3CRDA

Nmr structure of the raidd card domain, 15 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
100
structure length
100
Chain Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RAIDD CARD and model for CARD/CARD interaction in caspase-2 and caspase-9 recruitment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Caspase recruitment domain
molecule keywords RAIDD
total genus 26
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1998-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3crdA00
2G7RA 2L6AA 1A1WA 4M9SA 3QF2A 4M9XA 2YU0A 1WH4A 4IZAB 3CL3A 2YVIA 2LS7A 2YQFA 4M9ZA 4RHWE 4A2WA 1N3KA 3T6PA 4IZ5E 4O6XA 2LWDA 4O9FA 3YGSP 2HM2Q 1A1ZA 4P4HA 1WMGA 4I16A 4ZBWA 2DO9A 1E3YA 2KM6A 4A2QA 4UZ0A 1NGRA 2A9IA 2NZ7A 4P4HI 3EZQA 2MPCA 2MS7A 2D96A 4FH0A 2M5VA 2GF5A 2N80A 4QOBA 2OF5H 4NQKA 3MOPA 2B1WA 1D2ZA 2KN6A 3YGSC 2P1HA 2MS8A 4RHWA 2N00A 2A5YB 4JUPA 3MOPG 4N1JA 2DBDA 3KATA 1WXPA 3J6JA 2N97A 2VGQA 3MOPK 1D2ZB 1FADA 4DWNA 4N1KA 1UCPA 4D8OA 3CRDA 1C15A 2N1FA 1CY5A 4O7QA 2DBFA 4IZ7B 3J63A 1DGNA 2NSNA 2DBGA 2DBHA 4O9LA 4LWDA 3EZQB 4JQWA 2YGSA 2F1SA 1PN5A 4N1LA 2OF5A 2IB1A 2LWEA 2L9MA 2NAQA 2BBRA 1YGOA 4EWIA 2N7ZA 1Z6TA 1E41A 4F44A 2BBZA 2N83A 3LQQA 4E9MA 3LQRA 2MN4A 1DDFA 1ICHA 1CWWA 4F42A 2MB9A 2O71A
chains in the Genus database with same CATH superfamily
2G7RA 2L6AA 1A1WA 4M9SA 3QF2A 4M9XA 2XV9A 2YU0A 1WH4A 4IZAB 3CL3A 2YVIA 2LS7A 2YQFA 4M9ZA 4RHWE 4A2WA 1N3KA 3T6PA 4IZ5E 4O6XA 2LWDA 4O9FA 3YGSP 2HM2Q 1A1ZA 4P4HA 1WMGA 4I16A 4ZBWA 2DO9A 1E3YA 2KM6A 4A2QA 4UZ0A 1NGRA 2A9IA 2NZ7A 4P4HI 3EZQA 2MPCA 2MS7A 2D96A 4FH0A 2M5VA 2GF5A 2N80A 4QOBA 2OF5H 4NQKA 3MOPA 2B1WA 1D2ZA 2KN6A 3YGSC 2P1HA 2MS8A 4RHWA 2N00A 2A5YB 4JUPA 3MOPG 4N1JA 2DBDA 3KATA 1WXPA 3J6JA 2N97A 2VGQA 3MOPK 1D2ZB 1FADA 4DWNA 4N1KA 1UCPA 4D8OA 3CRDA 1C15A 2N1FA 1CY5A 4O7QA 2DBFA 4IZ7B 3J63A 1DGNA 2NSNA 2DBGA 2DBHA 4O9LA 4LWDA 3EZQB 4JQWA 2YGSA 2F1SA 1PN5A 4N1LA 2OF5A 2IB1A 2LWEA 2L9MA 2NAQA 2BBRA 1YGOA 4EWIA 2N7ZA 1Z6TA 1E41A 4F44A 2BBZA 2N83A 3LQQA 4E9MA 3LQRA 2MJMA 2MN4A 1DDFA 1ICHA 1CWWA 4F42A 2MB9A 2O71A
chains in the Genus database with same CATH topology
