3CQXC

Chaperone complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
81
structure length
81
Chain Sequence
ESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 33
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqxC00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
4YFSA 2LKHA 4KHZF 5LBMA 2QA7A 2CXDA 2XJ7A 4CQIA 4DUZT 2H7OA 3MK7C 1JNRA 4ZXLA 4FJOA 2HH7A 4QX8B 2E8IA 5ABHA 2BKNA 3GA8A 4TUYE 1OEDC 2GK9A 3UUNA 3PU8A 4ILUA 5LGUB 1DU2A 5AFUL 2YINA 1UURA 3P8CD 2X68A 3ZYMA 4AKHA 3UUBA 2JQHA 2Y48B 2B76A 3RIUC 4B3RT 2H3RA 4UF0A 3AAEB 2K9AA 4CI1B 4H9SE 3ZKRA 2KMFA 5F3JA 3KV6A 2KSRA 4YSYA 2K3WA 5EK4A 4DR1T 4ILCA 1MMDA 2LHRA 3N9OA 3Q5EA 5JDLA 2Y6XA 3UQ7A 3AB3B 3K8PC 2WAUA 2E9XA 3RH3A 4WBOA 3ZYKA 3B13A 4TWHA 4JI8T 4CXXA 1YKHB 5FNVE 1UGOA 5HEGA 2A72A 4QHOA 3PUQA 5CB4E 3QOFA 2X9WA 2LHNA 1IBLT 2C5IT 4LFCT 2WCAA 2N9DA 3CQCB 4MBQA 5JTGA 2WDVA 4GYRA 3H3AA 4WNKA 4BJNA 2XUEA 3UU3A 4DR3T 1ZOYA 2XTLA 1VOMA 1KF6A 5AQFB 2Q9QC 1BR4A 4Z8XA 3U78A 2HN1A 5LHHB 4WBNE 1D1AA 2RPAA 5HCMA 3FZKB 5LJMA 5AQLB 3GMIA 3N2KE 1HS7A 3FZHB 5IUXA 4Z90A 2V8SV 3PUXF 2VQET 3AE9A 2BG9C 2UXXB 1I94T 3RIFA 3KBTA 3EUHA 3P4WA 5LCYA 3CX8B 4UF0B 3OPCA 2YK0A 5LHIB 3T8OA 5LXTE 3OYXA 2FJDA 4AXPA 4GOUA 4X20E 2XQ3A 3QNUA 3ZCIA 5DQVA 5H6QB 1LVFA 4DO0A 1QSDA 5JDHA 3RQUA 4K0UA 4GKJT 3K3OA 1T72A 2CM0A 4LF7T 2KXPB 3UUMA 4HWHA 3PDYA 1UUSA 4EGWA 2XQ5A 2VKDA 1HNXT 1MNDA 3A5XA 2J4GA 3LBXA 1US7B 5J2UE 3PU3A 3FBZA 5DJQC 1HFAA 2C5KT 2IC6A 4HN9A 3C4ZA 2B1EA 4B3TT 2XQ6A 4B3MT 4PJNA 3NWIA 3AEDA 1HG2A 4DUYT 5CFBA 1Z8UA 3PE0A 1BR0A 1NAFA 2XM1A 4DMWA 4XAXB 4QXHB 1WFDA 2X0HA 4PJMA 4IE0A 3UUXB 3RRCA 1WR0A 3PJAA 1HF8A 2X66A 2H88A 2NW7A 5KMGP 3AE4A 2D0UA 4OX9T 4PJJA 4ZS3A 3FXEB 4GKKT 3ZMUB 4CI2B 5FVKA 4OYKA 3AE6A 1SHZC 1YKEB 4OFZA 3MKDA 3PUGA 4JUYA 1D1BA 2J47A 4G2AA 4JBWF 5FL0A 5HEOA 5JR9B 4FI5A 2YEVC 2LRLA 4X64T 1BR2A 2L8KA 3JAFA 2BG9A 2HN2A 3Q5XA 3TKLB 3HI2A 4M1PA 4HFIA 3E22E 2WZHA 2R6GF 4X1KE 3C64A 2DWGA 1N33T 2LOPA 3ZC0A 3JC6C 5L3GB 5CJ5A 4GIWA 2LEHA 2X0YA 3LBXB 4TNVA 3P50A 5FXZA 2XAGB 2K48A 5HXSA 4YHHT 3UU8A 3OVUA 3ETUA 5FVLA 2VKHA 2JJ9A 3AVRA 5HEHA 1T98A 2XAFB 4EOZB 3OJAA 1SE7A 1FEWA 2D2SA 3V5UA 3Q2MA 3J9X1 4LF5T 4DR2T 4LF6T 3RQWA 2WDRA 3CK6A 4LMLA 3GN5B 2CMRA 5E0OA 3F2EA 4PK5A 1HCIA 2JIWA 4X1YE 2UU9T 1U5PA 4UVCB 4DNDA 2IC9A 2ZM8A 2WU5A 3PV0F 2MOZA 2CXLA 3RKOA 4O4JE 2JQKA 3ONLC 3RF1A 4EYUA 2XQYA 3ETVA 4U2YA 2QGSA 4MALA 1LKXA 2LSJA 2NOXA 4U3CA 4K0KT 3SRZA 2UXNB 3K3QC 1HR0T 3MJXA 2D9DA 3L09A 4HTEA 2EHOA 2RA1A 3OTOT 3PUVF 3UU6A 1MMGA 1D0YA 1E2AA 2ACZA 3AA0B 2N2NA 3GWHA 5FXXA 4TNWA 4UEMA 5HAXA 3EAMA 2IUBA 2LE8A 5HCJA 4ISTA 2VL8A 2C5JA 2VVNA 1IAPA 4HGAA 1X79A 2K24A 3Q9DA 5ABEA 5AQUB 4DV6T 5HEJA 4TWDA 3RKGA 2DLRA 4HWCA 4TN7B 3MZKB 4U72A 4BJMA 1QUUA 3FZMB 1S94A 1ZKEA 3ZMZB 4B3ST 5AQKB 4ZI3D 2I59A 3UTKA 5LGTB 1U4QA 3OBVE 2M6BA 3N5LA 2UUAT 5GONE 1KFYA 2G0UA 2UUCT 1W09A 3I1AA 4YTPA 1SA0E 4E7SA 2CCQA 4UV8B 1ZEEA 1R8IA 2UXDT 4CI3B 2W00A 3IHRA 3J7Yq 1HNWT 2XPKA 4H63H 2FJBA 3KINB 5JQGE 2E9XD 3NBXX 4I55E 4AKGA 4Z91A 3EABA 2XASB 4X65T 3AVSA 2XQ9A 1YW0A 1CUNA 3P7IA 2X51A 4H9PC 3ESLA 1FMWA 3ZC1A 4PW8A 4EZ4A 3S4UA 3AE7A 5ADXL 1UX5A 4QXBB 1LRZA 3B5MA 2EHOB 5EZYE 1GQEA 3VR8A 4ISSA 3AAAB 4IIJE 3RX6A 4YJ3E 4KI0F 1MNEA 4IE6A 5LA6E 3ZPOA 3C4WA 4EAHA 2JMKA 4L0RA 1H7CA 4H9NC 5FP3A 4AQFA 1VCSA 3NKZA 2MBGA 3PUWF 4AQYT 4QH4A 4X1IE 4A98A 3Q5WA 3P4RA 1E1HB 3G06A 3N9PA 4X66T 4KUMB 3VRAA 3QUJA 1G73A 3N9QA 4WW0A 4NIQA 1N36T 4NUUA 5LBQB 2C0SA 3N9NA 4IL9A 3RIAA 4PFOA 3I0OA 2BBJA 3TLSA 1D1CA 4HFEA 2VB6A 2JQ9A 4HFHA 1FIOA 4LF8T 2IAKA 3TLTA 3EDUA 2V5CA 5JDMA 2HHHT 4YXDA 4O4IE 2V6XA 3RRWA 5ABFA 1CHUA 2F4VT 4PK4A 1OEDA 2X9HA 2BS3A 4PK6A 4JI2T 3O1IA 1IBMT 3P4SA 2MYSA 2YU2A 2DL1A 5AQJB 2CLYB 2VWAA 3LFMA 3AE3A 4BA9A 4ZHQE 4U2ZA 5LOVE 2W62A 3TLWA 5HXEA 2FUPA 1KNZA 2E2AA 2QVAA 2VASA 4H9OC 3RPUA 2H7VC 2KNDA 5FL1A 3RIUA 3ZT6A 2W2UA 3VHLA 2OV9A 3ZYLA 1MIYA 1XWMA 3KVBA 2FBWA 2E9XB 3M65A 3O1HA 3V5SA 2UUBT 5AQGB 4HEAA 2JQQA 4HWIB 4IE5A 2MTQA 2WDQA 4IE4A 4TZ4C 4EXTA 2UXBT 2M6IA 2XM2A 5JRCA 2ZLYA 3AXJA 4JI0T 4IDOA 5JVDE 3AE1A 4X5TA 4XZCA 3HR0A 4KMCA 5J2TE 5L47A 3PUZF 5AQQB 1MIWA 3KV4A 2IDOB 5H6RB 4GYSA 2Z6EA 3UFGA 2CEAA 3T1HT 4DIDB 3MACA 