3CRLC

Crystal structure of the pdhk2-l2 complex.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
86
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 14
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crlC00
1GHKA 3L7ZC 1SMYC 3QIAA 2B8FA 3I73A 1G291 2EJGC 4JBWA 3MFYA 2NN6I 3A7LA 1GUSA 3VR6A 2BE5D 3ND9A 1OXTA 4XTCS 3U9SA 1H9MA 4KN7C 1FYCA 1Y8NB 2A6HC 2NN6G 3H94A 1B9MA 2A68D 1OXVA 3PUWA 2B8GA 2D62A 1TKWB 1DCZA 3RLFA 2A69C 1LABA 2YYZA 3EQLC 4DNTB 3VR4A 1H9JA 4KKSA 2DNEA 3A8IE 3SE0A 5BN4A 3GQBA 1IYVA 1VDZA 5JEAH 1E2ZA 3DXJC 5C0XH 3HGBA 1H9KA 2PNRC 2R6GA 3FPPA 4BA1I 2V4DA 1K8OA 3QG1A 1Q12A 1I6VC 3VA7A 1CI3M 3PUVA 2E74C 1K8MA 3AB9A 4G7OC 4KI0A 3VR2A 2F1MA 3PUXA 3PUZA 1DD2A 4DK0A 4H44C 1BDOA 2O5JC 1H9RA 3NE5B 2E76C 1HQMC 2BE5C 1HPCA 4IFDH 4GZYC 3IFTA 1TU2B 2ZT9C 1GUNA 1E2VA 1IYUA 2L5TA 5BN5A 5KNDA 5K36H 2LMCB 2A68C 3CRKC 1HCZA 3FMCA 2DNCA 4G7ZC 1YNJC 3P20A 3KLRA 4HR7B 3MXUA 4KHZA 1IW7D 2DN8A 2KCCA 4RCNA 1ONLA 1ZKOA 1GHJA 1GUTA 1VF5C 4PV1C 3D31A 3W3AA 2D2CC 2EJFC 2A6ED 2KA7A 3BG3A 3GD7A 3LWUA 4TQUS 3VR5A 5BN3A 4BA2I 1T5EA 1DXMA 1OXUA 4OGQC 4I7ZC 1PMRA 1Y8OB 1E2WA 3A7AB 1Y69U 1GJXA 4DNRB 1Q1BA 1Z6HA 4KKUA 2AUJD 3T53B 1V43A 2EJMA 2BDOA 4H0LC 2D5DA 1GUOA 1O7LA 1VCIA 3ND8A 3QJYA 3T56B 5JEAG 1OXSC 2K7VA 2NN6H 4KMUC 1V8QA 5C0XG 2PPBC 3A8KE 2BA0A 4KKTA 1H9SA 3OPOA 3WDNA 1HTPA 1Y8PB 3I4LA 3N6RA 3A8JE 4L8JA 4LK1C 1IW7C 4TKOB 2EVBA 3LNNA 3M4YA 1GUGA 3VR3A 3PV0A 1A6XA 5KNCA 4DK1A 1YNNC 2CW0C 4G7HC 3PUYA 1FR3A 2A6HD 4IFDG 2A6EC 4XIGS 1Z7TA 1ZYRC 3TZUA 1EWHA 3BDOA 3I72A 5K36G 2EDGA 2IT1A 3M7NA 3OW7A 2A69D 3T51B 2E75C 3CRLC 1CFMA 1CTMA 2JEBI 2AUKA 5A35A 1VF7A 5KNBA 4H13C 2JXMB 2K32A 1LACA 3IKJA 2QF7A 2JE6I 3D4RA 3M85A 2JEAI 2AWOA 2K33A 4KN4C 2BA1A 1Q1EA 4OO1H 3SDZA 4OO1G 2PCFB 2Q8IB 1H9SB 4JK1C 1O78A 1Q90A 1QJOA 1B9NA 4LJZC 4IQZA 3OOCA 2O5IC 1OXXK
chains in the Genus database with same CATH superfamily
