3CR0A

Wee1 kinase complex with inhibitor pd259_809
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
281
structure length
257
Chain Sequence
SRYTTEFHELEKIGSGGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWADHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wee1-like protein kinase
publication title Structural determinants of Wee1 inhibitor selectivity
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 257
sequence length 281
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cr0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cr0A01
3LAUA 5AV1A 2WTVA 4QP9A 4C2VA 4GU9A 3NIZA 2VWWA 1H00A 2PZRA 3OWKA 3RJCA 4F65A 2E9VA 4O1OA 3UYSA 5EHOA 4BDEA 5M08A 3OWJA 3PP1A 3FC2A 5IUIA 3CKWA 2FH9A 2OU7A 4OLIA 1K2PA 4FTMA 4BKYA 1IASA 2V0DA 4FI1A 5KUPA 3ZFYA 4ZS4A 4GJ3A 3HP2A 2IWIA 1FGIA 1FVRA 5CSVA 3NEWA 4YHFA 3P7BA 3VS3A 3MFUA 5IQCA 4IAYA 3LQ8A 1H25A 5BMSA 1QMZA 3R8MA 4D0WA 3ZYAA 4FSZA 4IM2A 4FV9A 2BAKA 5BYYA 4LV5A 4X3FB 3KVWA 3ZMMA 2XNPA 3U55A 4WT6A 1HOWA 2JKOA 1XH7A 4L43A 5DT0A 5I3OA 3PSCA 3U51A 4AACA 3Q2JA 3IW8A 1JKLA 2R3JA 4BDBA 1BI7A 3L1SA 2GNFA 2QKWB 1KE5A 2O0UA 3PVGA 4DFZE 1ERKA 4G9CA 4BTJA 1MUOA 2QO7A 3BX5A 3EQHA 4TW9A 4ONAA 3QYZA 3DGKA 3VIDA 4BYJA 4F0GA 3OCSA 4XV3A 4HVIA 1OKVA 2V22A 2PWLA 5H2UA 3UIUA 2X2LA 2ZV9A 5M09A 2BAJA 5EYKA 4LRMA 4RFZA 1K3AA 4DA5A 1R39A 1ZY4A 4FUYA 4P4CA 4JBVA 3AMYA 1JQHA 2WTIA 4J52A 2Z60A 4WNKA 4MBLA 2OH0E 1H1PA 2EUFB 2VUWA 4II5A 4IVCA 1P4OA 1Y91A 3F88A 3CD8A 2PE1A 3LFNA 2R9SA 2VV9A 2ITYA 4FZFB 1J91A 4UWCA 2BKZA 4CFVA 4FEUA 3MDYA 3FZRA 2HXLA 4KS8A 3V8TA 3FKOA 4AA0A 3BHVA 3PXKA 4MBJA 2CKOA 1XO2B 4MHAA 4YJOA 4E5AX 2NO3A 4I6QA 2VWUA 1V1KA 2CMWA 4KD1A 5BVDA 5D10A 4ZMFA 5J87A 3WIGA 4CG9A 3V5QA 4WSYA 2W1HA 4WD5A 2I0YA 3UMWA 3VBQA 3VVHA 3VNTA 3G90X 3FL4A 4PTCA 2HXQA 3S95A 3VUGA 3ROYA 2C6MA 3LXKA 3WBLA 3ZO1A 3LJ1A 2PVFA 1JWHA 2ZYBA 3NAYA 3EN9A 2RFEA 3TUCA 3MH2A 3OMVA 4XH6A 4HCTA 4MWHA 4DG3E 5LCJA 4LL5A 4ENXA 1WMKA 2JDOA 4AGUA 4I94A 4GH2A 2RG5A 3C4WA 4KIOA 4YBJA 5GJFA 5KZ0A 4A4LA 5LWNA 3CY2A 3PSDA 1WBVA 3F5UA 3NW7A 4QP8A 3C51A 1ZZ2A 4RVMA 4EK4A 4OAUC 4RA4A 4DE4A 4ZS0A 1VJYA 3EOCA 3FKLA 4DTAA 3FZPA 4I5PA 3HMIA 3K3JA 2QR7A 3PY0A 5IA5A 1RE8A 4PY1A 3A7FA 3L8VA 4M0ZA 4I92A 5JQ5A 2DS1A 4B8MA 3SA0A 5DVRA 3V5PA 2O5KA 4F09A 4JR3A 2GHMA 4I20A 3HECA 2HELA 3UP2A 4FNZA 3ZCLA 4GIHA 2C0OA 4FA2A 4LOPA 4BBFA 2C6TA 2OFVA 2W5BA 5CANA 4D1ZA 2OG8A 1Y6AA 1PXOA 4M0YA 3D7TA 5AUVA 3MH1A 5AP6A 2C5NA 4PDYA 2W1DA 2H9VA 1JNKA 3DPKA 2GHLA 3KL8A 5F1ZA 5M4IA 4K11A 3CCNA 4IB0A 3RINA 3UG2A 4QP4A 4YJRA 1WZYA 4LGHA 2JIVA 1E1VA 4TYGA 4C4EA 5IZFA 3OF0A 3TV6A 4N6ZA 1TQPA 4WNPA 3HLLA 2ZV8A 4USDA 1W7HA 1CKIA 3D5VA 4ZIMA 5E8UA 4ARKA 1ZY5A 1DS5A 4G3EA 4WUAA 2CNVA 5CU3A 4HPUE 2FB8A 4TN6A 1YVJA 2C6OA 3OXIA 2VN9A 3FHRA 1FPUA 4XMOA 3EQRA 5FDXA 3D0EA 4ZXTA 4EJNA 1J7UA 2GQSA 3R9HA 1MRVA 4FIGA 4PL3A 4RC3A 3ZUVA 2BDFA 4MQ1A 5AR2A 4ERKA 4C3PA 1ZAOA 2WGJA 4XV9A 2Y9QA 2XA4A 2YIQA 3F5PA 3HV7A 3KXNA 3ZSGA 4QMQA 3I5NA 5ANKA 2QG5A 2PL0A 3THBA 4BDDA 3W2SA 3QQFA 4YZ9A 4A9SA 5KHXA 1JVPP 1OBGA 5LMAA 5EYCA 4FV8A 4DBXA 1ZYDA 5BVOA 3DU8A 4AGWA 4AFJA 2IVUA 1O9UA 3UGCA 5EK7A 4CKRA 3RAIA 3LW0A 5A4QA 4ZTQA 4BDAA 3OP5A 1EH4A 4FICA 4GIIA 4N4SA 4NYEA 3IS5A 5CAPA 5HLNA 1QPEA 3AXWA 4FKQA 2VTIA 5C1QB 2XP2A 3IK3A 3E8DA 3DXQA 3I0OA 2PMLX 3BEGA 3EKKA 3PWDA 4BYIA 4EKKA 1F3MC 5IU2A 2VTHA 5TE0A 3PPKA 5K5XA 4O27B 4FEVA 2YITA 4MF1A 4KSQA 3ZO2A 5I4NA 2XK7A 5HBJA 5FRIA 2J0IA 2XS0A 3EQDA 5CF4A 5KBRA 2W5HA 1DM2A 3FLWA 3MIAA 5ICPA 3E88A 2C5XA 3Q52A 2YDJA 2A0CX 2ITQA 2ZDTA 2ETMA 2VX1A 1OUYA 2W1FA 3DA6A 3HX4A 3PE2A 3REPA 4ALVA 1H24A 2W1EA 3QCXA 1NVSA 4MNEA 2Z7LA 4QYGA 5CI6A 2GFCA 3U9NA 5EH0A 3ZLWA 5C8NA 2WTDA 5FP5A 3TG1A 3IKAA 3KB7A 3VUHA 4BB4A 1ZOHA 3QC9A 4O83A 3LFAA 5GJGA 3RPYA 3FXZA 4JAJA 3VS0A 3GU6A 2R0UA 2XK6A 1XBCA 2JIIA 2PZYA 4EHVA 3DB6A 3FMDA 1S9IA 2F7ZE 1E1XA 3BBTB 3JUHA 3ORXA 3R6XA 4HVSA 2ZV7A 4RLLA 3AC3A 5AIKA 5DR6A 3W32A 3ZU7A 2F4JA 1WBPA 2FVDA 4XG8A 4D4RA 1MQ4A 3C4XA 4L7SA 4RLKA 4RA5A 3W1FA 2WMXA 4ALUA 2W5AA 3D4QA 1IRKA 4KS7A 2PMNX 5BUJA 5HO8A 4E26A 3E62A 3HV5A 2YIWA 2OO8X 1PW2A 5K4JA 5DNRA 3BYUA 3DOGA 4IB3A 5CNOA 5I3RA 4OBPA 2VAGA 3DLZA 2DUVA 4IC8A 3BGPA 3TKIA 2GFSA 5FG8A 1Q3DA 1YDTE 2OJJA 2QOFA 2P2IA 3P7CA 4GRBA 2VTPA 4C59A 4BFMA 3NR9A 2NRYA 3D5UA 4BCKA 4OT5A 2ETRA 3BHYA 4J96A 3FQEA 4O0WA 2AYPA 4XJ0A 3VRZA 4F7LA 3FLNC 2RFSA 4ANQA 4P90A 3T9IA 4GK2A 4QQCA 4S30A 2Y4PA 2C6LA 3HVCA 5AAEA 3VN9A 3EN4A 2VTSA 4ZTLA 4JS8A 2ZB1A 4Z9LA 4NEUA 5DE2A 3CEKA 3EQGA 2XCKA 4CXAA 2V55A 1BYGA 1H07A 3ZTXA 2B4SB 3QA8A 3E8EA 4B9DA 5JFVA 3RAKA 5DEWA 3GP0A 3UIBA 4ANMA 4K18A 2QD9A 4AW0A 2XEZA 2I0HA 3OZ6A 4I0TA 4NJDA 4C02A 3AD6A 1LP4A 3FDNA 2P3GX 3FI3A 4CKJA 3BGZA 5CSHA 2QLQA 4AA4A 3TM0A 3G9NA 1CSNA 4YNOA 5FGKA 3VQHA 3AD5A 4O7TA 3BBWA 1FVVA 4MWIA 4FKLA 4RIYA 3OWLA 4PTGA 3AT2A 3CQEA 5FTQA 3R7UA 4IZ7A 1V0BA 3I60A 3EQCA 4GCJA 3UYTA 2W17A 1JKKA 3E8CA 2HZ4A 3G2FA 3VC4A 1XH8A 3PRFA 5AP1A 3WF6A 4BWPA 3RZBA 3FLYA 5HO6A 3RKBA 3K3IA 3BKBA 4QTEA 1SVHA 2BDWA 1HCLA 1Q5KA 3RNYA 2OW3A 4C33A 4XHKB 5BPYA 3VQUA 1PMEA 1V0OA 1Q4LA 