3CRGA

Crystal structure of human fibroblast growth factor-1 with mutations glu81ala, glu82asn and lys101ala
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNANCLFLERLEENHYNTYISKAHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering an improved crystal contact across a solvent-mediated interface of human fibroblast growth factor 1.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone
source organism Homo sapiens
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3crgA00
5BQUC 3AJ5A 4A7ZA 4QKSA 1EPWA 2Y9XE 1E0OA 1QQLA 2Z49A 1JQZA 4PC4A 1YXWA 3A21A 1K5VA 4IZEA 4OWKA 3AKIA 1NUNA 4GAIA 1JT4A 3AKFA 3LTQA 2KKIA 4L4IA 5BP5A 3HMYA 3ZC8A 3VT1A 2FFVA 2VSEA 5B2HA 5BXRA 1YYNA 2WRYA 3H6SE 3BAUA 5FZZA 2GZBA 1G9BA 4X37A 2VLCA 3MPPG 3O5WB 3HALA 1FMZA 2XOAA 3N7JA 1IOBA 2AXMA 4P0KA 3AH1A 4LO7B 1ITBA 3O4OA 1S0FA 1BFFA 2Q9XA 3AZWA 4JKXB 1JT7A 1M2TB 1ISZA 4X3AA 3UJ4A 4IHZA 1JLXA 2Q3NB 3A22A 4X39A 3WINA 3QYDA 1S0BA 4GP0A 4EFRA 4Z9WB 1BLDA 2MIBA 1A8DA 3I29B 4OWLA 3IM5A 4XFUA 4I2SA 4GAFA 5E24E 4H9WA 3QR5A 5BXSA 1DQGA 3CRGA 1HIBA 8I1BA 4ZGRB 1Q04A 2F2FC 2ESUA 3PHZA 5GAQA 4LO2A 4YOLA 4QKRA 3UD8A 2R9KB 2K8RA 3R4UA 1AFCA 1II4A 3K1XA 1DFCA 1RY7A 3E8LC 4ZFYB 3R4SA 3FJFA 4GP3A 4IYBA 5DZUA 2P39A 1BFCA 2NVHA 5BQUA 1L2HA 3FJ9A 2D23A 4IONA 3P53A 4IY8A 3FJJA 4DEPA 1PWAA 4QO3A 2VXTI 4J2XA 4ZOTA 3Q7WA 3POKA 4I37A 4D0ZA 3O4BA 1JT3A 3OJMA 1TOOA 1DZDA 3FGMA 3FUOA 1K5UA 2ET2A 1JLYA 3OJ2A 1DJSB 2ZQNA 3V0BA 41BIA 3SNVA 2NP0A 2VXRA 2Y9GA 3RTIB 1PC8B 1UPSA 2YUGA 4ZFWB 4G9MA 4II0A 3UDAA 2KLLA 4I4OA 3H6QA 4IY9A 2E4MC 1Z4SA 1RG8A 1R8OA 5D61A 3AKGA 3V79C 4AN6A 5DSSB 5HPZA 4G9NA 3VSFA 2D7RA 4X38A 4EFQA 3BA4A 1G9CA 3W9TA 3IAGC 1TFMB 2HW9A 2VUAA 2KH2A 3HSMA 1D0HA 3BB2A 4TLPA 3FJHA 4QC4A 4XKIA 4EEEB 4HR6C 3V0AA 2Z48A 4ZFUB 3KMVA 4FGFA 2F2FA 3FJ8A 5F8YA 3FJCA 5JLVA 1FMMS 1RMLA 2P23A 1G82A 3BA7A 4P0LA 2IWTB 4I4XA 1S0GA 4I96A 2LIEA 4WBCA 3CQAA 3I2AA 1S0CA 1QXMA 4USPA 2D1ZA 2D24A 3JUTA 3S8JA 3O4AA 3WO3A 1N4KA 4LO1A 2K4AB 2BEBA 4QD2B 1BARA 1ILR1 4R6UB 2KI6B 2RQ9A 1W3GA 4GOVA 3AJ6A 5D62A 4I4QA 3AH4A 4I4PA 3WO4A 1IT0A 4KBBA 4LO7C 4XFTA 1YF8B 2QN4A 1T9FA 1Q1UA 2FGFA 3FJEA 1TWEA 3CA0A 4ZA3B 4F83A 3VWCA 2ERMA 3VT2A 1Z2VA 1WBAA 3F1RA 2F8XC 4ZKTB 9ILBA 3PMEA 1JY0A 3IIRA 2ZQOA 4OWJA 3ZXDA 3H6RA 3N0KA 5JMCA 1TP0A 1ISXA 3LLPA 4P6AA 2E4MA 6I1BA 2QYIB 3CRIA 3N7MA 3EF2A 3OBTA 4LO3C 3TC2A 5FNXA 2ZR1B 4FVVA 4OW4A 1TTUA 4D0TA 5F8WA 1I1EA 4OEGA 1MD6A 4I4RA 3ZX7A 1YBIA 1DLLA 3CAHA 5BXPA 4Q9PA 3FJBA 1XZZA 3VEQA 1XYFA 1BLAA 7I1BA 1AVUA 2AFGA 4I4SA 3CA6A 4I0YA 2D7IA 3UD7A 4OEFA 1V6VA 3BRGC 2HWAA 3WMUA 1RZOB 3AH2A 5D63A 1ABRB 1CVSA 1HWMB 3FJKA 2X2SA 4KEKA 3CA3A 3P6JA 3C9ZA 3HBWA 4LO8B 3F62B 3UD9A 3RTJB 2K43A 2FFUA 3BRDA 1P63A 4J2SA 4A7KA 3HOMA 1V6XA 1FWVA 1BFGA 4Z8SB 3BTAA 1ISVA 3A23A 4P0JA 4HJJA 1IILA 1S0EA 5F8SA 3CA1A 2M49A 3WINC 3FUQA 1TIEA 4USOA 4JQ0A 4Q91A 5DVHA 4I8MA 1S0DA 2GO2A 3O4DA 1T4QA 4I6IA 1PUUB 1FV2A 4EB2B 3CU1B 2NM1A 3WA1A 4IQPA 2VU9A 1IRAX 4QBVA 3CA5A 3FFZA 4EKXB 5FZUA 4G6MA 3NBDA 3CA4A 2MLLB 1FWUA 1GGPB 5F90A 2FDBM 1SZ6B 3ZC9A 2D43A 1G9DA 1R8NA 4LO0C 4HA2A 1AXMA 2DS0A 4IZXA 3VT0A 4KEIA 2MC2A 4LO3A 3NBNA 4L4HA 1NZKA 3RMYA 5DUYA 3V0BB 2KI4A 3BAOA 3MALA 3IM6A 4D8HA 1FGAA 2VSAA 3BAGA 2X2TA 1W3FA 2J3PA 1AVWB 1AVAC 1DFQA 3RSJA 1YTOA 5I1BA 1JT5A 4JRAA 5FNWA 3JRRA 4JAWA 4ZBVB 3BAQA 3WO2A 4G6JA 1F31A 1VCLA 1BA7A 31BIA 4EFPA 3T8SA 21BIA 4ISRA 2Y9WC 4QD2C 1HCDA 2D22A 2DREA 3D7WB 1ISYA 4I4UA 4I3NA 1EVTA 4ENDA 3O4CA 1IJTA 4JKQA 2NYYA 2D44A 1SR4C 4JPZA 1JTCA 2IHOA 3FJIA 1HWNB 2DRYA 4I7IA 4J2YA 1W3AA 3CRHA 3B9UA 3S8KA 2Y9FA 3RMXA 1AF9A 4QBCA 3BADA 3OGFA 3AKHA 3FJAA 4G1RA 3BX1C 1HKNA 3O3QA 3N7KA 1HCEA 3ZXGA 4ISQA 4A7YA 4XFSA 2UUSA 3V0AB 1Z0HA 1PZZA 3FJDA 1KNMA 1ONKB 3NJ5A 1PUMB 1V6UA 4H04A 3OGGA 3OJVA 4QALA 5EC5A 3Q7XA 4DENA 3BRFA 1J0SA 3Q7YA 2HWMA 