3CRIA

Crystal structure of human fibroblast growth factor-1 with mutations glu81ser, glu82asn and lys101ala
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNSNCLFLERLEENHYNTYISKAHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Engineering an improved crystal contact across a solvent-mediated interface of human fibroblast growth factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3criA00
1YF8B 1IT0A 4IY9A 1EVTA 2DREA 4J2KA 1ISZA 3N7JA 3O4BA 2ESUA 1EV2A 3FJIA 4OEEA 5DUYA 4I3NA 4ZFYB 1BARA 1ISXA 1G82A 1JY0A 3D7WB 1DZDA 4LO7C 3A07A 1RZOB 3O4AA 5BQUC 3AKHA 2F8XC 3SNVA 3VT0A 1GGPB 1R8NA 41BIA 4XFSA 3VUOA 2VSAA 4EFQA 4I7IA 5BXRA 1BLDA 1V6UA 1L2HA 3ZC9A 4I8MA 1TTUA 4JAWA 2UUSA 1R8OA 4H9WA 4LO2C 1RY7A 3AJ5A 1HWNB 2HWMA 1DLLA 3ILAA 4USOA 1QXMA 4JPZA 3FJAA 4TLPA 2VUAA 3BAUA 3FJ9A 2MLLB 4IZEA 2FFUA 3AZWA 4X38A 5BXPA 3WO4A 5B2HA 3K1XA 3O3QA 2X2TA 1JLXA 4GP0A 1YYNA 1S0CA 2WBCA 3S8JA 1FWUA 4GAIA 4D8HA 3FJ8A 3I2XA 4Z8SB 1HWPB 2HZ9A 3AH1A 1PUMB 1Z2VA 1XHBA 2AAIB 1EPWA 3QR5A 3UD7A 3BRFA 9ILBA 4R6UB 3O49A 1FQ9A 3OJMA 1CE7B 5BVPI 3V0BB 2GO2A 3CA3A 3BTAA 1SZ6B 1DJSB 5F90A 3NJ5A 5BP5A 3P6JA 2ERMA 2D22A 4ZKTB 5E24E 1S0GA 1G9BA 5GAQA 3NBEA 4D0ZA 2J3PA 4L4HA 2K4AB 3IM5A 3UD8A 5BQUA 3ZXDA 2R9KB 3C9ZA 4A7YA 3AKFA 3MPPG 3JRRA 4I96A 3BRDA 3LTQA 5DVHA 5FZYA 4OWKA 3VT2A 4FGFA 3WO3A 3B9UA 3CAHA 1PC8B 4IY8A 2D23A 2KLLA 4KEJA 4QKSA 4LO3C 3UJ4A 3IM6A 3IIRA 3VSFA 2KKIA 3BAOA 4G9MA 4I0YA 5FNWA 4LO2A 3BB2A 3RSJA 2M49A 1S0EA 3FJDA 1ISYA 3NBDA 2E4MA 4LO7B 1HWMB 1T4QA 2F2FC 3WMUA 4H04A 2BEAA 1NUNA 3PMEA 4Q9GA 5JLVA 4F83A 3RTJB 3FGMA 1S0LA 4KEIA 3OGFA 4CJMA 4OEGA 3IAGC 2K8RA 31BIA 4AN7B 4P6AA 1BFFA 4ZA3B 2L5XA 1CVSA 1TWEA 1ITBA 1WD3A 1V6VA 1W3FA 2NYYA 3FJBA 4ZFWB 3T8SA 1D0HA 1IRAX 4YOLA 1YXWA 1M16A 3HOMA 4IONA 4A7KA 2KH2A 2MC2A 1M2TB 4QALA 1MC9A 2DRZA 1DQOA 5FNXA 2FFVA 4P0KA 3CQAA 1G9AA 4G6JA 2DRYA 2Y9XE 3FUOA 1RMLA 1TP0A 1Q1UA 3BAHA 4ISRA 3WMVA 4J2YA 5FZUA 3FJCA 3A23A 3FJKA 4II0A 2KI4A 4I6IA 1NZKA 3TC2A 4GOYA 2HW9A 1WBAA 1ISWA 1DIWA 4G1RA 1FMZA 4DCKC 3PUBA 5F8YA 2QYIB 3OBTA 4G6MA 4ZOTA 4IHZA 1RG8A 4LO3A 4IQPA 3OBRA 5BXTA 1S0DA 1AFCA 2Z49A 3CA0A 2YUGA 1E0OA 1N4KA 5D61A 1AVUA 3BX1C 3V0BA 1BASA 4X3AA 2F2FA 3Q7XA 3FJFA 5BXSA 5DZUA 2Y9FA 1V6WA 1BA7A 3N7KA 2VLCA 4KEKA 2D43A 4I4QA 3UDAA 2P39A 3CRIA 3N0KA 3E8LC 4LO8B 1PWAA 3H6SE 2NP0A 4XKIA 1ONKB 3RTIB 2NM1A 2D24A 3N7LA 1ABRB 2NZ9A 1I1BA 1KNMA 3AH4A 3HSMA 4JRAA 3BA5A 5FZZA 2Q9XA 2KI6B 3BAVA 1DFCA 3UJ0A 3V0AB 3R4UA 2Z48A 1BFGA 3RMXA 2Y9GA 1BLAA 3P6IA 1HCDA 4QD2C 1BFCA 1IILA 3Q7YA 4J23B 3EF2A 2ET2A 3HBWA 4J2SA 4KC3A 4QBCA 2RSTA 4USPA 1XYFA 2XOAA 1VCLA 3H6QA 1IJTA 4I2SA 3OGGA 4QKRA 2Q3NB 4I4UA 3FJHA 5F8SA 4XFTA 3N7MA 3HN1A 3ZXGA 2RQ9A 2HWAA 3JUTA 1S0FA 2ZR1B 1FV2A 3FJJA 2BFHA 4JKQA 4L4IA 4EB2B 5BOWA 3MALA 3BRGC 3AKIA 2BEBA 1IOBA 3I29B 4DENA 3QYDA 3ZC8A 1FGAA 4G9NA 1Q04A 6I1BA 3NBNA 4I1BA 4ZLBB 4KBBA 4I4OA 1HIBA 4F34A 1WD4A 4DEPA 2VSEA 1K5VA 1JT4A 3S8KA 3FUQA 4IYBA 2ZQNA 4JQ0A 1HWOB 4QBVA 1JT7A 3H6RB 1ILR1 2VU9A 1FV3A 3AJ6A 2VXTI 4I4SA 4GOVA 3F62B 3F1RA 3CA6A 5JMCA 4Q9PA 1A8DA 2FDBM 2K43A 1XG6A 5D63A 4LO0C 2DS0A 1I1EA 4I4XA 2NTDA 1SR4C 4LO1C 4PC4A 3CA4A 3OJVA 4OUJA 4XFUA 3POKA 1Q03A 1AVXB 5BP5C 1FWVA 4HJJA 3Q7WA 4ZGRB 1WBCA 1BFBA 3BA4A 4JP0A 3BAQA 1AXMA 1TWMA 3LLPA 4QC4A 3CA5A 1FN0A 4X39A 3WINC 3CA1A 2I1BA 1AVAC 1P63A 2NVHA 1JQZA 4ZBVB 1JTCA 3BAGA 3UD9A 3VT1A 4I1EA 3AZVA 2RG9B 4FVVA 3CRGA 3BADA 4QD2B 5EHAA 3ZX7A 1HCEA 5DSSB 1TOOA 5EG6C 1V6XA 3NBCA 3I2AA 3FFZA 3O4CA 3V0AA 5G00A 1YBIA 3CU1B 3VWCA 2Y9WC 2E4MC 3KMVA 1DQGA 3IM7A 3O5WB 2P23A 3HALA 2FGFA 3AKGA 1W3GA 4HR6C 4I4RA 1XZZA 4JKXB 5F8WA 2IHOA 3OJ2A 4OEFA 3VEQA 2D44A 4P0JA 8I1BA 21BIA 4I4VA 2AQZA 5I1BA 3FJEA 1TIEA 1W3AA 2IWTB 3BA7A 1JT5A 4I4PA 4I37A 3W9TA 2WRYA 3PG0A 4AN6A 1QQKA 3VSZA 2FO1A 1YTOA 2D7RA 4P0LA 1JLYA 2ZQOA 4OW4A 4J2XA 1T9FA 4LO0A 3RMYA 4Q91A 4QO3A 2LIQA 1PZZA 3A21A 3CRHA 1SR4A 4LO1A 5EC5A 2LIEA 4GP3A 4EFPA 1F31A 3A22A 1Z0HA 1UPSA 7I1BA 1EYLA 4D0TA 3HMYA 4Z9WB 4EEEB 1II4A 4HA2A 1PUUB 2AXMA 2X2SA 3O44A 4WBCA 3P53A 1S0BA 1IRPA 1ISVA 4I4YA 3WINA 1DZCA 1AF9A 1K5UA 2GZBA 3H6RA 1FMMS 4OWLA 3O4DA 1DFQA 4ZFUB 2AFGA 4EKXB 2D1ZA 1HKNA 1TFMB 2D7IA 4IZXA 1G9DA 2VXRA 1OQLB 3O4OA 4A7ZA 5D62A 3AH2A 1IHKA 2D20A 1J0SA 3R4SA 4X37A 4EFRA 4GAFA 4ENDA 5HPZA 1AVWB 2QN4A 3PHZA 4OWJA 4ISQA 1MD6A 3WA1A 1Z4SA 1G9CA 3V79C 2MIBA 3WO2A 1QQLA 1JT3A
