3CRHA

Crystal structure of human fibroblast growth factor-1 with mutations glu81ser and lys101ala
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
HHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNSECLFLERLEENHYNTYISKAHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Engineering an improved crystal contact across a solvent-mediated interface of human fibroblast growth factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 37
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3crhA00
1IHKA 2AFGA 3OJVA 1W3FA 3NBDA 3FJFA 4X37A 3K1XA 2D24A 2GO2A 4I1EA 3VUOA 3O4BA 3MPPG 4I2SA 4L4IA 4AN6A 5BXTA 1JT5A 5DVHA 1MC9A 1HWMB 3ZXGA 4QD2B 1S0LA 2HWAA 4D8HA 1ITBA 1G9DA 3OJ2A 1S0DA 4J2KA 4Q91A 1YBIA 3V79C 1GGPB 4I6IA 5EG6C 3ZC9A 4IY8A 4I96A 3AJ5A 3Q7XA 3A23A 2HZ9A 4IQPA 4ENDA 2DRZA 1IOBA 3HMYA 4G9NA 1HWOB 1BLAA 4I4UA 1ILR1 3CA0A 2F8XC 3WO4A 4USPA 2VXRA 4HA2A 1G9AA 1V6WA 1S0FA 1SR4C 5G00A 3FJIA 5D62A 4LO8B 3B9UA 2YUGA 1WD3A 5JMCA 5FNXA 5BP5A 1K5VA 3HOMA 4LO1C 3LLPA 2NTDA 3RMYA 3N7JA 3CA5A 3AH4A 2WBCA 2P39A 2ESUA 5F90A 4USOA 5EC5A 4ZA3B 2F2FC 4ZFUB 4QBCA 4ZGRB 1YXWA 4KC3A 2D44A 1JY0A 5FNWA 4ZBVB 4FVVA 4QKSA 3R4SA 4LO2A 2VSEA 4LO7B 2ET2A 3HSMA 1S0CA 4I7IA 2NZ9A 5HPZA 1HWNB 4JAWA 1IT0A 1DFQA 5B2HA 4FGFA 1BASA 1DQOA 2AAIB 3IM5A 1ABRB 1F31A 1JT7A 2KKIA 1G9BA 3VT2A 3H6RA 1IRAX 1Z2VA 1IILA 4ISQA 2D7IA 9ILBA 3BAHA 3QYDA 3OBTA 3AZWA 2Y9WC 2QYIB 4ZFYB 3UJ4A 3BAUA 1V6XA 3H6RB 3C9ZA 2E4MA 7I1BA 2ZQOA 1BFGA 3N7LA 4P0KA 3AH1A 1NUNA 4I8MA 4PC4A 5F8SA 3V0AA 1S0GA 3O4CA 3BTAA 3NBNA 2NP0A 3V0BA 2MIBA 4X3AA 3TC2A 3V0AB 1SR4A 1DIWA 1FWUA 2UUSA 2DREA 3JRRA 3BADA 1MD6A 3AKHA 3CAHA 4LO1A 1RY7A 8I1BA 1TIEA 3N7MA 4QKRA 1HKNA 3ZX7A 5JLVA 4I4SA 1RMLA 1AVXB 1JT4A 1D0HA 3AKFA 3CRGA 4EFRA 1K5UA 3IM6A 5BQUC 3N7KA 3I2AA 3AKGA 4ZLBB 3O3QA 5F8WA 3IAGC 1I1EA 2X2TA 3UD9A 1AXMA 1FV3A 1DJSB 1PWAA 1FQ9A 1S0EA 3OBRA 4I4OA 3BRFA 4LO3A 3FJKA 2I1BA 3WO3A 4HR6C 4A7KA 2KI6B 1HCDA 1V6VA 41BIA 1QXMA 2Q3NB 1TP0A 3F1RA 5F8YA 2RG9B 4LO0C 3PHZA 2D1ZA 4ZOTA 2FO1A 1P63A 1FGAA 3UD7A 1RZOB 2GZBA 3FJJA 4AN7B 4EEEB 4I4XA 4EKXB 1W3GA 4J2SA 3HN1A 1EPWA 1SZ6B 1V6UA 4KBBA 4OW4A 3CA4A 2D7RA 1QQKA 2AXMA 2KH2A 4Z9WB 4DEPA 2MLLB 3JUTA 3F62B 4OWKA 4GOYA 3Q7YA 1EYLA 2NVHA 3FJDA 4X38A 2FFVA 3P6JA 4TLPA 4H9WA 4F34A 1G9CA 1DQGA 3BA7A 3P6IA 4EFQA 2ERMA 2VLCA 4JQ0A 5BQUA 3BRDA 4JKXB 1JLXA 2LIQA 4H04A 2AQZA 3OGGA 3ZC8A 4EFPA 4P0LA 1IJTA 3PMEA 4HJJA 4IONA 4JRAA 1TWEA 5DUYA 3O49A 4I4QA 1M16A 4XFTA 3NBEA 1I1BA 1Z0HA 1M2TB 1ISYA 1UPSA 5DZUA 2M49A 3W9TA 3QR5A 1A8DA 4Q9PA 1ISXA 1XZZA 3BAQA 5E24E 3D7WB 2NM1A 4QD2C 6I1BA 3I2XA 3EF2A 5I1BA 2K4AB 4XFUA 3H6SE 3AH2A 4EB2B 4LO0A 2Z49A 3PG0A 2MC2A 1G82A 4JKQA 3AZVA 4I4PA 3BAOA 1BLDA 1OQLB 4G6JA 4GP0A 4OEEA 3RTJB 2HW9A 1R8NA 3O44A 4QALA 4OEGA 4A7YA 5D61A 4DENA 4JP0A 3V0BB 4IZEA 2BEBA 1TOOA 5FZYA 1Q1UA 2BEAA 1XYFA 1WD4A 2VSAA 3BX1C 3CU1B 5BXPA 1DZCA 5GAQA 4GAFA 1QQLA 4KEIA 2Z48A 1N4KA 4ZKTB 1NZKA 3FJEA 2WRYA 2F2FA 4KEKA 3NBCA 31BIA 4I4VA 1ISWA 1JLYA 3CRIA 3FGMA 2K8RA 3BA4A 4I1BA 3HBWA 5D63A 3ZXDA 21BIA 4IY9A 2NYYA 2ZQNA 3VEQA 4XKIA 2Y9XE 4LO7C 3FJBA 3WMUA 1R8OA 2LIEA 4G6MA 5FZZA 3VT0A 1JQZA 1DZDA 1JT3A 3SNVA 3KMVA 1Q04A 2KI4A 3VWCA 1S0BA 4OWLA 4G1RA 4XFSA 3FUOA 3FJCA 1FV2A 4KEJA 1PC8B 3BAVA 3VT1A 3WO2A 3RTIB 1AVUA 1YTOA 5EHAA 2ZR1B 4R6UB 1WBAA 2D23A 1RG8A 2QN4A 1FN0A 4A7ZA 1BFBA 1VCLA 1Z4SA 3FUQA 3T8SA 3IIRA 1BARA 5DSSB 4QO3A 2DS0A 2IHOA 1EV2A 3UDAA 1WBCA 2BFHA 3ILAA 2E4MC 1ISZA 1FWVA 4I37A 4J2YA 5BXRA 4WBCA 3MALA 4DCKC 1BA7A 3UJ0A 3I29B 3BRGC 4QBVA 1Q03A 4F83A 1YYNA 3A07A 4OUJA 1HWPB 1FMMS 3S8KA 1AVWB 1PUMB 3FJ9A 1ONKB 2Y9FA 3FJ8A 3PUBA 3VSZA 1TTUA 1W3AA 5BVPI 3AKIA 2FFUA 3CQAA 3RSJA 3IM7A 3WINC 4IHZA 1L2HA 3BAGA 3OJMA 3CA1A 4I3NA 1YF8B 3A21A 2D22A 4GP3A 2DRYA 4JPZA 4IZXA 2Q9XA 1PUUB 1CVSA 2RQ9A 4GAIA 4Z8SB 5BXSA 2RSTA 2Y9GA 