3SS1A 3ZJ1A 3UU5A 3EVYA 5HEUA 2OLTA 2XQ8A 3AEFA 3FB2A 1S35A 3CVRA 4DR7T 3VU7H 5FKYA 4NXMT 3BQIA 3ZJ2A 1WLXA 4EEDA 1W9RA 4ZI7E 4ZZBA 3EHZA 3WAKA 4U74A 2E5LT 2CHNA 2Q9QA 2ODVA 3LK42 3FZLB 5AQSB 1SUMB 4ZOLE 3UT5E 2HPJA 4DV7T 1N32T 4JEUB 3DP7A 4LFAT 4DR6T 2V7IA 2PBIA 1OEDB 2V6YA 1LVKA 3RC3A 4F8HA 3FXDB 1UK5A 3RYFE 4ZS2A 4YY3T 4AKIA 2VKOA 5JREA 2NW9A 2YDRA 3UU4A 2V7MA 1J5WA 5L3EB 2ZM6T 4TV9E 1HTJF 5FY1A 1NEKA 4DVDA 2JPFA 2V26A 5KX5E 4HKAA 4PJLA 4DMVA 3EDVA 2VL0A 4UVBB 4ZZCA 1KK7A 4LMJA 2W0GA 2D5UA 3C51A 5CA1E 5J1GA 1E7PA 4QXCB 2XAJB 4IHJE 4ZI2C 4GK5E 3L8RA 4MHCA 4TX5A 2W67A 5JDGA 2LJLA 5EK3A 2L9QA 3BK9A 4YLHA 1KNRA 4JI3T 3EI0A 4JI4T 2FJEA 1XMQT 3IBPA 4CXWA 2ACXA 2XQ4A 3R84B 1WYCA 3O1JA 4QH1A 4I0UA 2LSGA 5AQIB 1YQ3A 2ZMAA 4TWFA 2XSAA 1J1JA 4P0AA 3OYZA 3AEEA 3AA7B 3CIRA 3X1DA 5M4YA 2BS2A 3PURA 2QYWA 4KBMB 3ZN0B 1M7KA 2BS4A 2H89A 4WYVA 3ONJA 3AE2A 3KBUA 2CA5A 2IMLA 1NENA 2EHOD 3KV9A 2WU2A 3QK6A 5LG3A 5BR8T 5HXCA 4LF9T 3AEAA 2CE7A 4IDZA 2JRKA 2BZBA 3RYIE 3I0QA 2W63A 5LJNA 4JI6T 4IDPA 2CXFA 1WCRA 2WMOA 4QH5A 5C2TA 2BG9B 3WAJA 1IJ6A 3KFWX 3FZFB 1V9DA 3RC8A 3ABVA 1VRBA 1ZP0A 2JMHA 3RLFF 1HX8A 3C4XA 4DV3T 2VK9A 4HWDA 2X9XA 4NPPA 2KINB 5AQTB 1N34T 4I4TE 3TLUA 1WRDA 4X62T 2CBJA 3JC6D 2DI4A 4OK0A 1OWAA 2J62A 5LYJE 4DBQA 4YSZA 2K5BB 3ZT5A 4CZZB 1XDOA 3Q5DA 2X9YA 3QB5A 3RHWA 3JADA 2DWKA 4UELA 3L3PA 1WYBA 2HPLA 3P4PA 2ODUA 4UIGA 2XAQB 2MAWA 4CXYA 4YTNA 5LG4A 1VCTA 4G63A 3HKEE 1ZV4X 5ABGA 2LKGA 5HWYA 4IT4A 2YKSA 3A7MA 1T7SA 3SOLA 2I0MA 2XZEA 2A9UA 2BG9E 3K3NA 2YN6A 1Y64B 5JR9C 2CBIA 5AQRB 2VQFT 3ZCJA 3AEBA 1M62A 2NW8A 2XQ7A 3BQKA 2XQAA 3IF8B 4PAGA 2XHEB 3LDQB 2CRBA 5IHYA 3AAIA 5L3DB 3KVAA 2YDQA 1D0ZA 4P09A 1XZYA 5AQOB 3HL6A 4KX6A 3HA4A 2W4XA 2KT9A 4DV0T 2DHRA 3OKQA 5F5WA 2AE9A 4DV4T 3ANWA 4O2BE 3CQXC 5LMUT 3PTRB 3CMLA 4DV1T 5L4HA 3AA6B 4YT0A 5JDQA 2VVSA 3QB5K 4TV8E 4DV5T 3PUAA 3ZMTB 2E5VA 4QX7B 4AISA 1QLBA 1FJGT 3PUYF 3VR9A 2SPCA 2J1DG 2WWUA 3F31A 4P1NA 4GK0E 4AIUA 4IL4A 3TLVA 4IGUA 4EV6A 3N2GE 3KV5A 4UR9A 5AQPB 5J0ZA 3PJAJ 1AJ3A 5HYAA 3AA1B 2M67A 4JI7T 4C90A 1KEYA 1IZNB 2A3DA 1XDPA 2DNXA 5LHGB 4B6XA 2NP9A 3D0TA 4JI5T 4ILAA 1IBKT 1KNPA 5L3BB 1MMAA 2NTYA 3SWHA 2LM2A 2WWVA 3ZEFB 2WP9A 1BR1A 5L2LA 4MFRA 2ZM0A 1L0VA 3W15B 3DJBA 2W61A 5HWXA 5AQHB 2WS3A 4EIWA 4DV2T 1HX1B 4J2CA 5FY0A 2V7KA 4I50E 2IHR1 3RYHE 2WBLA 1WR6A 3HKBE 4ERRA 4AQGA 2VURA 1XMOT 1HG5A 5C8YE 5LGNB 1EZ3A 5LNKA 2LOSA 1MMNA 4CN1A 4JI1T 2I6HA 4ADZA 5HXHA 2CWYA 2NTXA 3JCFA 3RGLA 3VKHA 3UULA 5JDNA 3O4XE 2LT3A 2KLQA 4YSXA 2FJAA 5JR9A 3ANWB 3CPZA 5AQVB 5EK2A 4AI6A 1YXRA 3ONXA 1W0AA 2V7JA 3C98B 2LLYA 3F57A 4UV9B 5IYZE 2CHOA 4JEHB 4EYYR 4HFCA 1T8BA 2KZ7B 3MXZA 3AEGA 4O4LE 2BKOA 4HE8A 2Y8DA 4HWFA 1Z0PA 3NVOA 3LK2B 2V5DA 2P9BA 5JDFA 4DBRA 4Q25A 2ES0A 3FBLA 3E08A 1I6ZA 4COFA 4EZHA 3N9LA 5TAOA 3ZMVB 3NRXA 4IREA 3P4QA 4AKRB 4PFPA 4V1Av 4A5XA 3T1YT 5LMNT 4C91A 1Y01A 4H9RC 4DR5T 3RI5A 4UXNB 3CKDA 1W0BA 2RP4A 2KWHA 5F8PA 1HNZT 4E7ZA 2Q9QD 4A97A 3DTOA 4L9IA 2D0TA 5FY7A 3UFEA 4O2AE 3AE8A 4NXNT 2YOEA 4NUVA 3CWZB 1X9BA 5FYMA 3GN5A 5C3JA 3HKCE 1UX4A 4HFBA 4LF4T 3KDSE 5FMNA 2IW5B 4L5GA 1J5ET 2BKPA 5ABFB 4N78D 5L3FB 3QC9A 4PNIA 3FHNA 4UVAB 4YTMA 4U33A 4EEBA 2N1GA 2EHOC 5DABA 5AQNB 4KP3C 4P0BA 3O9XA 3A8YC 1NWMX 4EB6E 5JH7E 3AECA 2UXCT 2VKJA 2WB5A 3U3IA 3LG7A 3UQ4A 3IA3A 3NZQA 4QKNA 4U7YA 2LSKA 5L4EA 3H3MA 5LP6E 2WMNA 3IEEA 2X67A 4OYJA 4JLEA 5IWAT 2W66A 3VKGA 3VRBA 2IIUA 2XSBA 4KHPT 5JRCB 4H9QC 2PTFA 4ZEYA 3AXJB 3B57A 4XBFB 2BVLA 5A1LA 2LM9A 3ZLIA 2LRKA 2NR4A 3N2OA 4HFDA 4LFBT 4CN6A 4O4HE 1YD8G 3ZSSA 2WZIA 1D0XA 3L39A 1OEDE 2BVMA 2WM9A 2BDEA 4AKLA 4MLKA 3K1SA 5LB7B 2XAHB 4ANJA 3BQLA 3C50A 4ASKA 2NWBA 3CQGB 1G8XA 3NZPA 5FXWA 5CA0E 4U7IA 5L3CB 4HFVA 1MIVA 2X0LB 3I9WA 4JYAT 5AQMB 1IJ5A 2OA5A 2XY8B 4ZI3C 3H37A 2QRXA 2KWIB 3ZT7A 5CGMA 3N9MA 2WSSV 4U31A 2CLYC 2LSIA 5KDMC 1XNRT 2PJQA 2Q9QB 3MA9A 4IE7A 5HXRA 1ZHCA 4JV5T 5KXJA 2LSYA 2PG8A 4I43B 3JAEA 2A2FX 2L3LA 2YDSA 1XNQT 2YU1A 1FMVA 2V6YB 2DCFA 4IDQA 3LSVA 4F6RC 3RYCE 4YHJA 1O3XA 3R6NA 3ZMSB 3SFDA 2E9XC 4ILBA 4CN4A 1YQ4A 5FXVA 3ZSTA 3E0ZA 1B7TA 2BBHA 3AE5A 3I9YA 3HKDE 3CX6B 2WY2A 4BAYB 3LJCA 4AQFC 1OXZA 2ZM2A 1UCUA 5ETWA 4H63V 4OHFA 3LK3B 3NRYA 4O8SA 4A56A 1JNZA 4QWNB 2V7LA 4IDNA 3SFEA 5BMVE 2AXDS 4LMKA 4WZXA 2CWOA 3CX7B 2CPTA 2PFVA 2V1DB 3M3ZB 3WI3A 4ZI2D 2WQYA 2MPKA 3ZN1B 5DQWA 3PUSA 4YJ2E 4DR4T