3KRXA 1KWPA 3CJFA 1P5EA 4L42A 4U79A 4ZSGA 3BYMA 4AG8A 2X2MA 3ATTA 1M7QA 2YZAA 1WVXA 5JFWA 2OI4X 3KULA 2GS6A 4YGAA 2J4ZA 2C0IA 3LXNA 2IVTA 4TWPA 4UMQA 4FIFA 4CT2A 5IQEA 2ITNA 3IO7A 2C47A 5KE0A 3DBQA 3OUNB 3PJ8A 4EH2A 5BVKA 3FUPA 4AW1A 4U41A 1KOBA 4ZP5A 1H0WA 4FTNA 4BDFA 3KXXA 4F6UA 3B8QA 5AMNA 4Y85A 5GINE 2XEYA 3O17A 2PK9A 4UEUA 5E8ZA 5HIEA 3IGOA 4GEOA 4FR4A 2PYWA 4YJSA 4EH4A 3AC2A 2HW7A 4WKQA 1U46A 5AAFA 3P1AA 3FBVA 2B1PA 4E20A 2XKCA 4O86A 1WVYA 4M69B 5E92A 4JRVA 4M15A 3HV4A 1NY3A 3LCTA 1R78A 3A7GA 4I3ZA 2XCHA 4TRLA 3T3VA 4QTAA 5I0BA 5HIBA 3TZ8A 4HJOA 3BV3A 2VGPA 3RCDA 4DH7A 4Z16A 4JDIA 4FZDB 3JVSA 1PYXA 3O8UA 5L2WA 1FVTA 4MF0A 5J79A 3FL5A 3NLBA 1MRUA 4YSMA 4R1YA 4Q5EA 4JDHA 4EWHA 5CALA 2W1IA 4D58A 4DF3A 1VYZA 3CGOA 4DT8A 4FK3A 1PKDA 3ZOSA 3NUXA 3FZSA 3QRUA 2J0JA 4K77A 2XNNA 3D9VA 3C1XA 5DRDA 3RPRA 1G8SA 1K9AA 2Y6OA 4JQ8A 4FKSA 2CKEA 5DR2A 2B7AA 3I4BA 1G8AA 4ANLA 3TN8A 5HG9A 2HY81 5EM5A 3BE9A 3OY3A 4RJ7A 3RNIA 5HVKA 4F08A 3C0IA 2GNJA 4FIIA 3RK7A 4ASDA 2OZAB 4ITIA 5B0XA 2F57A 3GQLA 4NJ3A 2IG7A 4XG2A 2BZKB 3ACKA 3QA0A 4FEWA 2WXVA 4L8MA 4I21A 4MNFA 1PXMA 4BGGA 3QC4A 4CT1A 3E93A 3FLZA 1STCE 4WBBB 1NW1A 4JJRA 4TYHB 2BZHB 3V51A 4E4NA 4RG0A 4Z55A 4EJ7A 4EH5A 2VWBA 4YLLA 1UV5A 3RCJA 3OD6X 5D41A 1BL6A 3R1NA 3CQUA 2XNBA 1UVRA 2BZJA 4FT7A 4QT1A 3R9DA 3OC1A 3R7YA 2V7AA 3F61A 5ANEA 3SXFA 3B2TA 5FXSA 2Y4IC 3MH3A 4YO6A 3S0OA 3Q32A 3R7GA 3UG1A 2I1MA 1SVEA 4MH7A 3RALA 4JLCA 3R9OA 4PNIA 4QTDA 3RHKA 4X6RA 3QX2A 3ZSIA 3ETAA 4F7SA 4JOAA 4JT3A 5CSPA 3QCYA 4NKSA 4IWOA 5HLWA 1PXJA 2F2CB 4HCVA 4HGEA 3FI8A 3QQKA 4GV1A 2XYNA 3V5LA 1V0PA 3AGLA 1QPJA 3ZDIA 5EOBA 4L68A 4IAFA 3R7IA 4FV0A 4FT9A 4W4VA 2JFLA 3VUMA 4IQ6A 3V04A 4G6OA 3Q96A 2R3HA 5C01A 4DH5A 3F3UA 5GIOE 3MVHA 4IX4A 3FMJA 4EOKA 1UWHA 1PKGA 4NH1A 4CLJA 4A07A 4ZLOA 2WTCA 2IPXA 4RVKA 2W7XA 3O51A 3MPTA 2QOHA 1XHAA 2XK3A 4FMQA 4IM0A 3DS6A 4CCUA 5L8KA 1U5QA 4S33A 1CMKE 3F2NA 2W4KA 2B0QA 1WVWA 4QOXA 3FSKA 4PP9A 3R7OA 4JX3A 4IDVA 5DMZA 2PMOX 5HTIA 3FZOA 2R3LA 5DOSA 4F1MA 5AX9A 3G51A 3C0HA 2YIXA 4KKEA 3U6HA 4WOVA 4Y83A 3DAKA 4D28A 4FTRA 4PWNA 5LMKA 1APME 5A3XA 5A4LA 4Y46A 3V6RA 3D94A 4H58A 4QTCA 5HD7A 3TTJA 4YUQA 1I44A 1FOTA 3HP5A 3LJ0A 4WO5A 2CN5A 4J95A 3F3WA 5K0KA 3PRIA 5L3AA 2BHEA 2VTAA 2J0KA 4D4YA 3VF8A 2XNOA 2YJSA 3NDMA 4IHPA 4KRDA 4R1VA 3ET7A 4EH8A 3TNPC 3QTRA 5IQDA 4BBEA 2DQ7X 4ZK5A 4TYEA 3V5WA 5LMKC 3MESA 2VTNA 3BWFA 2ZM3A 5EW9A 5TF9A 1P2AA 5KBQA 3GUBA 4QP7A 5IKWA 4CD0A 2CLQA 3JYAA 2W96B 3IW5A 3AC4A 3D7TB 3NUSA 3PVWA 5EM7A 3SX9A 4EOOA 3G5DA 1SNXA 4O0UA 3VHEA 3DBEA 2R7BA 1BLXA 5E1SA 4FSUA 4QMTA 4CYJA 1KOAA 1YOJA 2ITUA 2YCQA 3BPRA 4M13A 5HCYA 1OL5A 2YWVA 4O7SA 3COIA 5FWKK 4QQTA 5IA2A 3F9NA 3DBDA 3NS9A 5AP7A 5CEMA 5KMLA 3LVPA 4E7WA 2PY3A 2X8EA 3QAME 3P7AA 5LCKA 2A1AB 2GPHA 3HKOA 5K9IA 4DBNA 2W0JA 3KF7A 3LFFA 2J2IB 4B0GA 4FBXA 2YCRA 3KN5A 3UQGA 5CF5A 4DH8A 3WZEA 2C6DA 2WQNA 3ZC5A 3FYJX 2PVKA 2J9MA 3TT0A 4YP8A 3TEIA 4X6QC 3KRWA 4MK0A 3EYGA 3NGAA 3CTHA 4TYJA 3GCUA 1GIHA 4FL3A 4C4IA 3FC1X 3QQLA 2X4ZA 4DEGA 4PPCA 5C8KA 1YI4A 5DH3A 5HO7A 1ZMVA 2J50A 5GZ8A 1JBPE 3FYKX 4F7NA 4OTFA 4OR5A 3ENMA 2BRBA 4AS0A 2VTTA 1Y8YA 1OIRA 2PUPA 3GC8A 4U6RA 2PVJA 5IQHA 3QTXA 3FKNA 3KN6A 4LGDA 3VS7A 3HUCA 1XBAA 4V0GB 3FMMA 3MB6A 3QHRA 3BE2A 3Q04A 1NXKA 4GL9A 4MCVA 4EL9A 2GMXA 4FZ7A 3N4UA 3GI3A 4XV1A 4FT5A 5H9BA 3GNIB 4S34A 4V05A 3TV4A 5A4EA 3Q9ZA 2C68A 3POOA 3VHKA 4KUJA 3FWQA 3SRVA 3VULA 4BZDA 3ZUTA 4ENYA 2XIXA 4JR7A 2AUHA 4EOIA 1L8TA 4R7IA 1UNHA 3I0QA 4YJQA 2ZOQA 2GSFA 4DYMA 4FKWA 5EKOA 1RDQE 1MP8A 2X4FA 2PVYA 3Q6UA 2GCDA 2H6DA 3SC1A 4TTHB 3P9JA 1M52A 1KSWA 2ETKA 4UYNA 4EOJA 5EM8A 2BRHA 2EXCX 3NNXA 3FE3A 1JKTA 2WNTA 3CD3A 3O0GA 1H4LA 1ATPE 1XJDA 1Q97A 3QKMA 3FQHA 5L6WL 4AZEA 4AOJA 2V7OA 3UVPA 1RQQA 2Z02A 3ZBFA 5BQ0A 3AMBA 3DKGA 4IWQA 4FVPA 1R3CA 4AN2A 5I9ZA 3VS5A 4OTHA 5CT0A 2OGVA 3V01A 3MA6A 5AM6A 5J7BA 3KCFA 4RIXA 4AWIA 1U59A 3PIYA 1PXLA 3OBGA 4DTBA 3NCGA 2BALA 2JDVA 3Q3BA 5FEDA 3CE3A 5T3QA 3QD0A 4OTRA 2WQEA 3FV8A 2YM6A 3PG3A 3PE1A 4JI9A 2ESMA 4TZRA 3MH0A 4V04A 4NW6A 4ZOGA 4ZMEA 4YJPA 3F5XA 4F64A 1GZ8A 4MXCA 4RJ5A 5LQFA 5FTGA 3PIZA 3FI4A 3D2IA 1OL2A 4DEIA 4HW7A 2O64A 2XVDA 3LJ2A 4HGSA 2OBJA 3Q9XA 4WNOA 1XH6A 2I0EA 4FGRA 4IFGA 3RM7A 5AV4A 3TUDA 3SV0A 4B4LA 3IDPA 3ZDUA 3ZXZA 2CN8A 5JSMA 1KE6A 4FNWA 4DFYA 3KU2A 3FLSA 2J90A 4G3CA 2W4JA 4PUZA 4X2KA 2XJ0A 1YXSA 5T6KA 3ZO3A 5JN2A 3W18A 4ZTSA 3UIMA 2WEVA 2XK4A 5FM3A 4AP7A 4C0TA 3UIXA 1W8CA 4U97A 1GZNA 2UVXA 4W4XA 5M44A 4M67A 4CFUA 5M4UA 3HAMA 1BL7A 4CZUA 3ZRKA 2B9JA 4I6BA 4FNYA 3PP0A 3OUKA 5HE2A 2QCSA 2QU6A 4GW8A 4IVDA 1Z9XA 3QF9A 5ETFA 4BDIA 1O6KA 3OG7A 2OZOA 3L8SA 1LR4A 4M84A 5AP0A 4ID7A 4QPMA 5I9WA 4KIQA 5JGDA 3C0GA 1IAJA 3E7OA 3OROA 5CEOA 4PX6A 4BF2A 4O2PA 1W84A 3VW6A 5AWMA 3E92A 3TJDA 5FUTA 4RRVA 1PXNA 2R3PA 1M7NA 4XP2A 3ODYX 4YHJA 5CEKA 3QZFA 2ITWA 1R0PA 2DYLA 3ATSA 3NNVA 4G5JA 3EN6A 5DG5A 2OXYA 3NVMB 3NUPA 2JFMA 4IIRA 3AMAA 4BCMA 3KXZA 4YZNA 3IOKA 4E4XA 5I9YA 4EKLA 3DDPA 3OEZA 2IW8A 3UO4A 4N6YA 1J7LA 1UNGA 5AA9A 2VTOA 4G17A 3HYHA 2JKKA 4AZSA 5A46A 3CP9A 3C50A 4XG3A 3TZMA 5E8SA 4OGRA 1XH4A 