 2X9WA 4JI0T 5LHIB 1JNZA 2Q9QD 3P4PA 2NWBA 2WU5A 1I94T 5HWXA 1O3XA 5HCMA 3UU4A 2DCFA 5AQKB 2V8SV 2E9XC 4HWCA 5L3EB 1OEDE 2J4GA 3CK6A 2W0GA 1MNDA 2ZMAA 3AECA 4C91A 1UX5A 4UR9A 1IBMT 3K3OA 3NKZA 3P7IA 5J2UE 3Q5EA 4WYVA 2JMKA 2H3RA 2I59A 2P9BA 2H88A 4JI2T 4UVAB 2F4VT 4TV8E 5CB4E 4NUUA 3HKCE 3Q2MA 5LOVE 4AQFA 5BR8T 4TNVA 3OKQA 1HTJF 3N9OA 2MOZA 3L39A 5ETWA 3PV0F 4YFSA 3ZJ1A 4PFPA 2HN1A 4AQFC 1HR0T 5FNVE 2FBWA 2LSIA 2LEHA 2ZM8A 3U3IA 3WAJA 4U72A 3N2OA 2UXBT 4F6RC 1M62A 5AQTB 4LMLA 4ASKA 2WU2A 3PURA 3CVRA 3ZT5A 2IIUA 4GIWA 2X9YA 2LLYA 2KZ7B 2YOEA 4O4HE 2VB6A 4NPPA 4GYSA 4DV1T 4EV6A 2PFVA 2ACXA 3PU8A 3FHNA 4HWIB 3VKHA 3A8YC 2XQ8A 5JDGA 3ONLC 4LFAT 2WSSV 3RQWA 3RYHE 4DV3T 4JLEA 4YHJA 3J9X1 2Q9QC 5CGMA 2CPTA 2BBJA 3CPZA 3ZT7A 2V6YA 3CMLA 2CLYB 2N9DA 2WCAA 2CEAA 1M7KA 2WB5A 1MNEA 2ODVA 3N5LA 3KBUA 4JUYA 3P4RA 2YU2A 3LSVA 3FZHB 3AA1B 3PUZF 4DV0T 1XNRT 2VASA 4FJOA 3EUHA 1W0BA 4CN1A 2WP9A 4N78D 5CA1E 1VCTA 4ZEYA 1UX4A 4AI6A 2J62A 2KMFA 5KX5E 3HKDE 3HKBE 3N9QA 3G06A 4EYUA 2MBGA 1YXRA 5HXSA 3A5XA 2E9XB 5CA0E 2A72A 3ZSTA 4QXCB 2PBIA 4P1NA 4MHCA 3SFEA 1T8BA 2LT3A 1XDOA 4AQGA 2WMNA 4QH4A 5AQJB 4ISTA 4Q25A 2WS3A 4QHOA 3RLFF 2I0MA 3C4ZA 3OPCA 4CXWA 5IHYA 3UU8A 4U2ZA 2D2SA 2RPAA 4B6XA 2NTXA 2X9HA 3ZLIA 5LGUB 5E0OA 3I9YA 3RH3A 2CHOA 3E08A 3ZN0B 2IC9A 5F3JA 3B13A 3AVRA 3FBZA 2BS2A 4DUYT 2YU1A 2UU9T 2XQAA 4MFRA 5FVLA 4IDOA 1KK7A 1SHZC 1MMDA 4O4LE 4B3MT 3EI0A 2LM9A 3H3MA 2WM9A 3UUMA 3T1YT 3CWZB 4U7YA 3TLVA 3EDVA 2QA7A 1BR2A 5AQOB 4DO0A 1W0AA 3B57A 1OEDC 3ZYLA 5JVDE 2FJAA 4IDQA 4Z91A 1ZEEA 1MIWA 4IHJE 5HEUA 2Q9QB 1Z8UA 2NOXA 4Z8XA 1EZ3A 5GONE 3KV9A 5L3BB 3BQIA 4EGWA 4UV9B 2MYSA 2V7KA 2YN6A 3S4UA 3OVUA 4UF0A 3EVYA 5HXHA 5L3FB 2VL0A 4UEMA 4G2AA 4UELA 3JAEA 5JRCA 1S35A 2WMOA 3UU6A 4IIJE 3SRZA 3UFEA 3K8PC 3ZMVB 2D0UA 2CBJA 2CRBA 2VKOA 2WZIA 3I1AA 2N2NA 5LHHB 1N32T 4PJMA 1IJ6A 2Z6EA 3DTOA 2WAUA 3KINB 4HN9A 4LFCT 2A3DA 4O8SA 3QK6A 3QNUA 1E2AA 3V5UA 4YHHT 3FZKB 3LFMA 3JAFA 3GWHA 4CI1B 3E0ZA 3RYIE 2LSKA 2E5VA 4YJ2E 3NVOA 3PUSA 4JI1T 1D1AA 3O1HA 4KX6A 2BVLA 2E2AA 2KINB 4KHPT 3HR0A 1VRBA 3TKLB 2CBIA 4TV9E 3AXJA 1J5WA 1ZV4X 3RF1A 4JV5T 4EB6E 2QRXA 2Y6XA 2IAKA 1T72A 4H9OC 4QXBB 3ZC1A 2K3WA 4QH5A 2E5LT 2YEVC 4HWHA 4ZI3C 3MACA 4I55E 2UUCT 2CE7A 3NRXA 3PUXF 3RRCA 2LOPA 2IMLA 4PJLA 2AXDS 4UVCB 2W61A 3P4SA 4O4IE 5JDNA 2XASB 4YLHA 4LF4T 3KDSE 4DV6T 2XZEA 1L0VA 3O9XA 3PU3A 3PTRB 2X9XA 1E1HB 2CWOA 2JRKA 1OEDB 2FJBA 1QLBA 5LCYA 5LMUT 3O1JA 4LF7T 2VVSA 4B3ST 2A9UA 2MPKA 3AEGA 2M67A 1OXZA 4DMWA 1IAPA 4X1YE 5JR9A 1QSDA 5FL0A 3AE6A 2IW5B 3ANWA 4PK6A 1J1JA 1DU2A 3KFWX 3RX6A 2MAWA 5LMNT 5HCJA 3SS1A 5FY7A 3A7MA 4ZS2A 4B3RT 3SWHA 2EHOA 4IDNA 2XAJB 1YD8G 5EZYE 4DR1T 2V6XA 2ACZA 3RI5A 4U74A 2NW7A 3ABVA 2EHOC 1HS7A 2IUBA 3I0OA 3JC6C 3JCFA 4HFVA 2LSYA 3D0TA 3EABA 4EOZB 5LGNB 3ZT6A 2E8IA 3CIRA 5JQGE 2BKOA 4IDZA 1KNRA 1MMAA 3AA0B 1FIOA 1U4QA 4I50E 2K24A 3W15B 2LSJA 2LJLA 2D0TA 3UT5E 4XBFB 1US7B 2DI4A 2FUPA 3DP7A 5LHGB 5HEGA 4MBQA 1HF8A 5LJMA 5FXVA 5AQHB 5F5WA 4BAYB 5HEHA 3NZQA 1XWMA 4IE5A 3EHZA 4KMCA 3FB2A 3QB5A 1Y64B 2H7OA 4DVDA 2W2UA 1SUMB 3CX6B 4NXNT 4ZI2C 3AE5A 3PDYA 4B3TT 3ZPOA 2NW9A 2JMHA 3AEBA 2BBHA 5HYAA 1UUSA 3CQGB 4X66T 4ERRA 5JDHA 2X0LB 1KNZA 2B1EA 4TNWA 1ZOYA 1MMGA 2W62A 3FXEB 3N9NA 4ZOLE 4PAGA 4YJ3E 3GN5B 3N9PA 5JH7E 2JQHA 3PUGA 3UFGA 4HGAA 5LP6E 3RGLA 2OA5A 3PUVF 4HWDA 2VVNA 4AISA 4V1Av 3UUBA 4H9PC 1S94A 3RC8A 4U3CA 2C5KT 3RYFE 3KV6A 2XQ7A 5DQWA 1X79A 4EEBA 3PUQA 4X5TA 2MTQA 2NR4A 2CCQA 3IEEA 1AJ3A 5LJNA 2K48A 5FKYA 5LXTE 2HHHT 1D0YA 3IA3A 3CKDA 2KWIB 5HWYA 3L09A 3FZMB 4O2AE 2XUEA 1N36T 3MK7C 2WWVA 5FMNA 5EK2A 3AE4A 2DNXA 2W63A 2LOSA 5HXRA 2JIWA 3C4XA 3PJAA 2JJ9A 2M6BA 2BVMA 4DUZT 3NWIA 4Z90A 5DJQC 2X51A 5ABFA 4PW8A 1BR4A 1SE7A 1NWMX 3U78A 1NAFA 2YINA 4DR6T 1GQEA 4DMVA 4U7IA 4IE7A 3AEFA 4IREA 3Q5XA 4X20E 4OK0A 3L3PA 2CXFA 4QKNA 3UQ4A 1MMNA 1HX1B 3RQUA 3C50A 4DR4T 2LRLA 5FXZA 4WZXA 2BZBA 5LYJE 2WZHA 2FJEA 5FXWA 2L3LA 5KXJA 3RC3A 3Q9DA 1WR6A 5LGTB 3CQCB 4ZHQE 2H89A 5ABHA 1G8XA 3B5MA 3UUNA 2C5IT 2XQ5A 1HG5A 1IJ5A 3KV4A 3WAKA 