4AN7B 5BP5C 1AVXB 2BFHA 1BFBA 3BAHA 2D20A 2NTDA 3NBCA 2WBCA 1WBCA 2FO1A 1DIWA 3A07A 4I1BA 1FV3A 1IRPA 3O44A 3VSZA 2BEAA 4I4YA 2NZ9A 3ILAA 4LO0A 2I1BA 3BAVA 1DQOA 2LIQA 2AQZA 3PUBA 1BASA 4KEJA 5EG6C 4OUJA 1CE7B 3OBRA 1XG6A 5BVPI 4LO1C 1G9AA 1HWOB 3HN1A 1QQKA 2L5XA 1V6WA 1S0LA 1EYLA 1Q03A 4J23B 1EV2A 1MC9A 1DZCA 3NBEA 1M16A 2AAIB 3P6IA 1OQLB 3N7LA 3I2XA 4GOYA 3H6RB 3O49A 5BOWA 1IHKA 2RSTA 1WD4A 3AZVA 4CJMA 1WD3A 4KC3A 1TWMA 3VUOA 1SR4A 4F34A 1FQ9A 1XHBA 4ZLBB 1FN0A 2HZ9A 4OEEA 5BXTA 3PG0A 4LO2C 4I4VA 4J2KA 1HWPB 5G00A 1ISWA 5EHAA 3WMVA 2DRZA 1I1BA 3BA5A 3IM7A 2RG9B 4DCKC 3UJ0A 4I1EA 4JP0A 4Q9GA 5FZYA
chains in the Genus database with same CATH superfamily
5BQUC 3AJ5A 4A7ZA 4QKSA 1EPWA 2Y9XE 1E0OA 1QQLA 2Z49A 1JQZA 4PC4A 1YXWA 3A21A 1K5VA 4IZEA 4OWKA 3AKIA 1NUNA 4GAIA 1JT4A 3AKFA 3LTQA 2KKIA 4L4IA 5BP5A 3HMYA 3ZC8A 3VT1A 2FFVA 2VSEA 5B2HA 5BXRA 1YYNA 4MZHA 2WRYA 3H6SE 3BAUA 5FZZA 2GZBA 1G9BA 4X37A 2VLCA 3MPPG 3O5WB 3HALA 1FMZA 2XOAA 3N7JA 1IOBA 2AXMA 4P0KA 3AH1A 4LO7B 1ITBA 3O4OA 1S0FA 1BFFA 2Q9XA 3AZWA 4JKXB 1JT7A 1M2TB 1ISZA 4X3AA 3UJ4A 4IHZA 1JLXA 2Q3NB 3A22A 4X39A 3WINA 3QYDA 1S0BA 4GP0A 4EFRA 4Z9WB 1BLDA 2MIBA 1A8DA 4H75A 3I29B 4OWLA 3IM5A 4XFUA 4I2SA 4GAFA 5E24E 4H9WA 3QR5A 5BXSA 1DQGA 3CRGA 1HIBA 8I1BA 4ZGRB 1Q04A 2F2FC 2ESUA 3PHZA 5GAQA 4LO2A 4YOLA 4QKRA 3UD8A 2R9KB 2K8RA 3R4UA 1AFCA 1II4A 3K1XA 1DFCA 1RY7A 3E8LC 4ZFYB 3R4SA 3FJFA 4GP3A 4IYBA 5DZUA 2P39A 1BFCA 2NVHA 5BQUA 1L2HA 3FJ9A 2D23A 4IONA 3P53A 4IY8A 3FJJA 4DEPA 1PWAA 4QO3A 2VXTI 4J2XA 4ZOTA 3Q7WA 3POKA 4I37A 4D0ZA 3O4BA 1JT3A 3OJMA 1TOOA 1DZDA 3FGMA 3FUOA 1K5UA 2ET2A 1JLYA 3OJ2A 1DJSB 2ZQNA 3V0BA 41BIA 3SNVA 2NP0A 2VXRA 2Y9GA 3RTIB 1PC8B 1UPSA 2YUGA 4ZFWB 4G9MA 4II0A 3UDAA 2KLLA 4I4OA 3H6QA 4IY9A 2E4MC 1Z4SA 1RG8A 1R8OA 5D61A 3AKGA 3V79C 4AN6A 5DSSB 5HPZA 4G9NA 3VSFA 2D7RA 4X38A 4EFQA 3BA4A 1G9CA 3W9TA 3IAGC 1TFMB 2HW9A 2VUAA 2KH2A 3HSMA 1D0HA 3BB2A 4TLPA 3FJHA 4QC4A 4XKIA 4EEEB 4HR6C 3V0AA 2Z48A 4ZFUB 3KMVA 4FGFA 2F2FA 3FJ8A 5F8YA 3FJCA 5JLVA 1FMMS 1RMLA 2P23A 1G82A 3BA7A 4P0LA 2IWTB 4I4XA 1S0GA 4I96A 2LIEA 4WBCA 3CQAA 3I2AA 4MZFB 1S0CA 1QXMA 4USPA 2D1ZA 2D24A 3JUTA 3S8JA 3O4AA 3WO3A 1N4KA 4LO1A 2K4AB 2BEBA 4QD2B 1BARA 1ILR1 4R6UB 2KI6B 2RQ9A 1W3GA 4GOVA 3AJ6A 5D62A 4I4QA 3AH4A 4I4PA 3WO4A 1IT0A 4KBBA 4LO7C 4XFTA 1YF8B 2QN4A 1T9FA 1Q1UA 2FGFA 3FJEA 1TWEA 3CA0A 4ZA3B 4F83A 3VWCA 2ERMA 3VT2A 1Z2VA 1WBAA 3F1RA 2F8XC 4ZKTB 9ILBA 3PMEA 1JY0A 3IIRA 2ZQOA 4OWJA 3ZXDA 3H6RA 3N0KA 5JMCA 1TP0A 1ISXA 3LLPA 4P6AA 2E4MA 6I1BA 2QYIB 3CRIA 3N7MA 3EF2A 3OBTA 4LO3C 3TC2A 5FNXA 2ZR1B 4FVVA 4OW4A 1TTUA 4D0TA 5F8WA 1I1EA 4OEGA 1MD6A 4I4RA 3ZX7A 1YBIA 1DLLA 3CAHA 5BXPA 4Q9PA 3FJBA 1XZZA 3VEQA 1XYFA 1BLAA 7I1BA 1AVUA 2AFGA 4I4SA 3CA6A 4I0YA 2D7IA 3UD7A 4OEFA 1V6VA 3BRGC 2HWAA 3WMUA 1RZOB 3AH2A 5D63A 1ABRB 1CVSA 1HWMB 3FJKA 2X2SA 4KEKA 3CA3A 3P6JA 3C9ZA 3HBWA 4LO8B 3F62B 3UD9A 3RTJB 2K43A 2FFUA 3BRDA 2NS2A 1P63A 4J2SA 4A7KA 3HOMA 1V6XA 1FWVA 1BFGA 4Z8SB 3BTAA 1ISVA 3A23A 4P0JA 4HJJA 1IILA 1S0EA 5F8SA 3CA1A 2M49A 3WINC 3FUQA 1TIEA 4USOA 4JQ0A 4Q91A 5DVHA 4I8MA 1S0DA 2GO2A 3O4DA 1T4QA 4I6IA 1PUUB 1FV2A 4EB2B 3CU1B 2NM1A 3WA1A 4IQPA 2VU9A 1IRAX 4QBVA 3CA5A 3FFZA 4EKXB 5FZUA 4G6MA 3NBDA 3CA4A 2MLLB 1FWUA 1GGPB 5F90A 2FDBM 1SZ6B 3ZC9A 2D43A 1G9DA 1R8NA 4LO0C 4HA2A 1AXMA 2DS0A 4IZXA 3VT0A 4KEIA 2MC2A 4LO3A 3NBNA 4L4HA 1NZKA 3RMYA 5DUYA 3V0BB 2KI4A 3BAOA 3MALA 3IM6A 4D8HA 1FGAA 2VSAA 3BAGA 2X2TA 1W3FA 2J3PA 1AVWB 1AVAC 1DFQA 3RSJA 1YTOA 5I1BA 1JT5A 4JRAA 5FNWA 3JRRA 4JAWA 4ZBVB 3BAQA 3WO2A 4G6JA 1F31A 1VCLA 1BA7A 31BIA 4EFPA 3T8SA 21BIA 4ISRA 2Y9WC 4QD2C 1HCDA 2D22A 2DREA 3D7WB 1ISYA 4I4UA 4I3NA 1EVTA 4ENDA 3O4CA 1IJTA 4JKQA 2NYYA 2D44A 1SR4C 4JPZA 1JTCA 2IHOA 3FJIA 1HWNB 2DRYA 4I7IA 4J2YA 1W3AA 3CRHA 3B9UA 3S8KA 2Y9FA 3RMXA 1AF9A 4QBCA 3BADA 3OGFA 3AKHA 