3CR0A

Wee1 kinase complex with inhibitor pd259_809
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
281
structure length
257
Chain Sequence
SRYTTEFHELEKIGSGGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWADHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of Wee1 inhibitor selectivity
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Wee1-like protein kinase
total genus 83
structure length 257
sequence length 281
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cr0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cr0A01
3N9XA 5K4IA 3PXZA 3KN5A 1EH4A 1K3AA 3Q5IA 4QP9A 1O6YA 3TJDA 3GP0A 5H8GA 5F94A 3ZOSA 5I9XA 3VUIA 3BZ3A 3LKMA 2FVDA 4KABA 4O7WA 4HGEA 1ZOEA 1NA7A 3UYTA 5B7VA 3ITZA 1ZZLA 4FV0A 4EHZA 5AMNA 5A4LA 3KFAA 3OT8A 3EB0A 3MY1A 4GFMA 4M69A 4O7RA 1WAKA 2PMOX 2X6DA 4M3QA 3LM0A 3FQEA 3QTQA 4YJUA 4PPAA 3QC9A 4EBWA 2XH5A 2JFMA 4PP7A 3NVMB 4BBFA 4MBIA 3ZSIA 3IS5A 2C69A 1E9HA 1ZXEA 3NUUA 4QOXA 5L4QA 2CGXA 4Y85A 4J96A 5HE0A 3MPAA 3RVGA 2B9JA 4K1BA 4RVKA 4D28A 4EONA 5HNIX 5FBNC 4CG9A 3NRMA 5AUXA 2GNHA 4JDIA 2I40A 4EHVA 5HU9A 2IZTA 2JDVA 2ZB0A 1PXIA 3RAHA 5J5SA 3OY1A 5CLPA 4A07A 3RZBA 5GZAA 4G16A 4O7LA 2WMXA 3TM0A 5EM5A 3TWJA 3W32A 4ACCA 4ZAUA 2IPXA 3NNXA 3Q6UA 4NTSA 3S1HA 2ITPA 4D2SA 2H34A 4L44A 4RWJA 3TN8A 1YXXA 2BTRA 2A1AB 5LMKA 3LPBA 4CLIA 3EYHA 5HVYA 1XR1A 3T9TA 4UMRA 5EQEA 5AP0A 4KKGA 4NT4A 4I5MA 4W4YA 5CF4A 4BY9E 4BCFA 3A4OX 3QC4A 4JDJA 4ZTHA 4S31A 3W2RA 4FEUA 4AOJA 3ZCLA 4YBJA 4UXLA 4AGDA 2R0IA 4Y46A 4NSTA 2F7EE 2HIWA 2BDFA 3D14A 4IVAA 4OTRA 3KL8A 4KBAA 3FXWA 3VUKA 4PTCA 3R7YA 2ITQA 1OB3A 5HOAA 3W55A 2RFDA 4C0TA 3FMMA 5AAGA 4FVPA 1WBNA 1WBTA 2J50A 2PWLA 4XHKB 4EH2A 2YITA 3FEGA 1W98A 4I41A 3QQLA 2YM4A 3F2AA 3R8UA 4L6QA 4TYHB 1A48A 1YDTE 4KIKB 3TZMA 3FZOA 1X8BA 5EOLA 5AUYA 2WMTA 5DNRA 4FIIA 3NMUF 4G6OA 5M4CA 4QMZA 3PA4A 4OTGA 5IEYA 2XKDA 5BVWA 3FKNA 2IZSA 4B99A 4MVFA 4DHFA 1YWVA 4BDEA 3FMLA 1H27A 3KCFA 2WTKC 3BYUA 5CXHA 4H3BA 5CT7A 2VD5A 2YEXA 4M0ZA 5C01A 4EUTA 1M17A 5HU3A 3ID6C 4MXZA 4F99A 2B0QA 2QHMA 2C6IA 3GQLA 5J1VA 3DJ5A 1BUHA 4BCIA 3BV3A 3IG7A 4OTIA 4BC6A 4IWOA 3AOXA 1J7IA 3JR1A 1YI4A 3EQDA 3KXMA 2GNIA 3BU6A 4LRKA 3Q9XA 5FWKK 2ETMA 2X4FA 5IA3A 1HCKA 1DAWA 3ZFXA 5C8KA 2GFSA 3RMFA 5CNNA 3L9PA 2GMXA 2PUUA 2UZTA 1J1CA 4BF2A 2IWIA 1OPJA 2C1BA 4EH7A 5DT4A 2J0KA 4MD9E 5CY3A 3QTUA 1BI8A 5EQYA 4GUEA 1R78A 3OCGA 3OWPA 1PF8A 4DE4A 4FZAB 4FKSA 1RQQA 5L2QA 4JBVA 5J87A 4Z16A 2BRHA 4AW5A 3HLLA 4G3EA 4FTJA 5LWMA 3AD4A 3RAWA 2VGOA 4FNWA 2I0VA 3VS4A 4TL0A 5CEMA 4U81A 4W4VA 1PXPA 4C33A 4G2FA 3F69A 4KS8A 2WZJA 4C4JA 4HYUA 3W10A 4FICA 4ZTQA 4U6RA 5FDXA 4M12A 4A9YA 1REJA 3E7OA 2F9GA 2PMNX 4GVAA 3BX5A 3IO7A 2YZAA 4DLJA 3DK6A 4D9TA 4FTMA 2W4OA 2W4KA 4AXAA 4TXCA 2J7TA 4MCVA 3LJ2A 2A2AA 1WBPA 2VGPA 2W1HA 3ZUTA 2YWVA 3UYSA 3QXPA 3QHRA 3FMDA 4UYAA 3EQGA 3DZQA 1YDSE 4RJ7A 4YMJA 5IISA 2PVKA 2GS2A 3R8MA 4V01A 4F6SA 3DK7A 3NIZA 4YJNA 4IACA 3OXIA 2Y4IC 3BRBA 3HV4A 2YAAA 4XG3A 3ORKA 5DPVA 3KRJA 3EQHA 5AR7A 4HVHA 4CKRA 5L2WA 1G8SA 3PWYA 3UMXA 3TKUA 2ZJWA 4O21A 4ALVA 4J8MA 4NKAA 3QXOA 3WZJA 2EU9A 3HV6A 3QBNA 4I0RA 3R22A 4F9AA 4BKJA 4UMUA 3CPCA 2R3RA 4DG2E 2BKKA 3LFAA 3KRXA 2OFUA 5CXZA 4MQ1A 2ZMDA 3EIDA 5ANOA 2YCRA 4NCTC 3EFLA 5KX8A 4NL0A 4ANMA 4G3FA 5FQDC 1OKVA 2HOGA 3RNYA 5IDPA 4QMYA 3T8OA 2HZ4A 3BHHA 4FSRA 4QTBA 3W2QA 3QQHA 1E1XA 2QG5A 4R77A 4PTEA 5HE3A 3E5AA 3ORNA 4LFIA 3QTZA 3R7GA 3V3VA 2IVUA 3LM5A 5JGAA 3W2PA 3R1NA 5DYJA 3Q9WA 3W16A 4DFUA 1H25A 4TPTA 2YM7A 4N0SA 4JAJA 4NFMA 2J90A 4HZRA 2QOIA 2CGVA 2YJRA 4IDTA 4WG4A 3RP9A 4FSNA 5HLPA 5C8MA 2Q83A 3ZSGA 3C5UA 3EFJA 1H1QA 1NW1A 4EK3A 5M07A 4BZNA 4YUQA 3TZ8A 3V8WA 3O8TA 3MSSA 4QNYA 5KMNA 2XCHA 4FSTA 4YZBA 1V0BA 3KC3A 3UVQA 4D1ZA 3DAEA 3ZO4A 4OBQA 4F63A 2WTVA 1CMKE 3R71A 3PJ2A 3RK5A 2V7OA 3H4JA 3ACKA 3DQXA 5EQPA 3K3IA 2CKEA 3FL5A 5IKWA 4WRSA 5JFVA 4BHNA 3FMEA 2AYPA 4EORA 2XJ0A 4EOQA 3FZSA 4ANSA 3HMOA 2H8HA 2WQMA 3E8DA 2W06A 3BYSA 1XBCA 3GGFA 3ZBXA 1CKIA 4XV3A 4BIEA 4GSBA 4ZP5A 3DAKA 4BI2A 3PLSA 3C0IA 2W17A 2PZRA 3WZEA 4Y73A 4PWNA 4O96A 4M8TA 5AP3A 4DYMA 3O50A 1SM2A 2H6DA 3R7VA 2XNBA 4FEQA 3FLYA 4JXFA 3RHKA 1BL7A 3TNIA 3SG9A 1A06A 1QMZA 3DK3A 3DOGA 4BCHA 4M13A 1ZYLA 4O91A 2WELA 3KB7A 4X3FB 1GZNA 2UV2A 1OIRA 1PYXA 3PSDA 5M44A 4I4FA 2QR7A 5E90A 3C4FA 1M2QA 4GV1A 1URCA 4PMTA 2I0YA 2X2KA 3NYOA 2PZPA 5FLFA 3T9IA 2RFEA 5CALA 4DFLA 3VO3A 3A2CA 1YHVA 3UVPA 4EH3A 2DWBA 3IGOA 5HGIA 1REKA 4EKLA 4ORKA 5IA0A 4EYJA 4X0MA 4ZLZA 4I6BA 2GNLA 4W4XA 4ANNA 3HEGA 3JVRA 3A61A 3LFQA 2JD5A 3KQ7A 2VAGA 5CAPA 2HZNA 2C47A 5E1SA 4E1ZA 4JDKA 2VTMA 4GYGA 2Y8OA 4HPTE 5DOSA 4QMQA 4RG0A 3E62A 4QPMA 5FM3A 4CGAA 2R3MA 3EWHA 5DIAA 1DI8A 1FMOE 4MTAA 3VN9A 3PXRA 4CMUA 1RDQE 5A3XA 3R73A 3EQPA 2WIHA 3EQCA 4J1RA 3WF8A 4QMUA 3DBEA 3UPXA 3PRIA 4GIIA 2XJ2A 1MRUA 2F2CB 4XRJA 4AZFA 3DDPA 1QCFA 2O0UA 4BL1A 2IZRA 3II5A 4IB0A 3UNKA 2PVRA 3CPBA 4YJTA 4KIOA 3E63A 4L3LA 1OBDA 3G6GA 4X2NA 3GCVA 4L8MA 4LGHA 5HIBA 2C3JA 4QP3A 1RJBA 4KSPA 3ZLYA 4BKZA 3UP2A 3RNIA 4HCTA 3VS5A 3QRKA 5CSPA 2ERZE 4YR8A 1YWNA 3LFFA 5EYDA 5HZNA 5DEWA 3HAMA 5FEDA 5IDNA 2IN6A 