4HAEA 5FJ8G 4NP5A 3LGJA 2QKIC 4J6HA 3VR6A 4MN3A 4J1MA 3U4ZA 3V96A 3U9SA 4LF9L 3SK4A 1IBLQ 4YWLA 2PQEA 4JI2L 4AIMA 2D62A 1TWFH 3SK6A 4DNTB 4L63B 2UXCL 1XMOQ 4QL5A 1H9JA 1I4PA 1V1PA 4JI1L 3RZOB 2VQFQ 1IYVA 1RCVD 1XYIA 1S3OA 3DHQA 3HOZB 1ML0D 4BBSH 1WVLA 1UAPA 2V4DA 2HUGA 3VA7A 5JEAJ 2XWJB 1J5EQ 2RSNA 3ULJA 1AH9A 1V9PA 4HSVA 3G6JB 1F9SA 4C1NI 4GLAC 3H91A 1PH7A 1ZEQX 1TY0A 2HHHL 2ZT9C 1GUNA 2L5TA 1I4GA 4K6LA 4G7ZC 4FF3A 4GKKQ 4QIWB 3V05A 2F0PA 3K6OA 1FVIA 2NZHA 3CCVA 1GOZA 3I7FA 4NPSA 4PQXA 1S5DD 1LV9A 3A74A 3U4VA 1U0LA 2KA7A 1X3GA 2K03A 1DXMA 1O7ZA 4DR4Q 1PV4A 2EPBA 2VQEL 1D1IA 1NUCA 2Z6BA 1R4QB 2LKVA 4DV0L 4UAIA 4HEDA 4A93H 2JA7B 3QJYA 4RKBA 5EPKA 4JI5L 2F0QA 1HRJA 4R9WA 1TWGB 1V8QA 2NUCA 4V190 1K3RA 2PZTA 1JE5A 2FXQA 3KOJA 4K5WA 3ONAB 1LTBD 3QOJA 3S17B 3I4NH 1I50B 1ET9A 1XX8A 1EIFA 4CDCC 5GADC 3AU7A 4R4QA 5EGTA 2JXMB 2K32A 3E0EA 5C4JH 1LACA 2QF7A 2CQOA 3VYSA 2F0VA 1EIGA 4OIJA 2N78A 5EQ0A 2AQ1B 2PCFB 1CHQD 2XSCA 3J80L 5M5XH 2E2HB 3ZJYC 2ZJRA 4HJ7A 4B3SL 1N33L 2F4VL 1HHVA 2NN6I 1GUSA 2EY5A 4RGTA 3K8AA 4XXEA 2K5HA 3HRZC 4PZ7A 5ELEA 3CMEA 4R8IA 3E0JA 4LFAL 1Y14B 3HOZG 3NP8A 4ZCKA 1NR4A 4C2MB 2QDBA 1B2TA 4N9PA 4C3IH 3CF5A 5COYA 1IL2A 2IL8A 3HGBA 2HCIA 1VQ5A 4RFBA 4B3TQ 2PZWA 2NYZD 1LT5D 1EFWA 1EQTA 1UE5A 2TMPA 4H44C 2A73B 3TREA 2F0JA 1AZPA 3M4QA 5C3XA 2UXBQ 4FXKC 3IFTA 3AFPA 3TRZA 4IPGA 3OIPA 3PCOB 1X3FA 1SNPA 5JOBA 1JMCA 4OEMB 5AJ3Q 1SFOB 1G51A 4DF7A 1JOOA 2SDFA 3R3OA 2CFMA 1KDBA 4MTNA 2HD3A 3E5SA 1TWAB 1SE3A 5M5WB 3DWPA 4IUPA 1HZCA 3BYYB 3AMUA 1Y8OB 2YTVA 4LF9Q 2JA7G 2JA8B 1TIID 2KHJA 2UXCQ 3F1ZA 4ZYSA 2BDOA 1EY5A 4JBKA 1STEA 2NVTB 2WV6D 3Q24A 3OWEB 1A3TA 2NN6H 1BF4A 2Z6KA 4WJ3M 1A63A 1I3QH 3KFUA 1DZ1A 1QILA 4L8JA 1E0BA 5IYBG 2EVBA 3M4YA 1S5CD 4TSSA 2BDNA 4LF4Q 3CCJA 4DR6L 3F8TA 3PUYA 1W6KA 5IYDG 2B63H 1PRTC 3T51B 4JYAL 2IHEA 2HIVA 2KBNA 1CUKA 1LTTD 1PTOF 4N8X1 2K1BA 1B1ZA 1YHQA 2EY1A 4B3ML 1STAA 3PO2B 3J80E 1UE6A 5EBDA 5ELFA 1BNZA 1F9RA 2A1AA 2EYMA 5KYLA 3TP8A 4JV5L 2F0DA 3UI2A 1JOKA 4IALA 4C56C 3J80i 5IY0A 1VQMA 2FINB 1Y8NB 2XRQD 5IWAQ 3R8BA 2J0TD 3EIVA 3KDFB 2YYZA 1PLFA 2UUCQ 3A8IE 3HOYB 4BXXH 1CKNA 2F0NA 1A2TA 2BH2A 2K5WA 2B2TA 5ELDA 2R6GA 2B29A 3G71A 1PTOD 4K6DA 1ENCA 2GA4B 4ZAIA 1SLJA 5EKIA 5JPNC 4R4IA 5IP9H 3K7AB 3PUXA 3G6EA 1VMCA 1TWCH 4ME5A 1X3EA 1GKHA 1SNCA 1TQOA 3MA2B 4GN4B 4XQNA 3I3CA 3R93A 3NEMA 1AW7A 4KD4A 3A56A 1UE7A 1QWYA 1WI5A 3S9WA 4J8QA 2VUMB 1CZWA 2JA8G 3RMHA 3T13A 1ZYRD 1WTHA 1I5FA 1K0SA 3K5MA 2K14A 