2G7RA 2L6AA 1A1WA 4M9SA 3QF2A 4M9XA 2XV9A 2YU0A 1WH4A 4IZAB 3CL3A 2YVIA 2LS7A 2YQFA 4M9ZA 4RHWE 4A2WA 1N3KA 3T6PA 4IZ5E 4O6XA 2LWDA 4O9FA 3YGSP 2HM2Q 1A1ZA 4P4HA 1WMGA 4I16A 4ZBWA 2DO9A 1E3YA 2KM6A 4A2QA 4UZ0A 1NGRA 2A9IA 2NZ7A 4P4HI 3EZQA 2MPCA 2MS7A 2D96A 4FH0A 2M5VA 2GF5A 2N80A 4QOBA 2OF5H 4NQKA 3MOPA 2B1WA 1D2ZA 2KN6A 3YGSC 2P1HA 2MS8A 4RHWA 2N00A 2A5YB 4JUPA 3MOPG 4N1JA 2DBDA 3KATA 1WXPA 3J6JA 2N97A 2VGQA 3MOPK 1D2ZB 1FADA 4DWNA 4N1KA 1UCPA 4D8OA 3CRDA 1C15A 2N1FA 1CY5A 4O7QA 2DBFA 4IZ7B 3J63A 1DGNA 2NSNA 2DBGA 2DBHA 4O9LA 4LWDA 3EZQB 4JQWA 2YGSA 2F1SA 1PN5A 4N1LA 2OF5A 2IB1A 2LWEA 2L9MA 2NAQA 2BBRA 1YGOA 4EWIA 2N7ZA 1Z6TA 1E41A 4F44A 2BBZA 2N83A 3LQQA 4E9MA 3LQRA 2MJMA 2MN4A 1DDFA 1ICHA 1CWWA 4F42A 2MB9A 2O71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7R A;  2L6A A;  1A1W A;  4M9S A;  3QF2 A;  4M9X A;  2YU0 A;  1WH4 A;  4IZA B;  3CL3 A;  2YVI A;  2LS7 A;  2YQF A;  4M9Z A;  4RHW E;  4A2W A;  1N3K A;  3T6P A;  4IZ5 E;  4O6X A;  2LWD A;  4O9F A;  3YGS P;  2HM2 Q;  1A1Z A;  4P4H A;  1WMG A;  4I16 A;  4ZBW A;  2DO9 A;  1E3Y A;  2KM6 A;  4A2Q A;  4UZ0 A;  1NGR A;  2A9I A;  2NZ7 A;  4P4H I;  3EZQ A;  2MPC A;  2MS7 A;  2D96 A;  4FH0 A;  2M5V A;  2GF5 A;  2N80 A;  4QOB A;  2OF5 H;  4NQK A;  3MOP A;  2B1W A;  1D2Z A;  2KN6 A;  3YGS C;  2P1H A;  2MS8 A;  4RHW A;  2N00 A;  2A5Y B;  4JUP A;  3MOP G;  4N1J A;  2DBD A;  3KAT A;  1WXP A;  3J6J A;  2N97 A;  2VGQ A;  3MOP K;  1D2Z B;  1FAD A;  4DWN A;  4N1K A;  1UCP A;  4D8O A;  3CRD A;  1C15 A;  2N1F A;  1CY5 A;  4O7Q A;  2DBF A;  4IZ7 B;  3J63 A;  1DGN A;  2NSN A;  2DBG A;  2DBH A;  4O9L A;  4LWD A;  3EZQ B;  4JQW A;  2YGS A;  2F1S A;  1PN5 A;  4N1L A;  2OF5 A;  2IB1 A;  2LWE A;  2L9M A;  2NAQ A;  2BBR A;  1YGO A;  4EWI A;  2N7Z A;  1Z6T A;  1E41 A;  4F44 A;  2BBZ A;  2N83 A;  3LQQ A;  4E9M A;  3LQR A;  2MN4 A;  1DDF A;  1ICH A;  1CWW A;  4F42 A;  2MB9 A;  2O71 A; 
#chains in the Genus database with same CATH topology