chains in the Genus database with same CATH superfamily
1YF8B 1IT0A 4IY9A 1EVTA 2DREA 4J2KA 1ISZA 3N7JA 3O4BA 2ESUA 1EV2A 3FJIA 4OEEA 5DUYA 4I3NA 4ZFYB 1BARA 1ISXA 1G82A 1JY0A 3D7WB 1DZDA 4LO7C 3A07A 1RZOB 3O4AA 5BQUC 3AKHA 2F8XC 3SNVA 3VT0A 1GGPB 1R8NA 41BIA 4XFSA 3VUOA 2VSAA 4EFQA 4I7IA 5BXRA 1BLDA 1V6UA 1L2HA 3ZC9A 4I8MA 1TTUA 4JAWA 2UUSA 1R8OA 4H9WA 4LO2C 1RY7A 3AJ5A 1HWNB 2HWMA 1DLLA 3ILAA 4USOA 1QXMA 4JPZA 3FJAA 4TLPA 2VUAA 3BAUA 3FJ9A 2MLLB 4IZEA 2FFUA 3AZWA 4X38A 5BXPA 3WO4A 5B2HA 3K1XA 3O3QA 2X2TA 1JLXA 4GP0A 1YYNA 1S0CA 2WBCA 3S8JA 1FWUA 4GAIA 4D8HA 3FJ8A 3I2XA 4Z8SB 1HWPB 2HZ9A 3AH1A 1PUMB 1Z2VA 1XHBA 2AAIB 1EPWA 3QR5A 3UD7A 3BRFA 9ILBA 4R6UB 3O49A 1FQ9A 3OJMA 1CE7B 5BVPI 3V0BB 2GO2A 3CA3A 4H75A 3BTAA 1SZ6B 1DJSB 5F90A 3NJ5A 5BP5A 3P6JA 2ERMA 2D22A 4ZKTB 5E24E 1S0GA 1G9BA 5GAQA 3NBEA 4D0ZA 2J3PA 4L4HA 2K4AB 3IM5A 3UD8A 5BQUA 3ZXDA 2R9KB 3C9ZA 4A7YA 3AKFA 3MPPG 3JRRA 4I96A 3BRDA 3LTQA 5DVHA 5FZYA 4OWKA 3VT2A 4FGFA 3WO3A 3B9UA 3CAHA 1PC8B 4IY8A 2D23A 2KLLA 4KEJA 4QKSA 4LO3C 3UJ4A 3IM6A 3IIRA 3VSFA 2KKIA 3BAOA 4G9MA 4I0YA 5FNWA 4LO2A 3BB2A 3RSJA 2M49A 1S0EA 3FJDA 1ISYA 3NBDA 2E4MA 4LO7B 1HWMB 1T4QA 2F2FC 3WMUA 4H04A 2BEAA 1NUNA 3PMEA 4Q9GA 5JLVA 4F83A 3RTJB 3FGMA 1S0LA 4KEIA 3OGFA 4CJMA 4OEGA 3IAGC 2K8RA 31BIA 4AN7B 4P6AA 1BFFA 4ZA3B 2L5XA 1CVSA 1TWEA 1ITBA 1WD3A 1V6VA 1W3FA 2NYYA 3FJBA 4ZFWB 3T8SA 1D0HA 1IRAX 4YOLA 1YXWA 1M16A 3HOMA 4IONA 4A7KA 2KH2A 2MC2A 1M2TB 4QALA 1MC9A 2DRZA 1DQOA 5FNXA 2FFVA 4P0KA 3CQAA 1G9AA 4G6JA 2DRYA 2Y9XE 3FUOA 1RMLA 1TP0A 1Q1UA 3BAHA 4ISRA 3WMVA 4J2YA 5FZUA 3FJCA 4MZGB 3A23A 3FJKA 4II0A 2KI4A 4I6IA 1NZKA 3TC2A 4GOYA 2HW9A 1WBAA 1ISWA 1DIWA 4G1RA 1FMZA 4DCKC 3PUBA 5F8YA 2QYIB 3OBTA 4G6MA 4ZOTA 4IHZA 1RG8A 4LO3A 4IQPA 3OBRA 5BXTA 1S0DA 1AFCA 2Z49A 3CA0A 2YUGA 1E0OA 1N4KA 5D61A 1AVUA 3BX1C 3V0BA 1BASA 4X3AA 2F2FA 3Q7XA 3FJFA 5BXSA 5DZUA 2Y9FA 1V6WA 1BA7A 3N7KA 2VLCA 4KEKA 2D43A 4I4QA 3UDAA 2P39A 3CRIA 3N0KA 3E8LC 4LO8B 1PWAA 3H6SE 2NP0A 4XKIA 1ONKB 3RTIB 2NM1A 2D24A 3N7LA 1ABRB 2NZ9A 1I1BA 1KNMA 3AH4A 3HSMA 4JRAA 3BA5A 5FZZA 2Q9XA 2KI6B 3BAVA 1DFCA 3UJ0A 3V0AB 3R4UA 2Z48A 1BFGA 3RMXA 2Y9GA 1BLAA 3P6IA 1HCDA 4QD2C 1BFCA 1IILA 3Q7YA 4J23B 3EF2A 2ET2A 3HBWA 4J2SA 4KC3A 4QBCA 2RSTA 4USPA 1XYFA 2XOAA 1VCLA 3H6QA 1IJTA 4I2SA 3OGGA 4QKRA 2Q3NB 4I4UA 3FJHA 5F8SA 4XFTA 3N7MA 3HN1A 3ZXGA 2RQ9A 2HWAA 3JUTA 1S0FA 2ZR1B 1FV2A 4MZFB 3FJJA 2BFHA 4JKQA 4L4IA 4EB2B 5BOWA 3MALA 3BRGC 3AKIA 2BEBA 1IOBA 3I29B 4DENA 3QYDA 3ZC8A 1FGAA 4G9NA 1Q04A 6I1BA 3NBNA 4I1BA 4ZLBB 4KBBA 4I4OA 1HIBA 4F34A 1WD4A 4DEPA 2VSEA 1K5VA 1JT4A 3S8KA 3FUQA 4IYBA 2ZQNA 4JQ0A 1HWOB 4QBVA 1JT7A 3H6RB 1ILR1 2VU9A 1FV3A 3AJ6A 2VXTI 4I4SA 4GOVA 3F62B 3F1RA 3CA6A 5JMCA 4Q9PA 1A8DA 2FDBM 2K43A 1XG6A 5D63A 4LO0C 2DS0A 1I1EA 4I4XA 2NTDA 1SR4C 4LO1C 4PC4A 3CA4A 3OJVA 4OUJA 4XFUA 3POKA 1Q03A 1AVXB 5BP5C 1FWVA 2NS2A 4HJJA 3Q7WA 4ZGRB 1WBCA 1BFBA 3BA4A 4JP0A 3BAQA 1AXMA 1TWMA 3LLPA 4QC4A 3CA5A 1FN0A 4X39A 3WINC 3CA1A 2I1BA 1AVAC 1P63A 2NVHA 1JQZA 4ZBVB 1JTCA 3BAGA 3UD9A 3VT1A 4I1EA 3AZVA 2RG9B 4FVVA 3CRGA 3BADA 4QD2B 5EHAA 3ZX7A 1HCEA 5DSSB 1TOOA 5EG6C 1V6XA 3NBCA 3I2AA 3FFZA 3O4CA 3V0AA 5G00A 1YBIA 4UY4A 3CU1B 3VWCA 2Y9WC 2E4MC 3KMVA 1DQGA 3IM7A 3O5WB 2P23A 3HALA 2FGFA 3AKGA 1W3GA 