1O7YA 1EWCA 1Q86C 2OTLA 1BOSA 3KF8A 3HOXH 4QIWE 4LFCQ 2AUJD 3SVMA 2F0LA 4B9WA 1LM0A 3FP9A 1O7LA 1B70B 4ME3A 4RHRA 1EOVA 5C0XG 1KAAA 1SFOH 5FO8B 3WDNA 1HNXL 2MQHA 2WIIB 4LFBL 2VB2X 2PI2A 1ILPA 2IPKD 4TKOB 1XNQQ 5M5WH 1STHA 2ICIA 3U9OA 3S1QH 3J7A5 2R93H 3BDOA 1L0YB 3H6MA 3M7NA 2UUBQ 4KHPQ 1NNXA 1L1OA 3CKIB 2Q2HA 2NWGA 2AWOA 5JJKA 2FMMA 2NVYH 4JI8Q 3SHLA 1EWIA 1X6OA 3CAMA 1L0XB 2ATWA 4K0KL 1YITA 2Z6KC 3DUZA 2VNUD 5BR8L 4DV2L 4EQPA 2B8FA 3GTQH 1PVOA 2F03A 1F9PA 3H0GB 3TP5A 1N36L 4PZ6A 2D0OA 4XTCS 3HOYG 3KJOA 4FXDA 4DUYL 3H94A 4DR3Q 3JC66 4C3JB 2JQOA 1TKWB 1Y1VB 1DCZA 3J80c 2N49A 3GTLB 2HT1A 3VR4A 2DNEA 2JA9A 4YWMA 4RHSA 2E2DC 5KRUA 4A3GB 3E6ZX 3Q23A 5KEEA 1VQ7A 5C5LA 1I6VC 4ILWA 1K28A 5JJIA 4KI0A 1PFSA 4MIUA 1NMFA 3DWAA 2VUMG 2SEBD 4GZYC 3KLWA 5K36H 3A0JA 3FHWA 3CRKC 4NB3A 1S40A 1EY0A 1YNJC 4X64L 1XPUA 1KHIA 3CCRA 1EEID 1I4QA 1HFNA 1ONLA 2E2JB 3I91A 4DN4M 4Q5VA 4XYOA 4HJ5A 4F8MA 3BG3A 2B2VA 3VR5A 4X62L 3MWYW 1XXGA 2RF4A 5IYCH 2B2TC 5DEHA 5GAEC 4QMGA 3ERSX 1O7IA 4FP5D 4IUNA 3UE1A 4AYBB 1EL0A 1U9RA 4BBRB 4DV1Q 2ZTCA 4CBVA 1XNRL 4DR2Q 2PZUA 4L5TA 3A8KE 3S1MB 2EXDA 5GQOA 4Q0FA 3PO3H 1NSNS 1L0WA 5ELBA 4XQJA 2DY8A 3M3YH 3I2ZA 2XWBB 2KCTA 4RCOA 1A6XA 1N32Q 1YNNC 1CZGA 5IOCA 1MGSA 1EYAA 1K83H 2K5VA 1WJJA 3W1GA 2JYOA 1CTMA 1B7YB 4DFAA 1IBLL 4GS3A 4OHJA 3D4RA 2IX1A 3HOVB 5CV5A 4H02A 3C1FA 3GTGB 1EQQA 3K5NA 3H0GG 4P72A 3PIPA 1Q90A 2VQFL 1RF2D 4CKCA 4IURA 1PYWD 3CPFA 3O13A 1SNOA 1HA6A 4R1JA 1RDPD 1BCPC 2F0HA 3EBEA 3WOEA 4IJLA 1VQHA 3I73A 4DUZQ 4IN3A 2K75A 4C3JG 1PH9A 1Y1VG 5LMUQ 1X9NA 1J5EL 5GAGC 1V1OA 2Z8LA 2WACA 1STBA 4A3GG 2B8GA 3BS1A 1G91A 4OX9Q 2E2IH 1SYGA 2CH4A 4GNXB 1L1OC 4YHHQ 4X3KA 2KENA 4GKKL 3I8ZA 3ICEA 1Q12A 4RG1A 3H0GH 1AZQA 1D2BA 1K8GA 4CDEC 2MUYA 2ICEC 3U58A 5LHY1 1IBMQ 1WTOA 4DR4L 4EQ5A 3TN2A 3TEHB 1UWVA 3GTLH 1U4MA 1E2VA 2UU9Q 2F0WA 3S15B 1PH4A 3DEOA 3MXUA 3OMCA 2JA6H 4IFDJ 4RCNA 3F2UA 1BCPD 2EIFA 1C9OA 1Q8KA 2I0QA 3D31A 4TQUS 4UHVA 4HJ9A 4AYBG 4M8AA 5EBCA 4LF7Q 2E5LQ 3KLSA 3D8GA 4O2DA 4BBRG 3A7AB 4Z9CB 3IRBA 2RA4A 4B9XA 1EYGA 3T53B 4OXPA 5CV8A 5JEAG 3R2IA 2X69A 2UXDQ 3TP7A 1JICA 2RDHA 3RR5A 3BDLA 3KF6B 4WJWA 2NB0A 2ZTDA 1ZXTA 3H15A 1K3BC 3I4LA 4A3LG 2B3GA 