4J2XA 2K43A 3O5WB 4GOVA 4CJMA 2IWTB 3O4DA 4LO3C 4ZFWB 3FJAA 3UD8A 2XOAA 1KNMA 2X2SA 1ISVA 3Q7WA 5FZUA 1PZZA 4D0TA 4OWJA 1FMZA 4D0ZA 2VUAA 1AFCA 4J23B 4X39A 3A22A 3CA6A 3P53A 1AF9A 3BA5A 1HIBA 3CA3A 3BB2A 3H6QA 4L4HA 3O4OA 2R9KB 2FDBM 2J3PA 3OGFA 3FFZA 4ISRA 4YOLA 1E0OA 1JTCA 2VXTI 1J0SA 1TWMA 2VU9A 1DFCA 2D43A 3FJHA 4II0A 1AVAC 1DLLA 3R4UA 1HCEA 1IRPA 3AJ6A 2L5XA 3WMVA 3VSFA 4Q9GA 1BFFA 3LTQA 5BP5C 1XG6A 1CE7B 4G9MA 1EVTA 2FGFA 2D20A 3NJ5A 1XHBA 4I0YA 3WA1A 1BFCA 3CRHA 1TFMB 3POKA 4OEFA 4QC4A 4P6AA 2HWMA 3RMXA 3N0KA 3WINA 5BOWA 4I4YA 3O4AA 2KLLA 1II4A 2P23A 3HALA 3S8JA 4LO2C 1T9FA 4IYBA 4I4RA 1T4QA 3E8LC 4P0JA
chains in the Genus database with same CATH superfamily
1IHKA 2AFGA 3OJVA 1W3FA 3NBDA 3FJFA 4X37A 3K1XA 2D24A 2GO2A 4I1EA 3VUOA 3O4BA 3MPPG 4I2SA 4L4IA 4AN6A 5BXTA 1JT5A 5DVHA 1MC9A 1HWMB 3ZXGA 4QD2B 1S0LA 2HWAA 4D8HA 1ITBA 1G9DA 3OJ2A 1S0DA 4J2KA 4Q91A 1YBIA 3V79C 1GGPB 4I6IA 5EG6C 3ZC9A 4IY8A 4I96A 3AJ5A 3Q7XA 3A23A 2HZ9A 4IQPA 4ENDA 2DRZA 1IOBA 3HMYA 4G9NA 1HWOB 1BLAA 4I4UA 1ILR1 3CA0A 4MZHA 3WO4A 2F8XC 4USPA 2VXRA 4HA2A 1G9AA 1V6WA 1S0FA 1SR4C 5G00A 3FJIA 5D62A 4LO8B 3B9UA 2YUGA 1WD3A 5JMCA 5FNXA 5BP5A 1K5VA 3HOMA 4LO1C 3LLPA 2NTDA 3RMYA 3N7JA 3CA5A 3AH4A 2WBCA 2P39A 2ESUA 5F90A 4USOA 5EC5A 4ZA3B 2F2FC 4ZFUB 4QBCA 4ZGRB 1YXWA 4KC3A 2D44A 1JY0A 5FNWA 4ZBVB 4FVVA 4QKSA 3R4SA 4LO2A 2VSEA 4LO7B 2ET2A 3HSMA 1S0CA 4I7IA 2NZ9A 5HPZA 1HWNB 4JAWA 1IT0A 1DFQA 5B2HA 4FGFA 1BASA 1DQOA 2AAIB 3IM5A 1ABRB 1F31A 1JT7A 2KKIA 1G9BA 3VT2A 3H6RA 1IRAX 1Z2VA 1IILA 4ISQA 2D7IA 9ILBA 3BAHA 3QYDA 3OBTA 3AZWA 2Y9WC 2QYIB 4ZFYB 3UJ4A 3BAUA 1V6XA 3H6RB 3C9ZA 2E4MA 7I1BA 2ZQOA 1BFGA 3N7LA 4P0KA 3AH1A 1NUNA 4I8MA 4PC4A 5F8SA 3V0AA 1S0GA 3O4CA 3BTAA 3NBNA 2NP0A 3V0BA 2MIBA 4X3AA 3TC2A 3V0AB 1SR4A 1DIWA 1FWUA 2UUSA 2DREA 3JRRA 3BADA 1MD6A 3AKHA 3CAHA 4LO1A 1RY7A 8I1BA 1TIEA 3N7MA 4QKRA 1HKNA 3ZX7A 5JLVA 4I4SA 1RMLA 1AVXB 1JT4A 1D0HA 3AKFA 3CRGA 4EFRA 1K5UA 3IM6A 5BQUC 3N7KA 3I2AA 3AKGA 4ZLBB 3O3QA 5F8WA 3IAGC 1I1EA 2X2TA 3UD9A 1AXMA 1FV3A 1DJSB 1PWAA 1FQ9A 1S0EA 3OBRA 4I4OA 3BRFA 4LO3A 3FJKA 2I1BA 3WO3A 2NS2A 4HR6C 4A7KA 2KI6B 1HCDA 1V6VA 41BIA 1QXMA 2Q3NB 1TP0A 3F1RA 5F8YA 2RG9B 4LO0C 3PHZA 2D1ZA 4ZOTA 2FO1A 4UY4A 1P63A 1FGAA 3UD7A 1RZOB 2GZBA 3FJJA 4AN7B 4EEEB 4I4XA 4EKXB 1W3GA 4J2SA 3HN1A 1EPWA 1SZ6B 1V6UA 4KBBA 4OW4A 3CA4A 2D7RA 1QQKA 2AXMA 2KH2A 4Z9WB 4DEPA 2MLLB 3JUTA 3F62B 4MZFB 4GOYA 4OWKA 3Q7YA 1EYLA 2NVHA 3FJDA 4X38A 2FFVA 3P6JA 4TLPA 4H9WA 4F34A 1G9CA 1DQGA 3BA7A 3P6IA 4EFQA 2ERMA 2VLCA 4JQ0A 5BQUA 3BRDA 4JKXB 1JLXA 2LIQA 4H04A 2AQZA 3OGGA 3ZC8A 4EFPA 4P0LA 1IJTA 3PMEA 4HJJA 4IONA 4JRAA 1TWEA 5DUYA 3O49A 4I4QA 1M16A 4XFTA 3NBEA 1I1BA 1Z0HA 1M2TB 1ISYA 1UPSA 5DZUA 2M49A 3W9TA 3QR5A 1A8DA 4Q9PA 1ISXA 1XZZA 3BAQA 5E24E 3D7WB 2NM1A 4QD2C 6I1BA 3I2XA 3EF2A 5I1BA 2K4AB 4XFUA 3H6SE 3AH2A 4EB2B 4LO0A 2Z49A 3PG0A 2MC2A 1G82A 4JKQA 3AZVA 4I4PA 3BAOA 1BLDA 1OQLB 4G6JA 4GP0A 4OEEA 3RTJB 2HW9A 1R8NA 3O44A 4QALA 4OEGA 4A7YA 5D61A 4DENA 4JP0A 3V0BB 4IZEA 2BEBA 1TOOA 5FZYA 1Q1UA 2BEAA 1XYFA 1WD4A 2VSAA 3BX1C 3CU1B 5BXPA 1DZCA 5GAQA 4GAFA 1QQLA 4KEIA 2Z48A 1N4KA 4ZKTB 1NZKA 3FJEA 2WRYA 2F2FA 4KEKA 3NBCA 31BIA 4I4VA 1ISWA 1JLYA 3CRIA 3FGMA 2K8RA 3BA4A 4I1BA 3HBWA 5D63A 3ZXDA 21BIA 4IY9A 2NYYA 2ZQNA 3VEQA 4XKIA 2Y9XE 4LO7C 3FJBA 3WMUA 1R8OA 2LIEA 4G6MA 5FZZA 3VT0A 1JQZA 1DZDA 1JT3A 3SNVA 3KMVA 1Q04A 2KI4A 3VWCA 1S0BA 4OWLA 4G1RA 4XFSA 3FUOA 3FJCA 1FV2A 4KEJA 1PC8B 3BAVA 3VT1A 3WO2A 3RTIB 1AVUA 1YTOA 5EHAA 2ZR1B 4R6UB 1WBAA 2D23A 1RG8A 2QN4A 1FN0A 4A7ZA 1BFBA 1VCLA 1Z4SA 3FUQA 3T8SA 3IIRA 1BARA 5DSSB 4QO3A 2DS0A 2IHOA 1EV2A 3UDAA 1WBCA 2BFHA 3ILAA 2E4MC 1ISZA 1FWVA 4I37A 4J2YA 5BXRA 4WBCA 3MALA 4DCKC 1BA7A 3UJ0A 3I29B 3BRGC 4QBVA 1Q03A 4F83A 1YYNA 3A07A 4OUJA 1HWPB 4H75A 1FMMS 3S8KA 1AVWB 1PUMB 3FJ9A 1ONKB 2Y9FA 3FJ8A 