3IW4A 4WNMA 1UA2A 2HCKA 2REIA 3HL7A 3KK8A 5CWZA 3VS4A 3TKUA 3DDQA 3F7ZA 4HNFA 4BCNA 4YTCA 5IQBA 4CZYB 3OT3A 2BKKA 5J9YA 4GUBA 5K4IA 2YZLA 3FEGA 3ODZX 2YCSA 3OOMA 2WFYA 3H9FA 3LQ5A 3NAXA 1W0XC 3C4EA 2P33A 5J95A 2UZDA 4DG0E 4LRKA 3DZOA 3S3IA 3QQGA 4QMNA 2ZM4A 5CU6A 3UO6A 3PLAE 5CSXA 4NT4A 3BI6A 2IZSA 3QLFA 4L3JA 3R30A 4M3QA 2X6DA 5CXZA 4I6HA 3VBTA 3KKVA 4FTQA 4KIKA 3U87A 3UMXA 4R7BA 4FL1A 4DH3A 4O6LA 3R0TA 3W2OA 5EQEA 2O65A 2RKUA 4LRJA 4AGCA 5E90A 3TNWA 4D4SA 2R3MA 3HUBA 3SQQA 2ZV2A 3TTIA 2WB8A 3F3ZA 4D9UA 4LUDA 5AUUA 4N70A 5BUEA 4QRCA 5AV2A 4XG4A 4FTUA 4IC7A 5G1XA 3W2QA 3WF8A 1WCCA 4BCFA 2WPAA 3F2RA 4XS2A 3WARA 2IJMA 3R1YA 4FNXA 4YC3A 3UQFA 5EDPA 3SG9A 3QX4A 4R5YA 1UKHA 4KNBA 4L3LA 4ZSJA 2QURA 3DB8A 4NW5A 4UY9A 3GOPA 4GMYA 1BI8A 2UZWE 5FBOA 3G0FA 2QOCA 5D12A 3JS2A 3OY1A 2VTMA 4EH9A 1OPLA 4ASXA 2HENA 5ANJA 3T8OA 5LXMA 4IZAA 4JDJA 3A7JA 2B9FA 4JX7A 4IJ9A 2W1CA 1Q8ZA 2J5FA 5D11A 5HNBA 3DT1A 4O2ZA 4BN1A 5TO8A 3GFEA 4ZAUA 3U6IA 5KX8A 2YM8A 4O7ZA 3CC6A 4EOLA 3W2PA 2YWPA 4FKPA 3ZSHA 1F5QA 5DR9A 4NFNA 3P78A 4TKSA 5EDQA 3IW6A 4GT5A 2C5VA 3QRIA 1OPJA 1FMKA 2VGOA 4IXPA 2Z7SA 4YMJA 3FMNA 5L2SA 4ZZOA 1J7IA 1GJOA 5AR4A 4NFMA 4V01A 5EQPA 3EQBA 4O1PA 5B7VA 4DFNA 5AP5A 4Q2AA 3ZFMA 4HZRA 4ACMA 4DGGA 1JOWB 1Q62A 4IX3A 3F3VA 5K5NA 4AZTA 4ACCA 3BV2A 4UBAA 5CU4A 4O0XA 5F20A 1VZOA 4RJ8A 2ITPA 3C13A 2G2IA 4FTIA 3NRMA 2Y8OA 3N51A 3F6XA 3LHJA 3SOCA 5IG1A 3PDTA 3LM0A 3P08A 3A4OX 5JH6A 5DIAA 3MV5A 3LCKA 4GS6A 5DI1A 1QCFA 2EU9A 3QUEA 4OTQA 5L2QA 2ITTA 2EXMA 5H3QA 3CPBA 4UMPA 4APCA 4CLIA 4G2FA 2PVMA 2LAVA 1ZYJA 4HYIA 2BZIB 4HGLA 2HWPA 2BFXA 3ENHA 3HMNA 4F9BA 3G9LX 3EWHA 4JIAA 4EEVA 4HZSA 3V5TA 1J3HA 4NIFB 4IH8A 4X21A 1H26A 3CR0A 5FBNC 4HVHA 5HIDA 2JGZA 4L46A 2UVYA 3R04A 4XYFA 1Y57A 3BLRA 4GK3A 2Z7QA 4O7LA 1OZ1A 4A9RA 3FMKA 3A8WA 3SKCA 4AU8A 3GFWA 3ZZWA 2UW0A 3OVVA 2OK1A 3WZDA 4KB8A 5EM6A 3MVLA 4EWQA 1WAKA 3I6UA 2F49A 4XRLA 4AA5A 1CDKA 4JBPA 4WIHA 5IMXA 3AG9A 1BMKA 3F66A 4UXQA 4UB7A 4XG6A 4BVUA 5AM7A 4EQCA 1P14A 1CM8A 2UZLA 1TQMA 4DLIA 3FQSA 1YHSA 2JDSA 3WYXA 3FZTA 4PPBA 1X8BA 3ZH8A 2ZDUA 4DH1A 4QO9A 5A4TA 4JRNA 1JKSA 4IFCA 2CPKE 2JLDA 3R8UA 5BVWA 5EI2A 4AN9A 5BMMA 2GNIA 3P23A 3DNEA 2J7TA 3WE4A 4AZFA 2BAQA 3O7LB 4IAIA 3F5GA 3RMFA 3UODA 4PMSA 5AUTA 4DITA 1KV2A 5I9UA 1GAGA 4EH6A 3SW4A 1H0VA 1T45A 3OCGA 4KKGA 5F95A 5IEXA 4F1TA 2RG6A 5IH5A 2GS7A 4FKTA 2XYUA 4RIWA 5ANIA 3OTVA 3TCPA 3WILA 5A9UA 4EZ3A 5J9LA 4YSJA 2XBJA 4Y95A 3IONA 2CNUA 3A2CA 4BDHA 4MQ2A 3EYHA 3OW3A 4FG8A 4O22A 3DTWA 3PIXA 2C6EA 2GDOA 4QTBA 3R01A 4IAZA 5HOAA 3RTPA 4FG7A 3RK5A 2E9PA 4GT3A 3EJ1A 3I7BA 1JSUA 3AGMA 2B53A 3TNHA 2HZNA 1PJKA 4FTKA 2XIKA 3GC9A 4U42A 2IW6A 3VUTA 3QWKA 1A06A 4BHZA 4RZWA 4A4OA 5HX6A 5KMNA 3OXZA 4MTAA 3KC3A 2YLEA 4WHZA 3R8VA 3F69A 3EN5A 5LWMA 1OM1A 3VS1A 4DLJA 4YZBA 4G34A 4UALA 4O0TA 2HAKA 3DKFA 1YI6A 2LGCA 3W2CA 4DEBA 4F6WA 3DBCA 2J51A 1ZWSA 3AOXA 2R3GA 3JY9A 4QYFA 4NTSA 5AADA 4P5ZA 2X0GA 2QOIA 3JR1A 5DYJA 3UOJA 3TXOA 3FXXA 3R02A 3D7ZA 3O8TA 5CLPA 4YJUA 4O82A 3PY1A 3OXTA 4C7TA 1FGKA 4WG4A 3O8PA 1REKA 3KMUA 3LXLA 5TT7A 3W10A 4ALWA 2HWOA 4JQ7A 4TXCA 3BEAA 3SLSA 4FL2A 1L3RE 4IWPA 2YHVA 5I9XA 2WAJA 4X3FA 3DQXA 3ZLSA 2W4OA 5ETIA 3PJ2A 3UVRA 4D2SA 3CQWA 1H1WA 1LPUA 1XKKA 2OH4A 5JZNA 2BTRA 3L8XA 4C2WA 4O7NA 3EL8A 4M8TA 1OL7A 3G0EA 4JNWA 3M2WA 3DXPA 1YWVA 3ULZA 4AQCA 3NIEA 3U9CA 3NNUA 4RBLA 5M57A 4IB5A 3ZUUA 4ZJJA 1SYKA 4PTEA 4FUXA 2BDJA 3EKNA 4I4EA 4AOTA 3ZRLA 3HV3A 4YZCA 5HG5A 3MSSA 2QOLA 2R4BA 4JBQA 4X3FC 4DC2A 4K6ZA 5F4NA 3DFAA 1O6YA 2C30A 4CFXA 3PLSA 1YWNA 3TIZA 3WZJA 3R7VA 5AP3A 5AR5A 5EG3A 3DZQA 4X2NA 3AC5A 5H8BA 5AV0A 4FV7A 4X2JA 2XJ2A 3E7VA 3PJ1A 3EFJA 4AX8A 4W4WA 3SRVB 3MVMA 3ZXTA 4FTOA 4DGMA 5KKRB 5A6OA 5AJQA 4FTTA 4IMYA 4EK8A 5CASA 2OICA 4AT4A 3QUPA 4TPTA 3HMPA 5BNJA 3A61A 2YISA 2BIKB 5C4KA 2CJMA 2F7EE 3BLQA 2P55A 4I24A 4RZVA 3GOKA 2ZVAA 4O0YA 4ZJIA 4MXOA 4O0SA 3I79A 5LARA 3RHXA 3OWPA 4JXFA 1PXPA 2QG7A 4YURA 5HVYA 3SG8A 3Q60A 3QTWA 4XP0A 2WMRA 5JFXA 5J5SA 4QP2A 4IEBA 1PMVA 2BPMA 5DT3A 1NVRA 3KMWA 5KMKA 4FV5A 2WTKC 2O3PA 3K2LA 5E91A 4TY1A 2FSLX 2YM3A 3LCOA 5AP2A 3C7QA 5CQUA 5ITAA 5L4QA 1OPKA 2ZMCA 1KV1A 4C4JA 4FV1A 4WSQA 3HZTA 3KRLA 4JG8A 3O23A 4PMMA 3DV3A 2X81A 4FSYA 4RC2A 3N4TA 3VAPA 4YTFA 5EQYA 1RW8A 4JL9A 2VO7A 4LOQA 5FTOA 5ANOA 4PV0A 2QODA 3OBJA 4YHTA 4UN0C 4D2VA 4F9CA 4PP7A 1DAYA 2F2UA 2UZOA 5L8LA 2C5OA 5EYDA 3GB2A 3KGAA 1URWA 3BRBA 1WBOA 5FEQA 2PUUA 3KRRA 5IMEA 3WZKA 1OB3A 2WU7A 1GOLA 3E64A 2WIHA 2XNGA 3EIDA 3GCQA 4FODA 1PY5A 4I4FA 3TI1A 1FBNA 3PUPA 3Q4UA 3LCSA 1BX6A 2AC3A 2QOQA 4LV8A 4EH7A 4BZOA 4L45A 4D0XA 2UW9A 3DKOA 2WO6A 4W4YA 4F7JA 1QPCA 1YXVA 2WMTA 2RIOA 2JIUA 4XLIA 3PXRA 1YHWA 4HYSA 2X9FA 4XUFA 5D1JA 1PRYA 4FVRA 2Z7RA 3NYXA 2UVZA 4H3QA 4D2PA 2W06A 1FQ1B 3F7WA 4XG9A 4B99A 4BTFA 2PULA 4QPSA 3BQCA 2P2HA 3NW6A 3NPCA 3PG1A 3GCVA 4JG6A 4QMVA 4UZHA 5AR7A 3UZTA 2RGPA 5E9EA 3HDNA 5HTBA 3IDCA 3UPXA 5D9HA 4DAWA 5KMOA 2XZSA 3BQRA 5DN3A 2R2PA 5HBHA 4A7CA 3ZZEA 2WD1A 4UZDA 3IW7A 4N0SA 2UUEA 2WOTA 3MN3A 5C4LA 1JAMA 3E5AA 2XNMA 2FA2A 5ANGA 3QQJA 3H9OA 3WYYA 3QALE 3CS9A 1OECA 3NNWA 4FSNA 