chains in the Genus database with same CATH topology
1MIWA 2NP9A 4YFSA 3KV4A 3D0TA 3ETUA 5H6RB 5LBMA 2QA7A 2CXDA 2VKHA 4GYSA 4CQIA 2JJ9A 3AVRA 5L3BB 1MMAA 2Z6EA 2NTYA 3SWHA 2H7OA 3MK7C 1T98A 2XAFB 4EOZB 3OJAA 3ZEFB 4FJOA 1FEWA 2CEAA 2D2SA 2HH7A 4QX8B 3MACA 2E8IA 3SS1A 3ZJ1A 1BR1A 3V5UA 5L2LA 3GA8A 3EVYA 3Q2MA 3J9X1 4TUYE 4MFRA 2ZM0A 3FB2A 3W15B 1S35A 2GK9A 3CVRA 3DJBA 3GN5B 2CMRA 2W61A 3VU7H 5HWXA 5E0OA 3BQIA 4EIWA 3ZJ2A 1WLXA 3F2EA 4PK5A 3UUNA 4ZI7E 3PU8A 4J2CA 1HCIA 4ILUA 3WAKA 5LGUB 5FY0A 2V7KA 4U74A 4I50E 5AFUL 2YINA 3P8CD 4X1YE 3RYHE 2WBLA 1WR6A 3HKBE 1U5PA 4ERRA 4AQGA 2Q9QA 2K48A 2ODVA 2X68A 3LK42 4UVCB 4DNDA 1HG5A 4ZOLE 3ZYMA 5C8YE 3UT5E 2HPJA 5LGNB 4AKHA 2Y48B 2IC9A 2ZM8A 1EZ3A 3DP7A 4JEUB 5LNKA 2V7IA 2LOSA 1MMNA 2H3RA 4UF0A 2PBIA 4ADZA 1LVKA 3RC3A 5HXHA 3AAEB 3FXDB 2K9AA 3RYFE 4ZS2A 2MOZA 4CI1B 2CWYA 2CXLA 2NTXA 4AKIA 2VKOA 5JREA 4H9SE 3RKOA 2NW9A 4O4JE 2KMFA 3UULA 4EYUA 2XQYA 3ETVA 3VKHA 5JDNA 2V7MA 5F3JA 3O4XE 2LT3A 3KV6A 2KLQA 2QGSA 4MALA 5L3EB 5EK4A 5JR9A 1LKXA 3ANWB 3CPZA 4TV9E 2LSJA 5EK2A 4AI6A 2NOXA 1MMDA 3ONXA 2V7JA 3C98B 3F57A 4UV9B 5IYZE 3SRZA 2UXNB 1HTJF 5FY1A 2LHRA 3K3QC 3N9OA 3MJXA 4JEHB 3L09A 4EYYR 5JDLA 4DVDA 2JPFA 2V26A 2Y6XA 5KX5E 4HKAA 4PJLA 2KZ7B 4HTEA 4DMVA 3EDVA 2EHOA 3MXZA 3AB3B 2RA1A 3K8PC 4UVBB 4O4LE 1KK7A 4HE8A 2WAUA 2W0GA 2Y8DA 1Z0PA 3LK2B 2D5UA 2E9XA 3C51A 3RH3A 5CA1E 2P9BA 4WBOA 5JDFA 5J1GA 4DBRA 3ZYKA 3B13A 1MMGA 1D0YA 2ES0A 4CXXA 1YKHB 3AA0B 3E08A 3FBLA 5FNVE 4QXCB 2N2NA 3GWHA 2XAJB 5FXXA 2A72A 4UEMA 4QHOA 3PUQA 5HAXA 4IHJE 4EZHA 4ZI2C 4GK5E 2LE8A 3N9LA 5CB4E 3O9XA 4MHCA 4ISTA 2X9WA 4TX5A 2LHNA 5TAOA 2C5IT 2VL8A 5JDGA 2C5JA 1IAPA 2N9DA 3ZMVB 4HGAA 2LJLA 3CQCB 3NRXA 2L9QA 3BK9A 4YLHA 5EK3A 4AKRB 4PFPA 4V1Av 4MBQA 1X79A 2K24A 4C91A 3Q9DA 4H9RC 4GYRA 3H3AA 4WNKA 4BJNA 3IBPA 2XUEA 4CXWA 4UXNB 2ACXA 2DLRA 1WYCA 2XTLA 3CKDA 3R84B 2RP4A 2KWHA 3O1JA 5F8PA 4E7ZA 1VOMA 2Q9QD 3DTOA 2LSGA 2Q9QC 4L9IA 1BR4A 4Z8XA 2D0TA 3U78A 2ZMAA 4TN7B 5FY7A 5LHHB 3MZKB 4WBNE 1D1AA 4U72A 3UFEA 4BJMA 1QUUA 5LJMA 4P0AA 3GMIA 4O2AE 3OYZA 3N2KE 1S94A 1ZKEA 3AA7B 3ZMZB 4NUVA 4ZI3D 3CWZB 2I59A 1HS7A 5FYMA 5M4YA 3GN5A 3UTKA 5LGTB 2DNXA 3HKCE 1UX4A 3PURA 4B6XA 1U4QA 3OBVE 3N5LA 5GONE 4KBMB 2G0UA 3ZN0B 3KDSE 5FMNA 2IW5B 3I1AA 4L5GA 1SA0E 4N78D 4E7SA 5L3FB 2CCQA 3QC9A 2UXXB 4UV8B 1ZEEA 4PNIA 3KBTA 2CA5A 3KBUA 3EUHA 3FHNA 4UVAB 4CI3B 5LCYA 2W00A 2EHOD 3CX8B 3KV9A 4UF0B 3IHRA 2N1GA 3QK6A 3J7Yq 2EHOC 5DABA 5HXCA 4KP3C 4P0BA 4H63H 2YK0A 5LHIB 3KINB 2CE7A 4IDZA 1NWMX 3T8OA 4EB6E 5JH7E 2E9XD 2JRKA 5JQGE 5LXTE 3NBXX 3OYXA 4I55E 2BZBA 2VKJA 3RYIE 3I0QA 3U3IA 4AKGA 2XASB 2W63A 4AXPA 3AVSA 5LJNA 3LG7A 1YW0A 1CUNA 2CXFA 3P7IA 2X51A 4GOUA 3NZQA 4QKNA 4H9PC 4X20E 3ESLA 3ZCIA 2WMOA 5DQVA 1FMWA 3ZC1A 4PW8A 2LSKA 4EZ4A 3S4UA 5H6QB 1LVFA 5ADXL 1UX5A 5LP6E 4DO0A 2WMNA 1QSDA 4QXBB 3IEEA 3WAJA 5JDHA 1IJ6A 3KFWX 1V9DA 3RC8A 4K0UA 2X67A 1LRZA 3K3OA 4OYJA 1VRBA 2CM0A 4JLEA 2EHOB 2KXPB 2JMHA 5EZYE 3UUMA 3PDYA 1HX8A 3C4XA 3VKGA 2VK9A 4ISSA 3AAAB 4IIJE 3RX6A 2X9XA 4YJ3E 1MNEA 4IE6A 2VKDA 5LA6E 3ZPOA 1MNDA 2KINB 3C4WA 4EAHA 2JMKA 4I4TE 3A5XA 4L0RA 5JRCB 4H9QC 1H7CA 1WRDA 4H9NC 3B57A 4XBFB 3JC6D 2BVLA 2DI4A 3LBXA 5A1LA 5FP3A 2LM9A 3ZLIA 4AQFA 4OK0A 1OWAA 1US7B 5J2UE 5LYJE 3N2OA 4DBQA 3PU3A 2K5BB 2MBGA 3FBZA 4CZZB 5DJQC 1HFAA 2X9YA 2C5KT 4O4HE 2IC6A 1YD8G 4HN9A 3C4ZA 4X1IE 2DWKA 4UELA 1D0XA 3L3PA 1WYBA 2B1EA 2HPLA 2BVMA 2WM9A 3Q5WA 2BDEA 1E1HB 3N9PA 4PJNA 2ODUA 4AKLA 4MLKA 4UIGA 1HG2A 2XAHB 3BQLA 3C50A 2XAQB 4ANJA 4ASKA 2NWBA 3PE0A 3CQGB 4KUMB 4CXYA 1G8XA 3NZPA 3QUJA 1G73A 5FXWA 5LG4A 5CA0E 4G63A 3HKEE 1BR0A 1ZV4X 5L3CB 1NAFA 4HFVA 1MIVA 2X0LB 3I9WA 5HWYA 3N9QA 4WW0A 4DMWA 4XAXB 4NUUA 2OA5A 1IJ5A 5LBQB 2C0SA 4ZI3C 3H37A 3N9NA 4QXHB 4PJMA 3SOLA 2KWIB 4IE0A 3UUXB 4PFOA 3N9MA 3I0OA 3K3NA 2WSSV 1D1CA 2CLYC 2VB6A 3RRCA 1Y64B 2LSIA 5KDMC 5JR9C 2PJQA 2Q9QB 3MA9A 4IE7A 1HF8A 1ZHCA 2X66A 5HXRA 3ZCJA 2NW7A 1FIOA 5KMGP 2LSYA 2IAKA 2PG8A 4I43B 2D0UA 2NW8A 2A2FX 3EDUA 5JDMA 2L3LA 3BQKA 4PJJA 3IF8B 2YU1A 4O4IE 4ZS3A 1FMVA 4PAGA 