1GVPA 2CW0C 4ALPA 5IGDA 4QUFA 3HOVG 4A3FH 2B2VC 5NUCA 3OW7A 3UDGA 2K01A 2JEBI 1BR9A 3KK7A 4FVMA 4KJOA 3C46A 2Q2TA 2WP8J 2B39A 1QOHA 5CBEE 3H3VI 2ASBA 3BZCA 1RTNA 1W2BA 1QG7A 4X3SA 3J7AF 1OXXK 4DAYB 3L7ZC 3UDXA 4TVAB 3KLSX 1CSPA 3A7LA 4B3TL 4B08A 5D65A 1H9MA 1GXDC 1D8LA 4C1NK 3L9AX 2UXBL 4IOCA 5HGTA 4A3IB 1EQRA 4CDDC 4PG3A 3CD6A 3GTOB 1T5XD 2K05A 1FD7D 4LW1A 1Y1WH 1TVXA 2DUDA 2DJFC 4X3UA 3SK8A 1K8OA 5AJ3L 1CI3M 3FRPB 2WINB 2R92G 1BQQT 5DLQE 3FDTA 4LWCA 1DD2A 3NE5B 4POFA 1K73C 1B3AA 2NVQB 1SE2A 2LY7A 1KC8C 1M90C 1HNZQ 2LFNA 2Q8RE 3S2HB 3GP7A 1C8CA 1T9HA 3ULPA 1K9MC 4A3BB 3L0OA 2CWAA 3G7LA 3KLRA 2LS01 1JWSD 1FJGL 4APVA 3S1RH 3M7GA 4LF8Q 1B50A 5C3WA 1VF5C 3I4MH 1VQ8A 4BA2I 5LMNW 2MHVA 1OTCA 1ENAA 2I07B 4DV7Q 1NAPA 1PMRA 3H3VH 4A3MB 2Y0SB 4LF4L 1TS3A 1WOCA 4BY7B 1S4ZA 5FJ8H 2R92H 1SYFA 1EU4A 3W2DA 4OIKA 3S15H 4DV6Q 3PF4A 1CQFA 3M4OB 3OPOA 1F2YA 3I56A 3MHBA 3TZDA 1WCMB 5CYUA 3PF5A 4AYBE 3GTJH 3VR3A 1XMQQ 4UY8C 1JOQA 1PFMA 2J7ZA 2KHIA 1A3UA 1EWHA 3D6CA 3NELA 2RHQB 3L2PA 1X55A 1XWEA 2KCMA 3HG9A 1HZBA 4C3HB 3BVMA 2HIXA 5IWAL 5M5YB 1VMPA 3GTKH 5M3FB 1NCVA 1VS0A 3LWEA 1WFQA 5I2XA 1PH1A 2OQKA 2Q8IB 4KJNA 2UUCL 4K8IA 1YHAA 1BKBA 1HH2P 1U4RA 4NKLA 1MSGA 1GHKA 1WTQA 3V2TA 4IUVA 4UDUC 4A3IG 1IBKQ 4NXMQ 3RZDH 3CW2C 3D4WA 1TY2A 4DXGA 4DK6C 3S14B 1ASYA 3U50C 3EQLC 5IT9c 5GAHC 4P71A 1TWHB 5JAVA 2P5ZX 1EY4A 3HOUB 1G8ZD 3PIOA 2NTSA 1KRSA 4K5XA 4G7OC 4A3DB 3VR2A 1AEXA 2XRSD 4F7XA 4IPDA 2N55A 5LMNQ 1QZGA 4A3BG 2L1BA 4NW2A 4HTHA 3CPWA 2BE5C 4NMZA 1KDAA 4N8FA 4A3IH 4WRDA 1DGSA 1SRUA 1SYDA 4LFCL 4X65Q 2HQLA 1ET6A 3K57A 4DV4Q 2X6LA 3J7AV 1F9QA 4J15A 4A3MG 2Y0SG 3WOFA 1JE4A 1BBUA 4LUVA 4BY7G 2EJFC 1SNQA 1YVCA 2M00A 1HQRD 3EVQA 1XNQL 4IUQA 1GJXA 1CM9A 2MO0A 4BY1B 1CK1A 2NTTA 2IJ0A 1STYA 1VCIA 2KECA 1CQVA 2F0GA 1HXYD 2UUBL 3RZOH 4KHPL 1WCMG 4KMUC 4QJFA 3AFQA 1PH5A 1SROA 3CCSA 2WAQB 1S5FD 3N6RA 3HOZH 2B2WA 3A8JE 2H1EA 4JI8L 2GN5A 3SXHA 2FFKB 2C35B 2QEXA 1LTID 5IGCA 3OTOQ 2MO1A 3JAML 2EY6A 2NVXB 3NTIA 3HOWB 4C3HG 4UP7A 2A6EC 3I4OA 1R9TB 4DAMA 4KY7A 5M3FG 1AN8A 5IGBA 5A35A 4IJHA 1D5XC 4DR3L 4UP9A 2MPMA 1FJGQ 3GTPB 3HKZE 1FNWA 3SDZA 2JJQA 4LF5Q 5FK9C 1B4OA 2PW5A 1I6HB 1B9NA 4CKEA 5IE8A 1AFPA 