5EHYA 2VX3A 4D9TA 1YKRA 3KA0A 2IVVA 3BIZA 2C3LA 3H30A 4HYUA 2WMWA 3FSFA 4BBMA 3P86A 5IQAA 2VWYA 2X39A 3LFSA 5TR6A 3L9LA 4BL1A 2ITXA 5IUGA 4BTKA 2JDTA 4E5WA 1YXUA 4U80A 5L8JA 1VR2A 3I1AA 4QMSA 2J0LA 3HV6A 2YEXA 4GVAA 4BICA 3ALOA 3PFQA 2Q0BA 3CLYA 4AW5A 3C4ZA 1KE7A 4WRGA 4DT9A 4YC6A 5BYZA 2RSVA 3DJ7A 5FLFA 2CNQA 3G6GA 4GYGA 3PJ3A 3R8PA 5BX0A 4OTIA 4BCGA 2YAKA 2GNHA 2PVHA 5FD2A 5M4FA 2G01A 5HD4A 3VS2A 4XOZA 5C26A 5IEVA 3HDMA 2VWZA 3R73A 3B8RA 4IE9A 1TKIA 3R2YA 3GU4A 3LXPA 4DG2E 3CIKA 3K54A 3ORLA 1Q41A 4PPAA 4C8BA 2ZMDA 3UOLA 5LVLA 2QOKA 5CAVA 5JGAA 2OF4A 2PSQA 4O7WA 4AE9A 2JBOA 1LUFA 3DXNA 4KIKB 3W8LA 3FMHA 4NM0A 1H1SA 4D5KA 4K1BA 2VTRA 3QTQA 3DJ6A 4BC6A 4F9YA 3UZRA 3KF4A 1ZARA 3PA4A 4IWDA 5EDRA 4FEXA 1H01A 3HRFA 4FSMA 4CTCA 3TWJA 4PDOA 1W83A 5CAUA 4GK4A 4QMWA 2GNLA 2UW8A 4O81A 3GEQA 2ZB0A 3QFVA 1CTPE 4S31A 1J1BA 3VJNA 4QMXA 3QRTA 1ZOEA 4EORA 3TZ7A 4BI1A 5IA4A 2OIQA 4LOOA 3N4VA 4RT7A 4U7ZA 4W8DA 2R3OA 3SW7A 3NUAA 3VS6A 2JKMA 3O7LD 3OFMA 4YBKA 1UNLA 4H3BA 4FV6A 2BRMA 3MI9A 3GXLA 3VRYA 5J7HA 4A9UA 3P4KA 3V8SA 4MYGA 3OW4A 4RQVA 4XCUA 4IDTA 3UOHA 4A4XA 5HICA 4FSRA 3IECA 4BRXA 4QMPA 4EC9A 3AT4A 4XNEA 4R3PA 1GIIA 4RWIA 5J1WA 4MXAA 1UKIA 4OTGA 4IBMA 4H1MA 2OLCA 3JPVA 1Q8WA 4GFGA 4C3RA 2EB2A 3VBVA 2NRUA 4EC8A 3NUNA 3A7HA 4A9YA 4LYNA 2JBPA 4F0IA 3VWAA 4I6FA 5HU3A 4RWKA 2BCJA 4Y72A 4RX7A 4RJ6A 4FYOA 2WTJA 5CVFA 3U8WA 4F9AA 1ZZLA 2A4LA 2HK5A 2PUIA 2X8DA 5EFQA 4UXLA 4F4PA 4M68A 4S2ZA 1JSTA 3TL8A 5GIPE 3LMIA 4I0SA 2WMQA 3I6WA 4L67A 4X2FA 1KE9A 2OJFE 3UZPA 5AV3A 4GG7A 5AUWA 4L01A 4D5HA 3F3TA 5IQFA 4ZTMA 4EBWA 4RC4A 4AXAA 1SM2A 5JEBA 4TT7A 1OL6A 3B2WA 3E3PA 4MVFA 4OTWA 1AQ1A 4Y8DA 3V6SA 3BZ3A 1Q8UA 4KSPA 1R1WA 5DEYA 4BDCA 4C37A 2BMCA 4F63A 5LVPA 3R63A 4R3RA 5KHWA 1GZKA 5ACKA 4CV8A 2VWXA 5L6OA 3FY0A 3T3UA 4BHNA 4IVBA 3VUKA 4BCJA 1DI9A 3LFBA 3V5JA 5M53A 2G1TA 2XJ1A 1UWJA 3G33A 5HE0A 4CZTA 3Q53A 5A6NA 3NVKI 4FT0A 3TZ9A 3KXMA 3GU7A 3DY7A 4L9IA 4N57A 1OKWA 4ITHA 3M11A 5CZHA 3RZFA 4L00A 3KMMA 2WEIA 1MQBA 4FIJA 1YWRA 2CHLA 2XH5A 4IVAA 2CGXA 3R1QA 2C6KA 1OKZA 1WBSA 3ZC6A 4AN3A 1YI3A 2YCFA 1YOLA 3DK6A 3ZFXA 4E6AA 3S1HA 4L53A 4WRSA 1H08A 1SNUA 5GZ9A 2IO6A 1G3NA 3R22A 4U43A 4BCHA 3QTSA 4XP3A 2YN8A 4MNEB 4I5HA 3DK7A 4RSSA 1U54A 3BCEA 3LFDA 4NCTA 4CV9A 3EZVA 3PVBA 5EW3A 3AT3A 4MD9E 5HLPA 3R28A 3PA5A 2X6EA 3O2MA 4I0RA 2PZ5A 5H8EA 3JXWA 3QD4A 3T9TA 2UW5A 4R6VA 4AF3A 5A4CA 3OCBA 3RPVA 3QCQA 2ONLA 3QYWA 3LOKA 2OIBA 2BR1A 4O6EA 4ZSAA 4XV2A 4Y5QA 3ALNA 4QP3A 4W9WA 4I22A 5JT2A 3NYNA 2EB3A 5DPVA 1LEZA 4KAOA 3UVQA 4KINA 5JRSA 3O50A 5FM2A 4CNHA 4X0MA 2VO6A 5CT7A 2C69A 2G2HA 2OJIA 2V62A 4JBOA 4NCTC 1Z5MA 3LFCA 1ZMWA 2ITZA 5EYMA 3MFSA 3FPQA 3WI6A 3UQCA 3D2KA 4YZMA 3ANQA 2XKDA 3ID6C 3QD2B 1OIQA 3R1SA 2ONLC 2RFDA 4BDGA 4EOQA 3H10A 4CRLA 5K3YA 3MY0A 4GKIA 3IPHA 4HPTE 3EN7A 4MXYA 3RWPA 3GENA 4Y5HA 4ZSLA 3ROCA 3V8WA 2JKQA 5EI8A 5L6PA 4RIOA 3COHA 2J5EA 1PXIA 3TJCA 4YTHA 5HVJA 3GBZA 5FQDC 2WHBA 4RVLA 3FXWA 3GU5A 3AC8A 4MD8E 3ZLXA 4XG7A 4BIBA 2GNGA 4CFWA 4E73A 4M12A 4C62A 3ELJA 4FYNA 3JVRA 5GHVA 1QPDA 2W1GA 2BRNA 1SZMA 2XKEA 5L2IA 4GJ2A 3PA3A 3NUYA 4DEEA 3BYOA 5E8TA 4K2RA 4AOIA 3R9NA 5AFVA 5DBXA 2EWAA 1IG1A 2H8HA 2BFYA 4YJNA 4JAIA 2CSNA 3UPZA 2OSCA 4E4LA 4U0IA 2C0TA 2E9UA 4QYYA 4DFUA 2ZJWA 3LLTA 4FSQA 3ZEWA 2GU8A 3SGCA 2X7FA 2VNYA 3EB0A 2OZAA 1XBBA 2YDIA 5AR3A 1GNGA 4BI0A 4MEDA 2R64A 4E93A 1VYWA 3KEXA 5C9CA 1Q61A 3LM5A 2I7QA 4O7VA 2YIYA 3P0MA 4E6QA 3ORNA 4UX9A 4FKUA 4RJ3A 4RQKA 4U3YA 5IH6A 4KRCA 4CRSA 2QVSE 2IW9A 4EHZA 2PPQA 4TYHA 1Q99A 3SXRA 1OUKA 3UJGA 4UV0A 4I1ZA 5AIRA 5KMMA 3VBYA 3UC4A 3R21A 3EH9A 2ACXA 2UZBA 3PXFA 3ZM9A 4USEA 1I09A 4RIYB 5HE3A 2X7GA 3EFKA 1B38A 3NZ0A 3DAJA 1DAWA 2BVAA 3QQHA 4QMLA 2XM8A 2WMSA 4H39A 1YXTA 3MYGA 4HYHA 4MX9A 4E3CA 2WMUA 4C4FA 2QONA 5JKGA 2OFUA 3ORTA 3A60A 3QBNA 4EHGA 4DTKA 5CAQA 3CJGA 5LVMA 2CGVA 4O21A 3LMHA 2XMYA 3QUDA 4BDKA 2GTMA 3WF9A 3R7EA 4WBOA 1BKXA 3MPMA 4GFOA 2C1BA 3RK9A 4DCEA 3U6JA 5CU2A 5IA0A 2CGUA 3KULB 4NSTA 4FOCA 4GFMA 3BELA 2WTKB 4CFNA 2UW3A 3I81A 2OXDA 2UZEA 3PXZA 3UNKA 3QLGA 3QXOA 4GKHA 2UZUE 2XRWA 2A19B 2XKFA 3ZBXA 1XR1A 4R3CA 4ZSEA 2QNJA 3QCSA 5HTCA 4MKCA 3F2AA 4K0YA 4DGOA 4D2WA 5HG7A 4RFYA 3C4FA 3ZONA 5LOHA 3BHTA 3SDJA 3FZ1A 2QKRA 4G3GA 1GIJA 3QD3A 4FOBA 4Y73A 4BCIA 3ULIA 2NP8A 5DRBA 3H4JA 4IX5A 3C5UA 4ZEGA 3L9MA 2VTQA 3QRJA 3COKA 4FV4A 4KKHA 3U4WA 4O7YA 3OEFX 4QMOA 2VU3A 4EUUA 3BWJA 1RJBA 4EOPA 5C8MA 2HIWA 4AAAA 5BYLA 3HMOA 2XUUA 4Z7HA 1IR3A 2VD5A 1ZLTA 4EK5A 3ACJA 2VX0A 4IZYA 3Q5ZA 3ZS5A 4FSTA 4ANSA 4C58A 4DEHA 5CAOA 5LMBA 4USFA 5AX3A 3OCTA 5H8GA 2BRGA 4OW8A 4L3PA 2OKRA 2XF0A 5IDPA 2XM9A 2SRCA 4LUEA 5D7AA 2BTSA 1O6LA 5FP6A 2B52A 4TNBA 4U9AA 3NSZA 4UMTA 5HX8A 4APPA 3ORMA 5EKNA 4PQNA 3VBWA 3VUIA 1MRYA 2R3KA 3SHEA 2YIRA 3TDVA 1JLUE 4FX3A 3QWJA 3DTCA 3FI2A 3F82A 5A14A 3UDBA 4QMMA 5IF1A 3L9NA 3PTGA 1IEPA 3R71A 1UU7A 3MPAA 3SD0A 3PY3A 1AGWA 2VWVA 1LEWA 2WU6A 3CTJA 3IGGA 4AT5A 5J5TA 5CEIA 2R0IA 3Q6WA 2Y4IB 4YZDA 5KMIA 2R5TA 1H1QA 3COMA 5FXQA 1A48A 1OL1A 1T46A 1IAHA 4G3DA 4CMOA 3WOWA 4RWJA 4O84A 4AE6A 3GU8A 2IN6A 4YLKA 5IPJA 2Y7JA 3SAYA 2EVAA 