3PUBA 3VSZA 1TTUA 1W3AA 5BVPI 3AKIA 2FFUA 3CQAA 3RSJA 3IM7A 3WINC 4IHZA 1L2HA 3BAGA 3OJMA 3CA1A 4I3NA 1YF8B 3A21A 2D22A 4GP3A 2DRYA 4JPZA 4IZXA 2Q9XA 1PUUB 1CVSA 2RQ9A 4GAIA 4Z8SB 5BXSA 2RSTA 2Y9GA 4J2XA 2K43A 3O5WB 4GOVA 4CJMA 2IWTB 3O4DA 4LO3C 4ZFWB 3FJAA 3UD8A 2XOAA 1KNMA 2X2SA 1ISVA 3Q7WA 5FZUA 1PZZA 4D0TA 4OWJA 1FMZA 4D0ZA 2VUAA 1AFCA 4J23B 4X39A 3A22A 3CA6A 3P53A 1AF9A 3BA5A 1HIBA 3CA3A 3BB2A 3H6QA 4L4HA 3O4OA 2R9KB 2FDBM 2J3PA 3OGFA 3FFZA 4ISRA 4YOLA 1E0OA 1JTCA 2VXTI 1J0SA 1TWMA 4MZGB 2VU9A 1DFCA 2D43A 3FJHA 4II0A 1AVAC 1DLLA 3R4UA 1HCEA 1IRPA 3AJ6A 2L5XA 3WMVA 3VSFA 4Q9GA 1BFFA 3LTQA 5BP5C 1XG6A 1CE7B 4G9MA 1EVTA 2FGFA 2D20A 3NJ5A 1XHBA 4I0YA 3WA1A 1BFCA 3CRHA 1TFMB 3POKA 4OEFA 4QC4A 4P6AA 2HWMA 3RMXA 3N0KA 3WINA 5BOWA 4I4YA 3O4AA 2KLLA 1II4A 2P23A 3HALA 3S8JA 4LO2C 1T9FA 4IYBA 4I4RA 1T4QA 3E8LC 4P0JA
chains in the Genus database with same CATH topology
1IHKA 2AFGA 3OJVA 1W3FA 3NBDA 3FJFA 4X37A 3K1XA 2D24A 2GO2A 4I1EA 3VUOA 3O4BA 3MPPG 4I2SA 4L4IA 4AN6A 5BXTA 1JT5A 5DVHA 1MC9A 1HWMB 3ZXGA 4QD2B 1S0LA 2HWAA 4D8HA 1ITBA 1G9DA 3OJ2A 1S0DA 4J2KA 4Q91A 1YBIA 3V79C 1GGPB 4I6IA 5EG6C 3ZC9A 4IY8A 4I96A 3AJ5A 3Q7XA 3A23A 2HZ9A 4IQPA 4ENDA 2DRZA 1IOBA 3HMYA 4G9NA 1HWOB 1BLAA 4I4UA 1ILR1 3CA0A 4MZHA 3WO4A 2F8XC 4USPA 2VXRA 4HA2A 1G9AA 1V6WA 1S0FA 1SR4C 5G00A 3FJIA 5D62A 4LO8B 3B9UA 2YUGA 1WD3A 5JMCA 5FNXA 5BP5A 1K5VA 3HOMA 4LO1C 3LLPA 2NTDA 3RMYA 3N7JA 3CA5A 3AH4A 2WBCA 2P39A 2ESUA 5F90A 4USOA 5EC5A 4ZA3B 2F2FC 4ZFUB 4QBCA 4ZGRB 1YXWA 4KC3A 2D44A 1JY0A 5FNWA 4ZBVB 4FVVA 4QKSA 3R4SA 4LO2A 2VSEA 4LO7B 2ET2A 3HSMA 1S0CA 4I7IA 2NZ9A 5HPZA 1HWNB 4JAWA 1IT0A 1DFQA 5B2HA 4FGFA 1BASA 1DQOA 2AAIB 3IM5A 1ABRB 1F31A 1JT7A 2KKIA 1G9BA 3VT2A 3H6RA 1IRAX 1Z2VA 1IILA 4ISQA 2D7IA 9ILBA 3BAHA 3QYDA 3OBTA 3AZWA 2Y9WC 2QYIB 4ZFYB 3UJ4A 3BAUA 1V6XA 3H6RB 3C9ZA 2E4MA 7I1BA 2ZQOA 1BFGA 3N7LA 4P0KA 3AH1A 1NUNA 4I8MA 4PC4A 5F8SA 3V0AA 1S0GA 3O4CA 3BTAA 3NBNA 2NP0A 3V0BA 2MIBA 4X3AA 3TC2A 3V0AB 1SR4A 1DIWA 1FWUA 2UUSA 2DREA 3JRRA 3BADA 1MD6A 3AKHA 3CAHA 4LO1A 1RY7A 8I1BA 1TIEA 3N7MA 4QKRA 1HKNA 3ZX7A 5JLVA 4I4SA 1RMLA 1AVXB 1JT4A 1D0HA 3AKFA 3CRGA 4EFRA 1K5UA 3IM6A 5BQUC 3N7KA 3I2AA 3AKGA 4ZLBB 3O3QA 5F8WA 3IAGC 1I1EA 2X2TA 3UD9A 1AXMA 1FV3A 1DJSB 1PWAA 1FQ9A 1S0EA 3OBRA 4I4OA 3BRFA 4LO3A 3FJKA 2I1BA 3WO3A 2NS2A 4HR6C 4A7KA 2KI6B 1HCDA 1V6VA 41BIA 1QXMA 2Q3NB 1TP0A 3F1RA 5F8YA 2RG9B 4LO0C 3PHZA 2D1ZA 4ZOTA 2FO1A 4UY4A 1P63A 1FGAA 3UD7A 1RZOB 2GZBA 3FJJA 4AN7B 4EEEB 4I4XA 4EKXB 1W3GA 4J2SA 3HN1A 1EPWA 1SZ6B 1V6UA 4KBBA 4OW4A 3CA4A 2D7RA 1QQKA 2AXMA 2KH2A 4Z9WB 4DEPA 2MLLB 3JUTA 3F62B 4MZFB 4GOYA 4OWKA 3Q7YA 1EYLA 2NVHA 3FJDA 4X38A 2FFVA 3P6JA 4TLPA 4H9WA 4F34A 1G9CA 1DQGA 3BA7A 3P6IA 4EFQA 2ERMA 2VLCA 4JQ0A 5BQUA 3BRDA 4JKXB 1JLXA 2LIQA 4H04A 2AQZA 3OGGA 3ZC8A 4EFPA 4P0LA 1IJTA 3PMEA 4HJJA 4IONA 4JRAA 1TWEA 5DUYA 3O49A 4I4QA 1M16A 4XFTA 3NBEA 1I1BA 1Z0HA 1M2TB 1ISYA 1UPSA 5DZUA 2M49A 3W9TA 3QR5A 1A8DA 4Q9PA 1ISXA 1XZZA 3BAQA 5E24E 3D7WB 2NM1A 4QD2C 6I1BA 3I2XA 3EF2A 5I1BA 2K4AB 4XFUA 3H6SE 3AH2A 4EB2B 4LO0A 2Z49A 3PG0A 2MC2A 1G82A 4JKQA 3AZVA 4I4PA 3BAOA 1BLDA 1OQLB 4G6JA 4GP0A 4OEEA 3RTJB 2HW9A 1R8NA 3O44A 4QALA 4OEGA 4A7YA 5D61A 4DENA 4JP0A 3V0BB 4IZEA 2BEBA 1TOOA 5FZYA 1Q1UA 2BEAA 1XYFA 1WD4A 2VSAA 3BX1C 3CU1B 5BXPA 1DZCA 5GAQA 4GAFA 1QQLA 4KEIA 2Z48A 1N4KA 4ZKTB 1NZKA 3FJEA 2WRYA 2F2FA 4KEKA 3NBCA 31BIA 4I4VA 1ISWA 1JLYA 3CRIA 3FGMA 2K8RA 3BA4A 4I1BA 3HBWA 5D63A 3ZXDA 21BIA 4IY9A 2NYYA 2ZQNA 3VEQA 4XKIA 2Y9XE 4LO7C 3FJBA 3WMUA 1R8OA 2LIEA 4G6MA 5FZZA 3VT0A 1JQZA 1DZDA 1JT3A 3SNVA 3KMVA 1Q04A 2KI4A 3VWCA 1S0BA 4OWLA 4G1RA 4XFSA 3FUOA 3FJCA 1FV2A 4KEJA 1PC8B 3BAVA 3VT1A 3WO2A 3RTIB 1AVUA 1YTOA 5EHAA 2ZR1B 4R6UB 1WBAA 2D23A 1RG8A 2QN4A 1FN0A 4A7ZA 1BFBA 1VCLA 1Z4SA 3FUQA 3T8SA 3IIRA 1BARA 5DSSB 4QO3A 2DS0A 2IHOA 1EV2A 