3FJAA 4G1RA 3BX1C 1HKNA 3O3QA 3N7KA 1HCEA 3ZXGA 4ISQA 4A7YA 4XFSA 2UUSA 3V0AB 1Z0HA 1PZZA 3FJDA 1KNMA 1ONKB 3NJ5A 1PUMB 1V6UA 4H04A 3OGGA 3OJVA 4QALA 5EC5A 3Q7XA 4DENA 3BRFA 1J0SA 3Q7YA 2HWMA 4AN7B 5BP5C 1AVXB 2BFHA 1BFBA 3BAHA 4UY4A 2D20A 2NTDA 3NBCA 2WBCA 1WBCA 2FO1A 1DIWA 3A07A 4I1BA 1FV3A 1IRPA 3O44A 3VSZA 2BEAA 4I4YA 2NZ9A 3ILAA 4LO0A 2I1BA 3BAVA 1DQOA 2LIQA 2AQZA 3PUBA 1BASA 4KEJA 5EG6C 4OUJA 1CE7B 3OBRA 1XG6A 5BVPI 4LO1C 1G9AA 1HWOB 3HN1A 1QQKA 2L5XA 1V6WA 1S0LA 1EYLA 1Q03A 4J23B 1EV2A 1MC9A 1DZCA 3NBEA 4MZGB 1M16A 2AAIB 3P6IA 1OQLB 3N7LA 3I2XA 4GOYA 3H6RB 3O49A 5BOWA 1IHKA 2RSTA 1WD4A 3AZVA 4CJMA 1WD3A 4KC3A 1TWMA 3VUOA 1SR4A 4F34A 1FQ9A 1XHBA 4ZLBB 1FN0A 2HZ9A 4OEEA 5BXTA 3PG0A 4LO2C 4I4VA 4J2KA 1HWPB 5G00A 1ISWA 5EHAA 3WMVA 2DRZA 1I1BA 3BA5A 3IM7A 2RG9B 4DCKC 3UJ0A 4I1EA 4JP0A 4Q9GA 5FZYA
chains in the Genus database with same CATH topology
5BQUC 3AJ5A 4A7ZA 4QKSA 1EPWA 2Y9XE 1E0OA 1QQLA 2Z49A 1JQZA 4PC4A 1YXWA 3A21A 1K5VA 4IZEA 4OWKA 3AKIA 1NUNA 4GAIA 1JT4A 3AKFA 3LTQA 2KKIA 4L4IA 5BP5A 3HMYA 3ZC8A 3VT1A 2FFVA 2VSEA 5B2HA 5BXRA 1YYNA 4MZHA 2WRYA 3H6SE 3BAUA 5FZZA 2GZBA 1G9BA 4X37A 2VLCA 3MPPG 3O5WB 3HALA 1FMZA 2XOAA 3N7JA 1IOBA 2AXMA 4P0KA 3AH1A 4LO7B 1ITBA 3O4OA 1S0FA 1BFFA 2Q9XA 3AZWA 4JKXB 1JT7A 1M2TB 1ISZA 4X3AA 3UJ4A 4IHZA 1JLXA 2Q3NB 3A22A 4X39A 3WINA 3QYDA 1S0BA 4GP0A 4EFRA 4Z9WB 1BLDA 2MIBA 1A8DA 4H75A 3I29B 4OWLA 3IM5A 4XFUA 4I2SA 4GAFA 5E24E 4H9WA 3QR5A 5BXSA 1DQGA 3CRGA 1HIBA 8I1BA 4ZGRB 1Q04A 2F2FC 2ESUA 3PHZA 5GAQA 4LO2A 4YOLA 4QKRA 3UD8A 2R9KB 2K8RA 3R4UA 1AFCA 1II4A 3K1XA 1DFCA 1RY7A 3E8LC 4ZFYB 3R4SA 3FJFA 4GP3A 4IYBA 5DZUA 2P39A 1BFCA 2NVHA 5BQUA 1L2HA 3FJ9A 2D23A 4IONA 3P53A 4IY8A 3FJJA 4DEPA 1PWAA 4QO3A 2VXTI 4J2XA 4ZOTA 3Q7WA 3POKA 4I37A 4D0ZA 3O4BA 1JT3A 3OJMA 1TOOA 1DZDA 3FGMA 3FUOA 1K5UA 2ET2A 1JLYA 3OJ2A 1DJSB 2ZQNA 3V0BA 41BIA 3SNVA 2NP0A 2VXRA 2Y9GA 3RTIB 1PC8B 1UPSA 2YUGA 4ZFWB 4G9MA 4II0A 3UDAA 2KLLA 4I4OA 3H6QA 4IY9A 2E4MC 1Z4SA 1RG8A 1R8OA 5D61A 3AKGA 3V79C 4AN6A 5DSSB 5HPZA 4G9NA 3VSFA 2D7RA 4X38A 4EFQA 3BA4A 1G9CA 3W9TA 3IAGC 1TFMB 2HW9A 2VUAA 2KH2A 3HSMA 1D0HA 3BB2A 4TLPA 3FJHA 4QC4A 4XKIA 4EEEB 4HR6C 3V0AA 2Z48A 4ZFUB 3KMVA 4FGFA 2F2FA 3FJ8A 5F8YA 3FJCA 5JLVA 1FMMS 1RMLA 2P23A 1G82A 3BA7A 4P0LA 2IWTB 4I4XA 1S0GA 4I96A 2LIEA 4WBCA 3CQAA 3I2AA 4MZFB 1S0CA 1QXMA 4USPA 2D1ZA 2D24A 3JUTA 3S8JA 3O4AA 3WO3A 1N4KA 4LO1A 2K4AB 2BEBA 4QD2B 1BARA 1ILR1 4R6UB 2KI6B 2RQ9A 1W3GA 4GOVA 3AJ6A 5D62A 4I4QA 3AH4A 4I4PA 3WO4A 1IT0A 4KBBA 4LO7C 4XFTA 1YF8B 2QN4A 1T9FA 1Q1UA 2FGFA 3FJEA 1TWEA 3CA0A 4ZA3B 4F83A 3VWCA 2ERMA 3VT2A 1Z2VA 1WBAA 3F1RA 2F8XC 4ZKTB 9ILBA 3PMEA 1JY0A 3IIRA 2ZQOA 4OWJA 3ZXDA 3H6RA 3N0KA 5JMCA 1TP0A 1ISXA 3LLPA 4P6AA 2E4MA 6I1BA 2QYIB 3CRIA 3N7MA 3EF2A 3OBTA 4LO3C 3TC2A 5FNXA 2ZR1B 4FVVA 4OW4A 1TTUA 4D0TA 5F8WA 1I1EA 4OEGA 1MD6A 4I4RA 3ZX7A 1YBIA 1DLLA 3CAHA 5BXPA 4Q9PA 3FJBA 1XZZA 3VEQA 1XYFA 1BLAA 7I1BA 1AVUA 2AFGA 4I4SA 3CA6A 4I0YA 2D7IA 3UD7A 4OEFA 1V6VA 3BRGC 2HWAA 3WMUA 1RZOB 3AH2A 5D63A 1ABRB 1CVSA 1HWMB 3FJKA 2X2SA 4KEKA 3CA3A 3P6JA 3C9ZA 3HBWA 4LO8B 3F62B 3UD9A 3RTJB 2K43A 2FFUA 3BRDA 2NS2A 1P63A 4J2SA 4A7KA 3HOMA 1V6XA 1FWVA 1BFGA 4Z8SB 3BTAA 1ISVA 3A23A 4P0JA 4HJJA 1IILA 1S0EA 5F8SA 3CA1A 2M49A 3WINC 3FUQA 1TIEA 4USOA 4JQ0A 4Q91A 5DVHA 4I8MA 1S0DA 2GO2A 3O4DA 1T4QA 4I6IA 1PUUB 1FV2A 4EB2B 3CU1B 2NM1A 3WA1A 4IQPA 2VU9A 1IRAX 4QBVA 3CA5A 3FFZA 4EKXB 5FZUA 4G6MA 3NBDA 3CA4A 2MLLB 1FWUA 1GGPB 5F90A 2FDBM 1SZ6B 3ZC9A 2D43A 1G9DA 1R8NA 4LO0C 4HA2A 1AXMA 2DS0A 4IZXA 3VT0A 4KEIA 2MC2A 4LO3A 3NBNA 4L4HA 1NZKA 3RMYA 5DUYA 3V0BB 2KI4A 3BAOA 3MALA 3IM6A 4D8HA 1FGAA 2VSAA 3BAGA 2X2TA 1W3FA 2J3PA 1AVWB 1AVAC 1DFQA 3RSJA 1YTOA 5I1BA 1JT5A 4JRAA 5FNWA 3JRRA 4JAWA 4ZBVB 3BAQA 3WO2A 4G6JA 1F31A 1VCLA 1BA7A 31BIA 4EFPA 3T8SA 21BIA 4ISRA 2Y9WC 4QD2C 1HCDA 