4HR6C 4I4RA 1XZZA 4JKXB 5F8WA 2IHOA 3OJ2A 4OEFA 3VEQA 2D44A 4P0JA 8I1BA 21BIA 4I4VA 2AQZA 5I1BA 3FJEA 1TIEA 1W3AA 2IWTB 3BA7A 1JT5A 4I4PA 4I37A 3W9TA 2WRYA 3PG0A 4AN6A 1QQKA 3VSZA 2FO1A 1YTOA 2D7RA 4P0LA 1JLYA 2ZQOA 4OW4A 4J2XA 1T9FA 4LO0A 3RMYA 4Q91A 4QO3A 2LIQA 1PZZA 3A21A 3CRHA 1SR4A 4LO1A 5EC5A 2LIEA 4GP3A 4EFPA 1F31A 3A22A 1Z0HA 1UPSA 7I1BA 1EYLA 4D0TA 3HMYA 4Z9WB 4EEEB 1II4A 4HA2A 1PUUB 2AXMA 2X2SA 3O44A 4WBCA 3P53A 1S0BA 1IRPA 1ISVA 4I4YA 3WINA 1DZCA 1AF9A 1K5UA 2GZBA 3H6RA 1FMMS 4OWLA 3O4DA 1DFQA 4ZFUB 2AFGA 4EKXB 2D1ZA 1HKNA 1TFMB 2D7IA 4IZXA 1G9DA 2VXRA 1OQLB 3O4OA 4A7ZA 5D62A 3AH2A 1IHKA 2D20A 1J0SA 3R4SA 4X37A 4EFRA 4GAFA 4ENDA 5HPZA 1AVWB 4MZHA 2QN4A 3PHZA 4OWJA 4ISQA 1MD6A 3WA1A 1Z4SA 1G9CA 3V79C 2MIBA 3WO2A 1QQLA 1JT3A
chains in the Genus database with same CATH topology
1YF8B 1IT0A 4IY9A 1EVTA 2DREA 4J2KA 1ISZA 3N7JA 3O4BA 2ESUA 1EV2A 3FJIA 4OEEA 5DUYA 4I3NA 4ZFYB 1BARA 1ISXA 1G82A 1JY0A 3D7WB 1DZDA 4LO7C 3A07A 1RZOB 3O4AA 5BQUC 3AKHA 2F8XC 3SNVA 3VT0A 1GGPB 1R8NA 41BIA 4XFSA 3VUOA 2VSAA 4EFQA 4I7IA 5BXRA 1BLDA 1V6UA 1L2HA 3ZC9A 4I8MA 1TTUA 4JAWA 2UUSA 1R8OA 4H9WA 4LO2C 1RY7A 3AJ5A 1HWNB 2HWMA 1DLLA 3ILAA 4USOA 1QXMA 4JPZA 3FJAA 4TLPA 2VUAA 3BAUA 3FJ9A 2MLLB 4IZEA 2FFUA 3AZWA 4X38A 5BXPA 3WO4A 5B2HA 3K1XA 3O3QA 2X2TA 1JLXA 4GP0A 1YYNA 1S0CA 2WBCA 3S8JA 1FWUA 4GAIA 4D8HA 3FJ8A 3I2XA 4Z8SB 1HWPB 2HZ9A 3AH1A 1PUMB 1Z2VA 1XHBA 2AAIB 1EPWA 3QR5A 3UD7A 3BRFA 9ILBA 4R6UB 3O49A 1FQ9A 3OJMA 1CE7B 5BVPI 3V0BB 2GO2A 3CA3A 4H75A 3BTAA 1SZ6B 1DJSB 5F90A 3NJ5A 5BP5A 3P6JA 2ERMA 2D22A 4ZKTB 5E24E 1S0GA 1G9BA 5GAQA 3NBEA 4D0ZA 2J3PA 4L4HA 2K4AB 3IM5A 3UD8A 5BQUA 3ZXDA 2R9KB 3C9ZA 4A7YA 3AKFA 3MPPG 3JRRA 4I96A 3BRDA 3LTQA 5DVHA 5FZYA 4OWKA 3VT2A 4FGFA 3WO3A 3B9UA 3CAHA 1PC8B 4IY8A 2D23A 2KLLA 4KEJA 4QKSA 4LO3C 3UJ4A 3IM6A 3IIRA 3VSFA 2KKIA 3BAOA 4G9MA 4I0YA 5FNWA 4LO2A 3BB2A 3RSJA 2M49A 1S0EA 3FJDA 1ISYA 3NBDA 2E4MA 4LO7B 1HWMB 1T4QA 2F2FC 3WMUA 4H04A 2BEAA 1NUNA 3PMEA 4Q9GA 5JLVA 4F83A 3RTJB 3FGMA 1S0LA 4KEIA 3OGFA 4CJMA 4OEGA 3IAGC 2K8RA 31BIA 4AN7B 4P6AA 1BFFA 4ZA3B 2L5XA 1CVSA 1TWEA 1ITBA 1WD3A 1V6VA 1W3FA 2NYYA 3FJBA 4ZFWB 3T8SA 1D0HA 1IRAX 4YOLA 1YXWA 1M16A 3HOMA 4IONA 4A7KA 2KH2A 2MC2A 1M2TB 4QALA 1MC9A 2DRZA 1DQOA 5FNXA 2FFVA 4P0KA 3CQAA 1G9AA 4G6JA 2DRYA 2Y9XE 3FUOA 1RMLA 1TP0A 1Q1UA 3BAHA 4ISRA 3WMVA 4J2YA 5FZUA 3FJCA 4MZGB 3A23A 3FJKA 4II0A 2KI4A 4I6IA 1NZKA 3TC2A 4GOYA 2HW9A 1WBAA 1ISWA 1DIWA 4G1RA 1FMZA 4DCKC 3PUBA 5F8YA 2QYIB 3OBTA 4G6MA 4ZOTA 4IHZA 1RG8A 4LO3A 4IQPA 3OBRA 5BXTA 1S0DA 1AFCA 2Z49A 3CA0A 2YUGA 1E0OA 1N4KA 5D61A 1AVUA 3BX1C 3V0BA 1BASA 4X3AA 2F2FA 3Q7XA 3FJFA 5BXSA 5DZUA 2Y9FA 1V6WA 1BA7A 3N7KA 2VLCA 4KEKA 2D43A 4I4QA 3UDAA 2P39A 3CRIA 3N0KA 3E8LC 4LO8B 1PWAA 3H6SE 2NP0A 4XKIA 1ONKB 3RTIB 2NM1A 2D24A 3N7LA 1ABRB 2NZ9A 1I1BA 1KNMA 3AH4A 3HSMA 4JRAA 3BA5A 5FZZA 2Q9XA 2KI6B 3BAVA 1DFCA 3UJ0A 3V0AB 3R4UA 2Z48A 1BFGA 3RMXA 2Y9GA 1BLAA 3P6IA 1HCDA 4QD2C 1BFCA 1IILA 3Q7YA 4J23B 3EF2A 2ET2A 3HBWA 4J2SA 4KC3A 4QBCA 2RSTA 4USPA 1XYFA 2XOAA 1VCLA 3H6QA 1IJTA 4I2SA 3OGGA 4QKRA 2Q3NB 4I4UA 3FJHA 5F8SA 4XFTA 3N7MA 3HN1A 3ZXGA 2RQ9A 2HWAA 3JUTA 1S0FA 2ZR1B 1FV2A 4MZFB 3FJJA 2BFHA 4JKQA 4L4IA 4EB2B 5BOWA 3MALA 3BRGC 3AKIA 2BEBA 1IOBA 3I29B 4DENA 3QYDA 3ZC8A 1FGAA 4G9NA 1Q04A 6I1BA 3NBNA 4I1BA 4ZLBB 4KBBA 4I4OA 1HIBA 4F34A 1WD4A 4DEPA 2VSEA 1K5VA 1JT4A 3S8KA 3FUQA 4IYBA 2ZQNA 4JQ0A 1HWOB 4QBVA 1JT7A 3H6RB 1ILR1 2VU9A 1FV3A 3AJ6A 2VXTI 4I4SA 4GOVA 3F62B 3F1RA 3CA6A 5JMCA 4Q9PA 1A8DA 2FDBM 2K43A 1XG6A 5D63A 4LO0C 2DS0A 1I1EA 4I4XA 2NTDA 1SR4C 4LO1C 4PC4A 3CA4A 3OJVA 4OUJA 4XFUA 3POKA 1Q03A 1AVXB 5BP5C 1FWVA 2NS2A 4HJJA 3Q7WA 4ZGRB 1WBCA 1BFBA 3BA4A 4JP0A 3BAQA 1AXMA 1TWMA 3LLPA 4QC4A 3CA5A 1FN0A 4X39A 3WINC 3CA1A 2I1BA 1AVAC 1P63A 2NVHA 1JQZA 4ZBVB 1JTCA 3BAGA 3UD9A 3VT1A 