3UDAA 1WBCA 2BFHA 3ILAA 2E4MC 1ISZA 1FWVA 4I37A 4J2YA 5BXRA 4WBCA 3MALA 4DCKC 1BA7A 3UJ0A 3I29B 3BRGC 4QBVA 1Q03A 4F83A 1YYNA 3A07A 4OUJA 1HWPB 4H75A 1FMMS 3S8KA 1AVWB 1PUMB 3FJ9A 1ONKB 2Y9FA 3FJ8A 3PUBA 3VSZA 1TTUA 1W3AA 5BVPI 3AKIA 2FFUA 3CQAA 3RSJA 3IM7A 3WINC 4IHZA 1L2HA 3BAGA 3OJMA 3CA1A 4I3NA 1YF8B 3A21A 2D22A 4GP3A 2DRYA 4JPZA 4IZXA 2Q9XA 1PUUB 1CVSA 2RQ9A 4GAIA 4Z8SB 5BXSA 2RSTA 2Y9GA 4J2XA 2K43A 3O5WB 4GOVA 4CJMA 2IWTB 3O4DA 4LO3C 4ZFWB 3FJAA 3UD8A 2XOAA 1KNMA 2X2SA 1ISVA 3Q7WA 5FZUA 1PZZA 4D0TA 4OWJA 1FMZA 4D0ZA 2VUAA 1AFCA 4J23B 4X39A 3A22A 3CA6A 3P53A 1AF9A 3BA5A 1HIBA 3CA3A 3BB2A 3H6QA 4L4HA 3O4OA 2R9KB 2FDBM 2J3PA 3OGFA 3FFZA 4ISRA 4YOLA 1E0OA 1JTCA 2VXTI 1J0SA 1TWMA 4MZGB 2VU9A 1DFCA 2D43A 3FJHA 4II0A 1AVAC 1DLLA 3R4UA 1HCEA 1IRPA 3AJ6A 2L5XA 3WMVA 3VSFA 4Q9GA 1BFFA 3LTQA 5BP5C 1XG6A 1CE7B 4G9MA 1EVTA 2FGFA 2D20A 3NJ5A 1XHBA 4I0YA 3WA1A 1BFCA 3CRHA 1TFMB 3POKA 4OEFA 4QC4A 4P6AA 2HWMA 3RMXA 3N0KA 3WINA 5BOWA 4I4YA 3O4AA 2KLLA 1II4A 2P23A 3HALA 3S8JA 4LO2C 1T9FA 4IYBA 4I4RA 1T4QA 3E8LC 4P0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHK A;  2AFG A;  3OJV A;  1W3F A;  3NBD A;  3FJF A;  4X37 A;  3K1X A;  2D24 A;  2GO2 A;  4I1E A;  3VUO A;  3O4B A;  3MPP G;  4I2S A;  4L4I A;  4AN6 A;  5BXT A;  1JT5 A;  5DVH A;  1MC9 A;  1HWM B;  3ZXG A;  4QD2 B;  1S0L A;  2HWA A;  4D8H A;  1ITB A;  1G9D A;  3OJ2 A;  1S0D A;  4J2K A;  4Q91 A;  1YBI A;  3V79 C;  1GGP B;  4I6I A;  5EG6 C;  3ZC9 A;  4IY8 A;  4I96 A;  3AJ5 A;  3Q7X A;  3A23 A;  2HZ9 A;  4IQP A;  4END A;  2DRZ A;  1IOB A;  3HMY A;  4G9N A;  1HWO B;  1BLA A;  4I4U A;  1ILR 1;  3CA0 A;  2F8X C;  3WO4 A;  4USP A;  2VXR A;  4HA2 A;  1G9A A;  1V6W A;  1S0F A;  1SR4 C;  5G00 A;  3FJI A;  5D62 A;  4LO8 B;  3B9U A;  2YUG A;  1WD3 A;  5JMC A;  5FNX A;  5BP5 A;  1K5V A;  3HOM A;  4LO1 C;  3LLP A;  2NTD A;  3RMY A;  3N7J A;  3CA5 A;  3AH4 A;  2WBC A;  2P39 A;  2ESU A;  5F90 A;  4USO A;  5EC5 A;  4ZA3 B;  2F2F C;  4ZFU B;  4QBC A;  4ZGR B;  1YXW A;  4KC3 A;  2D44 A;  1JY0 A;  5FNW A;  4ZBV B;  4FVV A;  4QKS A;  3R4S A;  4LO2 A;  2VSE A;  4LO7 B;  2ET2 A;  3HSM A;  1S0C A;  4I7I A;  2NZ9 A;  5HPZ A;  1HWN B;  4JAW A;  1IT0 A;  1DFQ A;  5B2H A;  4FGF A;  1BAS A;  1DQO A;  2AAI B;  3IM5 A;  1ABR B;  1F31 A;  1JT7 A;  2KKI A;  1G9B A;  3VT2 A;  3H6R A;  1IRA X;  1Z2V A;  1IIL A;  4ISQ A;  2D7I A;  9ILB A;  3BAH A;  3QYD A;  3OBT A;  3AZW A;  2Y9W C;  2QYI B;  4ZFY B;  3UJ4 A;  3BAU A;  1V6X A;  3H6R B;  3C9Z A;  2E4M A;  7I1B A;  2ZQO A;  1BFG A;  3N7L A;  4P0K A;  3AH1 A;  1NUN A;  4I8M A;  4PC4 A;  5F8S A;  3V0A A;  1S0G A;  3O4C A;  3BTA A;  3NBN A;  2NP0 A;  3V0B A;  2MIB A;  4X3A A;  3TC2 A;  3V0A B;  1SR4 A;  1DIW A;  1FWU A;  2UUS A;  2DRE A;  3JRR A;  3BAD A;  1MD6 A;  3AKH A;  3CAH A;  4LO1 A;  1RY7 A;  8I1B A;  1TIE A;  3N7M A;  4QKR A;  1HKN A;  3ZX7 A;  5JLV A;  4I4S A;  1RML A;  1AVX B;  1JT4 A;  1D0H A;  3AKF A;  3CRG A;  4EFR A;  1K5U A;  3IM6 A;  5BQU C;  3N7K A;  3I2A A;  3AKG A;  4ZLB B;  3O3Q A;  5F8W A;  3IAG C;  1I1E A;  2X2T A;  3UD9 A;  1AXM A;  1FV3 A;  1DJS B;  1PWA A;  1FQ9 A;  1S0E A;  3OBR A;  4I4O A;  3BRF A;  4LO3 A;  3FJK A;  2I1B A;  3WO3 A;  4HR6 C;  4A7K A;  2KI6 B;  1HCD A;  1V6V A;  41BI A;  1QXM A;  2Q3N B;  1TP0 A;  3F1R A;  5F8Y A;  2RG9 B;  4LO0 C;  3PHZ A;  2D1Z A;  4ZOT A;  2FO1 A;  1P63 A;  1FGA A;  3UD7 A;  1RZO B;  2GZB A;  3FJJ A;  4AN7 B;  4EEE B;  4I4X A;  4EKX B;  1W3G A;  4J2S A;  3HN1 A;  1EPW A;  1SZ6 B;  1V6U A;  4KBB A;  4OW4 A;  3CA4 A;  2D7R A;  1QQK A;  2AXM A;  2KH2 A;  4Z9W B;  4DEP A;  2MLL B;  3JUT A;  3F62 B;  4OWK A;  4GOY A;  3Q7Y A;  1EYL A;  2NVH A;  3FJD A;  4X38 A;  2FFV A;  3P6J A;  4TLP A;  4H9W A;  4F34 A;  1G9C A;  1DQG A;  3BA7 A;  3P6I A;  4EFQ A;  2ERM A;  2VLC A;  4JQ0 A;  