4F64A 3AG9A 3FHIA 3I6UA 4L53A 2OXYA 4D2TA 4F7NA 4ACHA 5F20A 5KO1A 2PYWA 4F09A 4X3FC 3ZEPA 4U43A 3GC7A 2E2BA 3BYVA 4D55A 3DXNA 4NYEA 3WZKA 4YHTA 2EXEA 5DT3A 4MD7E 2BFYA 2G1TA 4XG6A 3O51A 4R7IA 4F7JA 3N4UA 2VWIA 5ANKA 4FKOA 2Y6MA 4TYHA 3VUHA 3ORMA 4CEGA 1UA2A 2ERKA 3KN6A 3E8EA 5C4KA 5HNBA 3LMGA 5CSHA 4YLKA 3RPYA 4DEGA 4JRNA 1JOWB 4MQ2A 2QOCA 2XCKA 1GIJA 2OICA 3KKVA 3LFNA 2RG5A 4ZTNA 4QMOA 1G5SA 4O0VA 4D1SA 4HVIA 4W9WA 3M1SA 4GKHA 3N4VA 3TTIA 2WQOA 3I0OA 2C5OA 4IAKA 4RIWB 4AGUA 5B2MA 5M4IA 5CSXA 4C35A 5HI2A 3UJGA 2HW7A 1JWHA 4NM5A 3DTWA 4N6ZA 5HX6A 1GJOA 1FQ1B 3F5UA 2GNJA 4QD6A 4F0IA 4MXOA 1J1BA 5CENA 4GH2A 3GBZA 4RBLA 3COKA 2YM5A 4MWHA 4FKPA 4E8AA 4F9WA 4JG8A 4F0FA 5DVRA 1OGUA 2PE1A 3I1AA 3SA0A 4H3PA 5BVDA 2B4SB 3VIDA 3VHEA 4EWQA 3F5GA 1OI9A 5E7RA 3VS0A 3ORXA 3D7ZA 3VRZA 2R3PA 2PUIA 4AOIA 2Z02A 3UZRA 4XV1A 4AGCA 4LGDA 4DEAA 3UVRA 3ZRKA 2BVAA 4U45A 2F57A 4WOVA 5BYLA 4L42A 4MF1A 4OR5A 3KXGA 5K3YA 4G5JA 1FMKA 4WSQA 1YOLA 1LUFA 3OF0A 3KULB 5HKMA 1PMNA 1PYEA 2GNFA 4J95A 2UZOA 4OT5A 3V01A 5EDRA 2CPKE 4CFXA 2P55A 3FSFA 4IAFA 3G2FA 3FZTA 4BWKA 4CKIA 5AADA 4NEUA 2VWBA 4I6QA 3R8ZA 5GIOE 4GL9A 1VYWA 3NDMA 4FG9A 4UX9A 3HRBA 3T3VA 4ANLA 4B6LA 2KULA 3CJGA 4GCJA 1PXLA 4BBEA 2XNMA 2Q0NA 4L9IA 4TWOA 3UO4A 2VN9A 2WTJA 3PJCA 3CEKA 1ZYSA 3CQEA 2WNTA 5KE0A 5CVFA 5K5XA 4FL3A 5HESA 2PSQA 4IX3A 5D9HA 4KIPA 3TNQB 4YO4A 5BMSA 4GK2A 5CAQA 4HGTA 2W4JA 4G6LA 4RC3A 4S2ZA 5F4NA 4BKYA 4NIFB 1Y8YA 2BHEA 4EHEA 4Q9ZA 5J9LA 4NJDA 3FY0A 3LFSA 2YA9A 3VQUA 3ZO2A 1BX6A 3IW8A 2PVNA 5LJJA 3ORIA 5M09A 2C3IB 2X8DA 3P08A 3PPZA 4RIXB 1OECA 3RCDA 2Z7RA 3A8WA 4YU2A 5JFXA 4FYNA 4D1XA 3FZRA 3SAYA 4UZHA 4PNKA 3QFVA 3AD6A 2B1PA 4LRMA 3QHWA 4PMMA 5EM8A 5HE1A 3EH9A 3UIXA 2I7QA 4U40A 4APCA 4GEOA 1SNXA 3QQGA 2GQSA 2WQNA 3R2YA 3S00A 4K0YA 2UZVA 2WIPA 3CBLA 3HVCA 1FVTA 2FSLX 3OWLA 2HAKA 4BCJA 3VF8A 3R00A 3OTUA 3ZLXA 3ZXZA 4JR7A 2YZLA 2Y4PA 4E26A 1CM8A 3MI9A 5KMLA 4AN2A 3OS3A 3FI2A 3QYZA 3R2BA 4WRGA 4YSMA 3K5UA 4EI4A 4FSMA 3ZSHA 4FZFB 4UZDA 1ZYCA 5FXRA 2V62A 1JKSA 3TNPC 4CMOA 3B2TA 4D5HA 3QCXA 2OJJA 2XYNA 3GCQA 5JRQA 3DS6A 2NP8A 3P23A 1NVRA 4NW6A 3PP1A 4DEDA 1I09A 4UV0A 5CNOA 2BALA 3IKAA 4E93A 3BBWA 2WTWA 2ZDUA 4CVAA 2JC6A 2JBPA 3IW5A 3R0TA 1Y91A 2Q0BA 3P1AA 2W7XA 5AUWA 4Q2AA 3HMIA 4D2RA 3DDQA 4LL5A 5HCXA 5HG5A 1YW2A 2E9UA 4O7SA 4BI1A 4HYSA 5M4UA 2G15A 4P5ZA 4EZ7A 4O2ZA 1SZMA 3PA3A 4G9RA 4FT0A 3RWPA 3F2NA 4B8LA 4FODA 3DKCA 2VX3A 3TUCA 4QMXA 3C4EA 3FBVA 4BI0A 2WTDA 2CMWA 2VUWA 2PVLA 5M4FA 3DQWA 3UG1A 3FLSA 2JAMA 3EHAA 4M0YA 4O6LA 4TRLA 5HG9A 2F7XE 2QI8A 4HCUA 4FSWA 4GMYA 1JNKA 2I0HA 3TKIA 2YDKA 3ZM4A 4AT5A 5LVOA 3KMWA 2QO9A 3PY3A 4FKWA 3O8UA 4CYJA 2W99B 4PTGA 1BKXA 2YM3A 3FMJA 4YNEA 5GJFA 1W7HA 2PVHA 2ZMCA 2YDJA 4E6AA 2C6DA 5E8SA 2VZ6A 3MVHA 3QKKA 5EDQA 1YQJA 5CQWA 5CEOA 2BDJA 4QYFA 4C37A 3MFSA 1W82A 4YJQA 5H8EA 4XYFA 3RPOA 1KE9A 5L3AA 3QRTA 4WD5A 4CXAA 3QZIA 4WA9A 1UU9A 3DJ6A 2GTNA 4IX6A 2JIVA 3GQIA 3LW0A 4G1WA 3R02A 4RZVA 4PMPA 3TDVA 3OW3A 3NW5A 1BYGA 3TG1A 3ZONA 1UNGA 3OCSA 3G9LX 2QLQA 5KUPA 2F49A 3O7LD 2OFVA 2XYUA 4U41A 3ZM9A 1NXKA 5AR8A 2C5VA 3R01A 4H1JA 4S33A 4X3JA 2PMLX 3ANRA 4MNEA 4RZWA 2B53A 4RRVA 2JKKA 3LQ5A 3PPKA 2O5KA 2XKFA 2BCJA 3HX4A 3NNWA 4O0RA 3R83A 5GINE 1KE6A 3Q60A 3BQCA 4IIRA 3RWQA 3UOHA 3MH3A 1G3NA 2BR1A 2OGVA 4UBAA 5CS6A 5CVHA 1UKHA 3K5VA 3OWJA 2GQGA 1KV1A 2W96B 3UIUA 3VS1A 5F9EA 3QQKA 5E4HA 3NUXA 3CGOA 3L8SA 3ORPA 3Q96A 3QA8A 4FTOA 5BMMA 4BVUA 3SRVB 4KD1A 4O27B 4RJ6A 4U8ZA 3FPQA 1R1WA 4AA4A 2UZEA 5IZFA 4RWLA 4IAZA 5CAUA 4H1MA 3HDMA 5LMBA 2JDOA 3AD5A 3E7VA 1FGKA 3PTGA 3W8QA 1NVSA 1YRPA 2G2HA 4UMQA 2GSFA 2YDIA 2UZLA 2JEDA 5AX3A 4NJ3A 4F6UA 5DE2A 3Q2MA 1ZWSA 3CJFA 1XWSA 2W1EA 3VAPA 4D4YA 4FTKA 5JRSA 2C0OA 3BYOA 4M66A 4PY1A 4FX3A 1U54B 2QVSE 4KIQA 2XS0A 4W8EA 5L8KA 4C8BA 2XVDA 4YSJA 2WGJA 3UTOA 4D4SA 3DPKA 3MS9A 4XOZA 5FDPA 1Q61A 2Z60A 2QOHA 4DBNA 5A14A 4EOKA 3QZGA 5ITAA 3VS2A 2HK5A 3UODA 4JAIA 1YDRE 4QP8A 2W1IA 2VTNA 3TUDA 2VU3A 5EK7A 4K77A 2WMVA 3RALA 3UQCA 3U6JA 3NYNA 2WQEA 4HYIA 1SVHA 3WE4A 2DUVA 4EYMA 1GZ8A 5CZHA 3R9OA 2OIBA 1YWRA 2V5QA 3HRFA 2V7AA 4GU6A 4JX7A 1XQZA 3BGQA 1OZ1A 3I0QA 4FSQA 4ITHA 3QX4A 4YJSA 3MIYA 5J1WA 3HUBA 4JDHA 4GG7A 1OL2A 4FK6A 4LQMA 1G8AA 4O1PA 3SLSA 2YM8A 4EH6A 4YHJA 5BUEA 3D5UA 4U3ZA 3PJ3A 2ZV7A 4UWBA 1TQPA 3BELA 4I22A 4YJRA 3NVKI 3MA3A 3NZ0A 4H3QA 5EKNA 2OXDA 4A9RA 4AWIA 2XNOA 3F82A 3I7BA 2WKMA 2BROA 5B2LA 4ZS0A 3VUDA 2FSOX 3G15A 4QQJA 3AT4A 1RW8A 2GHMA 2IG7A 3C51A 3I5NA 1H0WA 1XH6A 5KHXA 2XKEA 2ITXA 3GT8A 4JOAA 3WF9A 3DFAA 3I6WA 4NM3A 4YTFA 2CKOA 3EN5A 4A4LA 2VO3A 4B9DA 3PG3A 3KF4A 3NCGA 4BDGA 1H24A 1YXSA 2CGUA 3V5TA 5IU2A 1PMVA 5J79A 2ZV8A 3GU4A 4AZVA 5IH6A 2Z7LA 2IW9A 4BDJA 3ATSA 1KV2A 2XK7A 4JL9A 3QD4A 1J3HA 4O7YA 4IQ6A 3P9JA 4HZSA 1OM1A 4GFGA 2OZOA 2XEZA 4TN6A 4CNHA 4KSQA 4WUNA 2PZ5A 4ZLOA 4DTKA 4NWMA 3GC0A 4C4HA 5K0XA 5KCVA 3ROYA 4O7ZA 3GC9A 5C03A 4AZWA 2ZVAA 4J7BA 3AC8A 5HO7A 1JKTA 3PFQA 1F5QA 4BICA 2VTRA 4RFMA 5AUTA 3SW4A 5IA4A 2R3QA 4F6WA 1OL6A 4V0GA 3LLAA 5EI2A 4E5AX 4M14A 3ET7A 3IPHA 3ORZA 4UXQA 3FZPA 4RMZA 5EYKA 3UPZA 4O7NA 2KTYA 3BWFA 5IG1A 