4I1EA 3AZVA 2RG9B 4FVVA 3CRGA 3BADA 4QD2B 5EHAA 3ZX7A 1HCEA 5DSSB 1TOOA 5EG6C 1V6XA 3NBCA 3I2AA 3FFZA 3O4CA 3V0AA 5G00A 1YBIA 4UY4A 3CU1B 3VWCA 2Y9WC 2E4MC 3KMVA 1DQGA 3IM7A 3O5WB 2P23A 3HALA 2FGFA 3AKGA 1W3GA 4HR6C 4I4RA 1XZZA 4JKXB 5F8WA 2IHOA 3OJ2A 4OEFA 3VEQA 2D44A 4P0JA 8I1BA 21BIA 4I4VA 2AQZA 5I1BA 3FJEA 1TIEA 1W3AA 2IWTB 3BA7A 1JT5A 4I4PA 4I37A 3W9TA 2WRYA 3PG0A 4AN6A 1QQKA 3VSZA 2FO1A 1YTOA 2D7RA 4P0LA 1JLYA 2ZQOA 4OW4A 4J2XA 1T9FA 4LO0A 3RMYA 4Q91A 4QO3A 2LIQA 1PZZA 3A21A 3CRHA 1SR4A 4LO1A 5EC5A 2LIEA 4GP3A 4EFPA 1F31A 3A22A 1Z0HA 1UPSA 7I1BA 1EYLA 4D0TA 3HMYA 4Z9WB 4EEEB 1II4A 4HA2A 1PUUB 2AXMA 2X2SA 3O44A 4WBCA 3P53A 1S0BA 1IRPA 1ISVA 4I4YA 3WINA 1DZCA 1AF9A 1K5UA 2GZBA 3H6RA 1FMMS 4OWLA 3O4DA 1DFQA 4ZFUB 2AFGA 4EKXB 2D1ZA 1HKNA 1TFMB 2D7IA 4IZXA 1G9DA 2VXRA 1OQLB 3O4OA 4A7ZA 5D62A 3AH2A 1IHKA 2D20A 1J0SA 3R4SA 4X37A 4EFRA 4GAFA 4ENDA 5HPZA 1AVWB 4MZHA 2QN4A 3PHZA 4OWJA 4ISQA 1MD6A 3WA1A 1Z4SA 1G9CA 3V79C 2MIBA 3WO2A 1QQLA 1JT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF8 B;  1IT0 A;  4IY9 A;  1EVT A;  2DRE A;  4J2K A;  1ISZ A;  3N7J A;  3O4B A;  2ESU A;  1EV2 A;  3FJI A;  4OEE A;  5DUY A;  4I3N A;  4ZFY B;  1BAR A;  1ISX A;  1G82 A;  1JY0 A;  3D7W B;  1DZD A;  4LO7 C;  3A07 A;  1RZO B;  3O4A A;  5BQU C;  3AKH A;  2F8X C;  3SNV A;  3VT0 A;  1GGP B;  1R8N A;  41BI A;  4XFS A;  3VUO A;  2VSA A;  4EFQ A;  4I7I A;  5BXR A;  1BLD A;  1V6U A;  1L2H A;  3ZC9 A;  4I8M A;  1TTU A;  4JAW A;  2UUS A;  1R8O A;  4H9W A;  4LO2 C;  1RY7 A;  3AJ5 A;  1HWN B;  2HWM A;  1DLL A;  3ILA A;  4USO A;  1QXM A;  4JPZ A;  3FJA A;  4TLP A;  2VUA A;  3BAU A;  3FJ9 A;  2MLL B;  4IZE A;  2FFU A;  3AZW A;  4X38 A;  5BXP A;  3WO4 A;  5B2H A;  3K1X A;  3O3Q A;  2X2T A;  1JLX A;  4GP0 A;  1YYN A;  1S0C A;  2WBC A;  3S8J A;  1FWU A;  4GAI A;  4D8H A;  3FJ8 A;  3I2X A;  4Z8S B;  1HWP B;  2HZ9 A;  3AH1 A;  1PUM B;  1Z2V A;  1XHB A;  2AAI B;  1EPW A;  3QR5 A;  3UD7 A;  3BRF A;  9ILB A;  4R6U B;  3O49 A;  1FQ9 A;  3OJM A;  1CE7 B;  5BVP I;  3V0B B;  2GO2 A;  3CA3 A;  3BTA A;  1SZ6 B;  1DJS B;  5F90 A;  3NJ5 A;  5BP5 A;  3P6J A;  2ERM A;  2D22 A;  4ZKT B;  5E24 E;  1S0G A;  1G9B A;  5GAQ A;  3NBE A;  4D0Z A;  2J3P A;  4L4H A;  2K4A B;  3IM5 A;  3UD8 A;  5BQU A;  3ZXD A;  2R9K B;  3C9Z A;  4A7Y A;  3AKF A;  3MPP G;  3JRR A;  4I96 A;  3BRD A;  3LTQ A;  5DVH A;  5FZY A;  4OWK A;  3VT2 A;  4FGF A;  3WO3 A;  3B9U A;  3CAH A;  1PC8 B;  4IY8 A;  2D23 A;  2KLL A;  4KEJ A;  4QKS A;  4LO3 C;  3UJ4 A;  3IM6 A;  3IIR A;  3VSF A;  2KKI A;  3BAO A;  4G9M A;  4I0Y A;  5FNW A;  4LO2 A;  3BB2 A;  3RSJ A;  2M49 A;  1S0E A;  3FJD A;  1ISY A;  3NBD A;  2E4M A;  4LO7 B;  1HWM B;  1T4Q A;  2F2F C;  3WMU A;  4H04 A;  2BEA A;  1NUN A;  3PME A;  4Q9G A;  5JLV A;  4F83 A;  3RTJ B;  3FGM A;  1S0L A;  4KEI A;  3OGF A;  4CJM A;  4OEG A;  3IAG C;  2K8R A;  31BI A;  4AN7 B;  4P6A A;  1BFF A;  4ZA3 B;  2L5X A;  1CVS A;  1TWE A;  1ITB A;  1WD3 A;  1V6V A;  1W3F A;  2NYY A;  3FJB A;  4ZFW B;  3T8S A;  1D0H A;  1IRA X;  4YOL A;  1YXW A;  1M16 A;  3HOM A;  4ION A;  4A7K A;  2KH2 A;  2MC2 A;  1M2T B;  4QAL A;  1MC9 A;  2DRZ A;  1DQO A;  5FNX A;  2FFV A;  4P0K A;  3CQA A;  1G9A A;  4G6J A;  2DRY A;  2Y9X E;  3FUO A;  1RML A;  1TP0 A;  1Q1U A;  3BAH A;  4ISR A;  3WMV A;  4J2Y A;  5FZU A;  3FJC A;  3A23 A;  3FJK A;  4II0 A;  2KI4 A;  4I6I A;  1NZK A;  3TC2 A;  4GOY A;  2HW9 A;  1WBA A;  1ISW A;  1DIW A;  4G1R A;  1FMZ A;  4DCK C;  3PUB A;  5F8Y A;  2QYI B;  3OBT A;  4G6M A;  4ZOT A;  4IHZ A;  1RG8 A;  4LO3 A;  4IQP A;  3OBR A;  5BXT A;  1S0D A;  1AFC A;  2Z49 A;  3CA0 A;  2YUG A;  1E0O A;  1N4K A;  5D61 A;  1AVU A;  3BX1 C;  3V0B A;  1BAS A;  4X3A A;  2F2F A;  3Q7X A;  3FJF A;  5BXS A;  5DZU A;  2Y9F A;  1V6W A;  1BA7 A;  3N7K A;  2VLC