5BQU A;  3BRD A;  4JKX B;  1JLX A;  2LIQ A;  4H04 A;  2AQZ A;  3OGG A;  3ZC8 A;  4EFP A;  4P0L A;  1IJT A;  3PME A;  4HJJ A;  4ION A;  4JRA A;  1TWE A;  5DUY A;  3O49 A;  4I4Q A;  1M16 A;  4XFT A;  3NBE A;  1I1B A;  1Z0H A;  1M2T B;  1ISY A;  1UPS A;  5DZU A;  2M49 A;  3W9T A;  3QR5 A;  1A8D A;  4Q9P A;  1ISX A;  1XZZ A;  3BAQ A;  5E24 E;  3D7W B;  2NM1 A;  4QD2 C;  6I1B A;  3I2X A;  3EF2 A;  5I1B A;  2K4A B;  4XFU A;  3H6S E;  3AH2 A;  4EB2 B;  4LO0 A;  2Z49 A;  3PG0 A;  2MC2 A;  1G82 A;  4JKQ A;  3AZV A;  4I4P A;  3BAO A;  1BLD A;  1OQL B;  4G6J A;  4GP0 A;  4OEE A;  3RTJ B;  2HW9 A;  1R8N A;  3O44 A;  4QAL A;  4OEG A;  4A7Y A;  5D61 A;  4DEN A;  4JP0 A;  3V0B B;  4IZE A;  2BEB A;  1TOO A;  5FZY A;  1Q1U A;  2BEA A;  1XYF A;  1WD4 A;  2VSA A;  3BX1 C;  3CU1 B;  5BXP A;  1DZC A;  5GAQ A;  4GAF A;  1QQL A;  4KEI A;  2Z48 A;  1N4K A;  4ZKT B;  1NZK A;  3FJE A;  2WRY A;  2F2F A;  4KEK A;  3NBC A;  31BI A;  4I4V A;  1ISW A;  1JLY A;  3CRI A;  3FGM A;  2K8R A;  3BA4 A;  4I1B A;  3HBW A;  5D63 A;  3ZXD A;  21BI A;  4IY9 A;  2NYY A;  2ZQN A;  3VEQ A;  4XKI A;  2Y9X E;  4LO7 C;  3FJB A;  3WMU A;  1R8O A;  2LIE A;  4G6M A;  5FZZ A;  3VT0 A;  1JQZ A;  1DZD A;  1JT3 A;  3SNV A;  3KMV A;  1Q04 A;  2KI4 A;  3VWC A;  1S0B A;  4OWL A;  4G1R A;  4XFS A;  3FUO A;  3FJC A;  1FV2 A;  4KEJ A;  1PC8 B;  3BAV A;  3VT1 A;  3WO2 A;  3RTI B;  1AVU A;  1YTO A;  5EHA A;  2ZR1 B;  4R6U B;  1WBA A;  2D23 A;  1RG8 A;  2QN4 A;  1FN0 A;  4A7Z A;  1BFB A;  1VCL A;  1Z4S A;  3FUQ A;  3T8S A;  3IIR A;  1BAR A;  5DSS B;  4QO3 A;  2DS0 A;  2IHO A;  1EV2 A;  3UDA A;  1WBC A;  2BFH A;  3ILA A;  2E4M C;  1ISZ A;  1FWV A;  4I37 A;  4J2Y A;  5BXR A;  4WBC A;  3MAL A;  4DCK C;  1BA7 A;  3UJ0 A;  3I29 B;  3BRG C;  4QBV A;  1Q03 A;  4F83 A;  1YYN A;  3A07 A;  4OUJ A;  1HWP B;  1FMM S;  3S8K A;  1AVW B;  1PUM B;  3FJ9 A;  1ONK B;  2Y9F A;  3FJ8 A;  3PUB A;  3VSZ A;  1TTU A;  1W3A A;  5BVP I;  3AKI A;  2FFU A;  3CQA A;  3RSJ A;  3IM7 A;  3WIN C;  4IHZ A;  1L2H A;  3BAG A;  3OJM A;  3CA1 A;  4I3N A;  1YF8 B;  3A21 A;  2D22 A;  4GP3 A;  2DRY A;  4JPZ A;  4IZX A;  2Q9X A;  1PUU B;  1CVS A;  2RQ9 A;  4GAI A;  4Z8S B;  5BXS A;  2RST A;  2Y9G A;  4J2X A;  2K43 A;  3O5W B;  4GOV A;  4CJM A;  2IWT B;  3O4D A;  4LO3 C;  4ZFW B;  3FJA A;  3UD8 A;  2XOA A;  1KNM A;  2X2S A;  1ISV A;  3Q7W A;  5FZU A;  1PZZ A;  4D0T A;  4OWJ A;  1FMZ A;  4D0Z A;  2VUA A;  1AFC A;  4J23 B;  4X39 A;  3A22 A;  3CA6 A;  3P53 A;  1AF9 A;  3BA5 A;  1HIB A;  3CA3 A;  3BB2 A;  3H6Q A;  4L4H A;  3O4O A;  2R9K B;  2FDB M;  2J3P A;  3OGF A;  3FFZ A;  4ISR A;  4YOL A;  1E0O A;  1JTC A;  2VXT I;  1J0S A;  1TWM A;  2VU9 A;  1DFC A;  2D43 A;  3FJH A;  4II0 A;  1AVA C;  1DLL A;  3R4U A;  1HCE A;  1IRP A;  3AJ6 A;  2L5X A;  3WMV A;  3VSF A;  4Q9G A;  1BFF A;  3LTQ A;  5BP5 C;  1XG6 A;  1CE7 B;  4G9M A;  1EVT A;  2FGF A;  2D20 A;  3NJ5 A;  1XHB A;  4I0Y A;  3WA1 A;  1BFC A;  3CRH A;  1TFM B;  3POK A;  4OEF A;  4QC4 A;  4P6A A;  2HWM A;  3RMX A;  3N0K A;  3WIN A;  5BOW A;  4I4Y A;  3O4A A;  2KLL A;  1II4 A;  2P23 A;  3HAL A;  3S8J A;  4LO2 C;  1T9F A;  4IYB A;  4I4R A;  1T4Q A;  3E8L C;  4P0J A; 
#chains in the Genus database with same CATH topology