3GV6A 2L9HA 1A0IA 1Z47A 2Z0SA 5CV4A 1QE6A 2Q2IA 2K28A 3S16B 2A8VA 1C4QA 3E9IA 2SNMA 1BVSA 1B9MA 2JA7H 1OXVA 3HOUG 1XJVA 2YU9B 2RBMA 3TBIB 1TWGH 1PRTF 5E1FA 3TDQA 4A3DG 2VXWA 4Y7NB 1YI2A 4YWKA 5LL6S 4O1NA 4CHTB 3S2DB 1QUQB 3FPPA 2Z4HA 3KBGA 4BA1I 1DOKA 4JG2A 3S17H 3R2TA 5CR3A 5IYBH 1I50H 1J8IA 4GN5A 3Q22A 1P8LA 4AQYQ 3LX0A 2JA5B 4CKBA 3KUPA 3M4PA 4DNIA 5IYDH 2LMCB 2A68C 4WFN3 3HOUH 1V1PB 4HR7B 4DV1L 1PH8A 3RUZA 4DR2L 4JOIA 2E2HH 1G2TA 4JBJA 1NJIC 1ZKOA 4A3DH 3FKIB 4BY1G 1T5EA 2R7ZB 1PRTD 3HFZB 3QOLA 2A19A 2IX3A 1N32L 1V43A 1LTGD 2WAQG 3DM3A 5C0XI 1NBWA 2R61A 4MZ9A 3ER0A 4C2MH 3RN5A 2K4KA 1EU3A 3HOWG 2Y0SE 5C4ZA 4JC0A 1IW7C 2F0FA 5HGQA 4ABNA 1PTOB 3TP6A 3JAME 1MD2D 1PRTB 3D3RA 4MTKA 1EFID 1C7YA 1D5MC 3CP0A 4JPBW 4DUZL 2F3VA 1U4LA 4RKLA 1HTLD 5LMUL 3RNUA 1IZ6A 2ZXOA 3JAMi 2EYJA 5I2YA 1CKOA 4GLXA 1A8VA 2BCOA 1NTGA 4B3RQ 3T1HQ 4A3CG 2XTIA 1JB7A 2OQ0A 2K33A 1Q1EA 1YJNA 1STGA 4DV5Q 4OX9L 1VQBA 1X3QA 3CQZB 4L5RC 1W3SA 3CU7A 4RGMA 2PQAA 1UUPA 4YHHL 1TWAH 4HJ8A 1SMYC 2JA8H 2B2WC 1LTAD 2EJGC 2MGSA 2OEOA 4DU9A 4U673 3GV3A 2AKWB 4HIKA 1KRTA 5D14A 1IBML 2NVTH 3KF6A 1LT4D 2QILA 3PO2G 2YV5A 1LTSD 4QQBX 1E2ZA 2UU9L 1G6PA 4ZK9B 1DOLA 5C0XH 5I6WA 4RMFA 2E8GA 4ZQ3A 1GUWA 3PUVA 3VYRA 2JA5G 4HIOA 5M3MB 2L0CA 1J6QA 2RSOA 4LF7L 2E5LL 1M1KC 3T16A 3OHXC 4GN3B 3QWNA 1HPCA 4JI6Q 1VQ6A 1JWUD 4V0BA 1WTWA 4XYQA 2K04A 2EY2A 4KHZA 2UXDL 1RHPA 3FKIG 1IYJB 3NBHA 4EQOA 3S2DH 3PO2H 4GKJQ 2DN8A 2R7ZG 5A2QE 1VQLA 4P74A 3QR8A 1SYEA 4AH6A 3W3AA 5FO7B 2EYPA 5GROA 3B6YA 2OF1A 2HCCA 2F3WA 4JI3Q 2FMCA 1KNEA 3VYTA 2MFIA 4GOPA 1PA6A 3S1NB 2K50A 5C3EB 4PMWA 3HOYH 5CV7A 2ES2A 4KD3A 3BVGA 4LF6Q 5EKKA 2WKCA 1H9SA 1K0RA 3VA5A 5JJZA 3RN2A 1QZHA 3NBIA 3CXCA 4FNFA 5KNCA 1Q7YC 4JOIC 1KD1C 1KAWA 3K7AH 2AMCB 4IFDG 1M4VA 4HJAA 1Z7TA 5I9PA 3T1YQ 5DM63 1VQFA 1JJCB 2WAQE 3NK9A 2XIWA 1SDFA 5I6YA 2GVBA 4DKAC 1LUZA 2KHSA 1MKHA 2VUMH 3JAMc 1PZJD 4OO1G 1IKMA 4CGYB 4F87A 1O78A 1PTOH 4LJZC 3DLLA 2O5IC 1KLUD 2CHBD 5KYIA 1LT6D 2WKDA 2R7FA 5JVH3 1YEZA 4DR1Q 4KN7C 1FYCA 2A6HC 3GTMB 4ID6A 4PMCA 4O0AA 1Q3LA 3PUWA 3H3VC 1YNJD 1JCKB 2A69C 4JCVE 4MNOA 1HNZL 5KIXA 3QO2A 1K8AC 1UEBA 4OWXB 5M3MG 5DAUA 4JI4Q 2PNRC 5IT9L 3W5OA 1TXYA 