A;  4KEK A;  2D43 A;  4I4Q A;  3UDA A;  2P39 A;  3CRI A;  3N0K A;  3E8L C;  4LO8 B;  1PWA A;  3H6S E;  2NP0 A;  4XKI A;  1ONK B;  3RTI B;  2NM1 A;  2D24 A;  3N7L A;  1ABR B;  2NZ9 A;  1I1B A;  1KNM A;  3AH4 A;  3HSM A;  4JRA A;  3BA5 A;  5FZZ A;  2Q9X A;  2KI6 B;  3BAV A;  1DFC A;  3UJ0 A;  3V0A B;  3R4U A;  2Z48 A;  1BFG A;  3RMX A;  2Y9G A;  1BLA A;  3P6I A;  1HCD A;  4QD2 C;  1BFC A;  1IIL A;  3Q7Y A;  4J23 B;  3EF2 A;  2ET2 A;  3HBW A;  4J2S A;  4KC3 A;  4QBC A;  2RST A;  4USP A;  1XYF A;  2XOA A;  1VCL A;  3H6Q A;  1IJT A;  4I2S A;  3OGG A;  4QKR A;  2Q3N B;  4I4U A;  3FJH A;  5F8S A;  4XFT A;  3N7M A;  3HN1 A;  3ZXG A;  2RQ9 A;  2HWA A;  3JUT A;  1S0F A;  2ZR1 B;  1FV2 A;  3FJJ A;  2BFH A;  4JKQ A;  4L4I A;  4EB2 B;  5BOW A;  3MAL A;  3BRG C;  3AKI A;  2BEB A;  1IOB A;  3I29 B;  4DEN A;  3QYD A;  3ZC8 A;  1FGA A;  4G9N A;  1Q04 A;  6I1B A;  3NBN A;  4I1B A;  4ZLB B;  4KBB A;  4I4O A;  1HIB A;  4F34 A;  1WD4 A;  4DEP A;  2VSE A;  1K5V A;  1JT4 A;  3S8K A;  3FUQ A;  4IYB A;  2ZQN A;  4JQ0 A;  1HWO B;  4QBV A;  1JT7 A;  3H6R B;  1ILR 1;  2VU9 A;  1FV3 A;  3AJ6 A;  2VXT I;  4I4S A;  4GOV A;  3F62 B;  3F1R A;  3CA6 A;  5JMC A;  4Q9P A;  1A8D A;  2FDB M;  2K43 A;  1XG6 A;  5D63 A;  4LO0 C;  2DS0 A;  1I1E A;  4I4X A;  2NTD A;  1SR4 C;  4LO1 C;  4PC4 A;  3CA4 A;  3OJV A;  4OUJ A;  4XFU A;  3POK A;  1Q03 A;  1AVX B;  5BP5 C;  1FWV A;  4HJJ A;  3Q7W A;  4ZGR B;  1WBC A;  1BFB A;  3BA4 A;  4JP0 A;  3BAQ A;  1AXM A;  1TWM A;  3LLP A;  4QC4 A;  3CA5 A;  1FN0 A;  4X39 A;  3WIN C;  3CA1 A;  2I1B A;  1AVA C;  1P63 A;  2NVH A;  1JQZ A;  4ZBV B;  1JTC A;  3BAG A;  3UD9 A;  3VT1 A;  4I1E A;  3AZV A;  2RG9 B;  4FVV A;  3CRG A;  3BAD A;  4QD2 B;  5EHA A;  3ZX7 A;  1HCE A;  5DSS B;  1TOO A;  5EG6 C;  1V6X A;  3NBC A;  3I2A A;  3FFZ A;  3O4C A;  3V0A A;  5G00 A;  1YBI A;  3CU1 B;  3VWC A;  2Y9W C;  2E4M C;  3KMV A;  1DQG A;  3IM7 A;  3O5W B;  2P23 A;  3HAL A;  2FGF A;  3AKG A;  1W3G A;  4HR6 C;  4I4R A;  1XZZ A;  4JKX B;  5F8W A;  2IHO A;  3OJ2 A;  4OEF A;  3VEQ A;  2D44 A;  4P0J A;  8I1B A;  21BI A;  4I4V A;  2AQZ A;  5I1B A;  3FJE A;  1TIE A;  1W3A A;  2IWT B;  3BA7 A;  1JT5 A;  4I4P A;  4I37 A;  3W9T A;  2WRY A;  3PG0 A;  4AN6 A;  1QQK A;  3VSZ A;  2FO1 A;  1YTO A;  2D7R A;  4P0L A;  1JLY A;  2ZQO A;  4OW4 A;  4J2X A;  1T9F A;  4LO0 A;  3RMY A;  4Q91 A;  4QO3 A;  2LIQ A;  1PZZ A;  3A21 A;  3CRH A;  1SR4 A;  4LO1 A;  5EC5 A;  2LIE A;  4GP3 A;  4EFP A;  1F31 A;  3A22 A;  1Z0H A;  1UPS A;  7I1B A;  1EYL A;  4D0T A;  3HMY A;  4Z9W B;  4EEE B;  1II4 A;  4HA2 A;  1PUU B;  2AXM A;  2X2S A;  3O44 A;  4WBC A;  3P53 A;  1S0B A;  1IRP A;  1ISV A;  4I4Y A;  3WIN A;  1DZC A;  1AF9 A;  1K5U A;  2GZB A;  3H6R A;  1FMM S;  4OWL A;  3O4D A;  1DFQ A;  4ZFU B;  2AFG A;  4EKX B;  2D1Z A;  1HKN A;  1TFM B;  2D7I A;  4IZX A;  1G9D A;  2VXR A;  1OQL B;  3O4O A;  4A7Z A;  5D62 A;  3AH2 A;  1IHK A;  2D20 A;  1J0S A;  3R4S A;  4X37 A;  4EFR A;  4GAF A;  4END A;  5HPZ A;  1AVW B;  2QN4 A;  3PHZ A;  4OWJ A;  4ISQ A;  1MD6 A;  3WA1 A;  1Z4S A;  1G9C A;  3V79 C;  2MIB A;  3WO2 A;  1QQL A;  1JT3 A; 
#chains in the Genus database with same CATH topology
 1YF8 B;  1IT0 A;  4IY9 A;  1EVT A;  2DRE A;  4J2K A;  1ISZ A;  3N7J A;  3O4B A;  2ESU A;  1EV2 A;  3FJI A;  4OEE A;  5DUY A;  4I3N A;  4ZFY B;  1BAR A;  1ISX A;  1G82 A;  1JY0 A;  3D7W B;  1DZD A;  4LO7 C;  3A07 A;  1RZO B;  3O4A A;  5BQU C;  3AKH A;  2F8X C;  3SNV A;  3VT0 A;  1GGP B;  1R8N A;  41BI A;  4XFS A;  3VUO A;  2VSA A;  4EFQ A;  4I7I A;  5BXR A;  1BLD A;  1V6U A;  1L2H A;  3ZC9 A;  4I8M A;  1TTU A;  4JAW A;  2UUS A;  1R8O A;  4H9W A;  4LO2 C;  1RY7 A;  3AJ5 A;  1HWN B;  2HWM A;  1DLL A;  3ILA A;  4USO A;  1QXM A;  4JPZ A;  3FJA A;  4TLP A;  2VUA A;  3BAU A;  3FJ9 