4AS0A 2QC6A 3ALOA 2XRUA 3DBDA 3NAXA 4R1YA 2C68A 3MN3A 5CWZA 2JITA 3CE3A 3LFCA 4RLLA 2QR8A 1JSUA 1JVPP 2YHVA 3ZEWA 4QP1A 4CRSA 4RX5A 5E9EA 2UW5A 4I0SA 4MNFA 4AN9A 5AV4A 4CV8A 1PXMA 2UZNA 4F1TA 4J71A 2P3GX 3OD6X 5EHYA 3ULZA 3KRRA 3SDJA 4UN0C 4Y8DA 2CNVA 4S30A 1UNLA 2PTKA 1MP8A 4ID7A 2RSVA 2EVAA 2WTCA 4RVTA 4EK6A 2ZAZA 4L67A 4BDBA 3Q53A 4ACDA 3MH2A 3I5ZA 2CKPA 2V22A 4L00A 4QYEA 5K0KA 5FGKA 2XK8A 2W0JA 3RM7A 2E9NA 3CQUA 3FMHA 3F2RA 3QX2A 3WZDA 5L2SA 2WOTA 3QZHA 4KWPA 4JIKA 5CEKA 1Y57A 3Q4ZA 1P14A 2RF9A 2Z2WA 2BAQA 2QCSA 4CZTA 5CI7A 3L1SA 3D5VA 4XP3A 4EOOA 2YABA 2R3IA 3PXKA 4FUXA 4P4CA 4DFNA 4AA5A 3GXLA 3ZMMA 4Y72A 5ANDA 4G34A 5AEPA 1M52A 4C34A 4WBOA 4DH7A 3A7FA 3F61A 3KXZA 4YJPA 3REPA 3SOAA 3PA5A 5AP1A 2X39A 3TACA 2NRUA 3KXNA 4FBXA 3GB2A 4FV6A 4NCTA 2VTQA 1GZKA 3CY2A 4I20A 4IMYA 1GY3A 5DR9A 3A4PA 4ZSEA 2CSNA 2UZBA 1Q3WA 4XP0A 1OMWA 3GU8A 5E8YA 3AC4A 5GHVA 3UQFA 2UW3A 2BZJA 3H3CA 3PZEA 4IAIA 2OSCA 1YVJA 5HD7A 4AN3A 5IUGA 2E9PA 2ITVA 4KBKA 5EDPA 3QUDA 4HPUE 5CEPA 3ETAA 3FQSA 4YC8A 5L2IA 4Z3VA 5I9WA 2BRMA 3EQBA 4PL5A 3NW7A 5EM6A 2OU7A 4S34A 2EB2A 4QMMA 3MTFA 5LMAA 3NNVA 2OZAA 2XIZA 3EL7A 3FKLA 4JG6A 4J52A 4EH8A 5KMKA 4R78A 3DA6A 4DG0E 2R3FA 3MVLA 1I44A 5E1EA 4ZMEA 4DAWA 5DT0A 2C5NA 4QMLA 4RJ4A 5EYMA 3VWAA 4O7VA 3W2OA 4R5YA 3P86A 1KSWA 3C4ZA 4I6FA 3CCNA 3K54A 3DNEA 1XH4A 1XH8A 4IDVA 1YOJA 2ZM1A 1FINA 4LV8A 5L6WL 2BHHA 2WU7A 3RCJA 3VBVA 2IVSA 2GS6A 4QO9A 3C0GA 4APPA 3EKKA 2ITZA 2UUEA 4QYYA 5DFPA 4AT3A 2CKQA 1ZMWA 3BHTA 2BUJA 4DGLC 4FTIA 2YCFA 1K9AA 3E87A 3HL7A 4EJ7A 4FVRA 4W8DA 4Y95A 5L8LA 3QTSA 5KNJA 2FO0A 3FHRA 5CAVA 1HCLA 3D5XA 2FH9A 3OHTA 5KKRB 4QMSA 4KB8A 5M51A 3HP5A 5T68A 2G9XA 3CKWA 4B7TA 4DG3E 2XM8A 4I4EA 3QGYA 3SHEA 4BTFA 3GEQA 3QUPA 1PKGA 4OT6A 2ZYBA 3SW7A 5LVMA 2IJMA 2VTIA 4C4FA 3PVUA 1MRVA 3JYAA 4BTMA 5AAEA 2XIXA 4GT3A 1U5QA 4CRLA 5CU0A 5IEXA 4IANA 5FD2A 3R1YA 5BUJA 4J53A 5K4JA 2WOUA 4AW2A 4DEHA 4KUJA 3PXQA 3U87A 5H2UA 3EN6A 4GT5A 4UEUA 3VUMA 4GK4A 4TT7A 5CEQA 4PX6A 1UU7A 3FXZA 2R2PA 4FTNA 2I6LA 2C3KA 2QOOA 4IJ9A 3L8PA 4F4PA 3TDWA 4FTQA 3PIXA 3SD0A 5HD4A 3ZZWA 1V0OA 3QD0A 3VRYA 4FTLA 5I9YA 3MJ1A 4R7HA 1JAMA 4C02A 5JK3A 4PDOA 5F1ZA 4W9XA 3MJ2A 2O64A 3SXFA 3EYGA 1MRYA 4F70A 4EHGA 2OKRA 3TV7A 2PULA 1W84A 1UKIA 2HW6A 2WMBA 1XH9A 4CTBA 3GOKA 4ZSLA 5FTGA 3T3UA 4HJOA 2ITTA 4HOKA 5TE0A 3VUTA 3LJ1A 4XP2A 2PY3A 3DFCB 3RPVA 4ANOA 4O0WA 1OKZA 1GNGA 4FI1A 3OXZA 3MH1A 3OBJA 3NNUA 3ZRLA 4YNOA 4O0YA 3WBLA 2JIIA 3NX8A 5DH3A 4DCAA 3ZTXA 4EUUA 3MB6A 3H0ZA 3IW4A 4XMOA 5ETIA 1W8CA 5IQIA 2OIDA 4YZCA 1H01A 3QTRA 4CSVA 2AC5A 4LL0A 4RIYA 2VV9A 2QOBA 4QTAA 2BTSA 3FQHA 2NPQA 3UC4A 5BVFA 4WIHA 4FTTA 4D4VA 4I6HA 3R7EA 1SVGA 4IVDA 1H1SA 4RSSA 5KMMA 1R39A 2G2FA 2VNWA 5IA1A 1QPEA 1Q8TA 3GU6A 3HUCA 5IQCA 3KY2A 1OL1A 4QMTA 5JEBA 5LOHA 5JZNA 3MPTA 5M06A 4FOCA 4G31A 5A4QA 4PDYA 5AFVA 5AV3A 2X8IA 2HXQA 2HCKA 4BYJA 4WNMA 3QRIA 1JKKA 3QWJA 4RIOA 1ZOGA 4FSZA 5E91A 5TF9A 3R7IA 3HNGA 3QA0A 2BZHB 3SQQA 4BGQA 3MVJA 5EHOA 3DKOA 5HIEA 2VWXA 4FG8A 4IC8A 4LOQA 1Q8ZA 3PSCA 4IFGA 5ACKA 4R7BA 3PLAE 4ASZA 4AZSA 3D9VA 2OF4A 3H30A 3FSKA 4KA3A 4ANBA 4I24A 2B55A 3ALNA 4FNZA 1ZARA 4X2GA 1O9UA 4GVJA 2RFNA 3ZH8A 3MB7A 5A4CA 1FOTA 1Y6AA 4LUDA 3OEFX 5BNJA 2PE0A 2XB7A 3O0GA 4O2PA 4ACMA 4ZZNA 3PY0A 1PXNA 3QF9A 4FV1A 3FYJX 4GFOA 4HVGA 5I0BA 3CD3A 3LFDA 4IHPA 3UNZA 1WBOA 1S9IA 2B7AA 1AQ1A 5TT7A 1K2PA 3SC1A 5EYCA 4CLJA 1FPUA 2NO3A 2XK6A 3AXWA 3AGMA 4HGLA 4OBOA 4OTFA 2UZWE 5IUIA 3Q3BA 4FIEA 4L7SA 3UIMA 4EC8A 5A6NA 3LAUA 4YPSA 2CNUA 4C2VA 5IA2A 1VJYA 2WHBA 3FY2A 3MV5A 4N6YA 4YURA 5CSVA 3O23A 4C7TA 4EH4A 2VTTA 4MXCA 2C6OA 2B54A 4BCGA 3L8VA 3R7OA 5D41A 4ZEGA 3QCQA 4AZTA 3NUAA 2R3NA 5LVLA 4K6ZA 4MXXA 4BN1A 4TWPA 4O84A 5JQ5A 3FWQA 5JN2A 3KXHA 3V5LA 1H1RA 5HORA 3NIEA 4QP7A 4OGRA 1JQHA 1R0EA 4KKHA 3PDTA 3OXTA 1GZOA 1NY3A 4RJ5A 1J7UA 4PL3A 4B0GA 4DGMA 2YIRA 4ARKA 4X3FA 2C3LA 3AC3A 3ORLA 4FV5A 4EH5A 3EFWA 3C1XA 2XJ1A 4FYOA 5D10A 3R9HA 3O17A 4FF8A 1MQBA 2XNEA 4ZSJA 2VNYA 3TV6A 1SYKA 2UW9A 2Y4IB 2Y7JA 3C13A 4XBRA 4CD0A 2Z7QA 3KREA 3VULA 2C5XA 4GW8A 4AX8A 3GC8A 5CQUA 3P7CA 4YO6A 2OJFE 2YERA 5C1QB 5EW9A 3IOKA 2HWOA 3PG1A 2WD1A 2WB8A 4XG2A 2J0IA 2HZ0A 5CU3A 3PP0A 4ASDA 4AFEA 1Q4LA 5A4TA 3VS6A 4FR4A 4G17A 1BI7A 3OT3A 2XIKA 1IA9A 5AAFA 3DCVA 1XHAA 4DGNA 3TEIA 3IK3A 4OW8A 3AQVA 3IONA 4M7IA 5IUHA 3P79A 5DEYA 3V5WA 4FL1A 4IVCA 3P78A 2ESMA 4JG7A 4F7SA 3BBTB 1M2PA 4C58A 1KOAA 4RVLA 4H39A 5AWMA 2CCIA 2DYLA 1Q8YA 4YTHA 5GJDA 3ORTA 3LJ0A 3DU8A 3E88A 2X7GA 2X9EA 4NK9A 3N51A 3NW6A 3NR9A 3P7BA 4ZZMA 3MFUA 4FGRA 5IF1A 2YIWA 2UW0A 3HA8A 2WAJA 5JKGA 2CHLA 4MXYA 4C36A 2XP2A 4IW0A 4DCEA 2WMRA 3PRFA 4GIHA 3BE2A 3G0EA 3P7AA 3POZA 5TKDA 4Z7HA 2EXCX 4FKQA 3GI3A 4AZEA 4EC9A 4WNOA 2I0EA 4LM5A 1UVRA 4KBCA 4E6DA 4HVSA 3F66A 5AIRA 5C26A 3ENHA 2JIUA 3I79A 3U8WA 3HAVA 3W2SA 4QTEA 1IAHA 2BRGA 3ACJA 1WVYA 1ZMUA 4I21A 4E4XA 4Y5QA 4CQGA 1IRKA 4Q5EA 1YI3A 3OBGA 1JPAA 4G9CA 4U79A 3KGAA 4EOIA 5IMXA 5L6PA 1Z5MA 3EL8A 4TW9A 4YC3A 4O6EA 2CJMA 2QLUA 3FLWA 1M14A 5EFQA 4FVQA 2HZIA 4I0TA 5AM6A 3WZUA 3SG8A 2R3LA 4ITIA 1GIIA 2JKQA 3GOPA 4BFMA 4P90A 3LFEA 5BYZA 