2D22A 2DREA 3D7WB 1ISYA 4I4UA 4I3NA 1EVTA 4ENDA 3O4CA 1IJTA 4JKQA 2NYYA 2D44A 1SR4C 4JPZA 1JTCA 2IHOA 3FJIA 1HWNB 2DRYA 4I7IA 4J2YA 1W3AA 3CRHA 3B9UA 3S8KA 2Y9FA 3RMXA 1AF9A 4QBCA 3BADA 3OGFA 3AKHA 3FJAA 4G1RA 3BX1C 1HKNA 3O3QA 3N7KA 1HCEA 3ZXGA 4ISQA 4A7YA 4XFSA 2UUSA 3V0AB 1Z0HA 1PZZA 3FJDA 1KNMA 1ONKB 3NJ5A 1PUMB 1V6UA 4H04A 3OGGA 3OJVA 4QALA 5EC5A 3Q7XA 4DENA 3BRFA 1J0SA 3Q7YA 2HWMA 4AN7B 5BP5C 1AVXB 2BFHA 1BFBA 3BAHA 4UY4A 2D20A 2NTDA 3NBCA 2WBCA 1WBCA 2FO1A 1DIWA 3A07A 4I1BA 1FV3A 1IRPA 3O44A 3VSZA 2BEAA 4I4YA 2NZ9A 3ILAA 4LO0A 2I1BA 3BAVA 1DQOA 2LIQA 2AQZA 3PUBA 1BASA 4KEJA 5EG6C 4OUJA 1CE7B 3OBRA 1XG6A 5BVPI 4LO1C 1G9AA 1HWOB 3HN1A 1QQKA 2L5XA 1V6WA 1S0LA 1EYLA 1Q03A 4J23B 1EV2A 1MC9A 1DZCA 3NBEA 4MZGB 1M16A 2AAIB 3P6IA 1OQLB 3N7LA 3I2XA 4GOYA 3H6RB 3O49A 5BOWA 1IHKA 2RSTA 1WD4A 3AZVA 4CJMA 1WD3A 4KC3A 1TWMA 3VUOA 1SR4A 4F34A 1FQ9A 1XHBA 4ZLBB 1FN0A 2HZ9A 4OEEA 5BXTA 3PG0A 4LO2C 4I4VA 4J2KA 1HWPB 5G00A 1ISWA 5EHAA 3WMVA 2DRZA 1I1BA 3BA5A 3IM7A 2RG9B 4DCKC 3UJ0A 4I1EA 4JP0A 4Q9GA 5FZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQU C;  3AJ5 A;  4A7Z A;  4QKS A;  1EPW A;  2Y9X E;  1E0O A;  1QQL A;  2Z49 A;  1JQZ A;  4PC4 A;  1YXW A;  3A21 A;  1K5V A;  4IZE A;  4OWK A;  3AKI A;  1NUN A;  4GAI A;  1JT4 A;  3AKF A;  3LTQ A;  2KKI A;  4L4I A;  5BP5 A;  3HMY A;  3ZC8 A;  3VT1 A;  2FFV A;  2VSE A;  5B2H A;  5BXR A;  1YYN A;  2WRY A;  3H6S E;  3BAU A;  5FZZ A;  2GZB A;  1G9B A;  4X37 A;  2VLC A;  3MPP G;  3O5W B;  3HAL A;  1FMZ A;  2XOA A;  3N7J A;  1IOB A;  2AXM A;  4P0K A;  3AH1 A;  4LO7 B;  1ITB A;  3O4O A;  1S0F A;  1BFF A;  2Q9X A;  3AZW A;  4JKX B;  1JT7 A;  1M2T B;  1ISZ A;  4X3A A;  3UJ4 A;  4IHZ A;  1JLX A;  2Q3N B;  3A22 A;  4X39 A;  3WIN A;  3QYD A;  1S0B A;  4GP0 A;  4EFR A;  4Z9W B;  1BLD A;  2MIB A;  1A8D A;  3I29 B;  4OWL A;  3IM5 A;  4XFU A;  4I2S A;  4GAF A;  5E24 E;  4H9W A;  3QR5 A;  5BXS A;  1DQG A;  3CRG A;  1HIB A;  8I1B A;  4ZGR B;  1Q04 A;  2F2F C;  2ESU A;  3PHZ A;  5GAQ A;  4LO2 A;  4YOL A;  4QKR A;  3UD8 A;  2R9K B;  2K8R A;  3R4U A;  1AFC A;  1II4 A;  3K1X A;  1DFC A;  1RY7 A;  3E8L C;  4ZFY B;  3R4S A;  3FJF A;  4GP3 A;  4IYB A;  5DZU A;  2P39 A;  1BFC A;  2NVH A;  5BQU A;  1L2H A;  3FJ9 A;  2D23 A;  4ION A;  3P53 A;  4IY8 A;  3FJJ A;  4DEP A;  1PWA A;  4QO3 A;  2VXT I;  4J2X A;  4ZOT A;  3Q7W A;  3POK A;  4I37 A;  4D0Z A;  3O4B A;  1JT3 A;  3OJM A;  1TOO A;  1DZD A;  3FGM A;  3FUO A;  1K5U A;  2ET2 A;  1JLY A;  3OJ2 A;  1DJS B;  2ZQN A;  3V0B A;  41BI A;  3SNV A;  2NP0 A;  2VXR A;  2Y9G A;  3RTI B;  1PC8 B;  1UPS A;  2YUG A;  4ZFW B;  4G9M A;  4II0 A;  3UDA A;  2KLL A;  4I4O A;  3H6Q A;  4IY9 A;  2E4M C;  1Z4S A;  1RG8 A;  1R8O A;  5D61 A;  3AKG A;  3V79 C;  4AN6 A;  5DSS B;  5HPZ A;  4G9N A;  3VSF A;  2D7R A;  4X38 A;  4EFQ A;  3BA4 A;  1G9C A;  3W9T A;  3IAG C;  1TFM B;  2HW9 A;  2VUA A;  2KH2 A;  3HSM A;  1D0H A;  3BB2 A;  4TLP A;  3FJH A;  4QC4 A;  4XKI A;  4EEE B;  4HR6 C;  3V0A A;  2Z48 A;  4ZFU B;  3KMV A;  4FGF A;  2F2F A;  3FJ8 A;  5F8Y A;  3FJC A;  5JLV A;  1FMM S;  1RML A;  2P23 A;  1G82 A;  3BA7 A;  4P0L A;  2IWT B;  4I4X A;  1S0G A;  4I96 A;  2LIE A;  4WBC A;  3CQA A;  3I2A A;  1S0C A;  1QXM A;  4USP A;  2D1Z A;  2D24 A;  3JUT A;  3S8J A;  3O4A A;  3WO3 A;  1N4K A;  4LO1 A;  2K4A B;  2BEB A;  4QD2 B;  1BAR A;  1ILR 1;  4R6U B;  2KI6 B;  2RQ9 A;  1W3G A;  4GOV A;  3AJ6 A;  5D62 A;  4I4Q A;  3AH4 A;  4I4P A;  3WO4 A;  1IT0 A;  4KBB A;  4LO7 C;  4XFT A;  1YF8 B;  2QN4 A;  1T9F A;  1Q1U A;  2FGF A;  3FJE A;  1TWE A;  3CA0 A;  4ZA3 B;  4F83 A;  3VWC A;  2ERM A;  3VT2 A;  1Z2V A;  1WBA A;  3F1R A;  2F8X C;  4ZKT B;  9ILB A;  3PME A;  1JY0 A;  3IIR A;  2ZQO A;  4OWJ A;  3ZXD A;  3H6R A;  3N0K A;  5JMC A;  1TP0 A;  1ISX A;  3LLP A;  4P6A A;  2E4M A;  