4KP3C 3RHWA 4HFIA 2BS4A 5C2TA 2UUBT 2HN2A 3PUAA 3TLUA 5ABGA 4IT4A 4CXXA 3HL6A 3ZMUB 4FI5A 3LK3B 2KSRA 2VWAA 1WYCA 4TWFA 4NIQA 1W09A 2XM2A 4EIWA 1XMQT 4ZI3D 4LMKA 4TN7B 2V7IA 3VKGA 4YY3T 2V6YB 4DV2T 4HFCA 4TWDA 2VQFT 5L3GB 5JDMA 4A98A 3BQKA 4AXPA 3AE7A 3AEAA 4CQIA 2GK9A 2CA5A 3VR9A 3IBPA 2WQYA 2BG9A 3PUYF 4IE6A 1MIYA 2CXLA 4P0BA 2XAGB 1WYBA 2HPLA 3EDUA 5ADXL 1U5PA 3ZYMA 3UQ7A 3O1IA 4IL9A 5DABA 4NUVA 3NZPA 4ILBA 3MXZA 4E7ZA 1G73A 4H9RC 2DLRA 4PK5A 4U33A 3ZMTB 4EZ4A 5AQQB 2Y48B 2C0SA 3CQXC 1T98A 3F57A 3AE2A 5J2TE 2JPFA 4AKGA 5L47A 1HCIA 3C98B 5J1GA 5AFUL 2OV9A 2EHOD 3AVSA 5J0ZA 3FZFB 5C8YE 4I43B 5AQFB 3JC6D 3T1HT 2XQYA 3N2KE 3P50A 4ADZA 4HTEA 3V5SA 3AAEB 5AQIB 4LFBT 1XZYA 5LG4A 4E7SA 2W66A 4OYJA 4HE8A 3I0QA 4JI7T 2WBLA 3IHRA 2UXXB 2L8KA 5L3DB 1HX8A 3RPUA 2CWYA 2V7LA 2W67A 2G0UA 2UXCT 5LBMA 4KBMB 3JADA 4IL4A 3NRYA 2UUAT 2XQ4A 4XAXB 1W9RA 4EXTA 1WR0A 2QVAA 5HAXA 5KDMC 4HFBA 4IGUA 5AQSB 3T8OA 2XM1A 4ZI2D 4I4TE 3ZN1B 3ETVA 5JR9C 2PG8A 3R84B 4LMJA 4UF0B 2OLTA 5FL1A 4UXNB 2K5BB 2HPJA 2BS3A 1WLXA 3AE3A 3AAIA 5JRCB 1LKXA 4A56A 3FZLB 2J1DG 4PNIA 4KI0F 3AE1A 4WNKA 2JQ9A 4AIUA 4EYYR 4X1KE 2DL1A 3PJAJ 2PTFA 2NP9A 1KEYA 3ZCIA 3BQLA 4DR5T 4DBRA 2K9AA 5AQVB 3AAAB 4LF6T 2CLYC 5KMGP 3N2GE 2YKSA 1ZHCA 3P4WA 1R8IA 2B76A 2R6GF 3MA9A 2JQKA 2J47A 1IZNB 1CHUA 3AEEA 3QC9A 2XHEB 4PJNA 2WDVA 4L0RA 1D1BA 3HKEE 4JI3T 4CI2B 5AQNB 3UUXB 2VKHA 5A1LA 4DIDB 2VQET 3EAMA 4A5XA 2E9XA 2NW8A 4I0UA 4C90A 2CM0A 4WW0A 3GMIA 3AE9A 3AXJB 4CI3B 2IHR1 3RRWA 1X9BA 3X1DA 2XAFB 3L8RA 4AKHA 2VURA 1ZP0A 2ZM6T 3J7Yq 3F31A 5CFBA 3AA7B 3RKOA 3TLSA 5HEJA 1N34T 2L9QA 4PK4A 3KVBA 1YKEB 4WBOA 4QWNB 4CXYA 3LBXA 4PFOA 2XSAA 3VHLA 4CZZB 3K3QC 4A97A 3AB3B 5CJ5A 1VCSA 5LNKA 2A2FX 5FY0A 3CX7B 2BG9E 3Q5DA 4JEUB 3P4QA 2V7MA 4XZCA 5FYMA 4K0KT 3QUJA 3P8CD 4YSYA 2X66A 5JR9B 2N1GA 4GKJT 2LHNA 3ANWB 3UU5A 4H9NC 2I6HA 1XDPA 1N33T 5AQRB 2LSGA 2D9DA 5FVKA 5HXCA 5JREA 4BJNA 4DBQA 3ZMZB 3H3AA 2Q9QA 3KV5A 3RKGA 1Y01A 3AEDA 2V5CA 3OBVE 3LK42 2XQ6A 4H63H 3ZCJA 5IUXA 2EHOB 4ZS3A 1UGOA 4JI5T 4JYAT 2HH7A 2WDRA 5L4EA 2CMRA 3OYXA 2XQ9A 3SFDA 3NBXX 3C4WA 3R6NA 1XNQT 2X0YA 1ZKEA 4TUYE 1KF6A 2XAQB 3C64A 3GA8A 5EK4A 3SOLA 5LB7B 4NXMT 4X1IE 5H6QB 2CHNA 2M6IA 4KUMB 5AQUB 3H37A 4YT0A 5ABEA 4ZI7E 5LBQB 2H7VC 3N9LA 4H9QC 5L2LA 4F8HA 4J2CA 4YTPA 3ESLA 3TLTA 4ILCA 4HFDA 4L9IA 3MZKB 1FEWA 1WCRA 4KHZF 2V5DA 3OJAA 3CX8B 5FP3A 2UXNB 4JI4T 2BKNA 4ZZBA 1UK5A 4ILUA 2YK0A 5LG3A 4ZXLA 2KXPB 4JEHB 4BA9A 1BR0A 2DWKA 4ILAA 4X64T 2D5UA 1Z0PA 5FXXA 1LVKA 2V1DB 1HG2A 4HKAA 3ZJ2A 4DV7T 4IE4A 2XPKA 5LA6E 3LBXB 5C3JA 3RIFA 5HEOA 2ZM2A 2YDQA 3N9MA 2JQQA 2WDQA 3ONXA 3M65A 4CN4A 4YSXA 1CUNA 2C5JA 4QX8B 2SPCA 4H63V 2CXDA 1NENA 1LVFA 2YDRA 1OEDA 5M4YA 4L5GA 5AQMB 3MKDA 5AQGB 5H6RB 2V7JA 4G63A 3VR8A 4YTMA 3RIUA 4H9SE 2QGSA 2XSBA 3UTKA 3KBTA 1SA0E 3VRAA 2DWGA 3RIUC 1BR1A 1YQ3A 4TWHA 4OYKA 3AE8A 4X62T 3O4XE 1E7PA 5TAOA 2KT9A 4DR3T 3K3NA 3BK9A 3LK2B 4GOUA 5EK3A 1KNPA 1D0XA 3HA4A 3Q5WA 3RIAA 1HFAA 1UCUA 1KFYA 4UVBB 4QX7B 4LF8T 4TZ4C 1YW0A 4UIGA 4JBWF 2LKHA 2LM2A 4OHFA 4P09A 3FXDB 3ZKRA 2ZLYA 2BG9C 3MJXA 3LJCA 2Y8DA 4YXDA 5JDQA 1T7SA 2XQ3A 5ABFB 4MLKA 3UU3A 1IBKT 3UULA 4GK5E 3WI3A 1WFDA 2V26A 2LE8A 2KNDA 4GKKT 2BDEA 5HXEA 3F2EA 5JDFA 3HI2A 5FY1A 4DR2T 4LF5T 4YSZA 1XMOT
chains in the Genus database with same CATH topology
5DQWA 2W00A 2D2SA 1X79A 2VKJA 4WNKA 5IYZE 4B6XA 2NTXA 2X9HA 4EYYR 4X1KE 3ZLIA 4QXHB 3PUQA 2NP9A 5LGUB 2RP4A 5E0OA 2MTQA 2WWUA 3I9YA 3RH3A 2CCQA 1V9DA 3IEEA 2X67A 3E08A 4OFZA 3BQLA 3ZCIA 3ZN0B 2IC9A 1MIVA 4AKLA 4DBRA 1AJ3A 2K9AA 5LJNA 2K48A 3AAAB 5F3JA 4WBNE 2RA1A 3PE0A 5LXTE 3B13A 1D0YA 2CLYC 3I9WA 4PJJA 1YKHB 3AVRA 5KMGP 3N2GE 3FBZA 3RYCE 3CKDA 2KWIB 5HWYA 3L09A 1ZHCA 2YU1A 4MFRA 4O2AE 2XUEA 3MK7C 1KK7A 3MA9A 2PJQA 1SHZC 1MMDA 4O4LE 5FMNA 1IZNB 2LM9A 2ODUA 5EK2A 2WM9A 3UUMA 3QC9A 2XHEB 3CWZB 4PJNA 3EDVA 1D1CA 2QA7A 2DNXA 4L0RA 2W63A 1D1BA 2LOSA 2VKDA 3HKEE 1BR2A 4O4JE 4CI2B 4DO0A 5HXRA 3B57A 3ZYLA 5JVDE 3UUXB 2VKHA 1ZEEA 1MIWA 1QUUA 5A1LA 3C4XA 4IHJE 1FMVA 2E9XA 2NW8A 5F8PA 2Q9QB 4C90A 