A;  2MLL B;  4IZE A;  2FFU A;  3AZW A;  4X38 A;  5BXP A;  3WO4 A;  5B2H A;  3K1X A;  3O3Q A;  2X2T A;  1JLX A;  4GP0 A;  1YYN A;  1S0C A;  2WBC A;  3S8J A;  1FWU A;  4GAI A;  4D8H A;  3FJ8 A;  3I2X A;  4Z8S B;  1HWP B;  2HZ9 A;  3AH1 A;  1PUM B;  1Z2V A;  1XHB A;  2AAI B;  1EPW A;  3QR5 A;  3UD7 A;  3BRF A;  9ILB A;  4R6U B;  3O49 A;  1FQ9 A;  3OJM A;  1CE7 B;  5BVP I;  3V0B B;  2GO2 A;  3CA3 A;  4H75 A;  3BTA A;  1SZ6 B;  1DJS B;  5F90 A;  3NJ5 A;  5BP5 A;  3P6J A;  2ERM A;  2D22 A;  4ZKT B;  5E24 E;  1S0G A;  1G9B A;  5GAQ A;  3NBE A;  4D0Z A;  2J3P A;  4L4H A;  2K4A B;  3IM5 A;  3UD8 A;  5BQU A;  3ZXD A;  2R9K B;  3C9Z A;  4A7Y A;  3AKF A;  3MPP G;  3JRR A;  4I96 A;  3BRD A;  3LTQ A;  5DVH A;  5FZY A;  4OWK A;  3VT2 A;  4FGF A;  3WO3 A;  3B9U A;  3CAH A;  1PC8 B;  4IY8 A;  2D23 A;  2KLL A;  4KEJ A;  4QKS A;  4LO3 C;  3UJ4 A;  3IM6 A;  3IIR A;  3VSF A;  2KKI A;  3BAO A;  4G9M A;  4I0Y A;  5FNW A;  4LO2 A;  3BB2 A;  3RSJ A;  2M49 A;  1S0E A;  3FJD A;  1ISY A;  3NBD A;  2E4M A;  4LO7 B;  1HWM B;  1T4Q A;  2F2F C;  3WMU A;  4H04 A;  2BEA A;  1NUN A;  3PME A;  4Q9G A;  5JLV A;  4F83 A;  3RTJ B;  3FGM A;  1S0L A;  4KEI A;  3OGF A;  4CJM A;  4OEG A;  3IAG C;  2K8R A;  31BI A;  4AN7 B;  4P6A A;  1BFF A;  4ZA3 B;  2L5X A;  1CVS A;  1TWE A;  1ITB A;  1WD3 A;  1V6V A;  1W3F A;  2NYY A;  3FJB A;  4ZFW B;  3T8S A;  1D0H A;  1IRA X;  4YOL A;  1YXW A;  1M16 A;  3HOM A;  4ION A;  4A7K A;  2KH2 A;  2MC2 A;  1M2T B;  4QAL A;  1MC9 A;  2DRZ A;  1DQO A;  5FNX A;  2FFV A;  4P0K A;  3CQA A;  1G9A A;  4G6J A;  2DRY A;  2Y9X E;  3FUO A;  1RML A;  1TP0 A;  1Q1U A;  3BAH A;  4ISR A;  3WMV A;  4J2Y A;  5FZU A;  3FJC A;  4MZG B;  3A23 A;  3FJK A;  4II0 A;  2KI4 A;  4I6I A;  1NZK A;  3TC2 A;  4GOY A;  2HW9 A;  1WBA A;  1ISW A;  1DIW A;  4G1R A;  1FMZ A;  4DCK C;  3PUB A;  5F8Y A;  2QYI B;  3OBT A;  4G6M A;  4ZOT A;  4IHZ A;  1RG8 A;  4LO3 A;  4IQP A;  3OBR A;  5BXT A;  1S0D A;  1AFC A;  2Z49 A;  3CA0 A;  2YUG A;  1E0O A;  1N4K A;  5D61 A;  1AVU A;  3BX1 C;  3V0B A;  1BAS A;  4X3A A;  2F2F A;  3Q7X A;  3FJF A;  5BXS A;  5DZU A;  2Y9F A;  1V6W A;  1BA7 A;  3N7K A;  2VLC A;  4KEK A;  2D43 A;  4I4Q A;  3UDA A;  2P39 A;  3CRI A;  3N0K A;  3E8L C;  4LO8 B;  1PWA A;  3H6S E;  2NP0 A;  4XKI A;  1ONK B;  3RTI B;  2NM1 A;  2D24 A;  3N7L A;  1ABR B;  2NZ9 A;  1I1B A;  1KNM A;  3AH4 A;  3HSM A;  4JRA A;  3BA5 A;  5FZZ A;  2Q9X A;  2KI6 B;  3BAV A;  1DFC A;  3UJ0 A;  3V0A B;  3R4U A;  2Z48 A;  1BFG A;  3RMX A;  2Y9G A;  1BLA A;  3P6I A;  1HCD A;  4QD2 C;  1BFC A;  1IIL A;  3Q7Y A;  4J23 B;  3EF2 A;  2ET2 A;  3HBW A;  4J2S A;  4KC3 A;  4QBC A;  2RST A;  4USP A;  1XYF A;  2XOA A;  1VCL A;  3H6Q A;  1IJT A;  4I2S A;  3OGG A;  4QKR A;  2Q3N B;  4I4U A;  3FJH A;  5F8S A;  4XFT A;  3N7M A;  3HN1 A;  3ZXG A;  2RQ9 A;  2HWA A;  3JUT A;  1S0F A;  2ZR1 B;  1FV2 A;  4MZF B;  3FJJ A;  2BFH A;  4JKQ A;  4L4I A;  4EB2 B;  5BOW A;  3MAL A;  3BRG C;  3AKI A;  2BEB A;  1IOB A;  3I29 B;  4DEN A;  3QYD A;  3ZC8 A;  1FGA A;  4G9N A;  1Q04 A;  6I1B A;  3NBN A;  4I1B A;  4ZLB B;  4KBB A;  4I4O A;  1HIB A;  4F34 A;  1WD4 A;  4DEP A;  2VSE A;  1K5V A;  1JT4 A;  3S8K A;  3FUQ A;  4IYB A;  2ZQN A;  4JQ0 A;  1HWO B;  4QBV A;  1JT7 A;  3H6R B;  1ILR 1;  2VU9 A;  1FV3 A;  3AJ6 A;  2VXT I;  4I4S A;  4GOV A;  3F62 B;  3F1R A;  3CA6 A;  5JMC A;  4Q9P A;  1A8D A;  2FDB M;  2K43 A;  1XG6 A;  5D63 A;  4LO0 C;  2DS0 A;  1I1E A;  4I4X A;  2NTD A;  1SR4 C;  4LO1 C;  4PC4 A;  3CA4 A;  3OJV A;  4OUJ A;  4XFU A;  3POK A;  1Q03 A;  1AVX B;  5BP5 C;  1FWV A;  2NS2 A;  4HJJ A;  3Q7W A;  4ZGR B;  1WBC A;  1BFB A;  3BA4 A;  4JP0 A;  3BAQ A;  1AXM A;  1TWM A;  3LLP A;  4QC4 A;  3CA5 A;  1FN0 A;  4X39 A;  3WIN C;  3CA1 A;  2I1B A;  1AVA C;  1P63 A;  2NVH A;  1JQZ A;  4ZBV B;  1JTC A;  3BAG A;  3UD9 A;  3VT1 A;  4I1E A;  3AZV A;  2RG9 B;  4FVV A;  3CRG A;  3BAD A;  4QD2 B;  5EHA A;  3ZX7 A;  1HCE A;  5DSS B;  1TOO A;  5EG6 C;  1V6X A;  3NBC A;  3I2A A;  3FFZ A;  3O4C A;  3V0A A;  5G00 A;  1YBI A;  4UY4 A;  3CU1 B;  3VWC A;  2Y9W C;  2E4M C;  3KMV A;  1DQG A;  3IM7 A;  3O5W B;  2P23 A;  3HAL A;  2FGF A;  3AKG A;  1W3G A;  4HR6 C;  4I4R A;  1XZZ A;  4JKX B;  5F8W A;  2IHO A;  3OJ2 A;  4OEF A;  3VEQ A;  2D44 A;  4P0J A;  8I1B A;  21BI A;  4I4V A;  2AQZ A;  5I1B A;  3FJE A;  1TIE A;  1W3A A;  2IWT B;  3BA7 A;  1JT5 A;  4I4P A;  4I37 A;  3W9T A;  2WRY A;  3PG0 A;  4AN6 A;  1QQK A;  3VSZ A;  2FO1 A;  1YTO A;  2D7R A;  4P0L A;  1JLY A;  2ZQO A;  4OW4 A;  4J2X A;  1T9F A;  4LO0 A;  3RMY A;  4Q91 A;  4QO3 A;  2LIQ A;  1PZZ A;  3A21 A;  3CRH A;  1SR4 A;  4LO1 A;  5EC5 A;  2LIE A;  4GP3 A;  4EFP A;  1F31 A;  3A22 A;  1Z0H A;  1UPS A;  7I1B A;  1EYL A;  4D0T A;  3HMY A;  4Z9W B;  4EEE B;  1II4 A;  4HA2 A;  1PUU B;  2AXM A;  2X2S A;  3O44 A;  4WBC A;  3P53 A;  1S0B A;  1IRP A;  1ISV A;  4I4Y A;  3WIN A;  1DZC A;  1AF9 A;  1K5U A;  2GZB A;  3H6R A;  1FMM S;  4OWL A;  3O4D A;  1DFQ A;  4ZFU B;  2AFG A;  4EKX B;  2D1Z A;  1HKN A;  1TFM B;  2D7I A;  4IZX A;  1G9D A;  2VXR A;  1OQL B;  3O4O A;  4A7Z A;  5D62 A;  3AH2 A;  1IHK A;  2D20 A;  1J0S A;  3R4S A;  4X37 A;  4EFR A;  4GAF A;  4END A;  5HPZ A;  1AVW B;  4MZH A;  2QN4 A;  3PHZ A;  4OWJ A;  4ISQ A;  1MD6 A;  3WA1 A;  1Z4S A;  1G9C A;  3V79 C;  2MIB A;  3WO2 A;  1QQL A;  1JT3 A; 
#chains in the Genus database with same CATH homology
 1YF8 B;  1IT0 A;  4IY9 A;  1EVT A;  2DRE A;  4J2K A;  1ISZ A;  3N7J A;  3O4B A;  2ESU A;  1EV2 A;  3FJI A;  4OEE A;  5DUY A;  4I3N A;  4ZFY B;  1BAR A;  1ISX A;  1G82 A;  1JY0 A;  3D7W B;  1DZD A;  4LO7 C;  3A07 A;  1RZO B;  3O4A A;  5BQU C;  3AKH A;  2F8X C;  3SNV A;  3VT0 A;  1GGP B;  1R8N A;  41BI A;  4XFS A;  3VUO A;  2VSA A;  4EFQ A;  4I7I A;  5BXR A;  1BLD A;  1V6U A;  1L2H A;  3ZC9 A;  4I8M A;  1TTU A;  4JAW A;  2UUS A;  1R8O A;  4H9W A;  4LO2 C;  1RY7 A;  3AJ5 A;  1HWN B;  2HWM A;  1DLL A;  3ILA A;  4USO A;  1QXM A;  4JPZ A;  3FJA A;  4TLP A;  2VUA A;  3BAU A;  3FJ9 A;  2MLL B;  4IZE A;  2FFU A;  3AZW A;  4X38 A;  5BXP A;  3WO4 A;  5B2H A;  3K1X A;  3O3Q A;  2X2T A;  1JLX A;  4GP0 A;  1YYN A;  1S0C A;  2WBC A;  3S8J A;  1FWU A;  4GAI A;  4D8H A;  3FJ8 A;  3I2X A;  4Z8S B;  1HWP B;  2HZ9 A;  3AH1 A;  1PUM B;  1Z2V A;  1XHB A;  2AAI B;  1EPW A;  3QR5 A;  3UD7 A;  3BRF A;  9ILB A;  4R6U B;  3O49 A;  1FQ9 A;  3OJM A;  1CE7 B;  5BVP I;  3V0B B;  2GO2 A;  3CA3 A;  4H75 A;  3BTA A;  1SZ6 B;  1DJS B;  5F90 A;  3NJ5 A;  5BP5 A;  3P6J A;  2ERM A;  2D22 A;  4ZKT B;  5E24 E;  1S0G A;  1G9B A;  5GAQ A;  3NBE A;  4D0Z A;  2J3P A;  4L4H A;  2K4A B;  3IM5 A;  3UD8 A;  5BQU A;  3ZXD A;  2R9K B;  3C9Z A;  4A7Y A;  3AKF A;  3MPP G;  3JRR A;  4I96 A;  3BRD A;  3LTQ A;  5DVH A;  5FZY A;  4OWK A;  3VT2 A;  4FGF A;  3WO3 A;  3B9U A;  3CAH A;  1PC8 B;  4IY8 A;  2D23 A;  2KLL A;  4KEJ A;  4QKS A;  4LO3 C;  3UJ4 A;  3IM6 A;  3IIR A;  3VSF A;  2KKI A;  3BAO A;  4G9M A;  4I0Y A;  5FNW A;  4LO2 A;  3BB2 A;  3RSJ A;  2M49 A;  1S0E A;  3FJD A;  1ISY A;  3NBD A;  2E4M A;  4LO7 B;  1HWM B;  1T4Q A;  2F2F C;  3WMU A;  4H04 A;  2BEA A;  1NUN A;  3PME A;  4Q9G A;  5JLV A;  4F83 A;  3RTJ B;  3FGM A;  1S0L A;  4KEI A;  3OGF A;  4CJM A;  4OEG A;  3IAG C;  2K8R A;  31BI A;  4AN7 B;  4P6A A;  1BFF A;  4ZA3 B;  2L5X A;  1CVS A;  1TWE A;  1ITB A;  1WD3 A;  1V6V A;  1W3F A;  2NYY A;  3FJB A;  4ZFW B;  3T8S A;  1D0H A;  1IRA X;  4YOL A;  1YXW A;  1M16 A;  3HOM A;  4ION A;  4A7K A;  2KH2 A;  2MC2 A;  1M2T B;  4QAL A;  1MC9 A;  2DRZ A;  1DQO A;  5FNX A;  2FFV A;  4P0K A;  3CQA A;  1G9A A;  4G6J A;  2DRY A;  2Y9X