3RRWA 2XHEB 2DCFA 3FXEB 5IHYA 3AAIA 3ZMUB 5L3DB 4PK4A 4CI2B 4F6RC 3KVAA 3RYCE 4OYKA 2X9HA 4PK6A 1O3XA 4YHJA 1D0ZA 4P09A 1SHZC 3O1IA 1YKEB 3R6NA 3ZMSB 2E9XC 4OFZA 3MKDA 3PUGA 4JUYA 1D1BA 3HL6A 2MYSA 4G2AA 2YU2A 3HA4A 5FXVA 2CLYB 3E0ZA 1B7TA 2VWAA 2KT9A 3LFMA 5JR9B 4FI5A 2DHRA 3OKQA 2YEVC 4BA9A 4ZHQE 3ANWA 3I9YA 4O2BE 5LOVE 3CQXC 3CX6B 1BR2A 3HKDE 2L8KA 2W62A 4BAYB 3PTRB 3CMLA 5HXEA 3AA6B 1KNZA 5HXSA 2VASA 3LJCA 4H9OC 3RPUA 5JDQA 2H7VC 2KNDA 1OXZA 4AQFC 2ZM2A 3VHLA 3ZYLA 1MIYA 1UCUA 3Q5XA 3TKLB 3HI2A 4TV8E 3KVBA 3PUAA 3ZMTB 4M1PA 5ETWA 4H63V 3E22E 4OHFA 3LK3B 3NRYA 4QX7B 2E9XB 3M65A 3O1HA 3V5SA 4X1KE 3C64A 4HEAA 4O8SA 4A56A 2SPCA 2J1DG 2DWGA 2JQQA 4IE5A 2MTQA 2WWUA 3F31A 4QWNB 2LOPA 2V7LA 5BMVE 4IE4A 4GK0E 4TZ4C 4EXTA 4IGUA 3ZC0A 2CWOA 3CX7B 3KV5A 3N2GE 3JC6C 1AJ3A 5L3GB 5HYAA 4GIWA 3AA1B 2LEHA 2PFVA 5JRCA 3LBXB 2M67A 2ZLYA 2V1DB 5JVDE 5FXZA 3WI3A 4C90A 4ZI2D 1IZNB 4XZCA 2A3DA 3HR0A 4KMCA 3ZN1B 5J2TE 2XAGB 5LHGB 5DQWA 3PUSA 4YJ2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 4YFS A;  2LKH A;  4KHZ F;  5LBM A;  2QA7 A;  2CXD A;  2XJ7 A;  4CQI A;  4DUZ T;  2H7O A;  3MK7 C;  1JNR A;  4ZXL A;  4FJO A;  2HH7 A;  4QX8 B;  2E8I A;  5ABH A;  2BKN A;  3GA8 A;  4TUY E;  1OED C;  2GK9 A;  3UUN A;  3PU8 A;  4ILU A;  5LGU B;  1DU2 A;  5AFU L;  2YIN A;  1UUR A;  3P8C D;  2X68 A;  3ZYM A;  4AKH A;  3UUB A;  2JQH A;  2Y48 B;  2B76 A;  3RIU C;  4B3R T;  2H3R A;  4UF0 A;  3AAE B;  2K9A A;  4CI1 B;  4H9S E;  3ZKR A;  2KMF A;  5F3J A;  3KV6 A;  2KSR A;  4YSY A;  2K3W A;  5EK4 A;  4DR1 T;  4ILC A;  1MMD A;  2LHR A;  3N9O A;  3Q5E A;  5JDL A;  2Y6X A;  3UQ7 A;  3AB3 B;  3K8P C;  2WAU A;  2E9X A;  3RH3 A;  4WBO A;  3ZYK A;  3B13 A;  4TWH A;  4JI8 T;  4CXX A;  1YKH B;  5FNV E;  1UGO A;  5HEG A;  2A72 A;  4QHO A;  3PUQ A;  5CB4 E;  3QOF A;  2X9W A;  2LHN A;  1IBL T;  2C5I T;  4LFC T;  2WCA A;  2N9D A;  3CQC B;  4MBQ A;  5JTG A;  2WDV A;  4GYR A;  3H3A A;  4WNK A;  4BJN A;  2XUE A;  3UU3 A;  4DR3 T;  1ZOY A;  2XTL A;  1VOM A;  1KF6 A;  5AQF B;  2Q9Q C;  1BR4 A;  4Z8X A;  3U78 A;  2HN1 A;  5LHH B;  4WBN E;  1D1A A;  2RPA A;  5HCM A;  3FZK B;  5LJM A;  5AQL B;  3GMI A;  3N2K E;  1HS7 A;  3FZH B;  5IUX A;  4Z90 A;  2V8S V;  3PUX F;  2VQE T;  3AE9 A;  2BG9 C;  2UXX B;  1I94 T;  3RIF A;  3KBT A;  3EUH A;  3P4W A;  5LCY A;  3CX8 B;  4UF0 B;  3OPC A;  2YK0 A;  5LHI B;  3T8O A;  5LXT E;  3OYX A;  2FJD A;  4AXP A;  4GOU A;  4X20 E;  2XQ3 A;  3QNU A;  3ZCI A;  5DQV A;  5H6Q B;  1LVF A;  4DO0 A;  1QSD A;  5JDH A;  3RQU A;  4K0U A;  4GKJ T;  3K3O A;  1T72 A;  2CM0 A;  4LF7 T;  2KXP B;  3UUM A;  4HWH A;  3PDY A;  1UUS A;  4EGW A;  2XQ5 A;  2VKD A;  1HNX T;  1MND A;  3A5X A;  2J4G A;  3LBX A;  1US7 B;  5J2U E;  3PU3 A;  3FBZ A;  5DJQ C;  1HFA A;  2C5K T;  2IC6 A;  4HN9 A;  3C4Z A;  2B1E A;  4B3T T;  2XQ6 A;  4B3M T;  4PJN A;  3NWI A;  3AED A;  1HG2 A;  4DUY T;  5CFB A;  1Z8U A;  3PE0 A;  1BR0 A;  1NAF A;  2XM1 A;  4DMW A;  4XAX B;  4QXH B;  1WFD A;  2X0H A;  4PJM A;  4IE0 A;  3UUX B;  3RRC A;  1WR0 A;  3PJA A;  1HF8 A;  2X66 A;  2H88 A;  2NW7 A;  5KMG P;  3AE4 A;  2D0U A;  4OX9 T;  4PJJ A;  4ZS3 A;  3FXE B;  4GKK T;  3ZMU B;  4CI2 B;  5FVK A;  4OYK A;  3AE6 A;  1SHZ C;  1YKE B;  4OFZ A;  3MKD A;  3PUG A;  4JUY A;  1D1B A;  2J47 A;  4G2A A;  4JBW F;  5FL0 A;  5HEO A;  5JR9 B;  4FI5 A;  2YEV C;  2LRL A;  4X64 T;  1BR2 A;  2L8K A;  3JAF A;  2BG9 A;  2HN2 A;  3Q5X A;  3TKL B;  3HI2 A;  4M1P A;  4HFI A;  3E22 E;  2WZH A;  2R6G F;  4X1K E;  3C64 A;  2DWG A;  1N33 T;  2LOP A;  3ZC0 A;  3JC6 C;  5L3G B;  5CJ5 A;  4GIW A;  2LEH A;  2X0Y A;  3LBX B;  4TNV A;  3P50 A;  5FXZ A;  2XAG B;  2K48 A;  5HXS A;  4YHH T;  3UU8 A;  3OVU A;  3ETU A;  5FVL A;  2VKH A;  2JJ9 A;  3AVR A;  5HEH A;  1T98 A;  2XAF B;  4EOZ B;  3OJA A;  1SE7 A;  1FEW A;  2D2S A;  3V5U A;  3Q2M A;  3J9X 1;  4LF5 T;  4DR2 T;  4LF6 T;  3RQW A;  2WDR A;  3CK6 A;  4LML A;  3GN5 B;  2CMR A;  5E0O A;  3F2E A;  4PK5 A;  1HCI A;  2JIW A;  4X1Y E;  2UU9 T;  1U5P A;  4UVC B;  4DND A;  2IC9 A;  2ZM8 A;  2WU5 A;  3PV0 F;  2MOZ A;  2CXL A;  3RKO A;  4O4J E;  2JQK A;  3ONL C;  3RF1 A;  4EYU A;  2XQY A;  3ETV A;  4U2Y A;  