2CM0A 4WW0A 3GMIA 2KLQA 2NOXA 4Z8XA 2JJ9A 1EZ3A 5GONE 4CI3B 2BVMA 3RRWA 3KV9A 5L3BB 3BQIA 4UV9B 3ZC0A 4ISSA 2MYSA 3ETUA 5DJQC 1OWAA 2V7KA 3GN5A 3S4UA 2X51A 3OYZA 4PW8A 2XAFB 1BR4A 4M1PA 4AKHA 3FBLA 4UF0A 3ZEFB 3EVYA 5HXHA 2ZM0A 5L3FB 1NWMX 4BJMA 3J7Yq 3F31A 4UEMA 4G2AA 4UELA 3U78A 3AA7B 5JRCA 4EZHA 1NAFA 2LHRA 3RKOA 4AKRB 2YINA 2L9QA 1S35A 2E9XD 2WMOA 4PK4A 4IIJE 3KVBA 3SRZA 3UFEA 1YKEB 3K8PC 3ZMVB 4DMVA 4WBOA 2D0UA 2VKOA 4IE7A 4QWNB 3DJBA 3Q5XA 4ANJA 4CXYA 4X20E 2X68A 4OK0A 3L3PA 3I1AA 4K0UA 2CXFA 3LBXA 2N2NA 4PFOA 4QKNA 3VHLA 5LHHB 4UV8B 4CZZB 3K3QC 1MMNA 4PJMA 2VK9A 3C50A 1IJ6A 2Z6EA 3DTOA 4TX5A 1WRDA 1H7CA 3AB3B 4AKIA 4HEAA 2WAUA 2DHRA 3KINB 5FXZA 4HN9A 5LNKA 2A2FX 2BZBA 5LYJE 2A3DA 1FMWA 2XTLA 5FXWA 2L3LA 5FY0A 4O8SA 4EAHA 3QK6A 3CX7B 4JEUB 2V7MA 3AA6B 4XZCA 3V5UA 3LG7A 3VU7H 3LFMA 4GYRA 5FYMA 3GWHA 3RC3A 4CI1B 3E0ZA 3QUJA 3P8CD 3RYIE 2LSKA 2X66A 3C51A 1B7TA 3Q9DA 4YJ2E 5JR9B 5DQVA 4DNDA 2N1GA 4GK0E 1WR6A 5BMVE 3ZMSB 2LHNA 3ANWB 5LGTB 3CQCB 3PUSA 4H9NC 4P0AA 4ZHQE 2LSGA 4IE0A 1D1AA 1G8XA 3O1HA 3E22E 2BVLA 3UUNA 2C5IT 5HXCA 2KINB 5JREA 1HG5A 3KVAA 3HR0A 1IJ5A 1VRBA 3KV4A 2XAHB 3WAKA 4BJNA 4DBQA 3H3AA 4KP3C 3TKLB 3ZMZB 4O2BE 2ES0A 2Q9QA 3KV5A 4TV9E 3OBVE 1ZV4X 3LK42 1LRZA 3ZYKA 3PUAA 4H63H 3IF8B 4EB6E 3ZCJA 2IC6A 5L3CB 4MALA 2EHOB 4ZS3A 2Y6XA 2IAKA 4QXBB 4H9OC 3ZC1A 2HH7A 4CXXA 5JDLA 3HL6A 1VOMA 2VL8A 3ZMUB 4FI5A 2CMRA 2YEVC 3OYXA 2KWHA 4ZI3C 3MACA 2NTYA 1D0ZA 3C4WA 3NBXX 4I55E 2CE7A 3R6NA 2X9WA 3LK3B 3NRXA 5LHIB 1ZKEA 2Q9QD 3RRCA 2LOPA 1WYCA 2VWAA 4TUYE 2XAQB 4PJLA 2NWBA 3C64A 3GA8A 5EK4A 5HWXA 1O3XA 3SOLA 4UVCB 2W61A 4O4IE 4X1IE 4EIWA 5JDNA 2DCFA 5H6QB 2XASB 4ZI3D 2E9XC 4YLHA 5L3EB 4TN7B 3KDSE 4KUMB 3O9XA 3PU3A 3H37A 2V7IA 4ZI7E 3PTRB 5LBQB 2H7VC 2W0GA 2X9XA 3VKGA 1MNDA 1E1HB 2ZMAA 3N9LA 2CWOA 4C91A 2JRKA 1UX5A 4H9QC 5L2LA 5LCYA 3K3OA 4J2CA 3O1JA 3ESLA 5L3GB 5JDMA 3P7IA 5J2UE 2JMKA 2H3RA 3BQKA 2M67A 4AXPA 1OXZA 2I59A 2P9BA 4DMWA 4CQIA 1IAPA 2GK9A 4UVAB 2CA5A 4X1YE 3IBPA 4L9IA 4TV8E 5CB4E 3MZKB 1MIYA 4IE6A 4NUUA 1FEWA 2CXLA 3HKCE 3Q2MA 5JR9A 4P0BA 2XAGB 1QSDA 1WYBA 5LOVE 4AQFA 2IW5B 3ANWA 4PK6A 2HPLA 3OJAA 3EDUA 3OKQA 5ADXL 1U5PA 1HTJF 3ZYMA 3CX8B 5FP3A 2UXNB 3N9OA 3KFWX 2MOZA 5ETWA 3RX6A 3O1IA 4YFSA 3ZJ1A 4PFPA 4AQFC 5DABA 4NUVA 3NZPA 5FNVE 3SS1A 4ILUA 2ZM8A 2LSIA 2LEHA 2YK0A 3U3IA 5FY7A 2KXPB 4JEHB 4BA9A 4U72A 3N2OA 4ZS2A 3WAJA 1BR0A 2DWKA 4F6RC 3MXZA 2D5UA 3SWHA 2EHOA 4E7ZA 1G73A 2XAJB 1YD8G 3PURA 1Z0PA 3CVRA 5EZYE 5FXXA 4ASKA 1LVKA 4H9RC 2V1DB 4GIWA 2X9YA 2DLRA 4PK5A 3ZMTB 2KZ7B 1HG2A 4HKAA 4EZ4A 3ZJ2A 4O4HE 2VB6A 4GYSA 4U74A 2NW7A 2PFVA 2ACXA 2Y48B 2EHOC 2C0SA 3CQXC 1T98A 3F57A 3LBXB 3PU8A 4IE4A 5LA6E 1HS7A 3FHNA 3I0OA 3VKHA 3JC6C 5J2TE 2JPFA 4AKGA 1HCIA 2ZM2A 5JDGA 3N9MA 2JQQA 4HFVA 3C98B 5J1GA 2LSYA 3D0TA 2WSSV 3RYHE 5AFUL 4EOZB 3ONXA 5LGNB 3M65A 2EHOD 4JLEA 4YHJA 3J9X1 2Q9QC 1CUNA 3AVSA 5JQGE 2C5JA 2E8IA 4QX8B 4IDZA 5C8YE 2SPCA 4I43B 1MMAA 3JC6D 3AA0B 4H63V 2XQYA 3CPZA 2CXDA 1FIOA 3N2KE 1LVFA 1U4QA 4ADZA 4I50E 2K24A 4HTEA 3V5SA 4L5GA 3W15B 5M4YA 3CMLA 2CLYB 3MKDA 2N9DA 5H6RB 3AAEB 2V7JA 4G63A 2CEAA 2LSJA 1MNEA 2LJLA 2ODVA 3N5LA 2D0TA 3KBUA 4JUYA 2YU2A 3UT5E 4XBFB 4H9SE 5LG4A 3AA1B 1US7B 2DI4A 3DP7A 4E7SA 5LHGB 4MBQA 1HF8A 5LJMA 5FXVA 2QGSA 2VASA 4OYJA 4FJOA 3EUHA 4HE8A 3I0QA 3UTKA 4BAYB 2WBLA 3KBTA 1SA0E 2UXXB 2DWGA 3IHRA 3NZQA 4N78D 2L8KA 4IE5A 1BR1A 5CA1E 1UX4A 5L3DB 4KMCA 4AI6A 4OYKA 1HX8A 3FB2A 2KMFA 1Y64B 5KX5E 2H7OA 3HKDE 3HKBE 3O4XE 3RPUA 4DVDA 2CWYA 2V7LA 5TAOA 2G0UA 2KT9A 3K3NA 3CX6B 5LBMA 3BK9A 4KBMB 4ZI2C 3PDYA 3N9QA 3LK2B 3NRYA 4GOUA 3ZPOA 5EK3A 4EYUA 2MBGA 1D0XA 4XAXB 3HA4A 3Q5WA 2JMHA 2NW9A 1HFAA 4EXTA 1UCUA 5HAXA 4UVBB 5HYAA 4QX7B 5KDMC 3CQGB 5HXSA 3A5XA 4ERRA 4IGUA 2E9XB 3T8OA 5CA0E 4ZI2D 4I4TE 4TZ4C 5JDHA 1YW0A 2A72A 2X0LB 1KNZA 4QXCB 2PBIA 4UIGA 2B1EA 3RYFE 3ZN1B 1MMGA 4OHFA 3ETVA 2W62A 3FXEB 4MHCA 4P09A 3N9NA 4ZOLE 3FXDB 2ZLYA 4PAGA 4YJ3E 3MJXA 2LT3A 3LJCA 5JR9C 2Y8DA 3GN5B 5JDQA 2PG8A 3R84B 3N9PA 4MLKA 5JH7E 3UULA 4UF0B 4AQGA 4UXNB 3PUGA 4GK5E 2K5BB 