5HI2A 2R7IA 4FF8A 3M1SA 1Q3WA 3WZUA 2IZUA 3LE6A 5D7VA 1WBTA 3C5IA 2B9HA 2YLFA 3VO3A 4DFLA 3Q4TA 4ERWA 4TWCA 5FDPA 3RPOA 2CCHA 2Z2WA 1TVOA 1ZRZA 3L9PA 3P5KA 5CSWA 3RI1A 3S4QA 2Y6MA 4ZTHA 5CEPA 1UU9A 5B2KA 2FO0A 3GCSA 5M55A 5CEQA 2F7XE 3QHWA 2BROA 2QU5A 3O71A 4IAKA 4Q5HA 2YA9A 1XWSA 2G2FA 5JMSA 4CG8A 2XIRA 3RAHA 5E4HA 5ANDA 2DWBA 4IX6A 5AP4A 3FMEA 2X2KA 5HGIA 4ACGA 5BVFA 5CF6A 4LFIA 4PMPA 5IISA 4IW0A 4KWPA 4IADA 3BGQA 3MIYA 4I5CA 4C38A 4V0GA 4YLJA 1XH9A 5M07A 5CI7A 4TWOA 4YR8A 2QI8A 3LCDA 5ETAA 4OUCA 3MY1A 3QZGA 1CKJA 2PZPA 4NM5A 2VNWA 3BU6A 4ANNA 3GT8A 4D2RA 5HG8A 1P4FA 4NKAA 3SOAA 2UZVA 5HNIX 5M51A 5CYIA 4ASZA 3EMGA 2WMAA 3FHIA 3K5UA 3LLAA 3AD4A 4LL0A 4YTIA 4C34A 5DWRA 5E7RA 2O8YA 3ORKA 4IZ5A 2VTLA 4J53A 5M56A 4BR3A 2CKQA 3K5VA 2Z8CA 2FGIA 5E8YA 1Z57A 4L6QA 3DFCB 3E63A 3U4UA 2XNEA 3OS3A 5CU0A 3UTOA 3AC1A 3GCPA 2BIYA 5FEEA 3RPSA 3PJCA 4U45A 4ANOA 1B6CB 3C9WA 3PZEA 5CF8A 3A62A 4RX5A 4NL0A 2ITOA 4B8LA 3DLSA 1M2QA 3QTIA 5I9VA 3ERKA 2PMIA 4IB1A 4KBAA 5A54A 4WUNA 5B2MA 3LIJA 4OTPA 2X9EA 4HNIA 2YACA 3FAAA 2GTNA 2AC5A 1M17A 1SMHA 4X2GA 4UYAA 4C61A 4A06A 3EFLA 5AAGA 1ZYCA 4LQMA 3HA6A 4J71A 2B9IA 3QKKA 2W1ZA 4FKRA 3PWYA 3MFTA 4ACDA 2UW7A 2VZ6A 4YPDA 2HY0A 2I6LA 4FTJA 1ND4A 4I41A 4B7TA 1URCA 3FY2A 2E9NA 3KXHA 1ZXEA 2VO3A 4ZTNA 3DJ5A 4JDKA 2QO9A 3MB7A 4J99A 3CKXA 2PZIA 4ZLZA 3R9RA 2HYYA 5E8XA 1H1RA 4RJ4A 4CCBA 2RFNA 2ZAZA 4EI4A 3A4PA 3JY0A 1U5RA 5GZAA 3QXPA 2VWIA 3KFAA 1REJA 4B6LA 1YDRE 3HA8A 1Y8GA 2UW4A 2BILB 4LG4A 5HORA 4Z3VA 1S9JA 1GY3A 2C3IB 2PVRA 2YM7A 2V5QA 5DT4A 5HKMA 4FKOA 5F94A 5IH4A 2QOBA 4BWXA 4FC0A 1CKPA 4KA3A 4AW2A 4PNKA 5C03A 3D83A 4TWNA 3DQWA 3KK9A 2WOUA 2HZ0A 3E3BX 3ZHPC 4DN5A 3A7IA 2GQRA 4K9YA 2C3KA 3LFEA 1HCKA 3H0YA 3V3VA 5DHJA 4J8MA 4JQEA 2JEDA 1ZYSA 4FG9A 5E8VA 3UOKA 1OMWA 3DBFA 4E8AA 4IAAA 4YO4A 5CVHA 2PE0A 4BIDA 3UC3A 4D1SA 3MJ1A 2UZTA 2JITA 4EYMA 3W33A 1G5SA 5HBEA 3RGFA 4HOKA 5HCXA 4BCQA 5KCVA 4U3ZA 2KULA 2JC6A 3CY3A 2ZM1A 3MW1A 2XIZA 3NYOA 4G1WA 3TIYA 3VBXA 4GVJA 4KIPA 3P79A 3I5ZA 3N9XA 5DGZA 2FSOX 3DK3A 4MBIA 3R8ZA 4I5MA 1F0QA 4R5SA 4ZZMA 3NCZA 4YNEA 3HRBA 5EW8A 2C6IA 4HGTA 1ZOGA 3PXQA 3IOPA 2RF9A 4XBRA 4F1OA 1OITA 5CQWA 4EUTA 5L2TA 4FTCA 1BUHA 4G16A 2UW6A 4G5PA 5TKDA 3C4CA 2H96A 4YJTA 4C35A 4CSVA 1SVGA 4G3FA 3CSVA 4U81A 4EZ7A 4ZLYA 2YABA 5KNJA 4PF4A 1IA8A 2F9GA 3TDWA 2C1AA 1OKYA 4P7EA 2WELA 2OWBA 3UE4A 3D5WA 4QMYA 3R8LA 4JVGA 2R3RA 4DGLC 2KTYA 3LMGA 5B2LA 3WE8A 3BLHA 3NUUA 1YXXA 4G6NA 4U40A 5CX9A 2WTWA 3MVJA 3NW5A 4AFEA 4F6SA 3AQVA 2CLXA 3UP7A 4DFXE 5IA3A 3RM6A 4YJVA 4LGGA 3TACA 4TNDA 4E6CA 1U54B 3EQFA 2RL5A 3FPMA 2J6MA 2XK9A 4E5BA 4GYIA 4EQUA 1OVEA 3RP9A 5CXHA 4ORKA 4K33A 4NWMA 5J9ZA 3G6HA 1KE8A 3KVXA 3KY2A 4E1ZA 4BZNA 4R77A 1UU3A 1Y6BA 2W9FB 2WZJA 3EQIA 3HMMA 4I93A 4O0VA 4RIXB 2XIYA 3QGWA 3QQUA 3UNZA 3ZLYA 4BI2A 3MWUA 3LKMA 4U8ZA 4ZY5A 2UV2A 4FKGA 4BCOA 4O96A 2CDZA 3W55A 1H8FA 4FIEA 5F9EA 2YM4A 4CFMA 3W16A 4ZJVA 3BHUA 5CVGA 1PF8A 5HESA 4M14A 3QZHA 5T68A 1NT2A 4DFBA 2YDKA 3MBLA 5JK3A 1J1CA 4FZ6A 4CMTA 2I40A 4C4GA 4JIKA 4FZAB 3WF5A 4FTLA 5CNNA 5C27A 3EL7A 3FMLA 5JZJA 4QPAA 2FSTX 3H9RA 4U5JA 5CENA 3CXWA 2PTKA 5HCZA 5DLSA 4BKZA 3TKHA 2HW6A 1W98A 3Q4ZA 4PDPA 4XEYA 3MGYA 4X3JA 5LVOA 2IVSA 2VRXA 5CZIA 3KREA 2I0VA 2HZIA 3HNGA 3MA3A 3I7CA 4FVQA 4BWKA 2YERA 3CBLA 5AUXA 4TL0A 5JFSA 1ZYLA 4BCPA 4FTAA 1H27A 2Q83A 2GQGA 2PE2A 3DCVA 3QL8A 4OT6A 1WBNA 4A9TA 1WBWA 2IZTA 4NTTA 4KBCA 4C36A 4IJPA 3ZM4A 4ZY6A 3SVVA 3UNJA 3QU0A 4UWYA 2XK8A 5EHLA 4EK6A 4F9WA 2B55A 4E4MA 4IM3A 4OBQA 4HVGA 3MTLA 1YHVA 1UU8A 4C4HA 4AZVA 4QQ5A 4FKIA 2PHKA 2JDRA 2YFXA 4G31A 3RBWA 3LPBA 5IDNA 4MXZA 4H3PA 4R78A 2PU8A 2P4IA 2R3IA 2VTJA 4QD6A 4RGJA 4M97A 1NVQA 2FUMA 3RVGA 3ITZA 2QC6A 5KZIA 3KXGA 1AD5A 3II5A 4FSWA 5CTPA 5TOZA 2QR8A 3H0ZA 3R2BA 4EYJA 4DEAA 4PL4A 4D4VA 3EZRA 5IA1A 2W05A 3MY5A 3DAEA 4XBUA 4NUSA 3R83A 2GHGA 2XB7A 4F0FA 4J97A 2ITVA 4EBVA 1M14A 2W99B 4FKJA 4CFFA 2HOGA 2X8IA 4AT3A 2J0MB 3QTUA 2X7OA 4PL5A 2CCIA 2NPQA 2R3NA 4G6LA 1OI9A 5IUHA 1YOMA 3FLQA 2A27A 4F99A 3VF9A 3VW8A 5M4CA 4CGAA 5ACBC 2R3FA 4GG5A 2QHNA 4FKVA 3OHTA 1TQIA 4IACA 2R3QA 3VUDA 2WKMA 4ASEA 1GZOA 1U4DA 2OF2A 3POZA 3PVUA 1OIUA 4K8AA 4XX9A 5HHWA 4FGBA 4QMZA 4FE2A 3NX8A 4JG7A 3M42A 4BTMA 4DCAA 5IQGA 3IDBA 2UZNA 2E9OA 1OBDA 1M2RA 2ERKA 2ERZE 2GS2A 4NIFA 4FEQA 4FIHA 2XRUA 2O2UA 2QOOA 3RAWA 3QTZA 1IA9A 3D15A 5AR8A 1M2PA 4EK3A 5JRQA 3GVUA 5KO1A 5GNKA 1YDSE 4EOMA 4S32A 5HU9A 2FSMX 3BU5A 3Q4CA 2VO0A 4R8QA 1PHKA 4TYIA 2YJRA 2W9ZB 3EQPA 5E1EA 4CEGA 3CPCA 4P5QA 3PPJA 4J8NA 4H1JA 4BGHA 4Q9SA 4IANA 2FYSA 1PMUA 4MXXA 1WFCA 2Q0NA 4AGDA 3D14A 3O96A 2JD5A 3IG7A 2O63A 4ZTRA 2E2BA 3E8NA 4I23A 1PMNA 1NA7A 3R00A 4KBKA 4NK9A 3W8QA 4CKIA 4DHFA 1W82A 3OT8A 3CGFA 4J7BA 3KCKA 3MTFA 4C57A 2QLUA 5HQ0A 3LZBA 5JGBA 3KRJA 3GC0A 1XH5A 1Q24A 4QYEA 3GC7A 3BU3A 3ANRA 2YM5A 4LMNA 3PYYA 4XLVA 5DA3A 4W8EA 1JSVA 2PVNA 4G9RA 5M06A 1E9HA 4OTDA 5EI6A 3U54A 4NM7A 4EQMA 4YU2A 3HEGA 3ZRMA 4KABA 4DGNA 2G9XA 5BUIA 2OJGA 3Q2MA 5IEYA 4AUAA 1FMOE 4L52A 4PMTA 4QNYA 3ORIA 4XRJA 4LI5A 4EOSA 5IQIA 3WF7A 2C5YA 3MS9A 4W9XA 3S2PA 3ZO4A 3GGFA 4BKJA 3BYSA 