5FLXc 2E74C 1EIYB 4LF8L 2K5DA 5FLMG 4A3JB 2F1MA 1XPOA 3J7ZC 2K5QA 3KJPA 4DV7L 1F2ZA 2E76C 1DONA 2KEDA 1YIJA 5ISRA 1BCPF 4X3TA 4IPHA 1TU2B 4OWWB 4A3EB 4KY5A 1NY4A 1SYCA 5C4XB 2O2LD 1CKNB 4PMBA 4DV6L 2FHTA 1EOTA 1GO3E 1Q8IA 3NXWA 4A75A 1D6EC 2EE1A 1YNND 4IO9A 1QVGA 3CCQA 3M9BA 4RH6A 2CVRA 2N8NA 2EXZA 2VW9A 3OSOA 5C5MA 5C3EG 1GD7A 1XMQL 4DNRB 1Q1BA 2F0TA 4RWSC 2QW7A 4C3JH 2EQSA 2K5NA 1Y1VH 2N88A 2D5DA 1TWFB 4IUUA 1KQSA 2BA0A 3J81c 4A3GH 4KKTA 2EYLA 1SNDA 1HTPA 2IWHA 4R8NA 4LMQD 5E3FA 5C44B 4BBSB 3IL8A 2RDFA 3C1EA 4R4CA 3TZUA 4WORA 2ZM6Q 3KF8B 1EY8A 3DMUA 1VQKA 2ZJPA 1TS5A 4JI0Q 1IBKL 4NXML 1CA6A 3EFXD 3UDFA 1JB3A 5J39A 4GOPC 1EZ6A 1BCPB 3SK5A 2E2JH 4IQZA 2RHSB 1TR5A 5F2DA 3STBC 2OCEA 1BBXC 1WYDA 2ID0A 1JT8A 1G291 3HKZB 4JBWA 3MFGA 2MP1A 2HQEA 1U5KA 3NENA 2Z1CA 2JK8A 1H95A 4YY3Q 1STNA 5ELCA 4BBRH 5LMNL 2F0MA 1L1OB 4A93B 1LABA 2NZ1D 2C5CA 3S1MH 3EJIA 1A15A 2R7DA 5JEAH 3BU2A 3NQTA 4A3JG 4X65L 3ITPA 3DEPA 4DV4L 3FVQA 5IT9E 1HR0W 2VB3X 1KNAA 4A3LH 1QVCA 4A3EG 1WD1A 3I4NB 2B2YA 1VQDA 3MAQA 5C4XG 1N34Q 2CCZA 1VQNA 3HOVH 4HN7A 1IYUA 5C4JB 2DNCA 5J1ZA 1X32A 3GTGH 4LUZA 3MZ5A 3E3XA 2EZVA 4E6IA 2FJ2A 4RA8A 1I4XA 1YBYA 2ENBA 2CW0D 2K6AA 4K14A 4OL7A 5IGGA 4RGNA 5M5XB 1JJGA 3P7JA 1WTPA 3D0FA 2TSSA 1E1TA 1OXUA 4OGQC 4I7ZC 3TMEA 1MJCA 3OTOL 4IOAA 3MXGA 2C9OA 3BJUA 4A3EH 2D0PA 4QCLA 1BO0A 1CSQA 2XN9C 1MHWC 2PPBC 5C44G 4BBSG 3HS0C 2QCPX 1QNKA 2WFWA 3A55A 4FF4A 4C3IB 3F2CA 1M8AA 2JN4A 3HZXA 4HMIA 2RVLA 1JJ2A 4LF5L 1X3PA 1FNVA 5HY6A 3PV0A 4UP8A 4CJ2C 1HJPA 2UUAQ 1B3QA 2PO4A 3PSIA 2F0UA 1LYLA 1B8AA 3RLOA 3KDFA 3SGIA 4H13C 3BDCA 1D7QA 3M85A 1KL9A 2PMZB 3J81j 2JEAI 2RCFA 4KN4C 2BA1A 3KBXA 2AWNA 4KTAA 4DR7Q 4JK1C 3HKZG 5C44H 1S72A 1EZ8A 1VQIA 3TQYA 5D3DA 2QDLA 4ZKBB 3EN2A 3OMGA 3QIAA 4JI7L 2JP1A 4KLKA 4YCUA 4P73A 1HR0Q 4N9TA 4A93G 2SOBA 1MSHA 4HSPA 1SMXA 5I4DA 5I9OA 1TS2A 4A3KB 1XPRA 1DM0B 1JR0D 1KIXA 1I4HA 5JPMC 4NXNL 3K0XA 3RD4A 3AYHB 2AQ3B 4AQYL 4KKSA 4CJ0B 1NR2A 4CDFC 1S5ED 1FNUA 1I3QB 5DM73 4G57A 1H9KA 3I4NG 2NBFA 5HURA 1QVFA 2R3ZA 1EEFD 1K8MA 4QB4A 4A76A 4CJ1B 1SR3A 2XVSA 3K81C 4P75A 2B63B 1LLRD 2QA4A 1PYBA 1YJWA 2JSOA 2XNAC 4K2KA 3FMCA 4L5SA 3CC7A 3P20A 5IP7G 4X66Q 4FF2A 4M1UB 