4HGAA 3WI3A 2HPJA 1WLXA 2V26A 2LE8A 2KNDA 2WMNA 5LP6E 3AAIA 2OA5A 2BDEA 5HXEA 4ISTA 5JRCB 3F2EA 5JDFA 3HI2A 4V1Av 4QHOA 5FY1A 1LKXA 3C4ZA 4H9PC 4A56A 2J1DG 1S94A 4CXWA 3RC8A 5IHYA 2C5KT 3KV6A 4PNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 2W00 A;  5IYZ E;  2VKJ A;  5IWA T;  1JNR A;  1NEK A;  4QXH B;  4LF9 T;  2RP4 A;  4DV4 T;  3ZSS A;  2WWU A;  1V9D A;  2X67 A;  4OFZ A;  4AKL A;  1IBL T;  4JI6 T;  1MIV A;  4CN6 A;  1HNW T;  4HFE A;  5AQL B;  2RA1 A;  4WBN E;  3PE0 A;  4PJJ A;  3I9W A;  1YKH B;  2X0H A;  3RYC E;  2AE9 A;  4X65 T;  2PJQ A;  2BKP A;  2ODU A;  4DR7 T;  1D1C A;  2VKD A;  4O4J E;  4YTN A;  2LRK A;  2YDS A;  1QUU A;  2XY8 B;  1FMV A;  1UUR A;  5F8P A;  2KLQ A;  1J5E T;  2LKG A;  4JI8 T;  3ZC0 A;  4ISS A;  3ETU A;  1OWA A;  3GN5 A;  3M3Z B;  3OYZ A;  4M1P A;  3FBL A;  3ZEF B;  1I6Z A;  2ZM0 A;  4BJM A;  4EZH A;  2LHR A;  4AKR B;  2E9X D;  4QH1 A;  5JTG A;  2UXD T;  3ONJ A;  2XJ7 A;  3DJB A;  4ANJ A;  1HNX T;  2X68 A;  4K0U A;  4UV8 B;  2VK9 A;  4TX5 A;  1WRD A;  1H7C A;  4AKI A;  4HEA A;  2DHR A;  2WY2 A;  3TLW A;  1FMW A;  2XTL A;  4EAH A;  1FJG T;  3AA6 B;  4HFH A;  3LG7 A;  3OTO T;  3VU7 H;  4GYR A;  3VRB A;  4IDP A;  2BG9 B;  3PUW F;  3C51 A;  1B7T A;  2IDO B;  5DQV A;  4DND A;  4GK0 E;  5BMV E;  3ZMS B;  4EED A;  4P0A A;  4IE0 A;  3E22 E;  1HNZ T;  1YQ4 A;  4U31 A;  3KVA A;  3K1S A;  4COF A;  3QB5 K;  2XAH B;  4O2B E;  2ES0 A;  4U2Y A;  4DV5 T;  4AQY T;  4OX9 T;  1LRZ A;  3ZYK A;  2QYW A;  3IF8 B;  2IC6 A;  5L3C B;  4MAL A;  2FJD A;  4ZZC A;  5JDL A;  5AQP B;  4HWF A;  1VOM A;  2W4X A;  2VL8 A;  5L4H A;  2KWH A;  2NTY A;  1D0Z A;  3LDQ B;  3QOF A;  2X9W A;  4JI0 T;  5LHI B;  1JNZ A;  2Q9Q D;  3P4P A;  2NWB A;  2WU5 A;  1I94 T;  5HWX A;  1O3X A;  5HCM A;  3UU4 A;  2DCF A;  5AQK B;  2V8S V;  2E9X C;  4HWC A;  5L3E B;  1OED E;  2J4G A;  3CK6 A;  2W0G A;  1MND A;  2ZMA A;  3AEC A;  4C91 A;  1UX5 A;  4UR9 A;  1IBM T;  3K3O A;  3NKZ A;  3P7I A;  5J2U E;  3Q5E A;  4WYV A;  2JMK A;  2H3R A;  2I59 A;  2P9B A;  2H88 A;  4JI2 T;  4UVA B;  2F4V T;  4TV8 E;  5CB4 E;  4NUU A;  3HKC E;  3Q2M A;  5LOV E;  4AQF A;  5BR8 T;  4TNV A;  3OKQ A;  1HTJ F;  3N9O A;  2MOZ A;  3L39 A;  5ETW A;  3PV0 F;  4YFS A;  3ZJ1 A;  4PFP A;  2HN1 A;  4AQF C;  1HR0 T;  5FNV E;  2FBW A;  2LSI A;  2LEH A;  2ZM8 A;  3U3I A;  3WAJ A;  4U72 A;  3N2O A;  2UXB T;  4F6R C;  1M62 A;  5AQT B;  4LML A;  4ASK A;  2WU2 A;  3PUR A;  3CVR A;  3ZT5 A;  2IIU A;  4GIW A;  2X9Y A;  2LLY A;  2KZ7 B;  2YOE A;  4O4H E;  2VB6 A;  4NPP A;  4GYS A;  4DV1 T;  4EV6 A;  2PFV A;  2ACX A;  3PU8 A;  3FHN A;  4HWI B;  3VKH A;  3A8Y C;  2XQ8 A;  5JDG A;  3ONL C;  4LFA T;  2WSS V;  3RQW A;  3RYH E;  4DV3 T;  4JLE A;  4YHJ A;  3J9X 1;  2Q9Q C;  5CGM A;  2CPT A;  2BBJ A;  3CPZ A;  3ZT7 A;  2V6Y A;  3CML A;  2CLY B;  2N9D A;  2WCA A;  2CEA A;  1M7K A;  2WB5 A;  1MNE A;  2ODV A;  3N5L A;  3KBU A;  4JUY A;  3P4R A;  2YU2 A;  3LSV A;  3FZH B;  3AA1 B;  3PUZ F;  4DV0 T;  1XNR T;  2VAS A;  4FJO A;  3EUH A;  1W0B A;  4CN1 A;  2WP9 A;  4N78 D;  5CA1 E;  1VCT A;  4ZEY A;  1UX4 A;  4AI6 A;  2J62 A;  2KMF A;  5KX5 E;  3HKD E;  3HKB E;  3N9Q A;  3G06 A;  4EYU A;  2MBG A;  1YXR A;  5HXS A;  3A5X A;  2E9X B;  5CA0 E;  2A72 A;  3ZST A;  4QXC B;  2PBI A;  4P1N A;  4MHC A;  3SFE A;  1T8B A;  2LT3 A;  1XDO A;  4AQG A;  2WMN A;  4QH4 A;  5AQJ B;  4IST A;  4Q25 A;  2WS3 A;  4QHO A;  3RLF F;  2I0M A;  3C4Z A;  3OPC A;  4CXW A;  5IHY A;  3UU8 A;  4U2Z A;  2D2S A;  2RPA A;  4B6X A;  2NTX A;  2X9H A;  3ZLI A;  5LGU B;  5E0O A;  3I9Y A;  3RH3 A;  2CHO A;  3E08 A;  3ZN0 B;  2IC9 A;  5F3J A;  3B13 A;  3AVR A;  3FBZ A;  2BS2 A;  4DUY T;  2YU1 A;  2UU9 T;  2XQA A;  4MFR A;  5FVL A;  4IDO A;  1KK7 A;  1SHZ C;  1MMD A;  4O4L E;  4B3M T;  3EI0 A;  2LM9 A;  3H3M A;  2WM9 A;  3UUM A;  3T1Y T;  3CWZ B;  4U7Y A;  3TLV A;  3EDV A;  2QA7 A;  1BR2 A;  5AQO B;  4DO0 A;  1W0A A;  3B57 A;  1OED C;  3ZYL A;  5JVD E;  2FJA A;  4IDQ A;  4Z91 A;  1ZEE A;  1MIW A;  4IHJ E;  