 2G7R A;  2L6A A;  1A1W A;  4M9S A;  3QF2 A;  4M9X A;  2XV9 A;  2YU0 A;  1WH4 A;  4IZA B;  3CL3 A;  2YVI A;  2LS7 A;  2YQF A;  4M9Z A;  4RHW E;  4A2W A;  1N3K A;  3T6P A;  4IZ5 E;  4O6X A;  2LWD A;  4O9F A;  3YGS P;  2HM2 Q;  1A1Z A;  4P4H A;  1WMG A;  4I16 A;  4ZBW A;  2DO9 A;  1E3Y A;  2KM6 A;  4A2Q A;  4UZ0 A;  1NGR A;  2A9I A;  2NZ7 A;  4P4H I;  3EZQ A;  2MPC A;  2MS7 A;  2D96 A;  4FH0 A;  2M5V A;  2GF5 A;  2N80 A;  4QOB A;  2OF5 H;  4NQK A;  3MOP A;  2B1W A;  1D2Z A;  2KN6 A;  3YGS C;  2P1H A;  2MS8 A;  4RHW A;  2N00 A;  2A5Y B;  4JUP A;  3MOP G;  4N1J A;  2DBD A;  3KAT A;  1WXP A;  3J6J A;  2N97 A;  2VGQ A;  3MOP K;  1D2Z B;  1FAD A;  4DWN A;  4N1K A;  1UCP A;  4D8O A;  3CRD A;  1C15 A;  2N1F A;  1CY5 A;  4O7Q A;  2DBF A;  4IZ7 B;  3J63 A;  1DGN A;  2NSN A;  2DBG A;  2DBH A;  4O9L A;  4LWD A;  3EZQ B;  4JQW A;  2YGS A;  2F1S A;  1PN5 A;  4N1L A;  2OF5 A;  2IB1 A;  2LWE A;  2L9M A;  2NAQ A;  2BBR A;  1YGO A;  4EWI A;  2N7Z A;  1Z6T A;  1E41 A;  4F44 A;  2BBZ A;  2N83 A;  3LQQ A;  4E9M A;  3LQR A;  2MJM A;  2MN4 A;  1DDF A;  1ICH A;  1CWW A;  4F42 A;  2MB9 A;  2O71 A; 
#chains in the Genus database with same CATH homology
 2G7R A;  2L6A A;  1A1W A;  4M9S A;  3QF2 A;  4M9X A;  2XV9 A;  2YU0 A;  1WH4 A;  4IZA B;  3CL3 A;  2YVI A;  2LS7 A;  2YQF A;  4M9Z A;  4RHW E;  4A2W A;  1N3K A;  3T6P A;  4IZ5 E;  4O6X A;  2LWD A;  4O9F A;  3YGS P;  2HM2 Q;  1A1Z A;  4P4H A;  1WMG A;  4I16 A;  4ZBW A;  2DO9 A;  1E3Y A;  2KM6 A;  4A2Q A;  4UZ0 A;  1NGR A;  2A9I A;  2NZ7 A;  4P4H I;  3EZQ A;  2MPC A;  2MS7 A;  2D96 A;  4FH0 A;  2M5V A;  2GF5 A;  2N80 A;  4QOB A;  2OF5 H;  4NQK A;  3MOP A;  2B1W A;  1D2Z A;  2KN6 A;  3YGS C;  2P1H A;  2MS8 A;  4RHW A;  2N00 A;  2A5Y B;  4JUP A;  3MOP G;  4N1J A;  2DBD A;  3KAT A;  1WXP A;  3J6J A;  2N97 A;  2VGQ A;  3MOP K;  1D2Z B;  1FAD A;  4DWN A;  4N1K A;  1UCP A;  4D8O A;  3CRD A;  1C15 A;  2N1F A;  1CY5 A;  4O7Q A;  2DBF A;  4IZ7 B;  3J63 A;  1DGN A;  2NSN A;  2DBG A;  2DBH A;  4O9L A;  4LWD A;  3EZQ B;  4JQW A;  2YGS A;  2F1S A;  1PN5 A;  4N1L A;  2OF5 A;  2IB1 A;  2LWE A;  2L9M A;  2NAQ A;  2BBR A;  1YGO A;  4EWI A;  2N7Z A;  1Z6T A;  1E41 A;  4F44 A;  2BBZ A;  2N83 A;  3LQQ A;  4E9M A;  3LQR A;  2MJM A;  2MN4 A;  1DDF A;  1ICH A;  1CWW A;  4F42 A;  2MB9 A;  2O71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...