3TV7A 1XQZA 2QQ7A 1OGUA 1YW2A 2QO2A 4FV2A 2BHHA 2JAVA 2OJ9A 5CY3A 4Q9ZA 2IZRA 4EH3A 3G15A 4HVDA 3SXSA 3GQIA 5CS6A 4H05A 4RWLA 2G15A 4BIEA 4L7FA 1Q8YA 4ITJA 4J1RA 3D5XA 3ORZA 3FJQE 4RVTA 3MFRA 4NM3A 4PDSA 2P0CA 5HNGA 5G6VA 3MJ2A 2WQBA 3A99A 2YAAA 3H3CA 4D55A 3HAVA 4EZ5A 4F70A 2C4GA 4D2TA 5GJDA 3S00A 2Y0AA 4O7RA 5DFPA 3PXYA 3Q9WA 4CYIA 3HRCA 3QKLA 2WQOA 3Q9YA 4FT3A 4U44A 5I5ZA 1QL6A 4LMUA 2EXEA 4GSBA 4OBOA 4CQGA 4EONA 4OAVB 2WMVA 4NZWB 4BY9E 2H34A 3ZEPA 4ZZNA 4DEDA 4R7HA 2A2AA 1OIYA 4C3FA 4UMRA 5HZNA 5LJJA 4E6DA 5K0XA 3UBDA 3QRKA 3HGKA 4X7QA 4DINA 5HEZA 4RMZA 4YPSA 4MAOA 2WQMA 5AA8A 3PPZA 4J98A 2CKPA 5E8WA 3W2RA 1R0EA 3IQ7A 3OTUA 4M66A 4QP6A 3BYVA 4O91A 4YC8A 5HE1A 4PRJA 1FINA 3A8XA 4FV3A 3TUBA 4Z7GA 4CMUA 4NU1A 4RX8A 5KMJA 3OOGA 2PUNA 1YRPA 4UWBA 2BUJA 4MD7E 3LFQA 2CGWA 4L44A 1KUTA 3BHHA 5BVEA 1VEBA 4QP1A 4WG3A 5ETCA 3DNDA 3QZIA 4M7IA 4ACHA 1A9UA 4O0RA 3EFWA 4D1XA 3E87A 2X1NA 2B54A 3ORPA 3Q5IA 4P2KA 2OIDA 5EOLA 4BGQA 3PZHA 3NYVA 5FXRA 4QNAA 2WMBA 3DKCA 1JPAA 5J8IA 3RWQA 1PXKA 5BVNA 5AEPA 4LM5A 1Q8TA 4ANBA 4CTBA 4GU6A 4EHEA 1PYEA 4WG5A 3TNQB 4QQJA 4GT4A 4GUEA 4ZY4A 5AUYA 3UO5A 5JQ8A 3WIKA 4CQEA 3EHAA 3KQ7A 5KKRC 2PVLA 5AUZA 4FK6A 4RIWB 3PSBA 1B39A 3QGYA 2OXXA 1DI8A 3VJOA 4QMUA 3CTQA 4UMUA 4RPVA 1ZMUA 4AZWA 2NNWB 4XOYA 2JAMA 4M69A 4WA9A 3TNIA 4BDJA 5LVNA 4RX9A 4RFMA 5J1VA 2C3JA 3LQ3A 3NMUF 2WIPA 4QYHA 2QHMA 1H28A 4CVAA 4HCUA 2XBAA 1YQJA 4O38A 3NWWA 3L8PA 4H36A
chains in the Genus database with same CATH superfamily
3LAUA 5AV1A 2WTVA 4QP9A 4C2VA 4GU9A 3NIZA 2VWWA 1H00A 2PZRA 3OWKA 3RJCA 4F65A 2E9VA 4O1OA 3UYSA 5EHOA 4BDEA 4DHZA 5M08A 3OWJA 3PP1A 3FC2A 5IUIA 3CKWA 3VONA 2FH9A 2OU7A 4OLIA 4MUQA 1K2PA 4FTMA 4BKYA 1IASA 2V0DA 4FI1A 5KUPA 3ZFYA 4ZS4A 4GJ3A 3HP2A 2IWIA 3PUFC 1FGIA 1FVRA 5CSVA 3NEWA 4YHFA 3P7BA 3VS3A 3MFUA 5IQCA 4IAYA 3LQ8A 1H25A 5BMSA 1QMZA 3R8MA 4D0WA 3ZYAA 4FSZA 4IM2A 4FV9A 2BAKA 5BYYA 4LV5A 4X3FB 3KVWA 3ZMMA 2XNPA 3U55A 4WT6A 1HOWA 2JKOA 1XH7A 4L43A 5DT0A 5I3OA 3PSCA 3U51A 4AACA 3Q2JA 3IW8A 1JKLA 2R3JA 4BDBA 1BI7A 3L1SA 2GNFA 2QKWB 1KE5A 2O0UA 3PVGA 4DFZE 1ERKA 4G9CA 4BTJA 1MUOA 2QO7A 3BX5A 3EQHA 4TW9A 4ONAA 3QYZA 3DGKA 3VIDA 4BYJA 4F0GA 3OCSA 4XV3A 4HVIA 1OKVA 2V22A 2PWLA 5H2UA 3UIUA 2X2LA 2ZV9A 5M09A 2BAJA 5EYKA 4LRMA 4RFZA 1K3AA 4DA5A 1R39A 1ZY4A 4FUYA 4P4CA 4JBVA 3AMYA 1JQHA 2WTIA 3NFGB 4J52A 2Z60A 4WNKA 4MBLA 2OH0E 1H1PA 2EUFB 2VUWA 4II5A 4IVCA 1P4OA 1Y91A 3F88A 3CD8A 2PE1A 3LFNA 2R9SA 2VV9A 2ITYA 4FZFB 1J91A 4UWCA 2BKZA 4CFVA 4FEUA 3MDYA 3FZRA 2HXLA 4KS8A 3V8TA 3FKOA 4AA0A 3BHVA 3PXKA 4MBJA 2CKOA 1XO2B 4MHAA 4YJOA 4E5AX 2NO3A 4I6QA 2VWUA 1V1KA 2CMWA 4KD1A 5BVDA 5D10A 4ZMFA 5J87A 3WIGA 2XARA 4BJJA 4CG9A 3V5QA 4WSYA 2W1HA 4WD5A 2I0YA 3UMWA 3VBQA 3VVHA 3VNTA 3G90X 3FL4A 4PTCA 2HXQA 3S95A 3VUGA 3ROYA 2C6MA 3LXKA 3WBLA 3ZO1A 3LJ1A 2PVFA 1JWHA 2ZYBA 3NAYA 3EN9A 2RFEA 3TUCA 3MH2A 3OMVA 4XH6A 4HCTA 4MWHA 4DG3E 5LCJA 4LL5A 4ENXA 1WMKA 2JDOA 4AGUA 4I94A 4GH2A 2RG5A 3C4WA 4KIOA 4YBJA 5GJFA 5KZ0A 4A4LA 5LWNA 3CY2A 3PSDA 1WBVA 3F5UA 3NW7A 4QP8A 3C51A 1ZZ2A 4RVMA 4EK4A 4OAUC 4RA4A 4DE4A 4ZS0A 1VJYA 3EOCA 3FKLA 4DTAA 3FZPA 4I5PA 3HMIA 3K3JA 2QR7A 3PY0A 5IA5A 1XMMA 1RE8A 4PY1A 3A7FA 3L8VA 4M0ZA 4I92A 4O4BB 5JQ5A 2DS1A 4B8MA 3SA0A 5DVRA 3V5PA 2O5KA 4F09A 4JR3A 2GHMA 4I20A 3HECA 3P5JC 2HELA 3UP2A 4FNZA 3ZCLA 4GIHA 2C0OA 4FA2A 4LOPA 4BBFA 2C6TA 2OFVA 2W5BA 5CANA 4D1ZA 2OG8A 1Y6AA 1PXOA 4M0YA 3D7TA 5AUVA 3MH1A 5AP6A 2C5NA 4PDYA 2W1DA 2H9VA 1JNKA 3DPKA 2GHLA 3KL8A 5F1ZA 5M4IA 4K11A 3CCNA 4IB0A 3RINA 3UG2A 4QP4A 4YJRA 1WZYA 4LGHA 2JIVA 1E1VA 4TYGA 4C4EA 5IZFA 3OF0A 3TV6A 4N6ZA 1TQPA 4WNPA 3HLLA 2ZV8A 4USDA 1W7HA 1CKIA 3D5VA 4ZIMA 5E8UA 4ARKA 1ZY5A 1DS5A 4G3EA 4WUAA 2CNVA 5CU3A 4HPUE 2FB8A 4TN6A 1YVJA 2C6OA 3OXIA 2VN9A 3FHRA 1FPUA 4XMOA 3EQRA 5FDXA 3D0EA 4ZXTA 4EJNA 1J7UA 2GQSA 3R9HA 1MRVA 4FIGA 4PL3A 4RC3A 3ZUVA 2BDFA 4MQ1A 5AR2A 4ERKA 4C3PA 1ZAOA 2WGJA 4XV9A 2Y9QA 2XA4A 2YIQA 3F5PA 3HV7A 3KXNA 3ZSGA 4F78A 4QMQA 3I5NA 5ANKA 2QG5A 2PL0A 3THBA 4BDDA 3W2SA 3QQFA 4YZ9A 4A9SA 5KHXA 1JVPP 1OBGA 5LMAA 3AKJA 5EYCA 4FV8A 4DBXA 1ZYDA 5BVOA 3DU8A 4AGWA 4AFJA 2IVUA 1O9UA 3UGCA 5EK7A 4CKRA 3RAIA 3LW0A 5A4QA 3AKLA 4ZTQA 4AXEA 4BDAA 3OP5A 1EH4A 4FICA 4GIIA 4N4SA 4NYEA 3IS5A 5CAPA 5HLNA 1QPEA 3AXWA 3AKKA 4FKQA 2VTIA 5C1QB 2XP2A 3IK3A 3E8DA 3DXQA 3I0OA 2PMLX 3BEGA 3EKKA 3PWDA 4BYIA 4EKKA 1F3MC 5IU2A 2VTHA 5TE0A 3PPKA 5K5XA 4O27B 4FEVA 2YITA 4MF1A 4KSQA 3ZO2A 5I4NA 2XK7A 5HBJA 5FRIA 2J0IA 2XS0A 3EQDA 5CF4A 5KBRA 2W5HA 1DM2A 3FLWA 3MIAA 5ICPA 3E88A 2C5XA 3Q52A 2YDJA 2A0CX 2ITQA 2ZDTA 2ETMA 2VX1A 1OUYA 2W1FA 3DA6A 3HX4A 3PE2A 3REPA 4ALVA 1H24A 2W1EA 3QCXA 1NVSA 4MNEA 2Z7LA 4QYGA 5CI6A 2GFCA 3U9NA 5EH0A 3ZLWA 5C8NA 2WTDA 5FP5A 3TG1A 3IKAA 3KB7A 3VUHA 4BB4A 1ZOHA 3QC9A 4O83A 3LFAA 5GJGA 3RPYA 3FXZA 4JAJA 3VS0A 3GU6A 2R0UA 2XK6A 1XBCA 2JIIA 2PZYA 4EHVA 3DB6A 3FMDA 1S9IA 2F7ZE 1E1XA 3BBTB 3JUHA 3ORXA 3R6XA 4HVSA 2ZV7A 4RLLA 3AC3A 5AIKA 5DR6A 3W32A 3ZU7A 2F4JA 1WBPA 2FVDA 4XG8A 4D4RA 1MQ4A 3C4XA 4L7SA 4RLKA 4RA5A 3W1FA 2WMXA 4ALUA 2W5AA 3D4QA 1IRKA 4KS7A 2PMNX 5BUJA 5HO8A 