2QGS A;  4MAL A;  1LKX A;  2LSJ A;  2NOX A;  4U3C A;  4K0K T;  3SRZ A;  2UXN B;  3K3Q C;  1HR0 T;  3MJX A;  2D9D A;  3L09 A;  4HTE A;  2EHO A;  2RA1 A;  3OTO T;  3PUV F;  3UU6 A;  1MMG A;  1D0Y A;  1E2A A;  2ACZ A;  3AA0 B;  2N2N A;  3GWH A;  5FXX A;  4TNW A;  4UEM A;  5HAX A;  3EAM A;  2IUB A;  2LE8 A;  5HCJ A;  4IST A;  2VL8 A;  2C5J A;  2VVN A;  1IAP A;  4HGA A;  1X79 A;  2K24 A;  3Q9D A;  5ABE A;  5AQU B;  4DV6 T;  5HEJ A;  4TWD A;  3RKG A;  2DLR A;  4HWC A;  4TN7 B;  3MZK B;  4U72 A;  4BJM A;  1QUU A;  3FZM B;  1S94 A;  1ZKE A;  3ZMZ B;  4B3S T;  5AQK B;  4ZI3 D;  2I59 A;  3UTK A;  5LGT B;  1U4Q A;  3OBV E;  2M6B A;  3N5L A;  2UUA T;  5GON E;  1KFY A;  2G0U A;  2UUC T;  1W09 A;  3I1A A;  4YTP A;  1SA0 E;  4E7S A;  2CCQ A;  4UV8 B;  1ZEE A;  1R8I A;  2UXD T;  4CI3 B;  2W00 A;  3IHR A;  3J7Y q;  1HNW T;  2XPK A;  4H63 H;  2FJB A;  3KIN B;  5JQG E;  2E9X D;  3NBX X;  4I55 E;  4AKG A;  4Z91 A;  3EAB A;  2XAS B;  4X65 T;  3AVS A;  2XQ9 A;  1YW0 A;  1CUN A;  3P7I A;  2X51 A;  4H9P C;  3ESL A;  1FMW A;  3ZC1 A;  4PW8 A;  4EZ4 A;  3S4U A;  3AE7 A;  5ADX L;  1UX5 A;  4QXB B;  1LRZ A;  3B5M A;  2EHO B;  5EZY E;  1GQE A;  3VR8 A;  4ISS A;  3AAA B;  4IIJ E;  3RX6 A;  4YJ3 E;  4KI0 F;  1MNE A;  4IE6 A;  5LA6 E;  3ZPO A;  3C4W A;  4EAH A;  2JMK A;  4L0R A;  1H7C A;  4H9N C;  5FP3 A;  4AQF A;  1VCS A;  3NKZ A;  2MBG A;  3PUW F;  4AQY T;  4QH4 A;  4X1I E;  4A98 A;  3Q5W A;  3P4R A;  1E1H B;  3G06 A;  3N9P A;  4X66 T;  4KUM B;  3VRA A;  3QUJ A;  1G73 A;  3N9Q A;  4WW0 A;  4NIQ A;  1N36 T;  4NUU A;  5LBQ B;  2C0S A;  3N9N A;  4IL9 A;  3RIA A;  4PFO A;  3I0O A;  2BBJ A;  3TLS A;  1D1C A;  4HFE A;  2VB6 A;  2JQ9 A;  4HFH A;  1FIO A;  4LF8 T;  2IAK A;  3TLT A;  3EDU A;  2V5C A;  5JDM A;  2HHH T;  4YXD A;  4O4I E;  2V6X A;  3RRW A;  5ABF A;  1CHU A;  2F4V T;  4PK4 A;  1OED A;  2X9H A;  2BS3 A;  4PK6 A;  4JI2 T;  3O1I A;  1IBM T;  3P4S A;  2MYS A;  2YU2 A;  2DL1 A;  5AQJ B;  2CLY B;  2VWA A;  3LFM A;  3AE3 A;  4BA9 A;  4ZHQ E;  4U2Z A;  5LOV E;  2W62 A;  3TLW A;  5HXE A;  2FUP A;  1KNZ A;  2E2A A;  2QVA A;  2VAS A;  4H9O C;  3RPU A;  2H7V C;  2KND A;  5FL1 A;  3RIU A;  3ZT6 A;  2W2U A;  3VHL A;  2OV9 A;  3ZYL A;  1MIY A;  1XWM A;  3KVB A;  2FBW A;  2E9X B;  3M65 A;  3O1H A;  3V5S A;  2UUB T;  5AQG B;  4HEA A;  2JQQ A;  4HWI B;  4IE5 A;  2MTQ A;  2WDQ A;  4IE4 A;  4TZ4 C;  4EXT A;  2UXB T;  2M6I A;  2XM2 A;  5JRC A;  2ZLY A;  3AXJ A;  4JI0 T;  4IDO A;  5JVD E;  3AE1 A;  4X5T A;  4XZC A;  3HR0 A;  4KMC A;  5J2T E;  5L47 A;  3PUZ F;  5AQQ B;  1MIW A;  3KV4 A;  2IDO B;  5H6R B;  4GYS A;  2Z6E A;  3UFG A;  2CEA A;  3T1H T;  4DID B;  3MAC A;  3SS1 A;  3ZJ1 A;  3UU5 A;  3EVY A;  5HEU A;  2OLT A;  2XQ8 A;  3AEF A;  3FB2 A;  1S35 A;  3CVR A;  4DR7 T;  3VU7 H;  5FKY A;  4NXM T;  3BQI A;  3ZJ2 A;  1WLX A;  4EED A;  1W9R A;  4ZI7 E;  4ZZB A;  3EHZ A;  3WAK A;  4U74 A;  2E5L T;  2CHN A;  2Q9Q A;  2ODV A;  3LK4 2;  3FZL B;  5AQS B;  1SUM B;  4ZOL E;  3UT5 E;  2HPJ A;  4DV7 T;  1N32 T;  4JEU B;  3DP7 A;  4LFA T;  4DR6 T;  2V7I A;  2PBI A;  1OED B;  2V6Y A;  1LVK A;  3RC3 A;  4F8H A;  3FXD B;  1UK5 A;  3RYF E;  4ZS2 A;  4YY3 T;  4AKI A;  2VKO A;  5JRE A;  2NW9 A;  2YDR A;  3UU4 A;  2V7M A;  1J5W A;  5L3E B;  2ZM6 T;  4TV9 E;  1HTJ F;  5FY1 A;  1NEK A;  4DVD A;  2JPF A;  2V26 A;  5KX5 E;  4HKA A;  4PJL A;  4DMV A;  3EDV A;  2VL0 A;  4UVB B;  4ZZC A;  1KK7 A;  4LMJ A;  2W0G A;  2D5U A;  3C51 A;  5CA1 E;  5J1G A;  1E7P A;  4QXC B;  2XAJ B;  4IHJ E;  4ZI2 C;  4GK5 E;  3L8R A;  4MHC A;  4TX5 A;  2W67 A;  5JDG A;  2LJL A;  5EK3 A;  2L9Q A;  3BK9 A;  4YLH A;  1KNR A;  4JI3 T;  3EI0 A;  4JI4 T;  2FJE A;  1XMQ T;  3IBP A;  4CXW A;  2ACX A;  2XQ4 A;  3R84 B;  1WYC A;  3O1J A;  4QH1 A;  4I0U A;  2LSG A;  5AQI B;  1YQ3 A;  2ZMA A;  4TWF A;  2XSA A;  1J1J A;  4P0A A;  3OYZ A;  3AEE A;  3AA7 B;  3CIR A;  3X1D A;  5M4Y A;  2BS2 A;  3PUR A;  2QYW A;  4KBM B;  3ZN0 B;  1M7K A;  2BS4 A;  2H89 A;  4WYV A;  3ONJ A;  3AE2 A;  3KBU A;  2CA5 A;  2IML A;  1NEN A;  2EHO D;  3KV9 A;  2WU2 A;  3QK6 A;  5LG3 A;  5BR8 T;  5HXC A;  4LF9 T;  3AEA A;  2CE7 A;  4IDZ A;  2JRK A;  2BZB A;  3RYI E;  3I0Q A;  2W63 A;  5LJN A;  4JI6 T;  4IDP A;  2CXF A;  1WCR A;  2WMO A;  4QH5 A;  5C2T A;  2BG9 B;  3WAJ A;  1IJ6 A;  3KFW X;  3FZF B;  1V9D A;  3RC8 A;  3ABV A;  1VRB A;  1ZP0 A;  2JMH A;  3RLF F;  1HX8 A;  3C4X A;  4DV3 T;  2VK9 A;  4HWD A;  2X9X A;  4NPP A;  2KIN B;  5AQT B;  1N34 T;  4I4T E;  3TLU A;  1WRD A;  4X62 T;  2CBJ A;  3JC6 D;  2DI4 A;  4OK0 A;  1OWA A;  2J62 A;  5LYJ E;  4DBQ A;  4YSZ A;  2K5B B;  3ZT5 A;  4CZZ B;  1XDO A;  3Q5D A;  2X9Y A;  3QB5 A;  3RHW A;  3JAD A;  2DWK A;  4UEL A;  3L3P A;  1WYB A;  2HPL A;  3P4P A;  2ODU A;  4UIG A;  2XAQ B;  2MAW A;  4CXY A;  4YTN A;  5LG4 A;  1VCT A;  4G63 A;  3HKE E;  1ZV4 X;  5ABG A;  2LKG A;  5HWY A;  4IT4 A;  2YKS A;  3A7M A;  1T7S A;  3SOL A;  2I0M A;  2XZE A;  2A9U A;  2BG9 E;  3K3N A;  2YN6 A;  1Y64 B;  5JR9 C;  2CBI A;  5AQR B;  2VQF T;  3ZCJ A;  3AEB A;  1M62 A;  2NW8 A;  2XQ7 A;  3BQK A;  2XQA A;  3IF8 B;  4PAG A;  2XHE B;  3LDQ B;  2CRB A;  5IHY A;  3AAI A;  5L3D B;  3KVA A;  2YDQ A;  1D0Z A;  4P09 A;  1XZY A;  5AQO B;  3HL6 A;  4KX6 A;  3HA4 A;  2W4X A;  2KT9 A;  4DV0 T;  2DHR A;  3OKQ A;  5F5W A;  2AE9 A;  4DV4 T;  3ANW A;  4O2B E;  3CQX C;  5LMU T;  3PTR B;  3CML A;  4DV1 T;  5L4H A;  3AA6 B;  4YT0 A;  5JDQ A;  2VVS A;  3QB5 K;  4TV8 E;  4DV5 T;  3PUA A;  3ZMT B;  2E5V A;  4QX7 B;  4AIS A;  1QLB A;  1FJG T;  3PUY F;  3VR9 A;  2SPC A;  2J1D G;  2WWU A;  3F31 A;  4P1N A;  4GK0 E;  4AIU A;  4IL4 A;  3TLV A;  4IGU A;  4EV6 A;  3N2G E;  3KV5 A;  4UR9 A;  5AQP B;  5J0Z A;  3PJA J;  1AJ3 A;  5HYA A;  3AA1 B;  2M67 A;  4JI7 T;  4C90 A;  1KEY A;  1IZN B;  2A3D A;  1XDP A;  2DNX A;  5LHG B;  4B6X A;  2NP9 A;  3D0T A;  4JI5 T;  4ILA A;  1IBK T;  1KNP A;  5L3B B;  1MMA A;  2NTY A;  3SWH A;  2LM2 A;  2WWV A;  3ZEF B;  2WP9 A;  1BR1 A;  5L2L A;  4MFR A;  2ZM0 A;  1L0V A;  3W15 B;  3DJB A;  2W61 A;  5HWX A;  5AQH B;  2WS3 A;  4EIW A;  4DV2 T;  1HX1 B;  4J2C A;  5FY0 A;  2V7K A;  4I50 E;  2IHR 1;  3RYH E;  2WBL A;  1WR6 A;  3HKB E;  4ERR A;  4AQG A;  2VUR A;  1XMO T;  1HG5 A;  5C8Y E;  5LGN B;  1EZ3 A;  5LNK A;  2LOS A;  1MMN A;  4CN1 A;  4JI1 T;  2I6H A;  4ADZ A;  5HXH A;  2CWY A;  2NTX A;  3JCF A;  3RGL A;  3VKH A;  3UUL A;  5JDN A;  3O4X E;  2LT3 A;  2KLQ A;  4YSX A;  2FJA A;  5JR9 A;  3ANW B;  3CPZ A;  5AQV B;  5EK2 A;  4AI6 A;  1YXR A;  3ONX A;  1W0A A;  2V7J A;  3C98 B;  2LLY A;  3F57 A;  4UV9 B;  5IYZ E;  2CHO A;  4JEH B;  4EYY R;  4HFC A;  1T8B A;  2KZ7 B;  3MXZ A;  3AEG A;  4O4L E;  2BKO A;  4HE8 A;  2Y8D A;  4HWF A;  1Z0P A;  3NVO A;  3LK2 B;  2V5D A;  2P9B A;  5JDF A;  4DBR A;  4Q25 A;  2ES0 A;  3FBL A;  3E08 A;  1I6Z A;  4COF A;  4EZH A;  3N9L A;  5TAO A;  3ZMV B;  3NRX A;  4IRE A;  3P4Q A;  4AKR B;  4PFP A;  4V1A v;  4A5X A;  3T1Y T;  5LMN T;  4C91 A;  1Y01 A;  4H9R C;  4DR5 T;  3RI5 A;  4UXN B;  3CKD A;  1W0B A;  2RP4 A;  2KWH A;  5F8P A;  1HNZ T;  4E7Z A;  2Q9Q D;  4A97 A;  3DTO A;  4L9I A;  2D0T A;  5FY7 A;  3UFE A;  4O2A E;  3AE8 A;  4NXN T;  2YOE A;  4NUV A;  3CWZ B;  1X9B A;  5FYM A;  3GN5 A;  5C3J A;  3HKC E;  1UX4 A;  4HFB A;  4LF4 T;  3KDS E;  5FMN A;  2IW5 B;  4L5G A;  1J5E T;  2BKP A;  5ABF B;  4N78 D;  5L3F B;  3QC9 A;  4PNI A;  3FHN A;  4UVA B;  4YTM A;  4U33 A;  4EEB A;  2N1G A;  2EHO C;  5DAB A;  5AQN B;  4KP3 C;  4P0B A;  3O9X A;  3A8Y C;  1NWM X;  4EB6 E;  5JH7 E;  3AEC A;  2UXC T;  2VKJ A;  2WB5 A;  3U3I A;  3LG7 A;  3UQ4 A;  3IA3 A;  3NZQ A;  4QKN A;  4U7Y A;  2LSK A;  5L4E A;  3H3M A;  5LP6 E;  2WMN A;  3IEE A;  2X67 A;  4OYJ A;  4JLE A;  5IWA T;  2W66 A;  3VKG A;  3VRB A;  2IIU A;  2XSB A;  4KHP T;  5JRC B;  4H9Q C;  2PTF A;  4ZEY A;  3AXJ B;  3B57 A;  4XBF B;  2BVL A;  5A1L A;  2LM9 A;  3ZLI A;  2LRK A;  2NR4 A;  3N2O A;  4HFD A;  4LFB T;  4CN6 A;  4O4H E;  1YD8 G;  3ZSS A;  2WZI A;  1D0X A;  3L39 A;  1OED E;  2BVM A;  2WM9 A;  2BDE A;  4AKL A;  4MLK A;  3K1S A;  5LB7 B;  2XAH B;  4ANJ A;  3BQL A;  3C50 A;  4ASK A;  2NWB A;  3CQG B;  1G8X A;  3NZP A;  5FXW A;  5CA0 E;  4U7I A;  5L3C B;  4HFV A;  1MIV A;  2X0L B;  3I9W A;  4JYA T;  5AQM B;  1IJ5 A;  2OA5 A;  2XY8 B;  4ZI3 C;  3H37 A;  2QRX A;  2KWI B;  3ZT7 A;  5CGM A;  3N9M A;  2WSS