3D94A 2JGZA 3BLQA 4LI5A 3KK9A 5HIDA 4O0TA 1QPDA 3ZC5A 2GDOA 2H9VA 3PYYA 4FKTA 4L52A 4DITA 4ZY4A 4DA5A 1P5EA 3OWKA 3PXFA 5AR2A 2XM9A 3S0OA 5E8UA 2GTMA 4RT7A 3RJCA 2WMQA 4QTDA 4I5CA 4D9UA 4OBPA 2W5AA 5CT0A 4MH7A 4J98A 5IA5A 4H58A 2YLFA 5FUTA 3EQIA 4DFYA 3VQHA 1A9UA 4EH9A 3G90X 3I7CA 5CF8A 3W8LA 3DGKA 4RFZA 3VVHA 4BCPA 4RIWA 2W5BA 3E3BX 3UBDA 3KRWA 4ZK5A 5A6OA 5KZ0A 5CASA 1AD5A 5CI6A 4G6NA 3LXPA 2W1ZA 2J2IB 4WUAA 3R9NA 3OP5A 4IWPA 1WCCA 4WNKA 4ZSGA 1CSNA 3PWDA 4U7ZA 5HG8A 3ZZEA 4EWHA 2ZB1A 2QODA 1PW2A 3WILA 4A9SA 3W2CA 5CAOA 1XH7A 3QALE 4YJOA 2HXLA 3CS9A 4FKIA 4IB1A 3QQFA 3Q04A 4QQ5A 2UW6A 4D2PA 4EL9A 4DH3A 5DGZA 1OL7A 1DI9A 3BE9A 3DJ7A 5I4NA 4MEDA 5EOBA 3CTHA 3Q4CA 4JR3A 3UQGA 3V5QA 3PVWA 5E8XA 2R3OA 2YWPA 3OTVA 5C8NA 2FB8A 2Y0AA 4JIAA 4JRVA 4CT2A 1UWHA 4YHFA 3ATTA 2BIYA 3B8RA 5L6OA 3DXPA 4QYGA 4DGGA 2ONLC 4CT1A 4FKJA 3PE1A 3A60A 2FGIA 2IVTA 4ZS4A 3OUKA 4IWQA 3GVUA 4X2KA 2P2IA 4LGGA 4IEBA 5B0XA 4HW7A 3CTJA 5J8IA 1SVEA 3RBWA 5JGDA 3O96A 3Q4UA 4BWXA 3UZPA 3DKGA 3I81A 3HV5A 4PUZA 4WSYA 3BEAA 4XBUA 4ZJIA 1L3RE 3QGWA 4DBXA 2GU8A 3HZTA 3JXWA 3QQJA 4K11A 5HVKA 1DM2A 2RIOA 5T6KA 3BU5A 5C9CA 4XH6A 5T3QA 4C2WA 1WZYA 1H0VA 1VEBA 4E20A 4ZXTA 3UOKA 4CFWA 2OJ9A 1Z9XA 4K18A 1BMKA 2HELA 3L9LA 2YLEA 4L46A 4BIBA 3KMUA 4JNWA 3VBWA 4EOJA 3U4UA 3UO6A 4FSYA 3C4CA 4KNBA 5KMJA 2RG6A 4NIFA 1Q41A 2EWAA 2X81A 5IH4A 5C27A 3HA6A 2RGPA 4G3CA 4UALA 3DKFA 5EKOA 2WTIA 4PDSA 2XIYA 2J5EA 3VW6A 2OJGA 3OFMA 4G3DA 4PQNA 1VZOA 3BHUA 4O0XA 5CX9A 2WXVA 4DLIA 5HTCA 2VTLA 1UWJA 3PSBA 2YIYA 3RK9A 3WOWA 1YOMA 2XKCA 3PPJA 5AUUA 1PKDA 3O7LB 3F5XA 3GFWA 1WMKA 2O63A 5I3OA 3TV4A 4EOSA 1JSVA 3P4KA 3MWUA 2OXXA 3WARA 4EZ3A 2BZKB 3H9OA 1ND4A 3UNJA 3LMHA 3NUYA 2XK9A 4DFXE 2P2HA 4RPVA 4QRCA 4TNDA 4IFCA 4BGHA 2EB3A 4PPCA 3W33A 4E6QA 1OVEA 4QPSA 5EW3A 3KU2A 3LOKA 4O1OA 4ZMFA 4J97A 3CTQA 5L8JA 4E4LA 1T45A 3HMPA 3DXQA 1OUKA 2IO6A 2VO7A 3CQWA 3JS2A 2VTSA 1GOLA 1BLXA 5HBEA 4USEA 5ANGA 4OTPA 3I60A 4BZDA 3O2MA 2CN8A 2AUHA 3MGYA 3OVVA 2ETRA 3LFBA 3DBCA 3E93A 3A7IA 5AA9A 2VX0A 2YFXA 2WEVA 4FTAA 4DEEA 3D7TB 4OTDA 4M69B 4FNXA 3CLYA 4FSUA 3DTCA 5EI8A 5K9IA 3MA6A 2QQ7A 3NS9A 1WBVA 1ZYDA 4GRBA 4C4EA 4S32A 4E4MA 5LVPA 5E92A 5J5TA 5EG3A 4ZOGA 3QCYA 4I92A 4ANQA 2R64A 1TKIA 3P5KA 5E8VA 1XBBA 1B38A 5TR6A 3PE2A 4OTHA 5AUVA 4K33A 3AMAA 2O65A 4BCQA 4ZZOA 5A9UA 4YZMA 3WYXA 3FC2A 3HV7A 4FIFA 5HICA 3R8LA 3SKCA 3Q9ZA 2C6LA 3AMYA 3BEGA 1YXTA 4YC6A 4FC0A 1Q24A 4JQEA 3SX9A 1H1PA 1TQMA 3JUHA 1RE8A 4LYNA 4MD8E 3F3VA 5GNKA 1CKJA 1ZOHA 4QMWA 4F9BA 4M15A 1OPKA 4L3JA 3TKHA 2W1DA 1ZY5A 2X0GA 2CCHA 3M42A 4BDHA 5FBOA 4CV9A 4D5KA 4R5SA 5HBHA 2YCQA 3EJ1A 5IQFA 3EMGA 3ZS5A 2R3HA 3AT2A 3BQRA 4AFJA 4C59A 5BVNA 2JKMA 5AP5A 3D2IA 4LUEA 4UB7A 3LCOA 3P0MA 2XNNA 2OLCA 5EW8A 5FG8A 4H36A 2WPAA 5BUIA 4RWKA 3V5JA 5K5NA 5ETCA 3JY9A 3AT3A 3BPRA 2R3GA 4CQEA 3NEWA 3OZ6A 1PY5A 5E8TA 4YTCA 4NU1A 5FEQA 5JFWA 4YTIA 2UW4A 4O81A 2ZV2A 4OUCA 1Q99A 4BDCA 5IEVA 3THBA 4FE2A 2LGCA 2SRCA 3AC2A 2LAVA 3ZYAA 3U4WA 2Z8CA 4YGAA 3DT1A 3LMIA 5JSMA 3LCSA 2A0CX 4ERWA 3UG2A 4HYHA 5I9VA 1KOBA 4F7LA 1YHWA 4BDFA 3AC1A 4MNEB 2ONLA 1F3MC 4HGSA 4BHZA 3F7ZA 4KINA 3QWKA 1PXOA 5BYYA 4QPAA 3WF7A 4JBQA 3E8NA 3LHJA 3FI4A 4RLKA 4EZ5A 3R8PA 5FP6A 1U5RA 3ROCA 2PVJA 1UNHA 4XV2A 1J7LA 5HO6A 3IGGA 3Q9YA 5FTOA 2VTAA 4C3RA 3G6HA 4GT4A 2VWVA 3ANQA 4QYHA 5JGBA 2P0CA 4M97A 2J0JA 4L45A 1FVVA 5GIPE 1F0QA 3GUBA 1W0XC 3FE3A 4XG7A 5KBRA 4FEVA 5CF6A 3R6XA 3VW8A 4BDKA 4KS7A 4D2VA 2W9FB 3QYWA 3K3JA 3S2PA 4AW0A 4CCBA 4I1ZA 5FRIA 3RAIA 2PU8A 1SMHA 2OO8X 3CY3A 1H00A 5GJGA 4DH8A 3FL4A 5LCJA 3D2KA 1Z57A 4LOOA 3DB6A 4EEVA 4FKRA 3FZ1A 2PPQA 5JT2A 4N57A 3IQ7A 5A54A 2X2LA 1U54A 3SOCA 4Q9SA 2X2MA 3TZ9A 4E5BA 5HQ0A 2Z7SA 2C0TA 2QHNA 2VWZA 4BCOA 1IG1A 2FUMA 4TKSA 5FTQA 4A4XA 4NTTA 3MY0A 3FI3A 5HLNA 3MIAA 2OG8A 3HKOA 4O86A 1WBWA 4DTBA 5DBXA 3TTJA 5HE2A 3FDNA 4EK8A 4I94A 2XIRA 3LXKA 3MDYA 1JSTA 4E3CA 4Z55A 2BAJA 5JMSA 3VC4A 4EQUA 2QG7A 4RIYB 4LG4A 4L3PA 4FZ7A 5BVKA 2O8YA 3HMMA 3QAME 5D12A 2VTOA 3OW4A 4ZY6A 3RZFA 1H07A 4TWNA 4BGGA 2OI4X 2C6KA 4X21A 3G51A 5M57A 4CTCA 4IWDA 3PIZA 4PDPA 4TYIA 4EQCA 5AV1A 5AUZA 2QNJA 3D4QA 2WMAA 4QQTA 3NCZA 4XG4A 5KMIA 4NKSA 1OL5A 4LV5A 2PK9A 4E4NA 3VUGA 2WMWA 5IH5A 4P7EA 1PMUA 3EZRA 4MBJA 2QU6A 4F9YA 3PY1A 3U9NA 4F08A 4AG8A 3BV2A 3A62A 1W83A 3MY5A 3CP9A 3SXRA 2ITNA 5AR4A 2Y9QA 3DBQA 4M67A 4OTQA 4IE9A 3QUEA 2EXMA 4DTAA 2HY81 2YACA 3OCBA 1PJKA 3KEXA 2CN5A 4PRJA 4TYEA 4X6QC 3ODYX 1H26A 4C57A 4O83A 4CZYB 1J91A 5M56A 3DV3A 3A99A 3NPCA 2VWUA 4IZ5A 4RFYA 4WO5A 2IZUA 3WYYA 1XJDA 3Q5ZA 1B6CB 2W1FA 2YN8A 4M84A 1LEZA 4FKUA 4RX9A 1OBGA 3UZTA 2W9ZB 3MFRA 1R3CA 2CGWA 4JQ8A 4O0UA 4EOMA 3NYVA 4JVGA 5CANA 3Q4TA 3CSVA 3PUPA 5AP4A 5IQAA 4MX9A 2G2IA 5J7BA 1MQ4A 3IDBA 3QU0A 4F1OA 4RJ3A 3QD2B 4E5WA 3FUPA 5EH0A 2HWPA 3KF7A 3R9DA 1OIQA 5DRBA 1BL6A 4HVDA 4P5QA 2ZV9A 1VYZA 3F6XA 2QOKA 3HMNA 1PXKA 4YLLA 4AT4A 4CFMA 4UWYA 4YPDA 2R3KA 3BU3A 3FMNA 2XK3A 2CLQA 4EK5A 3D15A 3RPSA 1U46A 3QQUA 3PZHA 3UDBA 4C3FA 4F1MA 1OPLA 3KK8A 3HYHA 4E73A 2C0IA 1L8TA 5AX9A 2YAKA 4RJ8A 1JKLA 2NRYA 1IAJA 2BRBA 3V5PA 4RA4A 3D83A 2YIQA 