E;  3FUO A;  1RML A;  1TP0 A;  1Q1U A;  3BAH A;  4ISR A;  3WMV A;  4J2Y A;  5FZU A;  3FJC A;  4MZG B;  3A23 A;  3FJK A;  4II0 A;  2KI4 A;  4I6I A;  1NZK A;  3TC2 A;  4GOY A;  2HW9 A;  1WBA A;  1ISW A;  1DIW A;  4G1R A;  1FMZ A;  4DCK C;  3PUB A;  5F8Y A;  2QYI B;  3OBT A;  4G6M A;  4ZOT A;  4IHZ A;  1RG8 A;  4LO3 A;  4IQP A;  3OBR A;  5BXT A;  1S0D A;  1AFC A;  2Z49 A;  3CA0 A;  2YUG A;  1E0O A;  1N4K A;  5D61 A;  1AVU A;  3BX1 C;  3V0B A;  1BAS A;  4X3A A;  2F2F A;  3Q7X A;  3FJF A;  5BXS A;  5DZU A;  2Y9F A;  1V6W A;  1BA7 A;  3N7K A;  2VLC A;  4KEK A;  2D43 A;  4I4Q A;  3UDA A;  2P39 A;  3CRI A;  3N0K A;  3E8L C;  4LO8 B;  1PWA A;  3H6S E;  2NP0 A;  4XKI A;  1ONK B;  3RTI B;  2NM1 A;  2D24 A;  3N7L A;  1ABR B;  2NZ9 A;  1I1B A;  1KNM A;  3AH4 A;  3HSM A;  4JRA A;  3BA5 A;  5FZZ A;  2Q9X A;  2KI6 B;  3BAV A;  1DFC A;  3UJ0 A;  3V0A B;  3R4U A;  2Z48 A;  1BFG A;  3RMX A;  2Y9G A;  1BLA A;  3P6I A;  1HCD A;  4QD2 C;  1BFC A;  1IIL A;  3Q7Y A;  4J23 B;  3EF2 A;  2ET2 A;  3HBW A;  4J2S A;  4KC3 A;  4QBC A;  2RST A;  4USP A;  1XYF A;  2XOA A;  1VCL A;  3H6Q A;  1IJT A;  4I2S A;  3OGG A;  4QKR A;  2Q3N B;  4I4U A;  3FJH A;  5F8S A;  4XFT A;  3N7M A;  3HN1 A;  3ZXG A;  2RQ9 A;  2HWA A;  3JUT A;  1S0F A;  2ZR1 B;  1FV2 A;  4MZF B;  3FJJ A;  2BFH A;  4JKQ A;  4L4I A;  4EB2 B;  5BOW A;  3MAL A;  3BRG C;  3AKI A;  2BEB A;  1IOB A;  3I29 B;  4DEN A;  3QYD A;  3ZC8 A;  1FGA A;  4G9N A;  1Q04 A;  6I1B A;  3NBN A;  4I1B A;  4ZLB B;  4KBB A;  4I4O A;  1HIB A;  4F34 A;  1WD4 A;  4DEP A;  2VSE A;  1K5V A;  1JT4 A;  3S8K A;  3FUQ A;  4IYB A;  2ZQN A;  4JQ0 A;  1HWO B;  4QBV A;  1JT7 A;  3H6R B;  1ILR 1;  2VU9 A;  1FV3 A;  3AJ6 A;  2VXT I;  4I4S A;  4GOV A;  3F62 B;  3F1R A;  3CA6 A;  5JMC A;  4Q9P A;  1A8D A;  2FDB M;  2K43 A;  1XG6 A;  5D63 A;  4LO0 C;  2DS0 A;  1I1E A;  4I4X A;  2NTD A;  1SR4 C;  4LO1 C;  4PC4 A;  3CA4 A;  3OJV A;  4OUJ A;  4XFU A;  3POK A;  1Q03 A;  1AVX B;  5BP5 C;  1FWV A;  2NS2 A;  4HJJ A;  3Q7W A;  4ZGR B;  1WBC A;  1BFB A;  3BA4 A;  4JP0 A;  3BAQ A;  1AXM A;  1TWM A;  3LLP A;  4QC4 A;  3CA5 A;  1FN0 A;  4X39 A;  3WIN C;  3CA1 A;  2I1B A;  1AVA C;  1P63 A;  2NVH A;  1JQZ A;  4ZBV B;  1JTC A;  3BAG A;  3UD9 A;  3VT1 A;  4I1E A;  3AZV A;  2RG9 B;  4FVV A;  3CRG A;  3BAD A;  4QD2 B;  5EHA A;  3ZX7 A;  1HCE A;  5DSS B;  1TOO A;  5EG6 C;  1V6X A;  3NBC A;  3I2A A;  3FFZ A;  3O4C A;  3V0A A;  5G00 A;  1YBI A;  4UY4 A;  3CU1 B;  3VWC A;  2Y9W C;  2E4M C;  3KMV A;  1DQG A;  3IM7 A;  3O5W B;  2P23 A;  3HAL A;  2FGF A;  3AKG A;  1W3G A;  4HR6 C;  4I4R A;  1XZZ A;  4JKX B;  5F8W A;  2IHO A;  3OJ2 A;  4OEF A;  3VEQ A;  2D44 A;  4P0J A;  8I1B A;  21BI A;  4I4V A;  2AQZ A;  5I1B A;  3FJE A;  1TIE A;  1W3A A;  2IWT B;  3BA7 A;  1JT5 A;  4I4P A;  4I37 A;  3W9T A;  2WRY A;  3PG0 A;  4AN6 A;  1QQK A;  3VSZ A;  2FO1 A;  1YTO A;  2D7R A;  4P0L A;  1JLY A;  2ZQO A;  4OW4 A;  4J2X A;  1T9F A;  4LO0 A;  3RMY A;  4Q91 A;  4QO3 A;  2LIQ A;  1PZZ A;  3A21 A;  3CRH A;  1SR4 A;  4LO1 A;  5EC5 A;  2LIE A;  4GP3 A;  4EFP A;  1F31 A;  3A22 A;  1Z0H A;  1UPS A;  7I1B A;  1EYL A;  4D0T A;  3HMY A;  4Z9W B;  4EEE B;  1II4 A;  4HA2 A;  1PUU B;  2AXM A;  2X2S A;  3O44 A;  4WBC A;  3P53 A;  1S0B A;  1IRP A;  1ISV A;  4I4Y A;  3WIN A;  1DZC A;  1AF9 A;  1K5U A;  2GZB A;  3H6R A;  1FMM S;  4OWL A;  3O4D A;  1DFQ A;  4ZFU B;  2AFG A;  4EKX B;  2D1Z A;  1HKN A;  1TFM B;  2D7I A;  4IZX A;  1G9D A;  2VXR A;  1OQL B;  3O4O A;  4A7Z A;  5D62 A;  3AH2 A;  1IHK A;  2D20 A;  1J0S A;  3R4S A;  4X37 A;  4EFR A;  4GAF A;  4END A;  5HPZ A;  1AVW B;  4MZH A;  2QN4 A;  3PHZ A;  4OWJ A;  4ISQ A;  1MD6 A;  3WA1 A;  1Z4S A;  1G9C A;  3V79 C;  2MIB A;  3WO2 A;  1QQL A;  1JT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...