V;  4U31 A;  2CLY C;  2LSI A;  5KDM C;  1XNR T;  2PJQ A;  2Q9Q B;  3MA9 A;  4IE7 A;  5HXR A;  1ZHC A;  4JV5 T;  5KXJ A;  2LSY A;  2PG8 A;  4I43 B;  3JAE A;  2A2F X;  2L3L A;  2YDS A;  1XNQ T;  2YU1 A;  1FMV A;  2V6Y B;  2DCF A;  4IDQ A;  3LSV A;  4F6R C;  3RYC E;  4YHJ A;  1O3X A;  3R6N A;  3ZMS B;  3SFD A;  2E9X C;  4ILB A;  4CN4 A;  1YQ4 A;  5FXV A;  3ZST A;  3E0Z A;  1B7T A;  2BBH A;  3AE5 A;  3I9Y A;  3HKD E;  3CX6 B;  2WY2 A;  4BAY B;  3LJC A;  4AQF C;  1OXZ A;  2ZM2 A;  1UCU A;  5ETW A;  4H63 V;  4OHF A;  3LK3 B;  3NRY A;  4O8S A;  4A56 A;  1JNZ A;  4QWN B;  2V7L A;  4IDN A;  3SFE A;  5BMV E;  2AXD S;  4LMK A;  4WZX A;  2CWO A;  3CX7 B;  2CPT A;  2PFV A;  2V1D B;  3M3Z B;  3WI3 A;  4ZI2 D;  2WQY A;  2MPK A;  3ZN1 B;  5DQW A;  3PUS A;  4YJ2 E;  4DR4 T; 
#chains in the Genus database with same CATH homology
 1MIW A;  2NP9 A;  4YFS A;  3KV4 A;  3D0T A;  3ETU A;  5H6R B;  5LBM A;  2QA7 A;  2CXD A;  2VKH A;  4GYS A;  4CQI A;  2JJ9 A;  3AVR A;  5L3B B;  1MMA A;  2Z6E A;  2NTY A;  3SWH A;  2H7O A;  3MK7 C;  1T98 A;  2XAF B;  4EOZ B;  3OJA A;  3ZEF B;  4FJO A;  1FEW A;  2CEA A;  2D2S A;  2HH7 A;  4QX8 B;  3MAC A;  2E8I A;  3SS1 A;  3ZJ1 A;  1BR1 A;  3V5U A;  5L2L A;  3GA8 A;  3EVY A;  3Q2M A;  3J9X 1;  4TUY E;  4MFR A;  2ZM0 A;  3FB2 A;  3W15 B;  1S35 A;  2GK9 A;  3CVR A;  3DJB A;  3GN5 B;  2CMR A;  2W61 A;  3VU7 H;  5HWX A;  5E0O A;  3BQI A;  4EIW A;  3ZJ2 A;  1WLX A;  3F2E A;  4PK5 A;  3UUN A;  4ZI7 E;  3PU8 A;  4J2C A;  1HCI A;  4ILU A;  3WAK A;  5LGU B;  5FY0 A;  2V7K A;  4U74 A;  4I50 E;  5AFU L;  2YIN A;  3P8C D;  4X1Y E;  3RYH E;  2WBL A;  1WR6 A;  3HKB E;  1U5P A;  4ERR A;  4AQG A;  2Q9Q A;  2K48 A;  2ODV A;  2X68 A;  3LK4 2;  4UVC B;  4DND A;  1HG5 A;  4ZOL E;  3ZYM A;  5C8Y E;  3UT5 E;  2HPJ A;  5LGN B;  4AKH A;  2Y48 B;  2IC9 A;  2ZM8 A;  1EZ3 A;  3DP7 A;  4JEU B;  5LNK A;  2V7I A;  2LOS A;  1MMN A;  2H3R A;  4UF0 A;  2PBI A;  4ADZ A;  1LVK A;  3RC3 A;  5HXH A;  3AAE B;  3FXD B;  2K9A A;  3RYF E;  4ZS2 A;  2MOZ A;  4CI1 B;  2CWY A;  2CXL A;  2NTX A;  4AKI A;  2VKO A;  5JRE A;  4H9S E;  3RKO A;  2NW9 A;  4O4J E;  2KMF A;  3UUL A;  4EYU A;  2XQY A;  3ETV A;  3VKH A;  5JDN A;  2V7M A;  5F3J A;  3O4X E;  2LT3 A;  3KV6 A;  2KLQ A;  2QGS A;  4MAL A;  5L3E B;  5EK4 A;  5JR9 A;  1LKX A;  3ANW B;  3CPZ A;  4TV9 E;  2LSJ A;  5EK2 A;  4AI6 A;  2NOX A;  1MMD A;  3ONX A;  2V7J A;  3C98 B;  3F57 A;  4UV9 B;  5IYZ E;  3SRZ A;  2UXN B;  1HTJ F;  5FY1 A;  2LHR A;  3K3Q C;  3N9O A;  3MJX A;  4JEH B;  3L09 A;  4EYY R;  5JDL A;  4DVD A;  2JPF A;  2V26 A;  2Y6X A;  5KX5 E;  4HKA A;  4PJL A;  2KZ7 B;  4HTE A;  4DMV A;  3EDV A;  2EHO A;  3MXZ A;  3AB3 B;  2RA1 A;  3K8P C;  4UVB B;  4O4L E;  1KK7 A;  4HE8 A;  2WAU A;  2W0G A;  2Y8D A;  1Z0P A;  3LK2 B;  2D5U A;  2E9X A;  3C51 A;  3RH3 A;  5CA1 E;  2P9B A;  4WBO A;  5JDF A;  5J1G A;  4DBR A;  3ZYK A;  3B13 A;  1MMG A;  1D0Y A;  2ES0 A;  4CXX A;  1YKH B;  3AA0 B;  3E08 A;  3FBL A;  5FNV E;  4QXC B;  2N2N A;  3GWH A;  2XAJ B;  5FXX A;  2A72 A;  4UEM A;  4QHO A;  3PUQ A;  5HAX A;  4IHJ E;  4EZH A;  4ZI2 C;  4GK5 E;  2LE8 A;  3N9L A;  5CB4 E;  3O9X A;  4MHC A;  4IST A;  2X9W A;  4TX5 A;  2LHN A;  5TAO A;  2C5I T;  2VL8 A;  5JDG A;  2C5J A;  1IAP A;  2N9D A;  3ZMV B;  4HGA A;  2LJL A;  3CQC B;  3NRX A;  2L9Q A;  3BK9 A;  4YLH A;  5EK3 A;  4AKR B;  4PFP A;  4V1A v;  4MBQ A;  1X79 A;  2K24 A;  4C91 A;  3Q9D A;  4H9R C;  4GYR A;  3H3A A;  4WNK A;  4BJN A;  3IBP A;  2XUE A;  4CXW A;  4UXN B;  2ACX A;  2DLR A;  1WYC A;  2XTL A;  3CKD A;  3R84 B;  2RP4 A;  2KWH A;  3O1J A;  5F8P A;  4E7Z A;  1VOM A;  2Q9Q D;  3DTO A;  2LSG A;  2Q9Q C;  4L9I A;  1BR4 A;  4Z8X A;  2D0T A;  3U78 A;  2ZMA A;  4TN7 B;  5FY7 A;  5LHH B;  3MZK B;  4WBN E;  1D1A A;  4U72 A;  3UFE A;  4BJM A;  1QUU A;  5LJM A;  4P0A A;  3GMI A;  4O2A E;  3OYZ A;  3N2K E;  1S94 A;  1ZKE A;  3AA7 B;  3ZMZ B;  4NUV A;  4ZI3 D;  3CWZ B;  2I59 A;  1HS7 A;  5FYM A;  5M4Y A;  3GN5 A;  3UTK A;  5LGT B;  2DNX A;  3HKC E;  1UX4 A;  3PUR A;  4B6X A;  1U4Q A;  3OBV E;  3N5L A;  5GON E;  4KBM B;  2G0U A;  3ZN0 B;  3KDS E;  5FMN A;  2IW5 B;  3I1A A;  4L5G