3DZOA 3ZHPC 5HBJA 4ZTSA 2JDRA 1OKYA 1PXJA 3AGLA 4Z7GA 1R0PA 4V04A 4IM0A 4FV3A 5DR6A 5D1JA 1VR2A 3CC6A 4IX5A 2BRNA 4QTCA 3SVVA 4JI9A 1FGIA 5TOZA 3G5DA 1QPCA 4UWCA 4AE9A 3HDNA 3FJQE 4EBVA 1ZYJA 4CZUA 2OF2A 3KMMA 5H8BA 4BTKA 2IVVA 5JFSA 4YBKA 1Y6BA 4BIDA 4PPBA 1WFCA 5AIKA 3NUSA 5CF5A 1KWPA 2OW3A 4ONAA 1V0PA 3VBQA 4IADA 3BLRA 3Q32A 3JVSA 4XEYA 4XX9A 5D11A 4CFNA 2VWYA 2GCDA 1AGWA 2DS1A 3B8QA 3RTPA 3LQ3A 5LQFA 3F3UA 5HCYA 1LPUA 4XNEA 3V8SA 3VBYA 4DH5A 2OK1A 1HOWA 2PZIA 3C4WA 4LOPA 4ZLYA 4O82A 3KA0A 1YKRA 5GZ9A 3JPVA 4FKVA 3NLBA 4O0SA 4RIXA 4DT8A 4ENYA 2C6MA 2J0LA 3A7HA 4AE6A 3TJCA 1Q62A 4JBOA 5DN3A 2CNQA 5CU4A 4GG5A 4U44A 4O7TA 2GPHA 2HY0A 2ITWA 2JFLA 4IAYA 5HCZA 2OJIA 2WTKB 4H05A 1KE5A 4GKIA 3R1SA 2QKWB 5HEZA 2C6TA 2F7ZE 4RX7A 1CKPA 2VTPA 4TNBA 2PUNA 4P2KA 2C30A 5AR3A 3QRUA 4FIHA 1O6LA 4GJ3A 4NM0A 4DH1A 4EK4A 3VF9A 4AAAA 1UU3A 1H4LA 3EQFA 3NYXA 4KRCA 4CFFA 2ACXA 3MTLA 5DRDA 3MFTA 2A19B 1LEWA 2QONA 3KCKA 4FT5A 4IJPA 4UYNA 2F2UA 4YLJA 4Z9LA 4RGJA 4DEBA 3BIZA 4RA5A 3U55A 2OWBA 4O38A 4U0IA 2P33A 4A9TA 3U54A 4KRDA 5TO8A 2GHLA 3C50A 2VRXA 3QD3A 4JS8A 5D7AA 4DFZE 2WMUA 2G01A 4ASEA 4BCNA 2VWWA 3ZC6A 3FXXA 4L43A 1OUYA 5E8WA 1YHSA 3E92A 3NSZA 3RHXA 3G9NA 2REIA 2WFYA 5AP7A 4FUYA 5HTBA 3OROA 1PHKA 5G1XA 3RM6A 3W18A 4DGOA 3ZBFA 5DMZA 4IB5A 3VJNA 2VO0A 3COIA 4AACA 3GNIB 4IB3A 5JH6A 4AQCA 4FTRA 2DQ7X 4F65A 2JLDA 5BVEA 2X1NA 5JZJA 3QZFA 3BHYA 3U6IA 3GFEA 4PNIA 4D0XA 5LVNA 2FSMX 3EOCA 4ACGA 3KVXA 2R4BA 3TCPA 3D5WA 4QT1A 4C4GA 3ZXTA 2P4IA 5HTIA 3F7WA 3EKNA 1ZMVA 4A4OA 4K9YA 4FV2A 5J7HA 3TUBA 4F9CA 1QL6A 1OKWA 2UZUE 2C1AA 2QOQA 3NGAA 4XOYA 3SXSA 4C62A 2J9MA 2X7FA 3OOGA 4TTHB 5BVOA 3TZ7A 4EOPA 4TWCA 4IX4A 1UV5A 4BDIA 2WO6A 1XO2B 4FKLA 4V05A 5FXSA 2YM6A 2FSTX 3LIJA 5H9BA 4WT6A 5BPYA 1TVOA 3CKXA 4XG9A 1LP4A 5ANEA 1E1VA 3A8XA 3VS3A 1U4DA 3ZUUA 4ENXA 4HNIA 1H28A 1P2AA 4FTCA 4FV7A 4JBPA 4WG5A 2UZDA 3C7QA 2QO2A 2QU5A 1Q97A 3VJOA 4IZYA 3WF5A 4A7CA 4U5JA 4OAVB 1PRYA 4DFBA 4X2JA 2BFXA 5M53A 3LXLA 2C4GA 4ZTMA 4FIGA 4IZAA 3E3PA 3KXXA 4ZJJA 3TI1A 4GYIA 3VNTA 3IW7A 5ANJA 2QOFA 1IASA 5KZIA 3VHKA 3ZO3A 5I9UA 4WG3A 5LWNA 4DC2A 1WVWA 5J9YA 4CCUA 2B9FA 4ALWA 4R1VA 1Y8GA 4KAOA 5IMEA 3FKOA 4GJ2A 3LCDA 3ZFYA 3EQRA 1ZY4A 2FYSA 4ALUA 4FT3A 5I9ZA 4RC2A 2GNGA 5LARA 3LCTA 4MK0A 5G6VA 3LVPA 4L68A 4U9AA 4AOTA 4USFA 5HLWA 1FBNA 3N4TA 4XS2A 3TT0A 3UOLA 1JBPE 1P4FA 4FGBA 3PJ1A 4QMVA 5CU2A 5J95A 3VBTA 2NNWB 4ASXA 3ZU7A 4BDDA 1PMEA 2RKUA 3FPMA 1OITA 3L9MA 5ANIA 3R28A 4AP7A 3EN4A 3F3TA 3IOPA 4XG8A 3ERKA 4Y5HA 3KULA 3L8XA 4YP8A 3H9RA 4CMTA 4LMUA 2GQRA 2W1CA 4D2WA 4C61A 4LRJA 5CVGA 3DNDA 3CD8A 4CG8A 5IQHA 3R30A 2XF0A 3M11A 2HENA 4JT3A 4AU8A 3UMWA 2X6EA 4MF0A 5BX0A 2PE2A 2HYYA 3ELJA 2UVXA 5EM7A 1M2RA 2ZDTA 1H1WA 3GCUA 3MW1A 3BHVA 4AF3A 4TY1A 1B39A 1YI6A 2YISA 2ETKA 5KHWA 4FV4A 4GK3A 4NM7A 5DWRA 4RWIA 1T46A 3OEZA 2E9VA 3RINA 4NH1A 2JDSA 2GFCA 3IECA 5ACBC 1H08A 4UMPA 4RX8A 3Q52A 3S95A 4WKQA 2BMCA 3FC1X 5LCKA 4A06A 3PJ8A 1ZAOA 3QLGA 4BTJA 2BPMA 3C5IA 5HG7A 4OTWA 1S9JA 2V0DA 4O22A 4DEIA 2OH4A 3QKLA 3BCEA 3UGCA 3U51A 4BYIA 3NAYA 4D58A 5DR2A 3FLQA 3C0HA 3BLHA 3BKBA 5H3QA 2W05A 5FEEA 3QKMA 3EFKA 4NZWB 5LXMA 3DLSA 1DAYA 3GCSA 3GENA 3BYMA 3QRJA 4R3RA 2YJSA 3S3IA 4M68A 4OAUC 5DA3A 3MH0A 2R0UA 3D7TA 3QTXA 1ZZ2A 3MPMA 4NW5A 1V1KA 4NUSA 3HGKA 2BZIB 2B9HA 4E6CA 4II5A 3Q6WA 4IAAA 2GHGA 2OZAB 3B2WA 4ZIMA 2JAVA 2C5YA 2EUFB 2WQBA 2XBAA 2XNPA 2ZM3A 5FP5A 2O3PA 4PP9A 1OIYA 4C3PA 3ZO1A 4BB4A 3RKBA 3H10A 4F0GA 3NWWA 3FV8A 3LE6A 2XZSA 3FLZA 4I23A 2ITUA 1IR3A 2VO6A 2OH0E 3MBLA 4ZTRA 5CZIA 4IM2A 5F95A 4BZOA 1UU8A 4IC7A 1ZRZA 2X4ZA 2B9IA 4HNFA 5DI1A 3RAKA 3TIYA 3UC3A 3MESA 3R9RA 2W1GA 3JY0A 4IBMA 4ZTLA 1GIHA 3MVMA 4IZ7A 4KIKA 5D7VA 5IQEA 4QP4A 4USDA 4I3ZA 3ZFMA 3BWJA 4D0WA 3R7UA 5ETFA 2R3JA 5M55A 4B4LA 4TYGA 3M2WA 4GS6A 2R5TA 2E9OA 2CDZA 3ODZX 3R04A 4V0GB 4W4WA 3LXNA 3EN9A 3R1QA 4XV9A 2ZOQA 5I5ZA 2R7BA 2O2UA 5L2TA 4L01A 3CIKA 4BR3A 4AUAA 3LCKA 4JJRA 4Q5HA 5IQGA 2PHKA 4QP2A 3TNWA 3DBFA 4BBMA 2XBJA 3KVWA 1APME 3FI8A 3F9NA 3AC5A 3R21A 5IPJA 5AP2A 3VS7A 4EJNA 3UO5A 4FKGA 3SGCA 4N4SA 4D4RA 5E8ZA 2QO7A 5IQBA 4EQMA 4FMQA 1KE8A 4X6RA 5HO8A 3ZRMA 3W1FA 3QL8A 5CYIA 3DB8A 3ZUVA 1M7NA 4N70A 5C4LA 3PVGA 4CYIA 5IQDA 1O6KA 4U3YA 3R8VA 4FL2A 3L9NA 3GU5A 3CR0A 4EOLA 3NUNA 4I5HA 4FTUA 2J6MA 3CXWA 3LZBA 3CGFA 1Q8UA 3FLNC 3SV0A 2BAKA 4L7FA 3BI6A 5DG5A 4R6VA 4JLCA 1DS5A 5B2KA 1CTPE 4MWIA 2RL5A 1XBAA 3HV3A 2UVZA 1XKKA 4ITJA 3F88A 5CEIA 4R8QA 4FZDB 1IA8A 3QTIA 2QKRA 3I4BA 3IW6A 4FT9A 1ZLTA 4JQ7A 2XA4A 2IW6A 3FYKX 4UMTA 3ENMA 2RFSA 3E8CA 1NVQA 3COHA 4XUFA 3F3WA 4YJVA 4BCMA 4QP6A 3RGFA 4PMSA 4FT7A 1ERKA 2BDWA 3K2LA 4XLIA 4ZJVA 3UP7A 3ZLSA 4QMNA 3OC1A 5BQ0A 4PF4A 2BIKB 2F4JA 4UY9A 5DHJA 2YIXA 4ZY5A 3OG7A 2R7IA 3S4QA 3O8PA 4GU9A 4X7QA 3TL8A 5J9ZA 1WBSA 3HRCA 2J0MB 2PL0A 4BDAA 2PVYA 3V51A 3HECA 1JLUE 3SRVA 1LR4A 4IVBA 4CFVA 4R3PA 4DN5A 2ITOA 2BKZA 2PMIA 4EKKA 2BILB 4DT9A 5I3RA 5AV0A 2XK4A 5FM2A 2J51A 4QQCA 5M08A 3RI1A 4R3CA 2QURA 1FVRA 2ITYA 2JBOA 2VTHA 4BWPA 2XUUA 3DY7A 3WF6A 2A27A 3EN7A 4RVMA 4FEWA 3Q2JA 3WIGA 4XCUA 4MAOA 4MHAA 3QCSA 2Y6OA 3TNHA 3A7GA 