 1IHK A;  2AFG A;  3OJV A;  1W3F A;  3NBD A;  3FJF A;  4X37 A;  3K1X A;  2D24 A;  2GO2 A;  4I1E A;  3VUO A;  3O4B A;  3MPP G;  4I2S A;  4L4I A;  4AN6 A;  5BXT A;  1JT5 A;  5DVH A;  1MC9 A;  1HWM B;  3ZXG A;  4QD2 B;  1S0L A;  2HWA A;  4D8H A;  1ITB A;  1G9D A;  3OJ2 A;  1S0D A;  4J2K A;  4Q91 A;  1YBI A;  3V79 C;  1GGP B;  4I6I A;  5EG6 C;  3ZC9 A;  4IY8 A;  4I96 A;  3AJ5 A;  3Q7X A;  3A23 A;  2HZ9 A;  4IQP A;  4END A;  2DRZ A;  1IOB A;  3HMY A;  4G9N A;  1HWO B;  1BLA A;  4I4U A;  1ILR 1;  3CA0 A;  4MZH A;  3WO4 A;  2F8X C;  4USP A;  2VXR A;  4HA2 A;  1G9A A;  1V6W A;  1S0F A;  1SR4 C;  5G00 A;  3FJI A;  5D62 A;  4LO8 B;  3B9U A;  2YUG A;  1WD3 A;  5JMC A;  5FNX A;  5BP5 A;  1K5V A;  3HOM A;  4LO1 C;  3LLP A;  2NTD A;  3RMY A;  3N7J A;  3CA5 A;  3AH4 A;  2WBC A;  2P39 A;  2ESU A;  5F90 A;  4USO A;  5EC5 A;  4ZA3 B;  2F2F C;  4ZFU B;  4QBC A;  4ZGR B;  1YXW A;  4KC3 A;  2D44 A;  1JY0 A;  5FNW A;  4ZBV B;  4FVV A;  4QKS A;  3R4S A;  4LO2 A;  2VSE A;  4LO7 B;  2ET2 A;  3HSM A;  1S0C A;  4I7I A;  2NZ9 A;  5HPZ A;  1HWN B;  4JAW A;  1IT0 A;  1DFQ A;  5B2H A;  4FGF A;  1BAS A;  1DQO A;  2AAI B;  3IM5 A;  1ABR B;  1F31 A;  1JT7 A;  2KKI A;  1G9B A;  3VT2 A;  3H6R A;  1IRA X;  1Z2V A;  1IIL A;  4ISQ A;  2D7I A;  9ILB A;  3BAH A;  3QYD A;  3OBT A;  3AZW A;  2Y9W C;  2QYI B;  4ZFY B;  3UJ4 A;  3BAU A;  1V6X A;  3H6R B;  3C9Z A;  2E4M A;  7I1B A;  2ZQO A;  1BFG A;  3N7L A;  4P0K A;  3AH1 A;  1NUN A;  4I8M A;  4PC4 A;  5F8S A;  3V0A A;  1S0G A;  3O4C A;  3BTA A;  3NBN A;  2NP0 A;  3V0B A;  2MIB A;  4X3A A;  3TC2 A;  3V0A B;  1SR4 A;  1DIW A;  1FWU A;  2UUS A;  2DRE A;  3JRR A;  3BAD A;  1MD6 A;  3AKH A;  3CAH A;  4LO1 A;  1RY7 A;  8I1B A;  1TIE A;  3N7M A;  4QKR A;  1HKN A;  3ZX7 A;  5JLV A;  4I4S A;  1RML A;  1AVX B;  1JT4 A;  1D0H A;  3AKF A;  3CRG A;  4EFR A;  1K5U A;  3IM6 A;  5BQU C;  3N7K A;  3I2A A;  3AKG A;  4ZLB B;  3O3Q A;  5F8W A;  3IAG C;  1I1E A;  2X2T A;  3UD9 A;  1AXM A;  1FV3 A;  1DJS B;  1PWA A;  1FQ9 A;  1S0E A;  3OBR A;  4I4O A;  3BRF A;  4LO3 A;  3FJK A;  2I1B A;  3WO3 A;  2NS2 A;  4HR6 C;  4A7K A;  2KI6 B;  1HCD A;  1V6V A;  41BI A;  1QXM A;  2Q3N B;  1TP0 A;  3F1R A;  5F8Y A;  2RG9 B;  4LO0 C;  3PHZ A;  2D1Z A;  4ZOT A;  2FO1 A;  4UY4 A;  1P63 A;  1FGA A;  3UD7 A;  1RZO B;  2GZB A;  3FJJ A;  4AN7 B;  4EEE B;  4I4X A;  4EKX B;  1W3G A;  4J2S A;  3HN1 A;  1EPW A;  1SZ6 B;  1V6U A;  4KBB A;  4OW4 A;  3CA4 A;  2D7R A;  1QQK A;  2AXM A;  2KH2 A;  4Z9W B;  4DEP A;  2MLL B;  3JUT A;  3F62 B;  4MZF B;  4GOY A;  4OWK A;  3Q7Y A;  1EYL A;  2NVH A;  3FJD A;  4X38 A;  2FFV A;  3P6J A;  4TLP A;  4H9W A;  4F34 A;  1G9C A;  1DQG A;  3BA7 A;  3P6I A;  4EFQ A;  2ERM A;  2VLC A;  4JQ0 A;  5BQU A;  3BRD A;  4JKX B;  1JLX A;  2LIQ A;  4H04 A;  2AQZ A;  3OGG A;  3ZC8 A;  4EFP A;  4P0L A;  1IJT A;  3PME A;  4HJJ A;  4ION A;  4JRA A;  1TWE A;  5DUY A;  3O49 A;  4I4Q A;  1M16 A;  4XFT A;  3NBE A;  1I1B A;  1Z0H A;  1M2T B;  1ISY A;  1UPS A;  5DZU A;  2M49 A;  3W9T A;  3QR5 A;  1A8D A;  4Q9P A;  1ISX A;  1XZZ A;  3BAQ A;  5E24 E;  3D7W B;  2NM1 A;  4QD2 C;  6I1B A;  3I2X A;  3EF2 A;  5I1B A;  2K4A B;  4XFU A;  3H6S E;  3AH2 A;  4EB2 B;  4LO0 A;  2Z49 A;  3PG0 A;  2MC2 A;  1G82 A;  4JKQ A;  3AZV A;  4I4P A;  3BAO A;  1BLD A;  1OQL B;  4G6J A;  4GP0 A;  4OEE A;  3RTJ B;  2HW9 A;  1R8N A;  3O44 A;  4QAL A;  4OEG A;  4A7Y A;  5D61 A;  4DEN A;  4JP0 A;  3V0B B;  4IZE A;  2BEB A;  1TOO A;  5FZY A;  1Q1U A;  2BEA A;  1XYF A;  1WD4 A;  2VSA A;  3BX1 C;  3CU1 B;  5BXP A;  1DZC A;  5GAQ A;  4GAF A;  1QQL A;  4KEI A;  2Z48 A;  1N4K A;  4ZKT B;  1NZK A;  3FJE A;  2WRY A;  2F2F A;  4KEK A;  3NBC A;  31BI A;  4I4V A;  1ISW A;  1JLY A;  3CRI A;  3FGM A;  2K8R A;  3BA4 A;  4I1B A;  3HBW A;  5D63 A;  3ZXD A;  21BI A;  4IY9 A;  2NYY A;  2ZQN A;  3VEQ A;  4XKI A;  2Y9X E;  4LO7 C;  3FJB A;  3WMU A;  1R8O A;  2LIE A;  4G6M A;  5FZZ A;  3VT0 A;  1JQZ A;  1DZD A;  1JT3 A;  3SNV A;  3KMV A;  1Q04 A;  2KI4 A;  3VWC A;  1S0B A;  4OWL A;  4G1R A;  4XFS A;  3FUO A;  3FJC A;  1FV2 A;  4KEJ A;  1PC8 B;  3BAV A;  3VT1 A;  3WO2 A;  3RTI B;  1AVU A;  1YTO A;  5EHA A;  2ZR1 B;  4R6U B;  1WBA A;  2D23 A;  1RG8 A;  2QN4 A;  1FN0 A;  4A7Z A;  1BFB A;  1VCL A;  1Z4S A;  3FUQ A;  3T8S A;  3IIR A;  1BAR A;  5DSS B;  4QO3 A;  2DS0 A;  2IHO A;  1EV2 A;  3UDA A;  1WBC A;  2BFH