5HEU A;  2Q9Q B;  1Z8U A;  2NOX A;  4Z8X A;  1EZ3 A;  5GON E;  3KV9 A;  5L3B B;  3BQI A;  4EGW A;  4UV9 B;  2MYS A;  2V7K A;  2YN6 A;  3S4U A;  3OVU A;  4UF0 A;  3EVY A;  5HXH A;  5L3F B;  2VL0 A;  4UEM A;  4G2A A;  4UEL A;  3JAE A;  5JRC A;  1S35 A;  2WMO A;  3UU6 A;  4IIJ E;  3SRZ A;  3UFE A;  3K8P C;  3ZMV B;  2D0U A;  2CBJ A;  2CRB A;  2VKO A;  2WZI A;  3I1A A;  2N2N A;  5LHH B;  1N32 T;  4PJM A;  1IJ6 A;  2Z6E A;  3DTO A;  2WAU A;  3KIN B;  4HN9 A;  4LFC T;  2A3D A;  4O8S A;  3QK6 A;  3QNU A;  1E2A A;  3V5U A;  4YHH T;  3FZK B;  3LFM A;  3JAF A;  3GWH A;  4CI1 B;  3E0Z A;  3RYI E;  2LSK A;  2E5V A;  4YJ2 E;  3NVO A;  3PUS A;  4JI1 T;  1D1A A;  3O1H A;  4KX6 A;  2BVL A;  2E2A A;  2KIN B;  4KHP T;  3HR0 A;  1VRB A;  3TKL B;  2CBI A;  4TV9 E;  3AXJ A;  1J5W A;  1ZV4 X;  3RF1 A;  4JV5 T;  4EB6 E;  2QRX A;  2Y6X A;  2IAK A;  1T72 A;  4H9O C;  4QXB B;  3ZC1 A;  2K3W A;  4QH5 A;  2E5L T;  2YEV C;  4HWH A;  4ZI3 C;  3MAC A;  4I55 E;  2UUC T;  2CE7 A;  3NRX A;  3PUX F;  3RRC A;  2LOP A;  2IML A;  4PJL A;  2AXD S;  4UVC B;  2W61 A;  3P4S A;  4O4I E;  5JDN A;  2XAS B;  4YLH A;  4LF4 T;  3KDS E;  4DV6 T;  2XZE A;  1L0V A;  3O9X A;  3PU3 A;  3PTR B;  2X9X A;  1E1H B;  2CWO A;  2JRK A;  1OED B;  2FJB A;  1QLB A;  5LCY A;  5LMU T;  3O1J A;  4LF7 T;  2VVS A;  4B3S T;  2A9U A;  2MPK A;  3AEG A;  2M67 A;  1OXZ A;  4DMW A;  1IAP A;  4X1Y E;  5JR9 A;  1QSD A;  5FL0 A;  3AE6 A;  2IW5 B;  3ANW A;  4PK6 A;  1J1J A;  1DU2 A;  3KFW X;  3RX6 A;  2MAW A;  5LMN T;  5HCJ A;  3SS1 A;  5FY7 A;  3A7M A;  4ZS2 A;  4B3R T;  3SWH A;  2EHO A;  4IDN A;  2XAJ B;  1YD8 G;  5EZY E;  4DR1 T;  2V6X A;  2ACZ A;  3RI5 A;  4U74 A;  2NW7 A;  3ABV A;  2EHO C;  1HS7 A;  2IUB A;  3I0O A;  3JC6 C;  3JCF A;  4HFV A;  2LSY A;  3D0T A;  3EAB A;  4EOZ B;  5LGN B;  3ZT6 A;  2E8I A;  3CIR A;  5JQG E;  2BKO A;  4IDZ A;  1KNR A;  1MMA A;  3AA0 B;  1FIO A;  1U4Q A;  4I50 E;  2K24 A;  3W15 B;  2LSJ A;  2LJL A;  2D0T A;  3UT5 E;  4XBF B;  1US7 B;  2DI4 A;  2FUP A;  3DP7 A;  5LHG B;  5HEG A;  4MBQ A;  1HF8 A;  5LJM A;  5FXV A;  5AQH B;  5F5W A;  4BAY B;  5HEH A;  3NZQ A;  1XWM A;  4IE5 A;  3EHZ A;  4KMC A;  3FB2 A;  3QB5 A;  1Y64 B;  2H7O A;  4DVD A;  2W2U A;  1SUM B;  3CX6 B;  4NXN T;  4ZI2 C;  3AE5 A;  3PDY A;  4B3T T;  3ZPO A;  2NW9 A;  2JMH A;  3AEB A;  2BBH A;  5HYA A;  1UUS A;  3CQG B;  4X66 T;  4ERR A;  5JDH A;  2X0L B;  1KNZ A;  2B1E A;  4TNW A;  1ZOY A;  1MMG A;  2W62 A;  3FXE B;  3N9N A;  4ZOL E;  4PAG A;  4YJ3 E;  3GN5 B;  3N9P A;  5JH7 E;  2JQH A;  3PUG A;  3UFG A;  4HGA A;  5LP6 E;  3RGL A;  2OA5 A;  3PUV F;  4HWD A;  2VVN A;  4AIS A;  4V1A v;  3UUB A;  4H9P C;  1S94 A;  3RC8 A;  4U3C A;  2C5K T;  3RYF E;  3KV6 A;  2XQ7 A;  5DQW A;  1X79 A;  4EEB A;  3PUQ A;  4X5T A;  2MTQ A;  2NR4 A;  2CCQ A;  3IEE A;  1AJ3 A;  5LJN A;  2K48 A;  5FKY A;  5LXT E;  2HHH T;  1D0Y A;  3IA3 A;  3CKD A;  2KWI B;  5HWY A;  3L09 A;  3FZM B;  4O2A E;  2XUE A;  1N36 T;  3MK7 C;  2WWV A;  5FMN A;  5EK2 A;  3AE4 A;  2DNX A;  2W63 A;  2LOS A;  5HXR A;  2JIW A;  3C4X A;  3PJA A;  2JJ9 A;  2M6B A;  2BVM A;  4DUZ T;  3NWI A;  4Z90 A;  5DJQ C;  2X51 A;  5ABF A;  4PW8 A;  1BR4 A;  1SE7 A;  1NWM X;  3U78 A;  1NAF A;  2YIN A;  4DR6 T;  1GQE A;  4DMV A;  4U7I A;  4IE7 A;  3AEF A;  4IRE A;  3Q5X A;  4X20 E;  4OK0 A;  3L3P A;  2CXF A;  4QKN A;  3UQ4 A;  1MMN A;  1HX1 B;  3RQU A;  3C50 A;  4DR4 T;  2LRL A;  5FXZ A;  4WZX A;  2BZB A;  5LYJ E;  2WZH A;  2FJE A;  5FXW A;  2L3L A;  5KXJ A;  3RC3 A;  3Q9D A;  1WR6 A;  5LGT B;  3CQC B;  4ZHQ E;  2H89 A;  5ABH A;  1G8X A;  3B5M A;  3UUN A;  2C5I T;  2XQ5 A;  1HG5 A;  1IJ5 A;  3KV4 A;  3WAK A;  4KP3 C;  3RHW A;  4HFI A;  2BS4 A;  5C2T A;  2UUB T;  2HN2 A;  3PUA A;  3TLU A;  5ABG A;  4IT4 A;  4CXX A;  3HL6 A;  3ZMU B;  4FI5 A;  3LK3 B;  2KSR A;  2VWA A;  1WYC A;  4TWF A;  4NIQ A;  1W09 A;  2XM2 A;  4EIW A;  1XMQ T;  4ZI3 D;  4LMK A;  4TN7 B;  2V7I A;  3VKG A;  4YY3 T;  2V6Y B;  4DV2 T;  4HFC A;  4TWD A;  2VQF T;  5L3G