2PZYA 2AC3A 2WMSA 3GCPA 4J99A 4ZSAA 5ICPA 5LMKC 4FEXA 3U6HA 1KE7A 3POOA 4KKEA 4E7WA 4FA2A 2PUPA 4MKCA 3OMVA 2XNGA 2A4LA 3NUPA 3PIYA 1WVXA 3UIBA 4I5PA 4AW1A 3V6RA 4FK3A 1KUTA 4WBBB 1STCE 3COMA 4CKJA 4IH8A 4FIJA 3PXYA 3VBXA 2V55A 1SNUA 3F5PA 2J5FA 5EHLA 3U9CA 4PV0A 3ZLWA 2R9SA 3AMBA 3D0EA 1URWA 3FMKA 4QNAA 4BCKA 1IEPA 1XH5A 2H96A 3BGPA 2QD9A 3UE4A 4C4IA 4J8NA 1Q5KA 2GS7A 4IXPA 4K8AA 2W5HA 2X7OA 1P4OA 3IDCA 4X2FA 5A46A 4XJ0A 4MBLA 4FG7A 5AV2A 4AA0A 5KBQA 2XMYA 3DAJA 3PVBA 1NT2A 3A7JA 3QLFA 3E64A 2JKOA 5HVJA 4ERKA 5ETAA 3TIZA 2VTJA 3TXOA 4IM3A 4RC4A 4RQKA 3LQ8A 4G5PA 3WE8A 2WEIA 2ZM4A 4YZ9A 4LMNA 4YZDA 4C38A 5AR5A 1QPJA 3IDPA 5FXQA 3UOJA 4DF3A 3OCTA 3R63A 3V6SA 5A4EA 5KKRC 2UW8A 4DINA 3ZDIA 4CFUA 4GUBA 4YZNA 3FAAA 4HCVA 4U80A 5DLSA 2IW8A 4WNPA 2XEYA 3QTWA 1OIUA 5GZ8A 2X8EA 2UW7A 2FA2A 1ATPE 3DLZA 4Y83A 2QOLA 4TZRA 3LLTA 4FOBA 2B52A 2OBJA 4U97A 4JX3A 4XRLA 4RQVA 4BRXA 1YXUA 4K2RA 2CLXA 2PVMA 5HNGA 2UVYA 4A9UA 2JDTA 1YXVA 4U42A 3GU7A 5AJQA 3O71A 4I93A 3OY3A 2VX1A 4OLIA 2I1MA 3C9WA 1CDKA 3H9FA 4MXAA 3OOMA 3KRLA 3BGZA 5CSWA 1TQIA 1H8FA 3ULIA 2C6EA 5HX8A 4XLVA 3F3ZA 5CU6A 1Q8WA 1GAGA 4FV9A 3RK7A 4MYGA 3OUNB 4TYJA 4FV8A 4FZ6A 5AM7A 5EI6A 3H0YA 2PVFA 3V8TA 4AGWA 1U59A 3HP2A 3ZDUA 1Q3DA 3C4XA 4G3GA 5AP6A 1MUOA 4NFNA 3WI6A 3G33A 4QMPA 3RPRA 5KMOA 4WHZA 2YCSA 1M7QA 3EZVA 2XRWA 3G0FA 2X9FA 4FNYA 3MYGA 2J4ZA 5CTPA 5HHWA 5AA8A 3WIKA 2OIQA 2WU6A 5JQ8A 4B8MA 3V04A 4PL4A
chains in the Genus database with same CATH superfamily
3N9XA 5K4IA 3PXZA 3KN5A 1EH4A 1K3AA 3Q5IA 4QP9A 1O6YA 3TJDA 3GP0A 5H8GA 5F94A 3ZOSA 5I9XA 3VUIA 3BZ3A 3LKMA 3UDTA 2FVDA 4KABA 4O7WA 4HGEA 1ZOEA 1NA7A 3UYTA 5B7VA 3ITZA 1ZZLA 4FV0A 4EHZA 5AMNA 5A4LA 3KFAA 3OT8A 3EB0A 3MY1A 4GFMA 4M69A 4O7RA 1WAKA 2PMOX 2X6DA 4M3QA 3LM0A 3FQEA 3QTQA 4YJUA 4PPAA 3QC9A 4EBWA 2XH5A 2JFMA 4PP7A 3NVMB 4BBFA 4MBIA 3ZSIA 3IS5A 2C69A 1E9HA 1ZXEA 3NUUA 4QOXA 5L4QA 2CGXA 4Y85A 4J96A 5HE0A 3MPAA 3RVGA 2B9JA 4K1BA 4RVKA 4D28A 4EONA 5HNIX 5FBNC 4CG9A 3NRMA 5AUXA 2GNHA 4JDIA 2I40A 4EHVA 5HU9A 2IZTA 2JDVA 2ZB0A 1PXIA 3RAHA 5J5SA 3OY1A 5CLPA 4A07A 3RZBA 5GZAA 4G16A 4O7LA 2WMXA 3TM0A 5EM5A 3TWJA 3W32A 4ACCA 4ZAUA 2IPXA 3NNXA 3Q6UA 4NTSA 3S1HA 2ITPA 4D2SA 2H34A 4L44A 4RWJA 3TN8A 1YXXA 2BTRA 2A1AB 5LMKA 3LPBA 4CLIA 3EYHA 5HVYA 1XR1A 3T9TA 4UMRA 5EQEA 5AP0A 4KKGA 4NT4A 4I5MA 4W4YA 5CF4A 4BY9E 4BCFA 3A4OX 3QC4A 4JDJA 4ZTHA 4S31A 3W2RA 4FEUA 4AOJA 3ZCLA 4YBJA 4UXLA 4AGDA 2R0IA 4Y46A 4NSTA 2F7EE 2HIWA 2BDFA 3D14A 4IVAA 4OTRA 3KL8A 4KBAA 3FXWA 3VUKA 4PTCA 3R7YA 2ITQA 1OB3A 5HOAA 3W55A 2RFDA 4C0TA 3FMMA 5AAGA 4FVPA 1WBNA 1WBTA 2J50A 2PWLA 4XHKB 4EH2A 2YITA 3FEGA 1W98A 4I41A 3QQLA 2YM4A 3F2AA 3R8UA 4L6QA 4TYHB 1A48A 1YDTE 4KIKB 3TZMA 3FZOA 1X8BA 5EOLA 5AUYA 2WMTA 5DNRA 4FIIA 3NMUF 4G6OA 5M4CA 4QMZA 3PA4A 4OTGA 5IEYA 2XKDA 5BVWA 3FKNA 2IZSA 4B99A 4MVFA 4DHFA 1YWVA 4BDEA 3FMLA 1H27A 3KCFA 2WTKC 3BYUA 5CXHA 4H3BA 5CT7A 2VD5A 2YEXA 4M0ZA 5C01A 4EUTA 1M17A 5HU3A 3ID6C 4MXZA 4F99A 2B0QA 2QHMA 2C6IA 3GQLA 5J1VA 3DJ5A 1BUHA 4BCIA 3BV3A 3IG7A 4OTIA 4BC6A 4IWOA 3AOXA 1J7IA 3JR1A 1YI4A 3EQDA 4AXDA 3KXMA 2GNIA 3BU6A 4LRKA 3Q9XA 5FWKK 2ETMA 2X4FA 5IA3A 1HCKA 1DAWA 3ZFXA 5C8KA 2GFSA 3RMFA 5CNNA 3L9PA 2GMXA 2PUUA 2UZTA 1J1CA 4BF2A 2IWIA 1OPJA 2C1BA 4EH7A 5DT4A 2J0KA 4MD9E 5CY3A 3QTUA 1BI8A 5EQYA 4GUEA 1R78A 3OCGA 3OWPA 1PF8A 4DE4A 4FZAB 4FKSA 1RQQA 5L2QA 4JBVA 5J87A 4Z16A 2BRHA 4AW5A 3HLLA 4G3EA 4FTJA 5LWMA 3AD4A 3RAWA 2VGOA 4FNWA 2I0VA 3VS4A 4TL0A 5CEMA 4U81A 4W4VA 1PXPA 4C33A 4G2FA 3F69A 4KS8A 2WZJA 4C4JA 4HYUA 3W10A 4FICA 4ZTQA 4U6RA 5FDXA 4M12A 4A9YA 1REJA 3E7OA 2F9GA 2PMNX 4GVAA 3BX5A 3IO7A 2YZAA 4DLJA 3DK6A 4D9TA 4FTMA 2W4OA 2W4KA 4AXAA 4TXCA 2J7TA 4MCVA 3LJ2A 2A2AA 1WBPA 2VGPA 2W1HA 3ZUTA 2YWVA 3UYSA 3QXPA 3QHRA 3FMDA 4UYAA 3EQGA 3DZQA 1YDSE 4RJ7A 4YMJA 5IISA 2PVKA 2GS2A 3R8MA 4V01A 4F6SA 3DK7A 3NIZA 4YJNA 4IACA 3OXIA 2Y4IC 3BRBA 3HV4A 2YAAA 4XG3A 3ORKA 5DPVA 3KRJA 3EQHA 5AR7A 4HVHA 4CKRA 5L2WA 1G8SA 3PWYA 3UMXA 3TKUA 2ZJWA 4O21A 4ALVA 4J8MA 4NKAA 3QXOA 3WZJA 2EU9A 3HV6A 3QBNA 4I0RA 3R22A 4F9AA 4BKJA 4UMUA 3CPCA 2R3RA 4DG2E 2BKKA 3LFAA 3KRXA 2OFUA 5CXZA 4MQ1A 2ZMDA 3EIDA 5ANOA 2YCRA 4NCTC 3EFLA 5KX8A 4NL0A 4ANMA 4G3FA 5FQDC 1OKVA 2HOGA 3RNYA 5IDPA 4QMYA 3T8OA 2HZ4A 3BHHA 4FSRA 4QTBA 3W2QA 4BJJA 3QQHA 1E1XA 2QG5A 4R77A 4PTEA 5HE3A 3E5AA 3ORNA 4LFIA 3QTZA 3R7GA 3V3VA 2IVUA 3LM5A 5JGAA 3W2PA 3R1NA 5DYJA 3Q9WA 3W16A 4DFUA 1H25A 4TPTA 2YM7A 4N0SA 4JAJA 4NFMA 2J90A 4HZRA 2QOIA 2CGVA 2YJRA 4IDTA 4WG4A 3RP9A 4FSNA 5HLPA 5C8MA 2Q83A 3ZSGA 3C5UA 3EFJA 1H1QA 1NW1A 4EK3A 5M07A 4BZNA 4AXEA 4YUQA 3TZ8A 3V8WA 3O8TA 3MSSA 4QNYA 5KMNA 2XCHA 4FSTA 4YZBA 1V0BA 3KC3A 3UVQA 4D1ZA 3DAEA 3ZO4A 4OBQA 4F63A 2WTVA 1CMKE 3R71A 3PJ2A 3RK5A 2V7OA 3H4JA 3ACKA 3DQXA 5EQPA 3K3IA 2CKEA 3FL5A 5IKWA 4WRSA 5JFVA 4BHNA 3FMEA 2AYPA 4EORA 2XJ0A 4EOQA 3FZSA 4ANSA 3HMOA 2H8HA 2WQMA 3E8DA 2W06A 3BYSA 1XBCA 3GGFA 3ZBXA 1CKIA 4XV3A 4BIEA 4GSBA 4ZP5A 3DAKA 4BI2A 3PLSA 3C0IA 2W17A 2PZRA 3WZEA 4Y73A 4PWNA 4O96A 4M8TA 5AP3A 4DYMA 3O50A 1SM2A 2H6DA 3R7VA 2XNBA 4FEQA 3FLYA 4JXFA 3RHKA 1BL7A 