6I1B A;  2QYI B;  3CRI A;  3N7M A;  3EF2 A;  3OBT A;  4LO3 C;  3TC2 A;  5FNX A;  2ZR1 B;  4FVV A;  4OW4 A;  1TTU A;  4D0T A;  5F8W A;  1I1E A;  4OEG A;  1MD6 A;  4I4R A;  3ZX7 A;  1YBI A;  1DLL A;  3CAH A;  5BXP A;  4Q9P A;  3FJB A;  1XZZ A;  3VEQ A;  1XYF A;  1BLA A;  7I1B A;  1AVU A;  2AFG A;  4I4S A;  3CA6 A;  4I0Y A;  2D7I A;  3UD7 A;  4OEF A;  1V6V A;  3BRG C;  2HWA A;  3WMU A;  1RZO B;  3AH2 A;  5D63 A;  1ABR B;  1CVS A;  1HWM B;  3FJK A;  2X2S A;  4KEK A;  3CA3 A;  3P6J A;  3C9Z A;  3HBW A;  4LO8 B;  3F62 B;  3UD9 A;  3RTJ B;  2K43 A;  2FFU A;  3BRD A;  1P63 A;  4J2S A;  4A7K A;  3HOM A;  1V6X A;  1FWV A;  1BFG A;  4Z8S B;  3BTA A;  1ISV A;  3A23 A;  4P0J A;  4HJJ A;  1IIL A;  1S0E A;  5F8S A;  3CA1 A;  2M49 A;  3WIN C;  3FUQ A;  1TIE A;  4USO A;  4JQ0 A;  4Q91 A;  5DVH A;  4I8M A;  1S0D A;  2GO2 A;  3O4D A;  1T4Q A;  4I6I A;  1PUU B;  1FV2 A;  4EB2 B;  3CU1 B;  2NM1 A;  3WA1 A;  4IQP A;  2VU9 A;  1IRA X;  4QBV A;  3CA5 A;  3FFZ A;  4EKX B;  5FZU A;  4G6M A;  3NBD A;  3CA4 A;  2MLL B;  1FWU A;  1GGP B;  5F90 A;  2FDB M;  1SZ6 B;  3ZC9 A;  2D43 A;  1G9D A;  1R8N A;  4LO0 C;  4HA2 A;  1AXM A;  2DS0 A;  4IZX A;  3VT0 A;  4KEI A;  2MC2 A;  4LO3 A;  3NBN A;  4L4H A;  1NZK A;  3RMY A;  5DUY A;  3V0B B;  2KI4 A;  3BAO A;  3MAL A;  3IM6 A;  4D8H A;  1FGA A;  2VSA A;  3BAG A;  2X2T A;  1W3F A;  2J3P A;  1AVW B;  1AVA C;  1DFQ A;  3RSJ A;  1YTO A;  5I1B A;  1JT5 A;  4JRA A;  5FNW A;  3JRR A;  4JAW A;  4ZBV B;  3BAQ A;  3WO2 A;  4G6J A;  1F31 A;  1VCL A;  1BA7 A;  31BI A;  4EFP A;  3T8S A;  21BI A;  4ISR A;  2Y9W C;  4QD2 C;  1HCD A;  2D22 A;  2DRE A;  3D7W B;  1ISY A;  4I4U A;  4I3N A;  1EVT A;  4END A;  3O4C A;  1IJT A;  4JKQ A;  2NYY A;  2D44 A;  1SR4 C;  4JPZ A;  1JTC A;  2IHO A;  3FJI A;  1HWN B;  2DRY A;  4I7I A;  4J2Y A;  1W3A A;  3CRH A;  3B9U A;  3S8K A;  2Y9F A;  3RMX A;  1AF9 A;  4QBC A;  3BAD A;  3OGF A;  3AKH A;  3FJA A;  4G1R A;  3BX1 C;  1HKN A;  3O3Q A;  3N7K A;  1HCE A;  3ZXG A;  4ISQ A;  4A7Y A;  4XFS A;  2UUS A;  3V0A B;  1Z0H A;  1PZZ A;  3FJD A;  1KNM A;  1ONK B;  3NJ5 A;  1PUM B;  1V6U A;  4H04 A;  3OGG A;  3OJV A;  4QAL A;  5EC5 A;  3Q7X A;  4DEN A;  3BRF A;  1J0S A;  3Q7Y A;  2HWM A;  4AN7 B;  5BP5 C;  1AVX B;  2BFH A;  1BFB A;  3BAH A;  2D20 A;  2NTD A;  3NBC A;  2WBC A;  1WBC A;  2FO1 A;  1DIW A;  3A07 A;  4I1B A;  1FV3 A;  1IRP A;  3O44 A;  3VSZ A;  2BEA A;  4I4Y A;  2NZ9 A;  3ILA A;  4LO0 A;  2I1B A;  3BAV A;  1DQO A;  2LIQ A;  2AQZ A;  3PUB A;  1BAS A;  4KEJ A;  5EG6 C;  4OUJ A;  1CE7 B;  3OBR A;  1XG6 A;  5BVP I;  4LO1 C;  1G9A A;  1HWO B;  3HN1 A;  1QQK A;  2L5X A;  1V6W A;  1S0L A;  1EYL A;  1Q03 A;  4J23 B;  1EV2 A;  1MC9 A;  1DZC A;  3NBE A;  1M16 A;  2AAI B;  3P6I A;  1OQL B;  3N7L A;  3I2X A;  4GOY A;  3H6R B;  3O49 A;  5BOW A;  1IHK A;  2RST A;  1WD4 A;  3AZV A;  4CJM A;  1WD3 A;  4KC3 A;  1TWM A;  3VUO A;  1SR4 A;  4F34 A;  1FQ9 A;  1XHB A;  4ZLB B;  1FN0 A;  2HZ9 A;  4OEE A;  5BXT A;  3PG0 A;  4LO2 C;  4I4V A;  4J2K A;  1HWP B;  5G00 A;  1ISW A;  5EHA A;  3WMV A;  2DRZ A;  1I1B A;  3BA5 A;  3IM7 A;  2RG9 B;  4DCK C;  3UJ0 A;  4I1E A;  4JP0 A;  4Q9G A;  5FZY A; 
#chains in the Genus database with same CATH topology
 5BQU C;  3AJ5 A;  4A7Z A;  4QKS A;  1EPW A;  2Y9X E;  1E0O A;  1QQL A;  2Z49 A;  1JQZ A;  4PC4 A;  1YXW A;  3A21 A;  1K5V A;  4IZE A;  4OWK A;  3AKI A;  1NUN A;  4GAI A;  1JT4 A;  3AKF A;  3LTQ A;  2KKI A;  4L4I A;  5BP5 A;  3HMY A;  3ZC8 A;  3VT1 A;  2FFV A;  2VSE A;  5B2H A;  5BXR A;  1YYN A;  4MZH A;  2WRY A;  3H6S E;  3BAU A;  5FZZ A;  2GZB A;  1G9B A;  4X37 A;  2VLC A;  3MPP G;  3O5W B;  3HAL A;  1FMZ A;  2XOA A;  3N7J A;  1IOB A;  2AXM A;  4P0K A;  3AH1 A;  4LO7 B;  1ITB A;  3O4O A;  1S0F A;  1BFF A;  2Q9X A;  3AZW A;  4JKX B;  1JT7 A;  