B;  5JDM A;  4A98 A;  3BQK A;  4AXP A;  3AE7 A;  3AEA A;  4CQI A;  2GK9 A;  2CA5 A;  3VR9 A;  3IBP A;  2WQY A;  2BG9 A;  3PUY F;  4IE6 A;  1MIY A;  2CXL A;  4P0B A;  2XAG B;  1WYB A;  2HPL A;  3EDU A;  5ADX L;  1U5P A;  3ZYM A;  3UQ7 A;  3O1I A;  4IL9 A;  5DAB A;  4NUV A;  3NZP A;  4ILB A;  3MXZ A;  4E7Z A;  1G73 A;  4H9R C;  2DLR A;  4PK5 A;  4U33 A;  3ZMT B;  4EZ4 A;  5AQQ B;  2Y48 B;  2C0S A;  3CQX C;  1T98 A;  3F57 A;  3AE2 A;  5J2T E;  2JPF A;  4AKG A;  5L47 A;  1HCI A;  3C98 B;  5J1G A;  5AFU L;  2OV9 A;  2EHO D;  3AVS A;  5J0Z A;  3FZF B;  5C8Y E;  4I43 B;  5AQF B;  3JC6 D;  3T1H T;  2XQY A;  3N2K E;  3P50 A;  4ADZ A;  4HTE A;  3V5S A;  3AAE B;  5AQI B;  4LFB T;  1XZY A;  5LG4 A;  4E7S A;  2W66 A;  4OYJ A;  4HE8 A;  3I0Q A;  4JI7 T;  2WBL A;  3IHR A;  2UXX B;  2L8K A;  5L3D B;  1HX8 A;  3RPU A;  2CWY A;  2V7L A;  2W67 A;  2G0U A;  2UXC T;  5LBM A;  4KBM B;  3JAD A;  4IL4 A;  3NRY A;  2UUA T;  2XQ4 A;  4XAX B;  1W9R A;  4EXT A;  1WR0 A;  2QVA A;  5HAX A;  5KDM C;  4HFB A;  4IGU A;  5AQS B;  3T8O A;  2XM1 A;  4ZI2 D;  4I4T E;  3ZN1 B;  3ETV A;  5JR9 C;  2PG8 A;  3R84 B;  4LMJ A;  4UF0 B;  2OLT A;  5FL1 A;  4UXN B;  2K5B B;  2HPJ A;  2BS3 A;  1WLX A;  3AE3 A;  3AAI A;  5JRC B;  1LKX A;  4A56 A;  3FZL B;  2J1D G;  4PNI A;  4KI0 F;  3AE1 A;  4WNK A;  2JQ9 A;  4AIU A;  4EYY R;  4X1K E;  2DL1 A;  3PJA J;  2PTF A;  2NP9 A;  1KEY A;  3ZCI A;  3BQL A;  4DR5 T;  4DBR A;  2K9A A;  5AQV B;  3AAA B;  4LF6 T;  2CLY C;  5KMG P;  3N2G E;  2YKS A;  1ZHC A;  3P4W A;  1R8I A;  2B76 A;  2R6G F;  3MA9 A;  2JQK A;  2J47 A;  1IZN B;  1CHU A;  3AEE A;  3QC9 A;  2XHE B;  4PJN A;  2WDV A;  4L0R A;  1D1B A;  3HKE E;  4JI3 T;  4CI2 B;  5AQN B;  3UUX B;  2VKH A;  5A1L A;  4DID B;  2VQE T;  3EAM A;  4A5X A;  2E9X A;  2NW8 A;  4I0U A;  4C90 A;  2CM0 A;  4WW0 A;  3GMI A;  3AE9 A;  3AXJ B;  4CI3 B;  2IHR 1;  3RRW A;  1X9B A;  3X1D A;  2XAF B;  3L8R A;  4AKH A;  2VUR A;  1ZP0 A;  2ZM6 T;  3J7Y q;  3F31 A;  5CFB A;  3AA7 B;  3RKO A;  3TLS A;  5HEJ A;  1N34 T;  2L9Q A;  4PK4 A;  3KVB A;  1YKE B;  4WBO A;  4QWN B;  4CXY A;  3LBX A;  4PFO A;  2XSA A;  3VHL A;  4CZZ B;  3K3Q C;  4A97 A;  3AB3 B;  5CJ5 A;  1VCS A;  5LNK A;  2A2F X;  5FY0 A;  3CX7 B;  2BG9 E;  3Q5D A;  4JEU B;  3P4Q A;  2V7M A;  4XZC A;  5FYM A;  4K0K T;  3QUJ A;  3P8C D;  4YSY A;  2X66 A;  5JR9 B;  2N1G A;  4GKJ T;  2LHN A;  3ANW B;  3UU5 A;  4H9N C;  2I6H A;  1XDP A;  1N33 T;  5AQR B;  2LSG A;  2D9D A;  5FVK A;  5HXC A;  5JRE A;  4BJN A;  4DBQ A;  3ZMZ B;  3H3A A;  2Q9Q A;  3KV5 A;  3RKG A;  1Y01 A;  3AED A;  2V5C A;  3OBV E;  3LK4 2;  2XQ6 A;  4H63 H;  3ZCJ A;  5IUX A;  2EHO B;  4ZS3 A;  1UGO A;  4JI5 T;  4JYA T;  2HH7 A;  2WDR A;  5L4E A;  2CMR A;  3OYX A;  2XQ9 A;  3SFD A;  3NBX X;  3C4W A;  3R6N A;  1XNQ T;  2X0Y A;  1ZKE A;  4TUY E;  1KF6 A;  2XAQ B;  3C64 A;  3GA8 A;  5EK4 A;  3SOL A;  5LB7 B;  4NXM T;  4X1I E;  5H6Q B;  2CHN A;  2M6I A;  4KUM B;  5AQU B;  3H37 A;  4YT0 A;  5ABE A;  4ZI7 E;  5LBQ B;  2H7V C;  3N9L A;  4H9Q C;  5L2L A;  4F8H A;  4J2C A;  4YTP A;  3ESL A;  3TLT A;  4ILC A;  4HFD A;  4L9I A;  3MZK B;  1FEW A;  1WCR A;  4KHZ F;  2V5D A;  3OJA A;  3CX8 B;  5FP3 A;  2UXN B;  4JI4 T;  2BKN A;  4ZZB A;  1UK5 A;  4ILU A;  2YK0 A;  5LG3 A;  4ZXL A;  2KXP B;  4JEH B;  4BA9 A;  1BR0 A;  2DWK A;  4ILA A;  4X64 T;  2D5U A;  1Z0P A;  5FXX A;  1LVK A;  2V1D B;  1HG2 A;  4HKA A;  3ZJ2 A;  4DV7 T;  4IE4 A;  2XPK A;  5LA6 E;  3LBX B;  5C3J A;  3RIF A;  5HEO A;  2ZM2 A;  2YDQ A;  3N9M A;  2JQQ A;  2WDQ A;  3ONX A;  3M65 A;  4CN4 A;  4YSX A;  1CUN A;  2C5J A;  4QX8 B;  2SPC A;  4H63 V;  2CXD A;  1NEN A;  1LVF A;  2YDR A;  1OED A;  5M4Y A;  4L5G A;  5AQM B;  3MKD A;  5AQG B;  5H6R B;  2V7J A;  4G63 A;  3VR8 A;  4YTM A;  3RIU A;  4H9S E;  2QGS A;  2XSB A;  3UTK A;  3KBT A;  1SA0 E;  3VRA A;  2DWG A;  3RIU C;  1BR1 A;  1YQ3 A;  4TWH A;  4OYK A;  3AE8 A;  4X62 T;  3O4X E;  1E7P A;  5TAO A;  2KT9 A;  4DR3 T;  3K3N A;  3BK9 A;  3LK2 B;  4GOU A;  5EK3 A;  1KNP A;  1D0X A;  3HA4 A;  3Q5W A;  3RIA A;  1HFA A;  1UCU A;  1KFY A;  4UVB B;  4QX7 B;  4LF8 T;  4TZ4 C;  1YW0 A;  4UIG A;  4JBW F;  2LKH A;  2LM2 A;  4OHF A;  4P09 A;  3FXD B;  3ZKR A;  2ZLY A;  2BG9 C;  3MJX A;  3LJC A;  2Y8D A;  4YXD A;  5JDQ A;  1T7S A;  2XQ3 A;  5ABF B;  4MLK A;  3UU3 A;  1IBK T;  3UUL A;  4GK5 E;  3WI3 A;  1WFD A;  2V26 A;  2LE8 A;  2KND A;  4GKK T;  2BDE A;  5HXE A;  3F2E A;  5JDF A;  3HI2 A;  5FY1 A;  4DR2 T;  4LF5 T;  4YSZ A;  1XMO T; 