3TNIA 3SG9A 1A06A 1QMZA 3DK3A 3DOGA 4BCHA 4M13A 1ZYLA 4O91A 2WELA 3KB7A 4X3FB 1GZNA 2UV2A 1OIRA 1PYXA 3PSDA 5M44A 4I4FA 2QR7A 5E90A 3C4FA 1M2QA 4GV1A 1URCA 4PMTA 2I0YA 2X2KA 3NYOA 2PZPA 5FLFA 3T9IA 2RFEA 5CALA 4DFLA 3VO3A 3A2CA 1YHVA 3UVPA 4EH3A 2DWBA 3IGOA 5HGIA 1REKA 4EKLA 4ORKA 5IA0A 4EYJA 4X0MA 4ZLZA 4I6BA 2GNLA 4W4XA 4ANNA 3HEGA 3JVRA 3A61A 3LFQA 2JD5A 3KQ7A 2VAGA 5CAPA 2HZNA 2C47A 5E1SA 4E1ZA 4JDKA 2VTMA 4GYGA 2Y8OA 4HPTE 5DOSA 4QMQA 4RG0A 3E62A 4QPMA 5FM3A 4CGAA 2R3MA 3EWHA 5DIAA 1DI8A 1FMOE 4MTAA 3VN9A 3PXRA 4CMUA 1RDQE 5A3XA 3R73A 3EQPA 2WIHA 3EQCA 4J1RA 3WF8A 4QMUA 3DBEA 3UPXA 3PRIA 4GIIA 2XJ2A 1MRUA 2F2CB 4XRJA 4AZFA 3DDPA 1QCFA 2O0UA 4BL1A 2IZRA 3II5A 4IB0A 4QDVA 3UNKA 2PVRA 3CPBA 4YJTA 4KIOA 3E63A 4L3LA 1OBDA 3G6GA 4X2NA 3GCVA 4L8MA 4LGHA 5HIBA 2C3JA 4QP3A 1RJBA 4KSPA 3ZLYA 4BKZA 3UP2A 3RNIA 4HCTA 3VS5A 3QRKA 5CSPA 2ERZE 1ST0A 4YR8A 1YWNA 4DDIA 3LFFA 5EYDA 5HZNA 5DEWA 3HAMA 5FEDA 5IDNA 2IN6A 4F64A 3AG9A 3FHIA 3I6UA 4L53A 2OXYA 4D2TA 4F7NA 4ACHA 5F20A 5KO1A 2PYWA 4F09A 4X3FC 3ZEPA 4U43A 3GC7A 2E2BA 3BYVA 4D55A 3DXNA 4NYEA 3WZKA 4YHTA 2EXEA 5DT3A 4MD7E 2BFYA 2G1TA 4XG6A 3O51A 4R7IA 4F7JA 3N4UA 2VWIA 5ANKA 4FKOA 2Y6MA 4TYHA 3VUHA 3ORMA 4CEGA 1UA2A 2ERKA 3KN6A 3E8EA 5C4KA 5HNBA 3LMGA 5CSHA 4YLKA 3RPYA 4DEGA 4JRNA 1JOWB 4MQ2A 2QOCA 2XCKA 1GIJA 2OICA 3KKVA 3LFNA 2RG5A 4ZTNA 4QMOA 1G5SA 4O0VA 4D1SA 4HVIA 4W9WA 3M1SA 4GKHA 3N4VA 3TTIA 2WQOA 3I0OA 2C5OA 4IAKA 4RIWB 4AGUA 5B2MA 5M4IA 5CSXA 4C35A 5HI2A 3UJGA 2HW7A 1JWHA 4NM5A 3DTWA 4N6ZA 5HX6A 1GJOA 1FQ1B 3F5UA 2GNJA 4QD6A 4F0IA 4MXOA 1J1BA 1W2DA 5CENA 4GH2A 3GBZA 4RBLA 3COKA 2YM5A 4MWHA 4FKPA 4E8AA 4F9WA 4JG8A 4F0FA 5DVRA 1OGUA 2PE1A 3I1AA 3SA0A 4H3PA 5BVDA 3BLAA 2B4SB 3VIDA 3VHEA 4EWQA 3F5GA 1OI9A 5E7RA 3VS0A 3ORXA 3D7ZA 3VRZA 2R3PA 2PUIA 4AOIA 2Z02A 3UZRA 4XV1A 4AGCA 4LGDA 4DEAA 3UVRA 3ZRKA 2BVAA 4U45A 2F57A 4WOVA 5BYLA 4L42A 4DHIB 4MF1A 4OR5A 3KXGA 5K3YA 4G5JA 1FMKA 4WSQA 1YOLA 1LUFA 3OF0A 3KULB 5HKMA 1PMNA 1PYEA 2GNFA 4J95A 2UZOA 4OT5A 3V01A 5EDRA 2CPKE 4CFXA 2XALA 2P55A 3FSFA 4IAFA 3G2FA 3FZTA 4BWKA 4CKIA 5AADA 4NEUA 2VWBA 4I6QA 3R8ZA 5GIOE 4GL9A 1VYWA 3NDMA 4FG9A 4UX9A 3HRBA 3T3VA 4ANLA 4B6LA 2KULA 3CJGA 4GCJA 1PXLA 4BBEA 2XNMA 2Q0NA 4L9IA 4TWOA 3UO4A 2VN9A 2WTJA 3PJCA 3CEKA 1ZYSA 3CQEA 2WNTA 5KE0A 5CVFA 5K5XA 4FL3A 5HESA 2PSQA 4IX3A 5D9HA 4KIPA 3TNQB 4YO4A 5BMSA 4GK2A 5CAQA 4HGTA 2W4JA 4G6LA 4RC3A 4S2ZA 5F4NA 4BKYA 4NIFB 1Y8YA 2BHEA 4EHEA 4Q9ZA 5J9LA 4NJDA 3FY0A 3LFSA 2YA9A 3VQUA 3ZO2A 1BX6A 3IW8A 2PVNA 5LJJA 3ORIA 5M09A 2C3IB 2X8DA 3P08A 3PPZA 4RIXB 1OECA 3RCDA 2Z7RA 3A8WA 4YU2A 5JFXA 4FYNA 4D1XA 3FZRA 3SAYA 4UZHA 4PNKA 3QFVA 3NFGB 3AD6A 2B1PA 4LRMA 3QHWA 4PMMA 5EM8A 5HE1A 3EH9A 3UIXA 2I7QA 4U40A 4APCA 4GEOA 1SNXA 3QQGA 2GQSA 2WQNA 3R2YA 3S00A 4K0YA 2UZVA 2WIPA 3CBLA 3HVCA 1FVTA 2FSLX 3OWLA 2HAKA 4BCJA 3VF8A 3R00A 3OTUA 3ZLXA 3ZXZA 4JR7A 2YZLA 2Y4PA 4E26A 1CM8A 3MI9A 5KMLA 4AN2A 3OS3A 3FI2A 3QYZA 3R2BA 4WRGA 4YSMA 3K5UA 4EI4A 4BJJB 4FSMA 3ZSHA 4FZFB 4UZDA 1ZYCA 5FXRA 2V62A 1JKSA 3TNPC 4CMOA 3B2TA 4D5HA 3QCXA 2OJJA 2XYNA 3GCQA 5JRQA 3DS6A 2NP8A 3P23A 1NVRA 4NW6A 3PP1A 4DEDA 1I09A 4UV0A 5CNOA 2BALA 3IKAA 4E93A 3BBWA 2WTWA 2ZDUA 4JMQA 4CVAA 2JC6A 2JBPA 3IW5A 3R0TA 1Y91A 2Q0BA 3P1AA 2W7XA 5AUWA 4Q2AA 3HMIA 4D2RA 3DDQA 4LL5A 5HCXA 5HG5A 1YW2A 4LDTA 2E9UA 4O7SA 4BI1A 4HYSA 5M4UA 2G15A 4P5ZA 4EZ7A 4O2ZA 1SZMA 3PA3A 4G9RA 4FT0A 3RWPA 3F2NA 3AKJA 4B8LA 4FODA 3DKCA 2VX3A 3TUCA 4QMXA 3C4EA 3FBVA 4BI0A 2WTDA 2CMWA 2VUWA 2PVLA 5M4FA 3DQWA 3UG1A 3FLSA 2JAMA 3EHAA 4M0YA 4O6LA 4TRLA 5HG9A 2F7XE 2QI8A 4HCUA 4FSWA 4GMYA 1JNKA 2I0HA 3TKIA 2YDKA 3ZM4A 4AT5A 5LVOA 3KMWA 2QO9A 3PY3A 4FKWA 3O8UA 4CYJA 2W99B 4PTGA 1BKXA 2YM3A 3FMJA 4YNEA 5GJFA 1W7HA 2PVHA 2ZMCA 2YDJA 4E6AA 2C6DA 5E8SA 2VZ6A 3MVHA 3QKKA 5EDQA 1YQJA 5CQWA 5CEOA 2BDJA 4QEBA 4QYFA 4C37A 3MFSA 1W82A 4YJQA 5H8EA 4XYFA 3RPOA 1KE9A 5L3AA 3QRTA 4WD5A 4CXAA 3QZIA 4WA9A 1UU9A 3DJ6A 2GTNA 4IX6A 2JIVA 3GQIA 3LW0A 4G1WA 3R02A 4RZVA 4PMPA 3TDVA 3OW3A 3NW5A 1BYGA 3TG1A 3ZONA 1UNGA 3OCSA 3G9LX 2QLQA 5KUPA 2F49A 3O7LD 2OFVA 2XYUA 4U41A 2A98A 1NXKA 5AR8A 2C5VA 3ZM9A 3R01A 4H1JA 4S33A 4X3JA 2PMLX 3ANRA 4MNEA 4RZWA 2B53A 4RRVA 2JKKA 3LQ5A 3PPKA 2O5KA 2XKFA 2BCJA 3HX4A 3NNWA 4O0RA 3R83A 5GINE 1KE6A 3Q60A 3BQCA 4IIRA 3RWQA 3UOHA 3MH3A 1G3NA 2BR1A 2OGVA 4UBAA 5CS6A 5CVHA 1UKHA 3K5VA 3OWJA 2GQGA 1KV1A 2W96B 3UIUA 3VS1A 5F9EA 3QQKA 5E4HA 3NUXA 3CGOA 3L8SA 3ORPA 3Q96A 3QA8A 4FTOA 5BMMA 4BVUA 3SRVB 4KD1A 4O27B 4RJ6A 4U8ZA 3FPQA 1R1WA 4AA4A 2UZEA 5IZFA 4RWLA 4IAZA 5CAUA 4H1MA 3HDMA 5LMBA 2JDOA 3AD5A 3E7VA 1FGKA 3PTGA 3W8QA 1NVSA 1YRPA 2G2HA 4UMQA 2GSFA 2YDIA 2UZLA 2JEDA 5AX3A 4NJ3A 4F6UA 5DE2A 3Q2MA 1ZWSA 3CJFA 1XWSA 2W1EA 3VAPA 4D4YA 4FTKA 5JRSA 2C0OA 3BYOA 4M66A 4PY1A 4FX3A 1U54B 2QVSE 4KIQA 2XS0A 4W8EA 5L8KA 4C8BA 2XVDA 4YSJA 2WGJA 3UTOA 4D4SA 3DPKA 3MS9A 4XOZA 5FDPA 1Q61A 2Z60A 2QOHA 4DBNA 5A14A 4EOKA 3QZGA 5ITAA 3VS2A 2HK5A 3UODA 4JAIA 1OGYA 1YDRE 4QP8A 2W1IA 2VTNA 3TUDA 2VU3A 5EK7A 4K77A 2WMVA 3RALA 3UQCA 3U6JA 3NYNA 2WQEA 4HYIA 1SVHA 3WE4A 2DUVA 4EYMA 1GZ8A 