A;  1SA0 E;  4N78 D;  4E7S A;  5L3F B;  2CCQ A;  3QC9 A;  2UXX B;  4UV8 B;  1ZEE A;  4PNI A;  3KBT A;  2CA5 A;  3KBU A;  3EUH A;  3FHN A;  4UVA B;  4CI3 B;  5LCY A;  2W00 A;  2EHO D;  3CX8 B;  3KV9 A;  4UF0 B;  3IHR A;  2N1G A;  3QK6 A;  3J7Y q;  2EHO C;  5DAB A;  5HXC A;  4KP3 C;  4P0B A;  4H63 H;  2YK0 A;  5LHI B;  3KIN B;  2CE7 A;  4IDZ A;  1NWM X;  3T8O A;  4EB6 E;  5JH7 E;  2E9X D;  2JRK A;  5JQG E;  5LXT E;  3NBX X;  3OYX A;  4I55 E;  2BZB A;  2VKJ A;  3RYI E;  3I0Q A;  3U3I A;  4AKG A;  2XAS B;  2W63 A;  4AXP A;  3AVS A;  5LJN A;  3LG7 A;  1YW0 A;  1CUN A;  2CXF A;  3P7I A;  2X51 A;  4GOU A;  3NZQ A;  4QKN A;  4H9P C;  4X20 E;  3ESL A;  3ZCI A;  2WMO A;  5DQV A;  1FMW A;  3ZC1 A;  4PW8 A;  2LSK A;  4EZ4 A;  3S4U A;  5H6Q B;  1LVF A;  5ADX L;  1UX5 A;  5LP6 E;  4DO0 A;  2WMN A;  1QSD A;  4QXB B;  3IEE A;  3WAJ A;  5JDH A;  1IJ6 A;  3KFW X;  1V9D A;  3RC8 A;  4K0U A;  2X67 A;  1LRZ A;  3K3O A;  4OYJ A;  1VRB A;  2CM0 A;  4JLE A;  2EHO B;  2KXP B;  2JMH A;  5EZY E;  3UUM A;  3PDY A;  1HX8 A;  3C4X A;  3VKG A;  2VK9 A;  4ISS A;  3AAA B;  4IIJ E;  3RX6 A;  2X9X A;  4YJ3 E;  1MNE A;  4IE6 A;  2VKD A;  5LA6 E;  3ZPO A;  1MND A;  2KIN B;  3C4W A;  4EAH A;  2JMK A;  4I4T E;  3A5X A;  4L0R A;  5JRC B;  4H9Q C;  1H7C A;  1WRD A;  4H9N C;  3B57 A;  4XBF B;  3JC6 D;  2BVL A;  2DI4 A;  3LBX A;  5A1L A;  5FP3 A;  2LM9 A;  3ZLI A;  4AQF A;  4OK0 A;  1OWA A;  1US7 B;  5J2U E;  5LYJ E;  3N2O A;  4DBQ A;  3PU3 A;  2K5B B;  2MBG A;  3FBZ A;  4CZZ B;  5DJQ C;  1HFA A;  2X9Y A;  2C5K T;  4O4H E;  2IC6 A;  1YD8 G;  4HN9 A;  3C4Z A;  4X1I E;  2DWK A;  4UEL A;  1D0X A;  3L3P A;  1WYB A;  2B1E A;  2HPL A;  2BVM A;  2WM9 A;  3Q5W A;  2BDE A;  1E1H B;  3N9P A;  4PJN A;  2ODU A;  4AKL A;  4MLK A;  4UIG A;  1HG2 A;  2XAH B;  3BQL A;  3C50 A;  2XAQ B;  4ANJ A;  4ASK A;  2NWB A;  3PE0 A;  3CQG B;  4KUM B;  4CXY A;  1G8X A;  3NZP A;  3QUJ A;  1G73 A;  5FXW A;  5LG4 A;  5CA0 E;  4G63 A;  3HKE E;  1BR0 A;  1ZV4 X;  5L3C B;  1NAF A;  4HFV A;  1MIV A;  2X0L B;  3I9W A;  5HWY A;  3N9Q A;  4WW0 A;  4DMW A;  4XAX B;  4NUU A;  2OA5 A;  1IJ5 A;  5LBQ B;  2C0S A;  4ZI3 C;  3H37 A;  3N9N A;  4QXH B;  4PJM A;  3SOL A;  2KWI B;  4IE0 A;  3UUX B;  4PFO A;  3N9M A;  3I0O A;  3K3N A;  2WSS V;  1D1C A;  2CLY C;  2VB6 A;  3RRC A;  1Y64 B;  2LSI A;  5KDM C;  5JR9 C;  2PJQ A;  2Q9Q B;  3MA9 A;  4IE7 A;  1HF8 A;  1ZHC A;  2X66 A;  5HXR A;  3ZCJ A;  2NW7 A;  1FIO A;  5KMG P;  2LSY A;  2IAK A;  2PG8 A;  4I43 B;  2D0U A;  2NW8 A;  2A2F X;  3EDU A;  5JDM A;  2L3L A;  3BQK A;  4PJJ A;  3IF8 B;  2YU1 A;  4O4I E;  4ZS3 A;  1FMV A;  4PAG A;  3RRW A;  2XHE B;  2DCF A;  3FXE B;  5IHY A;  3AAI A;  3ZMU B;  5L3D B;  4PK4 A;  4CI2 B;  4F6R C;  3KVA A;  3RYC E;  4OYK A;  2X9H A;  4PK6 A;  1O3X A;  4YHJ A;  1D0Z A;  4P09 A;  1SHZ C;  3O1I A;  1YKE B;  3R6N A;  3ZMS B;  2E9X C;  4OFZ A;  3MKD A;  3PUG A;  4JUY A;  1D1B A;  3HL6 A;  2MYS A;  4G2A A;  2YU2 A;  3HA4 A;  5FXV A;  2CLY B;  3E0Z A;  1B7T A;  2VWA A;  2KT9 A;  3LFM A;  5JR9 B;  4FI5 A;  2DHR A;  3OKQ A;  2YEV C;  4BA9 A;  4ZHQ E;  3ANW A;  3I9Y A;  4O2B E;  5LOV E;  3CQX C;  3CX6 B;  1BR2 A;  3HKD E;  2L8K A;  2W62 A;  4BAY B;  3PTR B;  3CML A;  5HXE A;  3AA6 B;  1KNZ A;  5HXS A;  2VAS A;  3LJC A;  4H9O C;  3RPU A;  5JDQ A;  2H7V C;  2KND A;  1OXZ A;  4AQF C;  2ZM2 A;  3VHL A;  3ZYL A;  1MIY A;  1UCU A;  3Q5X A;  3TKL B;  3HI2 A;  4TV8 E;  3KVB A;  3PUA A;  3ZMT B;  4M1P A;  5ETW A;  4H63 V;  3E22 E;  4OHF A;  3LK3 B;  3NRY A;  4QX7 B;  2E9X B;  3M65 A;  3O1H A;  3V5S A;  4X1K E;  3C64 A;  4HEA A;  4O8S A;  4A56 A;  2SPC A;  2J1D G;  2DWG A;  2JQQ A;  4IE5 A;  2MTQ A;  2WWU A;  3F31 A;  4QWN B;  2LOP A;  2V7L A;  5BMV E;  4IE4 A;  4GK0 E;  4TZ4 C;  4EXT A;  4IGU A;  3ZC0 A;  2CWO A;  3CX7 B;  3KV5 A;  3N2G E;  3JC6 C;  1AJ3 A;  5L3G B;  5HYA A;  4GIW A;  3AA1 B;  2LEH A;  2PFV A;  5JRC A;  3LBX B;  2M67 A;  2ZLY A;  2V1D B;  5JVD E;  5FXZ A;  3WI3 A;  4C90 A;  4ZI2 D;  1IZN B;  4XZC A;  2A3D A;  3HR0 A;  4KMC A;  3ZN1 B;  5J2T E;  2XAG B;  5LHG B;  5DQW A;  3PUS A;  4YJ2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...