1M2T B;  1ISZ A;  4X3A A;  3UJ4 A;  4IHZ A;  1JLX A;  2Q3N B;  3A22 A;  4X39 A;  3WIN A;  3QYD A;  1S0B A;  4GP0 A;  4EFR A;  4Z9W B;  1BLD A;  2MIB A;  1A8D A;  4H75 A;  3I29 B;  4OWL A;  3IM5 A;  4XFU A;  4I2S A;  4GAF A;  5E24 E;  4H9W A;  3QR5 A;  5BXS A;  1DQG A;  3CRG A;  1HIB A;  8I1B A;  4ZGR B;  1Q04 A;  2F2F C;  2ESU A;  3PHZ A;  5GAQ A;  4LO2 A;  4YOL A;  4QKR A;  3UD8 A;  2R9K B;  2K8R A;  3R4U A;  1AFC A;  1II4 A;  3K1X A;  1DFC A;  1RY7 A;  3E8L C;  4ZFY B;  3R4S A;  3FJF A;  4GP3 A;  4IYB A;  5DZU A;  2P39 A;  1BFC A;  2NVH A;  5BQU A;  1L2H A;  3FJ9 A;  2D23 A;  4ION A;  3P53 A;  4IY8 A;  3FJJ A;  4DEP A;  1PWA A;  4QO3 A;  2VXT I;  4J2X A;  4ZOT A;  3Q7W A;  3POK A;  4I37 A;  4D0Z A;  3O4B A;  1JT3 A;  3OJM A;  1TOO A;  1DZD A;  3FGM A;  3FUO A;  1K5U A;  2ET2 A;  1JLY A;  3OJ2 A;  1DJS B;  2ZQN A;  3V0B A;  41BI A;  3SNV A;  2NP0 A;  2VXR A;  2Y9G A;  3RTI B;  1PC8 B;  1UPS A;  2YUG A;  4ZFW B;  4G9M A;  4II0 A;  3UDA A;  2KLL A;  4I4O A;  3H6Q A;  4IY9 A;  2E4M C;  1Z4S A;  1RG8 A;  1R8O A;  5D61 A;  3AKG A;  3V79 C;  4AN6 A;  5DSS B;  5HPZ A;  4G9N A;  3VSF A;  2D7R A;  4X38 A;  4EFQ A;  3BA4 A;  1G9C A;  3W9T A;  3IAG C;  1TFM B;  2HW9 A;  2VUA A;  2KH2 A;  3HSM A;  1D0H A;  3BB2 A;  4TLP A;  3FJH A;  4QC4 A;  4XKI A;  4EEE B;  4HR6 C;  3V0A A;  2Z48 A;  4ZFU B;  3KMV A;  4FGF A;  2F2F A;  3FJ8 A;  5F8Y A;  3FJC A;  5JLV A;  1FMM S;  1RML A;  2P23 A;  1G82 A;  3BA7 A;  4P0L A;  2IWT B;  4I4X A;  1S0G A;  4I96 A;  2LIE A;  4WBC A;  3CQA A;  3I2A A;  4MZF B;  1S0C A;  1QXM A;  4USP A;  2D1Z A;  2D24 A;  3JUT A;  3S8J A;  3O4A A;  3WO3 A;  1N4K A;  4LO1 A;  2K4A B;  2BEB A;  4QD2 B;  1BAR A;  1ILR 1;  4R6U B;  2KI6 B;  2RQ9 A;  1W3G A;  4GOV A;  3AJ6 A;  5D62 A;  4I4Q A;  3AH4 A;  4I4P A;  3WO4 A;  1IT0 A;  4KBB A;  4LO7 C;  4XFT A;  1YF8 B;  2QN4 A;  1T9F A;  1Q1U A;  2FGF A;  3FJE A;  1TWE A;  3CA0 A;  4ZA3 B;  4F83 A;  3VWC A;  2ERM A;  3VT2 A;  1Z2V A;  1WBA A;  3F1R A;  2F8X C;  4ZKT B;  9ILB A;  3PME A;  1JY0 A;  3IIR A;  2ZQO A;  4OWJ A;  3ZXD A;  3H6R A;  3N0K A;  5JMC A;  1TP0 A;  1ISX A;  3LLP A;  4P6A A;  2E4M A;  6I1B A;  2QYI B;  3CRI A;  3N7M A;  3EF2 A;  3OBT A;  4LO3 C;  3TC2 A;  5FNX A;  2ZR1 B;  4FVV A;  4OW4 A;  1TTU A;  4D0T A;  5F8W A;  1I1E A;  4OEG A;  1MD6 A;  4I4R A;  3ZX7 A;  1YBI A;  1DLL A;  3CAH A;  5BXP A;  4Q9P A;  3FJB A;  1XZZ A;  3VEQ A;  1XYF A;  1BLA A;  7I1B A;  1AVU A;  2AFG A;  4I4S A;  3CA6 A;  4I0Y A;  2D7I A;  3UD7 A;  4OEF A;  1V6V A;  3BRG C;  2HWA A;  3WMU A;  1RZO B;  3AH2 A;  5D63 A;  1ABR B;  1CVS A;  1HWM B;  3FJK A;  2X2S A;  4KEK A;  3CA3 A;  3P6J A;  3C9Z A;  3HBW A;  4LO8 B;  3F62 B;  3UD9 A;  3RTJ B;  2K43 A;  2FFU A;  3BRD A;  2NS2 A;  1P63 A;  4J2S A;  4A7K A;  3HOM A;  1V6X A;  1FWV A;  1BFG A;  4Z8S B;  3BTA A;  1ISV A;  3A23 A;  4P0J A;  4HJJ A;  1IIL A;  1S0E A;  5F8S A;  3CA1 A;  2M49 A;  3WIN C;  3FUQ A;  1TIE A;  4USO A;  4JQ0 A;  4Q91 A;  5DVH A;  4I8M A;  1S0D A;  2GO2 A;  3O4D A;  1T4Q A;  4I6I A;  1PUU B;  1FV2 A;  4EB2 B;  3CU1 B;  2NM1 A;  3WA1 A;  4IQP A;  2VU9 A;  1IRA X;  4QBV A;  3CA5 A;  3FFZ A;  4EKX B;  5FZU A;  4G6M A;  3NBD A;  3CA4 A;  2MLL B;  1FWU A;  1GGP B;  5F90 A;  2FDB M;  1SZ6 B;  3ZC9 A;  2D43 A;  1G9D A;  1R8N A;  4LO0 C;  4HA2 A;  1AXM A;  2DS0 A;  4IZX A;  3VT0 A;  4KEI A;  2MC2 A;  4LO3 A;  3NBN A;  4L4H A;  1NZK A;  3RMY A;  5DUY A;  3V0B B;  2KI4 A;  3BAO A;  3MAL A;  3IM6 A;  4D8H A;  1FGA A;  2VSA A;  3BAG A;  2X2T A;  1W3F A;  2J3P A;  1AVW B;  1AVA C;  1DFQ A;  3RSJ A;  1YTO A;  5I1B A;  1JT5 A;  4JRA A;  5FNW A;  3JRR A;  4JAW A;  4ZBV B;  3BAQ A;  3WO2 A;  4G6J A;  1F31 A;  1VCL A;  1BA7 A;  31BI A;  4EFP A;  3T8S A;  21BI A;  4ISR A;  2Y9W C;  4QD2 C;  1HCD A;  2D22 A;  