4E26A 3E62A 3HV5A 2YIWA 2OO8X 1PW2A 5K4JA 5DNRA 3BYUA 3DOGA 4IB3A 5CNOA 5I3RA 4OBPA 2VAGA 3DLZA 2DUVA 4IC8A 3BGPA 3TKIA 2GFSA 5FG8A 1Q3DA 1YDTE 2OJJA 2QOFA 2P2IA 3P7CA 4GRBA 2VTPA 4C59A 4BFMA 3NR9A 2NRYA 3D5UA 4BCKA 4OT5A 2ETRA 3BHYA 4J96A 3FQEA 4O0WA 2AYPA 4XJ0A 3VRZA 4F7LA 3FLNC 2RFSA 4ANQA 4P90A 3T9IA 4GK2A 4QQCA 4S30A 2Y4PA 2C6LA 3HVCA 5AAEA 3VN9A 3EN4A 2VTSA 4ZTLA 4JS8A 2ZB1A 4Z9LA 4NEUA 5DE2A 3CEKA 3EQGA 2XCKA 4CXAA 2V55A 1BYGA 1H07A 3ZTXA 2B4SB 3QA8A 3E8EA 4B9DA 5JFVA 3RAKA 5DEWA 3GP0A 3UIBA 4ANMA 4K18A 2QD9A 4AW0A 2XEZA 2I0HA 3OZ6A 4I0TA 4NJDA 4C02A 3AD6A 1LP4A 3FDNA 2P3GX 3FI3A 4CKJA 3BGZA 5CSHA 2QLQA 4AA4A 3TM0A 3G9NA 1CSNA 4YNOA 5FGKA 3VQHA 3AD5A 4O7TA 3BBWA 1FVVA 4MWIA 4FKLA 4RIYA 3OWLA 4PTGA 3AT2A 3CQEA 5FTQA 3R7UA 4IZ7A 1V0BA 3I60A 3EQCA 4GCJA 3UYTA 2W17A 1JKKA 3E8CA 2HZ4A 3G2FA 3VC4A 1XH8A 3PRFA 5AP1A 3WF6A 4BWPA 3RZBA 3FLYA 5HO6A 3RKBA 3K3IA 3BKBA 4QTEA 1SVHA 2BDWA 1HCLA 1Q5KA 3RNYA 2OW3A 4C33A 4XHKB 5BPYA 3VQUA 1PMEA 1V0OA 1Q4LA 3KRXA 1KWPA 3CJFA 1P5EA 4L42A 4U79A 4ZSGA 3BYMA 4AG8A 2X2MA 3ATTA 1M7QA 2YZAA 1WVXA 5JFWA 2OI4X 3KULA 2GS6A 4YGAA 2J4ZA 2C0IA 3LXNA 2IVTA 4TWPA 4UMQA 4FIFA 4CT2A 5IQEA 2ITNA 3IO7A 2C47A 5KE0A 3DBQA 3OUNB 3PJ8A 4EH2A 5BVKA 3FUPA 4AW1A 4U41A 1KOBA 4ZP5A 1H0WA 4FTNA 4BDFA 3KXXA 4F6UA 3B8QA 5AMNA 4Y85A 5GINE 2XEYA 3O17A 2PK9A 4UEUA 5E8ZA 5HIEA 3IGOA 4GEOA 4FR4A 2PYWA 4YJSA 4EH4A 3AC2A 2HW7A 4WKQA 1U46A 5AAFA 3P1AA 3FBVA 2B1PA 4E20A 2XKCA 4O86A 1WVYA 4M69B 5E92A 4JRVA 4M15A 3HV4A 1NY3A 3LCTA 1R78A 3A7GA 4I3ZA 2XCHA 4TRLA 3T3VA 4QTAA 5I0BA 5HIBA 3TZ8A 4HJOA 3BV3A 2VGPA 3RCDA 4DH7A 4Z16A 4JDIA 4FZDB 3JVSA 1PYXA 3O8UA 5L2WA 3BL9A 1FVTA 4MF0A 5J79A 3FL5A 3NLBA 1MRUA 4YSMA 4R1YA 4Q5EA 4JDHA 4EWHA 5CALA 2W1IA 4D58A 4DF3A 1VYZA 3CGOA 4DT8A 4FK3A 1PKDA 3ZOSA 3NUXA 3FZSA 3QRUA 2J0JA 4K77A 2XNNA 3D9VA 3C1XA 5DRDA 3RPRA 1G8SA 1K9AA 2Y6OA 1W2CA 4JQ8A 4FKSA 2CKEA 5DR2A 2B7AA 3I4BA 1G8AA 4ANLA 3TN8A 5HG9A 2HY81 5EM5A 3BE9A 3OY3A 4RJ7A 3RNIA 5HVKA 4F08A 3W0RA 3C0IA 2GNJA 4FIIA 3RK7A 4ASDA 2OZAB 4ITIA 5B0XA 2F57A 3GQLA 4NJ3A 2IG7A 4XG2A 2BZKB 3ACKA 3QA0A 4FEWA 2WXVA 4L8MA 4I21A 4MNFA 1PXMA 1ST0A 4BGGA 3QC4A 4CT1A 3E93A 3FLZA 1STCE 4WBBB 1NW1A 4JJRA 4TYHB 2BZHB 3V51A 4E4NA 4RG0A 4Z55A 4EJ7A 4EH5A 2VWBA 4YLLA 1UV5A 3RCJA 3OD6X 5D41A 1BL6A 3R1NA 3CQUA 2XNBA 1UVRA 2BZJA 4FT7A 4QT1A 3R9DA 3OC1A 3R7YA 2V7AA 3F61A 5ANEA 3SXFA 3B2TA 5FXSA 2Y4IC 3MH3A 4YO6A 3S0OA 3Q32A 3R7GA 3UG1A 2I1MA 1SVEA 4MH7A 3RALA 3TYKA 4JLCA 3R9OA 4PNIA 4QTDA 3RHKA 4X6RA 3QX2A 3ZSIA 3ETAA 4F7SA 4JOAA 4JT3A 5CSPA 3QCYA 4NKSA 4IWOA 5HLWA 1PXJA 2F2CB 4HCVA 4HGEA 3FI8A 3QQKA 4GV1A 2XYNA 3V5LA 1V0PA 3AGLA 1QPJA 3ZDIA 5EOBA 4L68A 4IAFA 3R7IA 4FV0A 4FT9A 4W4VA 2JFLA 3VUMA 4IQ6A 3V04A 4G6OA 3Q96A 2R3HA 5C01A 4DH5A 3F3UA 5GIOE 3MVHA 4IX4A 3FMJA 4EOKA 1UWHA 1PKGA 4NH1A 4CLJA 4A07A 4ZLOA 2WTCA 2IPXA 4RVKA 2W7XA 3O51A 3MPTA 2QOHA 1XHAA 2XK3A 4FMQA 4IM0A 3DS6A 4CCUA 5L8KA 1U5QA 4S33A 1CMKE 3F2NA 2W4KA 2B0QA 1WVWA 4QOXA 3FSKA 4PP9A 3R7OA 4JX3A 4IDVA 5DMZA 2PMOX 5HTIA 3FZOA 2R3LA 5DOSA 4F1MA 5AX9A 3G51A 3C0HA 2YIXA 4KKEA 3U6HA 4WOVA 4Y83A 3DAKA 4D28A 4FTRA 4PWNA 5LMKA 1APME 5A3XA 5A4LA 4Y46A 3V6RA 3D94A 4H58A 4QTCA 5HD7A 3TTJA 4YUQA 1I44A 1FOTA 3HP5A 3LJ0A 4WO5A 2CN5A 4J95A 3F3WA 5K0KA 3PRIA 5L3AA 2BHEA 2VTAA 2J0KA 4D4YA 3VF8A 2XNOA 2YJSA 3NDMA 4IHPA 4KRDA 4R1VA 3ET7A 4EH8A 3TNPC 3QTRA 2NYAA 5IQDA 4BBEA 2DQ7X 4ZK5A 4TYEA 3V5WA 5LMKC 3MESA 2VTNA 3BWFA 2ZM3A 5EW9A 5TF9A 1P2AA 5KBQA 3GUBA 4QP7A 5IKWA 4CD0A 2CLQA 3JYAA 2W96B 3IW5A 3AC4A 3D7TB 3NUSA 3PVWA 5EM7A 3SX9A 4EOOA 3G5DA 1SNXA 4O0UA 3VHEA 3DBEA 2R7BA 1BLXA 5E1SA 4FSUA 4QMTA 4CYJA 1KOAA 1YOJA 2ITUA 2YCQA 3BPRA 4M13A 5HCYA 1OL5A 2YWVA 4O7SA 3COIA 5FWKK 4QQTA 5IA2A 3F9NA 3DBDA 3NS9A 5AP7A 5CEMA 5KMLA 3LVPA 4E7WA 2PY3A 2X8EA 3QAME 3P7AA 5LCKA 2A1AB 2GPHA 3HKOA 5K9IA 4DBNA 2W0JA 3KF7A 3LFFA 2J2IB 4B0GA 4FBXA 2YCRA 3KN5A 3UQGA 5CF5A 4DH8A 3WZEA 2C6DA 2WQNA 3ZC5A 3FYJX 2PVKA 2J9MA 3TT0A 4YP8A 3TEIA 4X6QC 3KRWA 4MK0A 3EYGA 3NGAA 3CTHA 4TYJA 3GCUA 1GIHA 4FL3A 4C4IA 3FC1X 3QQLA 2X4ZA 4DEGA 4PPCA 5C8KA 1YI4A 5DH3A 5HO7A 1ZMVA 2J50A 5GZ8A 1JBPE 3FYKX 4F7NA 4OTFA 4OR5A 3ENMA 2BRBA 4AS0A 2VTTA 1Y8YA 1OIRA 2PUPA 3GC8A 3W0OA 4U6RA 2PVJA 5IQHA 3QTXA 3FKNA 3KN6A 4LGDA 3VS7A 3HUCA 1XBAA 4V0GB 3FMMA 3MB6A 3QHRA 3BE2A 3Q04A 1NXKA 4GL9A 4MCVA 4EL9A 2GMXA 4FZ7A 3N4UA 3GI3A 4QDVA 4XV1A 4FT5A 5H9BA 3GNIB 4S34A 4V05A 3TV4A 5A4EA 3Q9ZA 2C68A 3POOA 3VHKA 4KUJA 3FWQA 3SRVA 3VULA 4BZDA 3ZUTA 4ENYA 2XIXA 4JR7A 2AUHA 4EOIA 1L8TA 4R7IA 1UNHA 3I0QA 1G8KA 4YJQA 2ZOQA 2GSFA 4DYMA 4FKWA 5EKOA 1RDQE 1MP8A 2X4FA 2PVYA 3Q6UA 2GCDA 2H6DA 3SC1A 4TTHB 3P9JA 1M52A 1KSWA 2ETKA 4UYNA 4EOJA 5EM8A 2BRHA 2EXCX 3NNXA 3FE3A 1JKTA 2WNTA 3CD3A 3O0GA 1H4LA 1ATPE 1XJDA 1Q97A 3QKMA 3FQHA 5L6WL 4AZEA 4AOJA 2V7OA 3UVPA 1RQQA 2Z02A 3ZBFA 5BQ0A 3AMBA 3DKGA 4IWQA 4FVPA 1R3CA 4AN2A 5I9ZA 3VS5A 4OTHA 5CT0A 2OGVA 3V01A 3MA6A 5AM6A 5J7BA 3KCFA 4RIXA 4AWIA 1U59A 3PIYA 1PXLA 3OBGA 4DTBA 3NCGA 2BALA 2JDVA 3Q3BA 5FEDA 3CE3A 5T3QA 3QD0A 4OTRA 2WQEA 3FV8A 2YM6A 3PG3A 3PE1A 4JI9A 2ESMA 