A;  3ILA A;  2E4M C;  1ISZ A;  1FWV A;  4I37 A;  4J2Y A;  5BXR A;  4WBC A;  3MAL A;  4DCK C;  1BA7 A;  3UJ0 A;  3I29 B;  3BRG C;  4QBV A;  1Q03 A;  4F83 A;  1YYN A;  3A07 A;  4OUJ A;  1HWP B;  4H75 A;  1FMM S;  3S8K A;  1AVW B;  1PUM B;  3FJ9 A;  1ONK B;  2Y9F A;  3FJ8 A;  3PUB A;  3VSZ A;  1TTU A;  1W3A A;  5BVP I;  3AKI A;  2FFU A;  3CQA A;  3RSJ A;  3IM7 A;  3WIN C;  4IHZ A;  1L2H A;  3BAG A;  3OJM A;  3CA1 A;  4I3N A;  1YF8 B;  3A21 A;  2D22 A;  4GP3 A;  2DRY A;  4JPZ A;  4IZX A;  2Q9X A;  1PUU B;  1CVS A;  2RQ9 A;  4GAI A;  4Z8S B;  5BXS A;  2RST A;  2Y9G A;  4J2X A;  2K43 A;  3O5W B;  4GOV A;  4CJM A;  2IWT B;  3O4D A;  4LO3 C;  4ZFW B;  3FJA A;  3UD8 A;  2XOA A;  1KNM A;  2X2S A;  1ISV A;  3Q7W A;  5FZU A;  1PZZ A;  4D0T A;  4OWJ A;  1FMZ A;  4D0Z A;  2VUA A;  1AFC A;  4J23 B;  4X39 A;  3A22 A;  3CA6 A;  3P53 A;  1AF9 A;  3BA5 A;  1HIB A;  3CA3 A;  3BB2 A;  3H6Q A;  4L4H A;  3O4O A;  2R9K B;  2FDB M;  2J3P A;  3OGF A;  3FFZ A;  4ISR A;  4YOL A;  1E0O A;  1JTC A;  2VXT I;  1J0S A;  1TWM A;  4MZG B;  2VU9 A;  1DFC A;  2D43 A;  3FJH A;  4II0 A;  1AVA C;  1DLL A;  3R4U A;  1HCE A;  1IRP A;  3AJ6 A;  2L5X A;  3WMV A;  3VSF A;  4Q9G A;  1BFF A;  3LTQ A;  5BP5 C;  1XG6 A;  1CE7 B;  4G9M A;  1EVT A;  2FGF A;  2D20 A;  3NJ5 A;  1XHB A;  4I0Y A;  3WA1 A;  1BFC A;  3CRH A;  1TFM B;  3POK A;  4OEF A;  4QC4 A;  4P6A A;  2HWM A;  3RMX A;  3N0K A;  3WIN A;  5BOW A;  4I4Y A;  3O4A A;  2KLL A;  1II4 A;  2P23 A;  3HAL A;  3S8J A;  4LO2 C;  1T9F A;  4IYB A;  4I4R A;  1T4Q A;  3E8L C;  4P0J A; 
#chains in the Genus database with same CATH homology
 1IHK A;  2AFG A;  3OJV A;  1W3F A;  3NBD A;  3FJF A;  4X37 A;  3K1X A;  2D24 A;  2GO2 A;  4I1E A;  3VUO A;  3O4B A;  3MPP G;  4I2S A;  4L4I A;  4AN6 A;  5BXT A;  1JT5 A;  5DVH A;  1MC9 A;  1HWM B;  3ZXG A;  4QD2 B;  1S0L A;  2HWA A;  4D8H A;  1ITB A;  1G9D A;  3OJ2 A;  1S0D A;  4J2K A;  4Q91 A;  1YBI A;  3V79 C;  1GGP B;  4I6I A;  5EG6 C;  3ZC9 A;  4IY8 A;  4I96 A;  3AJ5 A;  3Q7X A;  3A23 A;  2HZ9 A;  4IQP A;  4END A;  2DRZ A;  1IOB A;  3HMY A;  4G9N A;  1HWO B;  1BLA A;  4I4U A;  1ILR 1;  3CA0 A;  4MZH A;  3WO4 A;  2F8X C;  4USP A;  2VXR A;  4HA2 A;  1G9A A;  1V6W A;  1S0F A;  1SR4 C;  5G00 A;  3FJI A;  5D62 A;  4LO8 B;  3B9U A;  2YUG A;  1WD3 A;  5JMC A;  5FNX A;  5BP5 A;  1K5V A;  3HOM A;  4LO1 C;  3LLP A;  2NTD A;  3RMY A;  3N7J A;  3CA5 A;  3AH4 A;  2WBC A;  2P39 A;  2ESU A;  5F90 A;  4USO A;  5EC5 A;  4ZA3 B;  2F2F C;  4ZFU B;  4QBC A;  4ZGR B;  1YXW A;  4KC3 A;  2D44 A;  1JY0 A;  5FNW A;  4ZBV B;  4FVV A;  4QKS A;  3R4S A;  4LO2 A;  2VSE A;  4LO7 B;  2ET2 A;  3HSM A;  1S0C A;  4I7I A;  2NZ9 A;  5HPZ A;  1HWN B;  4JAW A;  1IT0 A;  1DFQ A;  5B2H A;  4FGF A;  1BAS A;  1DQO A;  2AAI B;  3IM5 A;  1ABR B;  1F31 A;  1JT7 A;  2KKI A;  1G9B A;  3VT2 A;  3H6R A;  1IRA X;  1Z2V A;  1IIL A;  4ISQ A;  2D7I A;  9ILB A;  3BAH A;  3QYD A;  3OBT A;  3AZW A;  2Y9W C;  2QYI B;  4ZFY B;  3UJ4 A;  3BAU A;  1V6X A;  3H6R B;  3C9Z A;  2E4M A;  7I1B A;  2ZQO A;  1BFG A;  3N7L A;  4P0K A;  3AH1 A;  1NUN A;  4I8M A;  4PC4 A;  5F8S A;  3V0A A;  1S0G A;  3O4C A;  3BTA A;  3NBN A;  2NP0 A;  3V0B A;  2MIB A;  4X3A A;  3TC2 A;  3V0A B;  1SR4 A;  1DIW A;  1FWU A;  2UUS A;  2DRE A;  3JRR A;  3BAD A;  1MD6 A;  3AKH A;  3CAH A;  4LO1 A;  1RY7 A;  8I1B A;  1TIE A;  3N7M A;  4QKR A;  1HKN A;  3ZX7 A;  5JLV A;  4I4S A;  1RML A;  1AVX B;  1JT4 A;  1D0H A;  3AKF A;  3CRG A;  4EFR A;  1K5U A;  3IM6 A;  5BQU C;  3N7K A;  3I2A A;  3AKG A;  4ZLB B;  3O3Q A;  5F8W A;  3IAG C;  1I1E A;  2X2T A;  3UD9 A;  1AXM A;  1FV3 A;  1DJS B;  1PWA A;  1FQ9 A;  1S0E A;  3OBR A;  4I4O A;  3BRF A;  4LO3 A;  3FJK A;  2I1B A;  3WO3 A;  2NS2 A;  4HR6 C;  4A7K A;  2KI6 B;  1HCD A;  1V6V A;  41BI A;  1QXM A;  2Q3N B;  