2DRE A;  3D7W B;  1ISY A;  4I4U A;  4I3N A;  1EVT A;  4END A;  3O4C A;  1IJT A;  4JKQ A;  2NYY A;  2D44 A;  1SR4 C;  4JPZ A;  1JTC A;  2IHO A;  3FJI A;  1HWN B;  2DRY A;  4I7I A;  4J2Y A;  1W3A A;  3CRH A;  3B9U A;  3S8K A;  2Y9F A;  3RMX A;  1AF9 A;  4QBC A;  3BAD A;  3OGF A;  3AKH A;  3FJA A;  4G1R A;  3BX1 C;  1HKN A;  3O3Q A;  3N7K A;  1HCE A;  3ZXG A;  4ISQ A;  4A7Y A;  4XFS A;  2UUS A;  3V0A B;  1Z0H A;  1PZZ A;  3FJD A;  1KNM A;  1ONK B;  3NJ5 A;  1PUM B;  1V6U A;  4H04 A;  3OGG A;  3OJV A;  4QAL A;  5EC5 A;  3Q7X A;  4DEN A;  3BRF A;  1J0S A;  3Q7Y A;  2HWM A;  4AN7 B;  5BP5 C;  1AVX B;  2BFH A;  1BFB A;  3BAH A;  4UY4 A;  2D20 A;  2NTD A;  3NBC A;  2WBC A;  1WBC A;  2FO1 A;  1DIW A;  3A07 A;  4I1B A;  1FV3 A;  1IRP A;  3O44 A;  3VSZ A;  2BEA A;  4I4Y A;  2NZ9 A;  3ILA A;  4LO0 A;  2I1B A;  3BAV A;  1DQO A;  2LIQ A;  2AQZ A;  3PUB A;  1BAS A;  4KEJ A;  5EG6 C;  4OUJ A;  1CE7 B;  3OBR A;  1XG6 A;  5BVP I;  4LO1 C;  1G9A A;  1HWO B;  3HN1 A;  1QQK A;  2L5X A;  1V6W A;  1S0L A;  1EYL A;  1Q03 A;  4J23 B;  1EV2 A;  1MC9 A;  1DZC A;  3NBE A;  4MZG B;  1M16 A;  2AAI B;  3P6I A;  1OQL B;  3N7L A;  3I2X A;  4GOY A;  3H6R B;  3O49 A;  5BOW A;  1IHK A;  2RST A;  1WD4 A;  3AZV A;  4CJM A;  1WD3 A;  4KC3 A;  1TWM A;  3VUO A;  1SR4 A;  4F34 A;  1FQ9 A;  1XHB A;  4ZLB B;  1FN0 A;  2HZ9 A;  4OEE A;  5BXT A;  3PG0 A;  4LO2 C;  4I4V A;  4J2K A;  1HWP B;  5G00 A;  1ISW A;  5EHA A;  3WMV A;  2DRZ A;  1I1B A;  3BA5 A;  3IM7 A;  2RG9 B;  4DCK C;  3UJ0 A;  4I1E A;  4JP0 A;  4Q9G A;  5FZY A; 
#chains in the Genus database with same CATH homology
 5BQU C;  3AJ5 A;  4A7Z A;  4QKS A;  1EPW A;  2Y9X E;  1E0O A;  1QQL A;  2Z49 A;  1JQZ A;  4PC4 A;  1YXW A;  3A21 A;  1K5V A;  4IZE A;  4OWK A;  3AKI A;  1NUN A;  4GAI A;  1JT4 A;  3AKF A;  3LTQ A;  2KKI A;  4L4I A;  5BP5 A;  3HMY A;  3ZC8 A;  3VT1 A;  2FFV A;  2VSE A;  5B2H A;  5BXR A;  1YYN A;  4MZH A;  2WRY A;  3H6S E;  3BAU A;  5FZZ A;  2GZB A;  1G9B A;  4X37 A;  2VLC A;  3MPP G;  3O5W B;  3HAL A;  1FMZ A;  2XOA A;  3N7J A;  1IOB A;  2AXM A;  4P0K A;  3AH1 A;  4LO7 B;  1ITB A;  3O4O A;  1S0F A;  1BFF A;  2Q9X A;  3AZW A;  4JKX B;  1JT7 A;  1M2T B;  1ISZ A;  4X3A A;  3UJ4 A;  4IHZ A;  1JLX A;  2Q3N B;  3A22 A;  4X39 A;  3WIN A;  3QYD A;  1S0B A;  4GP0 A;  4EFR A;  4Z9W B;  1BLD A;  2MIB A;  1A8D A;  4H75 A;  3I29 B;  4OWL A;  3IM5 A;  4XFU A;  4I2S A;  4GAF A;  5E24 E;  4H9W A;  3QR5 A;  5BXS A;  1DQG A;  3CRG A;  1HIB A;  8I1B A;  4ZGR B;  1Q04 A;  2F2F C;  2ESU A;  3PHZ A;  5GAQ A;  4LO2 A;  4YOL A;  4QKR A;  3UD8 A;  2R9K B;  2K8R A;  3R4U A;  1AFC A;  1II4 A;  3K1X A;  1DFC A;  1RY7 A;  3E8L C;  4ZFY B;  3R4S A;  3FJF A;  4GP3 A;  4IYB A;  5DZU A;  2P39 A;  1BFC A;  2NVH A;  5BQU A;  1L2H A;  3FJ9 A;  2D23 A;  4ION A;  3P53 A;  4IY8 A;  3FJJ A;  4DEP A;  1PWA A;  4QO3 A;  2VXT I;  4J2X A;  4ZOT A;  3Q7W A;  3POK A;  4I37 A;  4D0Z A;  3O4B A;  1JT3 A;  3OJM A;  1TOO A;  1DZD A;  3FGM A;  3FUO A;  1K5U A;  2ET2 A;  1JLY A;  3OJ2 A;  1DJS B;  2ZQN A;  3V0B A;  41BI A;  3SNV A;  2NP0 A;  2VXR A;  2Y9G A;  3RTI B;  1PC8 B;  1UPS A;  2YUG A;  4ZFW B;  4G9M A;  4II0 A;  3UDA A;  2KLL A;  4I4O A;  3H6Q A;  4IY9 A;  2E4M C;  1Z4S A;  1RG8 A;  1R8O A;  5D61 A;  3AKG A;  3V79 C;  4AN6 A;  5DSS B;  5HPZ A;  4G9N A;  3VSF A;  2D7R A;  4X38 A;  4EFQ A;  3BA4 A;  1G9C A;  3W9T A;  3IAG C;  1TFM B;  2HW9 A;  2VUA A;  2KH2 A;  3HSM A;  1D0H A;  3BB2 A;  4TLP A;  3FJH A;  4QC4 A;  4XKI A;  4EEE B;  4HR6 C;  3V0A A;  2Z48 A;  4ZFU B;  3KMV A;  4FGF A;  2F2F A;  3FJ8 A;  5F8Y A;  3FJC A;  5JLV A;  1FMM S;  1RML A;  2P23 A;  1G82 A;  3BA7 A;  4P0L A;  2IWT B;  4I4X A;  1S0G A;  4I96 A;  2LIE A;  4WBC A;  3CQA A;  3I2A A;  4MZF B;  1S0C A;  1QXM A;  4USP A;  2D1Z A;  2D24 A;  3JUT