4TZRA 3MH0A 4V04A 4NW6A 4ZOGA 4ZMEA 4YJPA 3F5XA 4F64A 1GZ8A 4MXCA 4RJ5A 5LQFA 5FTGA 3PIZA 3FI4A 3D2IA 1OL2A 4DEIA 4HW7A 2O64A 2XVDA 3LJ2A 4HGSA 2OBJA 3Q9XA 4WNOA 1XH6A 2I0EA 4FGRA 4IFGA 3RM7A 5AV4A 3TUDA 3SV0A 4B4LA 3IDPA 3ZDUA 3ZXZA 2CN8A 5JSMA 1KE6A 4FNWA 4DFYA 3KU2A 3FLSA 2J90A 4G3CA 2W4JA 4PUZA 4X2KA 2XJ0A 1YXSA 5T6KA 3ZO3A 5JN2A 3W18A 4ZTSA 3UIMA 2WEVA 2XK4A 5FM3A 4AP7A 4C0TA 3UIXA 1W8CA 4U97A 1GZNA 2UVXA 4W4XA 5M44A 4M67A 2X0PA 4CFUA 5M4UA 3HAMA 1BL7A 4CZUA 3ZRKA 2B9JA 4I6BA 4FNYA 3PP0A 3OUKA 5HE2A 2QCSA 2QU6A 4GW8A 4IVDA 1Z9XA 3QF9A 5ETFA 4BDIA 1O6KA 5BV3A 3OG7A 2OZOA 3L8SA 1LR4A 4M84A 5AP0A 4ID7A 4QPMA 5I9WA 4KIQA 5JGDA 3C0GA 1IAJA 3E7OA 3OROA 5CEOA 4PX6A 4BF2A 4O2PA 1W84A 3VW6A 5AWMA 3E92A 3TJDA 5FUTA 4RRVA 1PXNA 2R3PA 1M7NA 4XP2A 3ODYX 4YHJA 5CEKA 3QZFA 2ITWA 1R0PA 2DYLA 3ATSA 3NNVA 4G5JA 3EN6A 5DG5A 2OXYA 3NVMB 3NUPA 2JFMA 4IIRA 3AMAA 4BCMA 3KXZA 4YZNA 3IOKA 4E4XA 5I9YA 4EKLA 3DDPA 3OEZA 2IW8A 3UO4A 4N6YA 1J7LA 1UNGA 5AA9A 2VTOA 4G17A 3HYHA 2JKKA 4O4DA 4AZSA 5A46A 3CP9A 3C50A 4XG3A 3TZMA 5E8SA 4OGRA 1XH4A 3IW4A 4QDEA 4WNMA 1UA2A 2HCKA 2REIA 3HL7A 3KK8A 5CWZA 3VS4A 3TKUA 3DDQA 3F7ZA 4HNFA 4BCNA 4YTCA 5IQBA 4CZYB 3OT3A 2BKKA 5J9YA 4GUBA 5K4IA 2YZLA 3FEGA 3ODZX 2YCSA 3OOMA 2WFYA 3H9FA 3LQ5A 3NAXA 1W0XC 3C4EA 2P33A 5J95A 2UZDA 4DG0E 4LRKA 3DZOA 3S3IA 3QQGA 4QMNA 2ZM4A 5CU6A 3UO6A 3PLAE 5CSXA 4NT4A 3BI6A 4I6LA 2IZSA 3QLFA 4L3JA 3R30A 4M3QA 2X6DA 5CXZA 3UDTA 4I6HA 3VBTA 3KKVA 4FTQA 4KIKA 3U87A 3UMXA 4R7BA 4FL1A 4DH3A 4O6LA 3R0TA 3W2OA 5EQEA 2O65A 2RKUA 4LRJA 4AGCA 5E90A 3TNWA 4D4SA 2R3MA 3HUBA 3SQQA 2ZV2A 3TTIA 2WB8A 3F3ZA 4D9UA 4LUDA 5AUUA 4N70A 5BUEA 4QRCA 5AV2A 4XG4A 4FTUA 4IC7A 5G1XA 3W2QA 3WF8A 1WCCA 4BCFA 2WPAA 3F2RA 4XS2A 3WARA 2IJMA 3R1YA 4FNXA 4YC3A 3UQFA 5EDPA 3SG9A 3QX4A 4R5YA 1UKHA 4KNBA 4L3LA 4ZSJA 2QURA 3DB8A 4NW5A 1ST4A 4UY9A 3GOPA 4GMYA 1BI8A 3NFFB 2UZWE 5FBOA 3G0FA 2QOCA 5D12A 3JS2A 3OY1A 2VTMA 4EH9A 1OPLA 4ASXA 2HENA 5ANJA 3T8OA 5LXMA 4IZAA 4JDJA 3A7JA 2B9FA 4JX7A 4IJ9A 2W1CA 1Q8ZA 2J5FA 5D11A 5HNBA 3DT1A 4O2ZA 4BN1A 5TO8A 3GFEA 4ZAUA 3U6IA 5KX8A 2YM8A 4O7ZA 3CC6A 4EOLA 3W2PA 2YWPA 4FKPA 3ZSHA 1F5QA 5DR9A 4NFNA 3P78A 4TKSA 5EDQA 3IW6A 4GT5A 2C5VA 3QRIA 1OPJA 1FMKA 2VGOA 4IXPA 2Z7SA 4YMJA 3FMNA 5L2SA 4ZZOA 1J7IA 1GJOA 5AR4A 4NFMA 4V01A 5EQPA 3EQBA 4O1PA 5B7VA 4DFNA 5AP5A 4Q2AA 3ZFMA 4HZRA 4ACMA 4DGGA 1JOWB 1Q62A 4IX3A 3F3VA 5K5NA 4AZTA 4ACCA 3BV2A 4UBAA 5CU4A 4O0XA 5F20A 1VZOA 4RJ8A 2ITPA 3C13A 2G2IA 4FTIA 3NRMA 2Y8OA 3N51A 3F6XA 3LHJA 3SOCA 5IG1A 3PDTA 3LM0A 3P08A 3A4OX 5JH6A 5DIAA 3MV5A 3LCKA 4GS6A 5DI1A 1QCFA 2EU9A 3QUEA 4OTQA 5L2QA 2ITTA 2EXMA 5H3QA 3CPBA 4UMPA 4APCA 4CLIA 4G2FA 2PVMA 2LAVA 1ZYJA 4HYIA 2BZIB 4HGLA 2HWPA 2BFXA 3ENHA 3HMNA 4F9BA 3G9LX 3EWHA 4JIAA 4EEVA 4HZSA 3V5TA 1J3HA 4NIFB 4IH8A 4X21A 1H26A 3CR0A 5FBNC 4HVHA 5HIDA 2JGZA 4L46A 2UVYA 3R04A 4XYFA 1Y57A 3BLRA 4GK3A 2Z7QA 4O7LA 1OZ1A 4A9RA 3FMKA 3A8WA 3SKCA 4AU8A 3GFWA 3ZZWA 2UW0A 3OVVA 2OK1A 3WZDA 4KB8A 5EM6A 3MVLA 4EWQA 1WAKA 3I6UA 2F49A 4XRLA 4AA5A 1CDKA 4JBPA 4WIHA 5IMXA 3AG9A 1BMKA 3F66A 4UXQA 4UB7A 4XG6A 4BVUA 5AM7A 4EQCA 1P14A 1CM8A 2UZLA 1TQMA 4DLIA 3FQSA 1YHSA 2JDSA 3WYXA 3FZTA 4PPBA 1X8BA 3ZH8A 2ZDUA 4DH1A 4QO9A 5A4TA 2AQXA 4JRNA 1JKSA 4IFCA 2CPKE 2JLDA 3R8UA 5BVWA 5EI2A 4AN9A 5BMMA 2GNIA 3P23A 3DNEA 2J7TA 3WE4A 4AZFA 2BAQA 3O7LB 4IAIA 3F5GA 3RMFA 3UODA 4PMSA 5AUTA 4DITA 1KV2A 5I9UA 1GAGA 4EH6A 3SW4A 1H0VA 1T45A 3OCGA 4KKGA 5F95A 5IEXA 4F1TA 2RG6A 5IH5A 2GS7A 4FKTA 2XYUA 4RIWA 5ANIA 3OTVA 3TCPA 3WILA 5A9UA 4EZ3A 5J9LA 4YSJA 2XBJA 4Y95A 3IONA 2CNUA 3A2CA 4BDHA 4MQ2A 3EYHA 3OW3A 4FG8A 4O22A 3DTWA 3PIXA 2C6EA 2GDOA 4QTBA 3R01A 4IAZA 5HOAA 3RTPA 4FG7A 3RK5A 2E9PA 4GT3A 3EJ1A 2XALA 3I7BA 1JSUA 3AGMA 2B53A 3TNHA 2HZNA 1PJKA 4FTKA 2XIKA 3GC9A 4U42A 2IW6A 3VUTA 3QWKA 1A06A 4BHZA 4RZWA 4A4OA 5HX6A 5KMNA 3W0NA 3OXZA 4MTAA 3KC3A 2YLEA 4WHZA 3R8VA 3F69A 3EN5A 5LWMA 1OM1A 3VS1A 4DLJA 4YZBA 4G34A 4UALA 4O0TA 2HAKA 3DKFA 1YI6A 2LGCA 3W2CA 4DEBA 4F6WA 3DBCA 3PFYA 2J51A 1ZWSA 3AOXA 2R3GA 3JY9A 4QYFA 4NTSA 5AADA 4P5ZA 2X0GA 2QOIA 3JR1A 5DYJA 3UOJA 3TXOA 3FXXA 3R02A 3D7ZA 3O8TA 5CLPA 4YJUA 4O82A 3PY1A 3OXTA 4C7TA 1FGKA 4WG4A 3O8PA 1REKA 3KMUA 3LXLA 5TT7A 2ZFYA 3W10A 4ALWA 2HWOA 4JQ7A 4TXCA 3BEAA 3SLSA 4FL2A 1L3RE 4IWPA 3KIOC 2YHVA 5I9XA 2WAJA 4X3FA 3DQXA 3ZLSA 2W4OA 5ETIA 3PJ2A 3UVRA 4D2SA 3CQWA 1H1WA 1LPUA 1XKKA 2OH4A 5JZNA 2BTRA 3L8XA 4C2WA 4O7NA 3EL8A 4M8TA 1OL7A 3G0EA 4JNWA 3M2WA 3DXPA 1YWVA 3ULZA 4AQCA 3NIEA 3U9CA 3NNUA 4RBLA 5M57A 4IB5A 3ZUUA 4ZJJA 1SYKA 4PTEA 4FUXA 2BDJA 3EKNA 4I4EA 4AOTA 3ZRLA 3HV3A 4YZCA 5HG5A 3MSSA 2QOLA 2R4BA 4JBQA 4X3FC 4DC2A 4K6ZA 5F4NA 3DFAA 1O6YA 2C30A 4CFXA 3PLSA 1YWNA 3TIZA 3WZJA 3R7VA 5AP3A 5AR5A 5EG3A 3DZQA 4X2NA 4AXCA 3AC5A 5H8BA 5AV0A 4FV7A 4X2JA 2XJ2A 3E7VA 3PJ1A 3EFJA 4AX8A 4W4WA 3SRVB 3MVMA 3ZXTA 4FTOA 4DGMA 5KKRB 5A6OA 5AJQA 4FTTA 4IMYA 4EK8A 5CASA 2OICA 4AT4A 3QUPA 4TPTA 3HMPA 5BNJA 3A61A 2YISA 2BIKB 3UDZA 5C4KA 2CJMA 2F7EE 3BLQA 2P55A 4I24A 4RZVA 3GOKA 2ZVAA 4O0YA 4ZJIA 4MXOA 4O0SA 3I79A 5LARA 3RHXA 3OWPA 4JXFA 1PXPA