1TP0 A;  3F1R A;  5F8Y A;  2RG9 B;  4LO0 C;  3PHZ A;  2D1Z A;  4ZOT A;  2FO1 A;  4UY4 A;  1P63 A;  1FGA A;  3UD7 A;  1RZO B;  2GZB A;  3FJJ A;  4AN7 B;  4EEE B;  4I4X A;  4EKX B;  1W3G A;  4J2S A;  3HN1 A;  1EPW A;  1SZ6 B;  1V6U A;  4KBB A;  4OW4 A;  3CA4 A;  2D7R A;  1QQK A;  2AXM A;  2KH2 A;  4Z9W B;  4DEP A;  2MLL B;  3JUT A;  3F62 B;  4MZF B;  4GOY A;  4OWK A;  3Q7Y A;  1EYL A;  2NVH A;  3FJD A;  4X38 A;  2FFV A;  3P6J A;  4TLP A;  4H9W A;  4F34 A;  1G9C A;  1DQG A;  3BA7 A;  3P6I A;  4EFQ A;  2ERM A;  2VLC A;  4JQ0 A;  5BQU A;  3BRD A;  4JKX B;  1JLX A;  2LIQ A;  4H04 A;  2AQZ A;  3OGG A;  3ZC8 A;  4EFP A;  4P0L A;  1IJT A;  3PME A;  4HJJ A;  4ION A;  4JRA A;  1TWE A;  5DUY A;  3O49 A;  4I4Q A;  1M16 A;  4XFT A;  3NBE A;  1I1B A;  1Z0H A;  1M2T B;  1ISY A;  1UPS A;  5DZU A;  2M49 A;  3W9T A;  3QR5 A;  1A8D A;  4Q9P A;  1ISX A;  1XZZ A;  3BAQ A;  5E24 E;  3D7W B;  2NM1 A;  4QD2 C;  6I1B A;  3I2X A;  3EF2 A;  5I1B A;  2K4A B;  4XFU A;  3H6S E;  3AH2 A;  4EB2 B;  4LO0 A;  2Z49 A;  3PG0 A;  2MC2 A;  1G82 A;  4JKQ A;  3AZV A;  4I4P A;  3BAO A;  1BLD A;  1OQL B;  4G6J A;  4GP0 A;  4OEE A;  3RTJ B;  2HW9 A;  1R8N A;  3O44 A;  4QAL A;  4OEG A;  4A7Y A;  5D61 A;  4DEN A;  4JP0 A;  3V0B B;  4IZE A;  2BEB A;  1TOO A;  5FZY A;  1Q1U A;  2BEA A;  1XYF A;  1WD4 A;  2VSA A;  3BX1 C;  3CU1 B;  5BXP A;  1DZC A;  5GAQ A;  4GAF A;  1QQL A;  4KEI A;  2Z48 A;  1N4K A;  4ZKT B;  1NZK A;  3FJE A;  2WRY A;  2F2F A;  4KEK A;  3NBC A;  31BI A;  4I4V A;  1ISW A;  1JLY A;  3CRI A;  3FGM A;  2K8R A;  3BA4 A;  4I1B A;  3HBW A;  5D63 A;  3ZXD A;  21BI A;  4IY9 A;  2NYY A;  2ZQN A;  3VEQ A;  4XKI A;  2Y9X E;  4LO7 C;  3FJB A;  3WMU A;  1R8O A;  2LIE A;  4G6M A;  5FZZ A;  3VT0 A;  1JQZ A;  1DZD A;  1JT3 A;  3SNV A;  3KMV A;  1Q04 A;  2KI4 A;  3VWC A;  1S0B A;  4OWL A;  4G1R A;  4XFS A;  3FUO A;  3FJC A;  1FV2 A;  4KEJ A;  1PC8 B;  3BAV A;  3VT1 A;  3WO2 A;  3RTI B;  1AVU A;  1YTO A;  5EHA A;  2ZR1 B;  4R6U B;  1WBA A;  2D23 A;  1RG8 A;  2QN4 A;  1FN0 A;  4A7Z A;  1BFB A;  1VCL A;  1Z4S A;  3FUQ A;  3T8S A;  3IIR A;  1BAR A;  5DSS B;  4QO3 A;  2DS0 A;  2IHO A;  1EV2 A;  3UDA A;  1WBC A;  2BFH A;  3ILA A;  2E4M C;  1ISZ A;  1FWV A;  4I37 A;  4J2Y A;  5BXR A;  4WBC A;  3MAL A;  4DCK C;  1BA7 A;  3UJ0 A;  3I29 B;  3BRG C;  4QBV A;  1Q03 A;  4F83 A;  1YYN A;  3A07 A;  4OUJ A;  1HWP B;  4H75 A;  1FMM S;  3S8K A;  1AVW B;  1PUM B;  3FJ9 A;  1ONK B;  2Y9F A;  3FJ8 A;  3PUB A;  3VSZ A;  1TTU A;  1W3A A;  5BVP I;  3AKI A;  2FFU A;  3CQA A;  3RSJ A;  3IM7 A;  3WIN C;  4IHZ A;  1L2H A;  3BAG A;  3OJM A;  3CA1 A;  4I3N A;  1YF8 B;  3A21 A;  2D22 A;  4GP3 A;  2DRY A;  4JPZ A;  4IZX A;  2Q9X A;  1PUU B;  1CVS A;  2RQ9 A;  4GAI A;  4Z8S B;  5BXS A;  2RST A;  2Y9G A;  4J2X A;  2K43 A;  3O5W B;  4GOV A;  4CJM A;  2IWT B;  3O4D A;  4LO3 C;  4ZFW B;  3FJA A;  3UD8 A;  2XOA A;  1KNM A;  2X2S A;  1ISV A;  3Q7W A;  5FZU A;  1PZZ A;  4D0T A;  4OWJ A;  1FMZ A;  4D0Z A;  2VUA A;  1AFC A;  4J23 B;  4X39 A;  3A22 A;  3CA6 A;  3P53 A;  1AF9 A;  3BA5 A;  1HIB A;  3CA3 A;  3BB2 A;  3H6Q A;  4L4H A;  3O4O A;  2R9K B;  2FDB M;  2J3P A;  3OGF A;  3FFZ A;  4ISR A;  4YOL A;  1E0O A;  1JTC A;  2VXT I;  1J0S A;  1TWM A;  4MZG B;  2VU9 A;  1DFC A;  2D43 A;  3FJH A;  4II0 A;  1AVA C;  1DLL A;  3R4U A;  1HCE A;  1IRP A;  3AJ6 A;  2L5X A;  3WMV A;  3VSF A;  4Q9G A;  1BFF A;  3LTQ A;  5BP5 C;  1XG6 A;  1CE7 B;  4G9M A;  1EVT A;  2FGF A;  2D20 A;  3NJ5 A;  1XHB A;  4I0Y A;  3WA1 A;  1BFC A;  3CRH A;  1TFM B;  3POK A;  4OEF A;  4QC4 A;  4P6A A;  2HWM A;  3RMX A;  3N0K A;  3WIN A;  5BOW A;  4I4Y A;  3O4A A;  2KLL A;  1II4 A;  2P23 A;  3HAL A;  3S8J A;  4LO2 C;  1T9F A;  4IYB A;  4I4R A;  1T4Q A;  3E8L C;  4P0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...