#chains in the Genus database with same CATH homology
 5DQW A;  2W00 A;  2D2S A;  1X79 A;  2VKJ A;  4WNK A;  5IYZ E;  4B6X A;  2NTX A;  2X9H A;  4EYY R;  4X1K E;  3ZLI A;  4QXH B;  3PUQ A;  2NP9 A;  5LGU B;  2RP4 A;  5E0O A;  2MTQ A;  2WWU A;  3I9Y A;  3RH3 A;  2CCQ A;  1V9D A;  3IEE A;  2X67 A;  3E08 A;  4OFZ A;  3BQL A;  3ZCI A;  3ZN0 B;  2IC9 A;  1MIV A;  4AKL A;  4DBR A;  1AJ3 A;  2K9A A;  5LJN A;  2K48 A;  3AAA B;  5F3J A;  4WBN E;  2RA1 A;  3PE0 A;  5LXT E;  3B13 A;  1D0Y A;  2CLY C;  3I9W A;  4PJJ A;  1YKH B;  3AVR A;  5KMG P;  3N2G E;  3FBZ A;  3RYC E;  3CKD A;  2KWI B;  5HWY A;  3L09 A;  1ZHC A;  2YU1 A;  4MFR A;  4O2A E;  2XUE A;  3MK7 C;  1KK7 A;  3MA9 A;  2PJQ A;  1SHZ C;  1MMD A;  4O4L E;  5FMN A;  1IZN B;  2LM9 A;  2ODU A;  5EK2 A;  2WM9 A;  3UUM A;  3QC9 A;  2XHE B;  3CWZ B;  4PJN A;  3EDV A;  1D1C A;  2QA7 A;  2DNX A;  4L0R A;  2W63 A;  1D1B A;  2LOS A;  2VKD A;  3HKE E;  1BR2 A;  4O4J E;  4CI2 B;  4DO0 A;  5HXR A;  3B57 A;  3ZYL A;  5JVD E;  3UUX B;  2VKH A;  1ZEE A;  1MIW A;  1QUU A;  5A1L A;  3C4X A;  4IHJ E;  1FMV A;  2E9X A;  2NW8 A;  5F8P A;  2Q9Q B;  4C90 A;  2CM0 A;  4WW0 A;  3GMI A;  2KLQ A;  2NOX A;  4Z8X A;  2JJ9 A;  1EZ3 A;  5GON E;  4CI3 B;  2BVM A;  3RRW A;  3KV9 A;  5L3B B;  3BQI A;  4UV9 B;  3ZC0 A;  4ISS A;  2MYS A;  3ETU A;  5DJQ C;  1OWA A;  2V7K A;  3GN5 A;  3S4U A;  2X51 A;  3OYZ A;  4PW8 A;  2XAF B;  1BR4 A;  4M1P A;  4AKH A;  3FBL A;  4UF0 A;  3ZEF B;  3EVY A;  5HXH A;  2ZM0 A;  5L3F B;  1NWM X;  4BJM A;  3J7Y q;  3F31 A;  4UEM A;  4G2A A;  4UEL A;  3U78 A;  3AA7 B;  5JRC A;  4EZH A;  1NAF A;  2LHR A;  3RKO A;  4AKR B;  2YIN A;  2L9Q A;  1S35 A;  2E9X D;  2WMO A;  4PK4 A;  4IIJ E;  3KVB A;  3SRZ A;  3UFE A;  1YKE B;  3K8P C;  3ZMV B;  4DMV A;  4WBO A;  2D0U A;  2VKO A;  4IE7 A;  4QWN B;  3DJB A;  3Q5X A;  4ANJ A;  4CXY A;  4X20 E;  2X68 A;  4OK0 A;  3L3P A;  3I1A A;  4K0U A;  2CXF A;  3LBX A;  2N2N A;  4PFO A;  4QKN A;  3VHL A;  5LHH B;  4UV8 B;  4CZZ B;  3K3Q C;  1MMN A;  4PJM A;  2VK9 A;  3C50 A;  1IJ6 A;  2Z6E A;  3DTO A;  4TX5 A;  1WRD A;  1H7C A;  3AB3 B;  4AKI A;  4HEA A;  2WAU A;  2DHR A;  3KIN B;  5FXZ A;  4HN9 A;  5LNK A;  2A2F X;  2BZB A;  5LYJ E;  2A3D A;  1FMW A;  2XTL A;  5FXW A;  2L3L A;  5FY0 A;  4O8S A;  4EAH A;  3QK6 A;  3CX7 B;  4JEU B;  2V7M A;  3AA6 B;  4XZC A;  3V5U A;  3LG7 A;  3VU7 H;  3LFM A;  4GYR A;  5FYM A;  3GWH A;  3RC3 A;  4CI1 B;  3E0Z A;  3QUJ A;  3P8C D;  3RYI E;  2LSK A;  2X66 A;  3C51 A;  1B7T A;  3Q9D A;  4YJ2 E;  5JR9 B;  5DQV A;  4DND A;  2N1G A;  4GK0 E;  1WR6 A;  5BMV E;  3ZMS B;  2LHN A;  3ANW B;  5LGT B;  3CQC B;  3PUS A;  4H9N C;  4P0A A;  4ZHQ E;  2LSG A;  4IE0 A;  1D1A A;  1G8X A;  3O1H A;  3E22 E;  2BVL A;  3UUN A;  2C5I T;  5HXC A;  2KIN B;  5JRE A;  1HG5 A;  3KVA A;  3HR0 A;  1IJ5 A;  1VRB A;  3KV4 A;  2XAH B;  3WAK A;  4BJN A;  4DBQ A;  3H3A A;  4KP3 C;  3TKL B;  3ZMZ B;  4O2B E;  2ES0 A;  2Q9Q A;  3KV5 A;  4TV9 E;  3OBV E;  1ZV4 X;  3LK4 2;  1LRZ A;  3ZYK A;  3PUA A;  4H63 H;  3IF8 B;  4EB6 E;  3ZCJ A;  2IC6 A;  5L3C B;  4MAL A;  2EHO B;  4ZS3 A;  2Y6X A;  2IAK A;  4QXB B;  4H9O C;  3ZC1 A;  2HH7 A;  4CXX A;  5JDL A;  3HL6 A;  1VOM A;  2VL8 A;  3ZMU B;  4FI5 A;  2CMR A;  2YEV C;  3OYX A;  2KWH A;  4ZI3 C;  3MAC A;  2NTY A;  1D0Z A;  3C4W A;  3NBX X;  4I55 E;  2CE7 A;  3R6N A;  2X9W A;  3LK3 B;  3NRX A;  5LHI B;  1ZKE A;  2Q9Q D;  3RRC A;  2LOP A;  1WYC A;  2VWA A;  4TUY E;  2XAQ B;  4PJL A;  2NWB A;  3C64 A;  3GA8 A;  5EK4 A;  