A;  3S8J A;  3O4A A;  3WO3 A;  1N4K A;  4LO1 A;  2K4A B;  2BEB A;  4QD2 B;  1BAR A;  1ILR 1;  4R6U B;  2KI6 B;  2RQ9 A;  1W3G A;  4GOV A;  3AJ6 A;  5D62 A;  4I4Q A;  3AH4 A;  4I4P A;  3WO4 A;  1IT0 A;  4KBB A;  4LO7 C;  4XFT A;  1YF8 B;  2QN4 A;  1T9F A;  1Q1U A;  2FGF A;  3FJE A;  1TWE A;  3CA0 A;  4ZA3 B;  4F83 A;  3VWC A;  2ERM A;  3VT2 A;  1Z2V A;  1WBA A;  3F1R A;  2F8X C;  4ZKT B;  9ILB A;  3PME A;  1JY0 A;  3IIR A;  2ZQO A;  4OWJ A;  3ZXD A;  3H6R A;  3N0K A;  5JMC A;  1TP0 A;  1ISX A;  3LLP A;  4P6A A;  2E4M A;  6I1B A;  2QYI B;  3CRI A;  3N7M A;  3EF2 A;  3OBT A;  4LO3 C;  3TC2 A;  5FNX A;  2ZR1 B;  4FVV A;  4OW4 A;  1TTU A;  4D0T A;  5F8W A;  1I1E A;  4OEG A;  1MD6 A;  4I4R A;  3ZX7 A;  1YBI A;  1DLL A;  3CAH A;  5BXP A;  4Q9P A;  3FJB A;  1XZZ A;  3VEQ A;  1XYF A;  1BLA A;  7I1B A;  1AVU A;  2AFG A;  4I4S A;  3CA6 A;  4I0Y A;  2D7I A;  3UD7 A;  4OEF A;  1V6V A;  3BRG C;  2HWA A;  3WMU A;  1RZO B;  3AH2 A;  5D63 A;  1ABR B;  1CVS A;  1HWM B;  3FJK A;  2X2S A;  4KEK A;  3CA3 A;  3P6J A;  3C9Z A;  3HBW A;  4LO8 B;  3F62 B;  3UD9 A;  3RTJ B;  2K43 A;  2FFU A;  3BRD A;  2NS2 A;  1P63 A;  4J2S A;  4A7K A;  3HOM A;  1V6X A;  1FWV A;  1BFG A;  4Z8S B;  3BTA A;  1ISV A;  3A23 A;  4P0J A;  4HJJ A;  1IIL A;  1S0E A;  5F8S A;  3CA1 A;  2M49 A;  3WIN C;  3FUQ A;  1TIE A;  4USO A;  4JQ0 A;  4Q91 A;  5DVH A;  4I8M A;  1S0D A;  2GO2 A;  3O4D A;  1T4Q A;  4I6I A;  1PUU B;  1FV2 A;  4EB2 B;  3CU1 B;  2NM1 A;  3WA1 A;  4IQP A;  2VU9 A;  1IRA X;  4QBV A;  3CA5 A;  3FFZ A;  4EKX B;  5FZU A;  4G6M A;  3NBD A;  3CA4 A;  2MLL B;  1FWU A;  1GGP B;  5F90 A;  2FDB M;  1SZ6 B;  3ZC9 A;  2D43 A;  1G9D A;  1R8N A;  4LO0 C;  4HA2 A;  1AXM A;  2DS0 A;  4IZX A;  3VT0 A;  4KEI A;  2MC2 A;  4LO3 A;  3NBN A;  4L4H A;  1NZK A;  3RMY A;  5DUY A;  3V0B B;  2KI4 A;  3BAO A;  3MAL A;  3IM6 A;  4D8H A;  1FGA A;  2VSA A;  3BAG A;  2X2T A;  1W3F A;  2J3P A;  1AVW B;  1AVA C;  1DFQ A;  3RSJ A;  1YTO A;  5I1B A;  1JT5 A;  4JRA A;  5FNW A;  3JRR A;  4JAW A;  4ZBV B;  3BAQ A;  3WO2 A;  4G6J A;  1F31 A;  1VCL A;  1BA7 A;  31BI A;  4EFP A;  3T8S A;  21BI A;  4ISR A;  2Y9W C;  4QD2 C;  1HCD A;  2D22 A;  2DRE A;  3D7W B;  1ISY A;  4I4U A;  4I3N A;  1EVT A;  4END A;  3O4C A;  1IJT A;  4JKQ A;  2NYY A;  2D44 A;  1SR4 C;  4JPZ A;  1JTC A;  2IHO A;  3FJI A;  1HWN B;  2DRY A;  4I7I A;  4J2Y A;  1W3A A;  3CRH A;  3B9U A;  3S8K A;  2Y9F A;  3RMX A;  1AF9 A;  4QBC A;  3BAD A;  3OGF A;  3AKH A;  3FJA A;  4G1R A;  3BX1 C;  1HKN A;  3O3Q A;  3N7K A;  1HCE A;  3ZXG A;  4ISQ A;  4A7Y A;  4XFS A;  2UUS A;  3V0A B;  1Z0H A;  1PZZ A;  3FJD A;  1KNM A;  1ONK B;  3NJ5 A;  1PUM B;  1V6U A;  4H04 A;  3OGG A;  3OJV A;  4QAL A;  5EC5 A;  3Q7X A;  4DEN A;  3BRF A;  1J0S A;  3Q7Y A;  2HWM A;  4AN7 B;  5BP5 C;  1AVX B;  2BFH A;  1BFB A;  3BAH A;  4UY4 A;  2D20 A;  2NTD A;  3NBC A;  2WBC A;  1WBC A;  2FO1 A;  1DIW A;  3A07 A;  4I1B A;  1FV3 A;  1IRP A;  3O44 A;  3VSZ A;  2BEA A;  4I4Y A;  2NZ9 A;  3ILA A;  4LO0 A;  2I1B A;  3BAV A;  1DQO A;  2LIQ A;  2AQZ A;  3PUB A;  1BAS A;  4KEJ A;  5EG6 C;  4OUJ A;  1CE7 B;  3OBR A;  1XG6 A;  5BVP I;  4LO1 C;  1G9A A;  1HWO B;  3HN1 A;  1QQK A;  2L5X A;  1V6W A;  1S0L A;  1EYL A;  1Q03 A;  4J23 B;  1EV2 A;  1MC9 A;  1DZC A;  3NBE A;  4MZG B;  1M16 A;  2AAI B;  3P6I A;  1OQL B;  3N7L A;  3I2X A;  4GOY A;  3H6R B;  3O49 A;  5BOW A;  1IHK A;  2RST A;  1WD4 A;  3AZV A;  4CJM A;  1WD3 A;  4KC3 A;  1TWM A;  3VUO A;  1SR4 A;  4F34 A;  1FQ9 A;  1XHB A;  4ZLB B;  1FN0 A;  2HZ9 A;  4OEE A;  5BXT A;  3PG0 A;  4LO2 C;  4I4V A;  4J2K A;  1HWP B;  5G00 A;  1ISW A;  5EHA A;  3WMV A;  2DRZ A;  1I1B A;  3BA5 A;  3IM7 A;  2RG9 B;  4DCK C;  3UJ0 A;  4I1E A;  4JP0 A;  4Q9G A;  5FZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...