1GUTA 5J3BA 4H7BA 2D2CC 3HP3A 1E22A 1I94L 2EYHA 1EY9A 2ALYB 1TT2A 2SNSA 4DAPA 1HNWQ 2KJXA 1N8RC 1UE1A 2AHOB 2OT2A 1EYCA 2B2YC 4C3IG 1OXSC 2K7VA 4HCEA 1E1OA 1N9WA 4B3RL 3BZDB 3GTOH 4QUCA 3GDEA 3T1HL 2RDGA 4QY7A 3OYYA 3CCUA 4DV5L 3BVZA 3LNNA 5IP7H 5IODA 1Q81C 4KHVA 1D5ZC 3PQIA 1PZKD 2OWOA 2I5LX 3EA6A 3C2PA 2NVQH 1PFNA 1TWCB 1WD0A 3G4SA 4FYDA 4ZUIA 4OELB 5CC4A 3S2HH 3L3OC 3Q8DA 1CKMA 2VZAA 3PIO3 4A3BH 2V1CC 1PZID 1JWMD 3IFDA 1SSOA 5G3LF 3RLNA 5EJWA 2NZOA 5ELOA 1X54A 1QJOA 3AEVA 5J22A 1QNUA 3MXNB 1SXTA 4A3KG 3K5LA 1LTLA 4IZ8A 4A3MH 3BYTB 2BE5D 4BY7H 3HOXB 2NN6G 2XGTA 1JQYD 1BUVT 4OWTB 3M4OH 2PI2E 4IPCA 1B53A 2LXKA 1BXTA 3QB3A 3SE0A 4JI6L 4ZLTF 1HFGA 4KK7A 3UDIA 2KQ3A 3DXJC 4DR5Q 1WCMH 4U68A 1U4PA 4GKJL 5C4HA 3F2DA 3MTSA 2B63G 2KCNA 3S1QB 2R93B 5G3LD 2KOLA 4JI2Q 4A3KH 1BDOA 2ZXRA 4LNQA 1HQMC 3P75A 4JI3L 4C3HH 1HUNA 4JI1Q 5FLXL 1SBBB 5M5YH 4DA2A 5M3FH 5LL6X 1HCZA 2KEEA 2QEJC 5TSSA 1VQEA 1HZ9A 2NVYB 2AQ2B 4DPGA 1IKLA 1PHJA 4LF6L 4JI7Q 1GHJA 2VL6A 2A6ED 2DJGC 3GTQB 1PTOC 3W1BA 2HHHQ 1RIPA 1E3PA 5DNFA 4NXNQ 4BXXG 4DK3C 3S14H 4QF4A 3ND8A 3T1YL 2G9HD 1EIHA 1S5BD 4FO2A 4YCWA 1TWHH 3HEJA 5FOBB 3OW2A 3F2BA 3K0YA 1EYDA 1SJHD 1Y8PB 3IAYA 5IP9G 4LAAA 5A2QL 1FL0A 1CT1D 2CQAA 2VQEQ 3J81L 1BBWA 3TS0A 4K5VA 4DV0Q 3A5UA 5KGUA 4XIGS 1ZYRC 2F0KA 4G4KA 1NE3A 4JI5Q 3N52A 3ULLA 3K80C 5IGEA 1VQPA 2OXPA 4DR1L 2CKZB 2L15A 5EKLA 3D6WA 2F0SA 3S24A 5K5PA 4GNXA 4FF1A 2LSSA 1X65A 3BZKA 2H4OA 3NUCA 1JORA 2D9UA 4PZ8A 4L6TB 1GM5A 1I94Q 1QCBD 4ZKCB 2ZTEA 5CV9A 1XTCD 3HOXG 1O80A 5C6AA 3PGZA 3CCLA 4JI4L 4WJ4A 2L12A 3X3MA 3MFYA 2HDMA 2PMZE 3CCEA 2L11A 1PFBA 1PYSB 1Q82C 4BY1H 1J9OA 2A68D 3ZYYX 1VQ4A 3RLFA 2L55A 4DAVA 5AFWA 5FKAC 5E4WC 1A2UA 3CCMA 5BN4A 1UEAB 1F77A 3GQBA 3H09A 4JBMA 1VDZA 5EAYA 3VDYA 2R93G 1MI2A 4B3SQ 3T4AC 3OIQA 1N33Q 3PO3B 3I90A 2F4VQ 3K7UC 2LXJA 2NVXH 3M3YB 2CH4W 2F0IA 3HOWH 2WB1B 4HIMA 1R9TH 2RQXA 1II3A 4DK0A 1NMGA 4LFAQ 1MIUA 4YCVA 1K83B 5CMDA 4EX5A 5FLXE 5E4XA 5BN5A 1VQOA 3GTPH 5M9OA 1IW7D 3A54A 1C0AA 1HUMA 5D3IB 3NQIA 1I6HH 2H5XA 4A3CH 4ODGA 1DYQA 4PV1C 2K52A 3GD7A 1LTRD 3G48A 2Z4IA 1E2WA 3NTHA 3MEHA 4K2LA 3S16H 1D1KA 4K8JA 4FDBA 3GO5A 4KKUA 4P2CB 3DM1A 2YU9H 2EJMA 2J4XA 2L4NA 