5HWX A;  1O3X A;  3SOL A;  4UVC B;  2W61 A;  4O4I E;  4X1I E;  4EIW A;  5JDN A;  2DCF A;  5H6Q B;  2XAS B;  4ZI3 D;  2E9X C;  4YLH A;  5L3E B;  4TN7 B;  3KDS E;  4KUM B;  3O9X A;  3PU3 A;  3H37 A;  2V7I A;  4ZI7 E;  3PTR B;  5LBQ B;  2H7V C;  2W0G A;  2X9X A;  3VKG A;  1MND A;  1E1H B;  2ZMA A;  3N9L A;  2CWO A;  4C91 A;  2JRK A;  1UX5 A;  4H9Q C;  5L2L A;  5LCY A;  3K3O A;  4J2C A;  3O1J A;  3ESL A;  5L3G B;  5JDM A;  3P7I A;  5J2U E;  2JMK A;  2H3R A;  3BQK A;  2M67 A;  4AXP A;  1OXZ A;  2I59 A;  2P9B A;  4DMW A;  4CQI A;  1IAP A;  2GK9 A;  4UVA B;  2CA5 A;  4X1Y E;  3IBP A;  4L9I A;  4TV8 E;  5CB4 E;  3MZK B;  1MIY A;  4IE6 A;  4NUU A;  1FEW A;  2CXL A;  3HKC E;  3Q2M A;  5JR9 A;  4P0B A;  2XAG B;  1QSD A;  1WYB A;  5LOV E;  4AQF A;  2IW5 B;  3ANW A;  4PK6 A;  2HPL A;  3OJA A;  3EDU A;  3OKQ A;  5ADX L;  1U5P A;  1HTJ F;  3ZYM A;  3CX8 B;  5FP3 A;  2UXN B;  3N9O A;  3KFW X;  2MOZ A;  5ETW A;  3RX6 A;  3O1I A;  4YFS A;  3ZJ1 A;  4PFP A;  4AQF C;  5DAB A;  4NUV A;  3NZP A;  5FNV E;  3SS1 A;  4ILU A;  2ZM8 A;  2LSI A;  2LEH A;  2YK0 A;  3U3I A;  5FY7 A;  2KXP B;  4JEH B;  4BA9 A;  4U72 A;  3N2O A;  4ZS2 A;  3WAJ A;  1BR0 A;  2DWK A;  4F6R C;  3MXZ A;  2D5U A;  3SWH A;  2EHO A;  4E7Z A;  1G73 A;  2XAJ B;  1YD8 G;  3PUR A;  1Z0P A;  3CVR A;  5EZY E;  5FXX A;  4ASK A;  1LVK A;  4H9R C;  2V1D B;  4GIW A;  2X9Y A;  2DLR A;  4PK5 A;  3ZMT B;  2KZ7 B;  1HG2 A;  4HKA A;  4EZ4 A;  3ZJ2 A;  4O4H E;  2VB6 A;  4GYS A;  4U74 A;  2NW7 A;  2PFV A;  2ACX A;  2Y48 B;  2EHO C;  2C0S A;  3CQX C;  1T98 A;  3F57 A;  3LBX B;  3PU8 A;  4IE4 A;  5LA6 E;  1HS7 A;  3FHN A;  3I0O A;  3VKH A;  3JC6 C;  5J2T E;  2JPF A;  4AKG A;  1HCI A;  2ZM2 A;  5JDG A;  3N9M A;  2JQQ A;  4HFV A;  3C98 B;  5J1G A;  2LSY A;  3D0T A;  2WSS V;  3RYH E;  5AFU L;  4EOZ B;  3ONX A;  5LGN B;  3M65 A;  2EHO D;  4JLE A;  4YHJ A;  3J9X 1;  2Q9Q C;  1CUN A;  3AVS A;  5JQG E;  2C5J A;  2E8I A;  4QX8 B;  4IDZ A;  5C8Y E;  2SPC A;  4I43 B;  1MMA A;  3JC6 D;  3AA0 B;  4H63 V;  2XQY A;  3CPZ A;  2CXD A;  1FIO A;  3N2K E;  1LVF A;  1U4Q A;  4ADZ A;  4I50 E;  2K24 A;  4HTE A;  3V5S A;  4L5G A;  3W15 B;  5M4Y A;  3CML A;  2CLY B;  3MKD A;  2N9D A;  5H6R B;  3AAE B;  2V7J A;  4G63 A;  2CEA A;  2LSJ A;  1MNE A;  2LJL A;  2ODV A;  3N5L A;  2D0T A;  3KBU A;  4JUY A;  2YU2 A;  3UT5 E;  4XBF B;  4H9S E;  5LG4 A;  3AA1 B;  1US7 B;  2DI4 A;  3DP7 A;  4E7S A;  5LHG B;  4MBQ A;  1HF8 A;  5LJM A;  5FXV A;  2QGS A;  2VAS A;  4OYJ A;  4FJO A;  3EUH A;  4HE8 A;  3I0Q A;  3UTK A;  4BAY B;  2WBL A;  3KBT A;  1SA0 E;  2UXX B;  2DWG A;  3IHR A;  3NZQ A;  4N78 D;  2L8K A;  4IE5 A;  1BR1 A;  5CA1 E;  1UX4 A;  5L3D B;  4KMC A;  4AI6 A;  4OYK A;  1HX8 A;  3FB2 A;  2KMF A;  1Y64 B;  5KX5 E;  2H7O A;  3HKD E;  3HKB E;  3O4X E;  3RPU A;  4DVD A;  2CWY A;  2V7L A;  5TAO A;  2G0U A;  2KT9 A;  3K3N A;  3CX6 B;  5LBM A;  3BK9 A;  4KBM B;  4ZI2 C;  3PDY A;  3N9Q A;  3LK2 B;  3NRY A;  4GOU A;  3ZPO A;  5EK3 A;  4EYU A;  2MBG A;  1D0X A;  4XAX B;  3HA4 A;  3Q5W A;  2JMH A;  2NW9 A;  1HFA A;  4EXT A;  1UCU A;  5HAX A;  4UVB B;  5HYA A;  4QX7 B;  5KDM C;  3CQG B;  5HXS A;  3A5X A;  4ERR A;  4IGU A;  2E9X B;  3T8O A;  5CA0 E;  4ZI2 D;  4I4T E;  4TZ4 C;  5JDH A;  1YW0 A;  2A72 A;  2X0L B;  1KNZ A;  4QXC B;  2PBI A;  4UIG A;  2B1E A;  3RYF E;  3ZN1 B;  1MMG A;  4OHF A;  3ETV A;  2W62 A;  3FXE B;  4MHC A;  4P09 A;  3N9N A;  4ZOL E;  3FXD B;  2ZLY A;  4PAG A;  4YJ3 E;  3MJX A;  2LT3 A;  3LJC A;  5JR9 C;  2Y8D A;  3GN5 B;  5JDQ A;  2PG8 A;  3R84 B;  3N9P A;  4MLK A;  5JH7 E;  3UUL A;  4UF0 B;  4AQG A;  4UXN B;  3PUG A;  4GK5 E;  2K5B B;  4HGA A;  3WI3 A;  2HPJ A;  1WLX A;  2V26 A;  2LE8 A;  2KND A;  2WMN A;  5LP6 E;  3AAI A;  2OA5 A;  2BDE A;  5HXE A;  4IST A;  5JRC B;  3F2E A;  5JDF A;  3HI2 A;  4V1A v;  4QHO A;  5FY1 A;  1LKX A;  3C4Z A;  4H9P C;  4A56 A;  2J1D G;  1S94 A;  4CXW A;  3RC8 A;  5IHY A;  2C5K T;  3KV6 A;  4PNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...