5CZHA 3R9OA 2OIBA 1YWRA 2V5QA 3HRFA 2V7AA 4GU6A 4JX7A 1XQZA 3BGQA 1OZ1A 3I0QA 4FSQA 4ITHA 3QX4A 4YJSA 3MIYA 5J1WA 3HUBA 4JDHA 4GG7A 1OL2A 4FK6A 4LQMA 1G8AA 3BL9A 4O1PA 3SLSA 2YM8A 4EH6A 4YHJA 5BUEA 3D5UA 4U3ZA 3PJ3A 2ZV7A 4UWBA 1TQPA 3BELA 4I22A 4YJRA 3NVKI 3MA3A 3NZ0A 4H3QA 5EKNA 2OXDA 4A9RA 4AWIA 2XNOA 3F82A 3I7BA 2WKMA 2BROA 5B2LA 4ZS0A 3VUDA 2FSOX 3G15A 4QQJA 3AT4A 4AAYA 1RW8A 2GHMA 2IG7A 3C51A 3I5NA 1H0WA 1XH6A 5KHXA 2XKEA 2ITXA 3GT8A 4JOAA 3WF9A 3DFAA 3I6WA 4NM3A 4YTFA 2CKOA 3EN5A 4A4LA 2VO3A 4B9DA 3PG3A 3KF4A 3NCGA 4BDGA 1H24A 1YXSA 2CGUA 3V5TA 5IU2A 1PMVA 5J79A 2ZV8A 3GU4A 4AZVA 5IH6A 2Z7LA 2IW9A 4BDJA 3ATSA 1KV2A 2XK7A 4JL9A 3QD4A 1J3HA 4O7YA 4IQ6A 3P9JA 4HZSA 1OM1A 4GFGA 2OZOA 2XEZA 4TN6A 4CNHA 4KSQA 4WUNA 2PZ5A 4ZLOA 4DTKA 4NWMA 3GC0A 4C4HA 5K0XA 5KCVA 3ROYA 4O7ZA 3GC9A 5C03A 4AZWA 2ZVAA 4J7BA 3AC8A 5HO7A 1JKTA 3PFQA 1F5QA 4BICA 2VTRA 4RFMA 5AUTA 3SW4A 5IA4A 2R3QA 4F6WA 1OL6A 4V0GA 3LLAA 5EI2A 4E5AX 4M14A 3ET7A 3IPHA 3ORZA 4UXQA 3FZPA 4RMZA 5EYKA 3UPZA 4O7NA 2KTYA 3BWFA 5IG1A 4AS0A 2QC6A 3ALOA 2XRUA 3DBDA 3NAXA 4R1YA 2C68A 3MN3A 5CWZA 2JITA 3CE3A 3LFCA 4RLLA 2QR8A 1JSUA 1JVPP 2YHVA 3ZEWA 4QP1A 4CRSA 4RX5A 5E9EA 2UW5A 4I0SA 4MNFA 4AN9A 5AV4A 4CV8A 1PXMA 2UZNA 4F1TA 4J71A 2P3GX 3OD6X 5EHYA 3ULZA 4DHJA 3KRRA 3SDJA 4UN0C 4Y8DA 2CNVA 4S30A 1UNLA 2PTKA 1MP8A 4ID7A 2RSVA 2EVAA 2WTCA 4RVTA 4EK6A 2ZAZA 4L67A 4BDBA 3Q53A 4ACDA 3MH2A 3I5ZA 2CKPA 2V22A 4L00A 4QYEA 5K0KA 5FGKA 2XK8A 2W0JA 3RM7A 2E9NA 3CQUA 3FMHA 3F2RA 3QX2A 3WZDA 5L2SA 2WOTA 3QZHA 4KWPA 4JIKA 5CEKA 3NFFB 1Y57A 3Q4ZA 1P14A 2RF9A 2Z2WA 2BAQA 2QCSA 4CZTA 5CI7A 3L1SA 3D5VA 4XP3A 4EOOA 2YABA 2R3IA 3PXKA 4FUXA 4P4CA 4DFNA 2X0OA 4AA5A 3GXLA 3ZMMA 4Y72A 5ANDA 4G34A 4O4FA 5AEPA 1M52A 4C34A 4WBOA 4DH7A 3A7FA 3F61A 3KXZA 4YJPA 3REPA 3SOAA 3PA5A 5AP1A 2X39A 3TACA 2NRUA 3KXNA 3TMOA 4FBXA 3GB2A 4FV6A 4NCTA 2VTQA 1GZKA 3CY2A 4I20A 4IMYA 1GY3A 5DR9A 3A4PA 4ZSEA 2CSNA 2UZBA 2IEWA 1Q3WA 4XP0A 1OMWA 3GU8A 5E8YA 3AC4A 5GHVA 3UQFA 2UW3A 2BZJA 3H3CA 3PZEA 4IAIA 2OSCA 1YVJA 5HD7A 4AN3A 5IUGA 2E9PA 2IF8A 2ITVA 4KBKA 3QUDA 4HPUE 5EDPA 5CEPA 3ETAA 3FQSA 4YC8A 5L2IA 4Z3VA 5I9WA 2BRMA 3EQBA 4PL5A 3NW7A 5EM6A 2OU7A 4S34A 2EB2A 4QMMA 3MTFA 5LMAA 3NNVA 2OZAA 2XIZA 3EL7A 3FKLA 4JG6A 4J52A 4EH8A 5KMKA 4R78A 3DA6A 4DG0E 2R3FA 3MVLA 1I44A 5E1EA 4ZMEA 4DAWA 5DT0A 2C5NA 4QMLA 4RJ4A 5EYMA 3VWAA 4O7VA 3W2OA 4R5YA 3P86A 1KSWA 3C4ZA 4I6FA 3CCNA 3K54A 3DNEA 1XH4A 1XH8A 4IDVA 1YOJA 2ZM1A 1FINA 4LV8A 5L6WL 2BHHA 2WU7A 3RCJA 3VBVA 2IVSA 2GS6A 4QO9A 3C0GA 4APPA 3EKKA 2ITZA 2UUEA 4QYYA 5DFPA 4AT3A 2CKQA 2ZFYA 1ZMWA 3BHTA 2BUJA 4DGLC 4FTIA 2YCFA 1K9AA 3E87A 3HL7A 4EJ7A 4FVRA 4W8DA 4Y95A 5L8LA 3QTSA 5KNJA 2FO0A 3FHRA 5CAVA 1HCLA 3D5XA 2FH9A 3OHTA 5KKRB 4QMSA 4KB8A 5M51A 3HP5A 5T68A 2G9XA 3CKWA 4B7TA 4DG3E 2XM8A 4I4EA 3QGYA 3SHEA 4BTFA 3GEQA 3QUPA 1PKGA 4OT6A 2ZYBA 3SW7A 5LVMA 2IJMA 2VTIA 4C4FA 3PVUA 1MRVA 3JYAA 4BTMA 5AAEA 2XIXA 4GT3A 1U5QA 4CRLA 5CU0A 5IEXA 4IANA 5FD2A 3R1YA 5BUJA 4J53A 5K4JA 2WOUA 4AW2A 4DEHA 4KUJA 3PXQA 3U87A 5H2UA 3EN6A 4GT5A 4UEUA 3VUMA 4GK4A 4TT7A 5CEQA 4PX6A 1UU7A 3FXZA 2R2PA 4FTNA 2I6LA 2C3KA 2QOOA 4IJ9A 3L8PA 4F4PA 3TDWA 4FTQA 3PIXA 3SD0A 5HD4A 3ZZWA 1V0OA 3QD0A 3VRYA 4FTLA 5I9YA 2X0PA 3MJ1A 4R7HA 1JAMA 4C02A 5JK3A 4PDOA 5F1ZA 4W9XA 3MJ2A 2O64A 3SXFA 3EYGA 1MRYA 4F70A 4EHGA 2OKRA 3TV7A 2PULA 1W84A 1UKIA 2HW6A 2WMBA 1XH9A 4CTBA 3GOKA 4O4CA 4ZSLA 5FTGA 3T3UA 4HJOA 2ITTA 4HOKA 5TE0A 3VUTA 3LJ1A 4XP2A 2PY3A 3DFCB 3RPVA 4ANOA 4O0WA 1OKZA 1GNGA 4FI1A 3OXZA 3MH1A 3OBJA 3NNUA 3ZRLA 4YNOA 4O0YA 3WBLA 2JIIA 3NX8A 5DH3A 4DCAA 3ZTXA 4EUUA 3MB6A 3H0ZA 3IW4A 4XMOA 5ETIA 1W8CA 5IQIA 2OIDA 4YZCA 1H01A 3QTRA 4CSVA 2AC5A 4LL0A 4RIYA 2VV9A 2QOBA 4QTAA 2BTSA 3FQHA 2NPQA 3UC4A 5BVFA 4WIHA 4FTTA 4D4VA 4I6HA 3R7EA 1SVGA 4IVDA 1H1SA 4RSSA 5KMMA 1R39A 2G2FA 2VNWA 5IA1A 1QPEA 1Q8TA 3GU6A 3HUCA 5IQCA 3KY2A 1W2FA 1OL1A 4QMTA 5JEBA 5LOHA 5JZNA 3MPTA 5M06A 4FOCA 4G31A 5A4QA 4PDYA 5AFVA 5AV3A 2X8IA 2HXQA 2HCKA 4BYJA 4WNMA 3QRIA 1JKKA 3QWJA 4RIOA 1ZOGA 4FSZA 5E91A 5TF9A 3R7IA 3HNGA 3QA0A 2BZHB 3SQQA 4BGQA 3MVJA 5EHOA 3DKOA 5HIEA 2VWXA 4FG8A 4IC8A 4LOQA 1Q8ZA 3PSCA 4IFGA 5ACKA 4R7BA 3PLAE 4ASZA 4AZSA 3D9VA 2OF4A 3H30A 3FSKA 4KA3A 4ANBA 4I24A 2B55A 1G8KA 3ALNA 4FNZA 1ZARA 4X2GA 1O9UA 4GVJA 2RFNA 3ZH8A 3MB7A 5A4CA 1FOTA 1Y6AA 4LUDA 3OEFX 5BNJA 2PE0A 2XB7A 3O0GA 4O2PA 4ACMA 4ZZNA 3PY0A 1PXNA 3QF9A 4FV1A 3FYJX 4GFOA 4HVGA 5I0BA 3CD3A 3LFDA 4IHPA 3UNZA 1WBOA 1S9IA 2B7AA 1AQ1A 5TT7A 1K2PA 3SC1A 5EYCA 4CLJA 1FPUA 2NO3A 2XK6A 3AXWA 3AGMA 4HGLA 4OBOA 4OTFA 2UZWE 5IUIA 3Q3BA 4FIEA 4L7SA 3UIMA 4EC8A 5A6NA 3LAUA 4YPSA 2CNUA 4C2VA 5IA2A 1VJYA 2WHBA 3FY2A 3MV5A 4N6YA 4YURA 5CSVA 3O23A 4C7TA 4EH4A 2VTTA 4MXCA 2C6OA 2B54A 4BCGA 3L8VA 3R7OA 5D41A 4ZEGA 3QCQA 4AZTA 3NUAA 2R3NA 5LVLA 4K6ZA 4MXXA 4BN1A 4TWPA 4O84A 5JQ5A 3FWQA 5JN2A 3KXHA 3V5LA 1H1RA 5HORA 3NIEA 4QP7A 4OGRA 1JQHA 1R0EA 4KKHA 3PDTA 3OXTA 1GZOA 1NY3A 4RJ5A 1J7UA 4PL3A 4B0GA 4DGMA 2YIRA 4ARKA 4X3FA 2C3LA 3AC3A 3ORLA 4FV5A 4EH5A 3EFWA 3C1XA 2XJ1A 4FYOA 5D10A 3R9HA 3O17A 4FF8A 1MQBA 2XNEA