2VY3A 4H0LC 3T56B 4EVOA 2ZM6L 2I5MX 2Z9HA 4JI0L 3TSSA 2F52A 2IX0A 2E2IB 4Y7NH 4POGA 1KLGD 2PW7A 1MBYA 1SMYD 4LK1C 4O42A 1ILQA 1Z9FA 4DAYA 4IFDI 1E24A 3J81E 4DK1A 2IW3A 4RAUC 5T1GA 3AQQA 3I72A 5K36G 2EDGA 4LUOA 2JA5H 3CRLC 3C3LA 1CFMA 1PDQA 1Q46A 1F2LA 1VF7A 5KNBA 3J81i 1CA5A 1SE4A 2RCNA 4YY3L 4OO1I 2QGQA 4R4OA 4DV3L 2IHFA 1XTDA 1RL2A 2JA6B 3VYUA 3FPUB 3PMFA 5IYCG 1SN8A 4DR6Q 1VQ9A 3FKIH 3NHHA 2R7ZH 1EY7A 4ZUJA 4JYAQ 1UNSA 3ND9A 4IUTA 1VQGA 1E7ZA 2MJ8A 3URYA 1AE2A 4B3MQ 3K5OA 2YTXA 3PO3G 1N34L 5JJLA 2Q8TA 1VQCA 2M2LA 1PH3A 3CC2A 1R4PB 2G9DA 2WB1G 1RODA 2F0EA 5IGFA 1PH2A 3CMAA 1YHBA 4GNXC 4JV5Q 2F4IA 5EPLA 3QG1A 1IXRA 4FXGC 4NDXA 1FGBD 3MEFA 4X6AH 3PUZA 5C0XJ 1P16A 2PYKA 2B2UA 4A3FB 5CBAE 4IFDH 1ESRA 4I65A 1JC7A 1V1QA 5KNDA 4HIDA 2G5DA 1RTOA 2DGYA 2HDLA 1A62A 3CQZH 4F88A 2KCCA 5FO9B 1F2MA 4I7AA 4XT3B 3J7YW 5CV6A 1HA5A 1ASZA 4OO1H 3LWUA 3E9HA 2A74C 4R4TA 2EYOA 1ICWA 1ESFA 1Y69U 3NWSA 4PNYA 3MXPA 3NPPA 4HMJA 1PH6A 2UUAL 3I70A 1RD9D 2EYFA 2F3IA 1XMOL 2Q2UA 3EROA 5JVG3 1FGUA 1C48A 3CC4A 1RKNA 1Y1WB 1AE3A 4DR7L 2N3SA 1HZAA 3SEBA 1TS4A 3HKSA 5M3MH 2A6HD 5CORA 2VS1A 5T1IA 1W6JA 5H1SE 3UE0A 2DY7A 2IT1A 1HR0L 2A69D 2I46A 2E75C 2ZXPA 5FLMH 1KDCA 2AUKA 1SYBA 2JA6G 1OO9B 3Q6SA 4OONA 4XT1B 2JE6I 2BH8A 3PIP3 1HNXQ 4Y52H 3NSWA 4LFBQ 4JVZA 2EOTA 1WTRA 1LT3D 1EQVA 3S1RB 1G6ZA 1YNXA 3I4MB 5CGKA 4DGZA 1VQAA 3NWTA 5IIFA 4XDXA 1WTXA 1KTKA 1OXTA 1DJRD 5E7NA 3MVVA 3S1NH 5C3EH 2R92B 1EUJA 1YJ9A 4KY6A 3A5ZB 3K59A 3D4DA 1LO5D 5ELNA 3K58A 4K0KQ 4L5QA 5BR8Q 4DV2Q 4X66L 2RKSA 2PQAB 1N36Q 5L37A 4A3FG 2CWPA 3AB9A 3GTJB 1B44D 4ZRZA 2KUMA 4DUYQ 4MHEA 2M9VA 2O5JC 1H9RA 1SJED 1YZ6A 1DOMA 2A5HA 3DWQA 3OWFA 2I5HA 2IY5B 1HNWL 1SNMA 4DV3Q 2F0OA 1X56A 4XQQA 1MJEA 4YIJA 1IL8A 1IHZA 3GTKB 4JW0A 4HCSA 4BWGB 2WB1E 3MC0B 1AP0A 1QB5D 3MXNA 1SE8A 1WTVA 1KABA 3ERQA 1ICFB 2O4XA 5BN3A 2ZJQA 1L2FA 4S3SA 3X3NA 2X6GA 3Q0AA 2GVAA 2YTYA 2PNHA 1I4RA 3GTMH 1Z6HA 1ENFA 1G2SA 3RZDB 5EPJA 2MNAA 4X64Q 1GUOA 3NTKA 1KXLA 2OTJA 1Y1WG 2B2UC 4ULLA 1RJTA 4A4IA 3STBD 3NBHB 3FEWX 4X62Q 3KYHC 3CHBD 3P1HA 1GUGA 4A3JH 4GLVB 1VQJA 4G7HC 4DXFA 1FR3A 3TS2A 4TRDA 1SAPA 4RGOS 1XNRQ 4EQNA 1A3VA 1CHPD 4GOPB 3I55A 3IKJA 4EGVA 4KV6A 5C4XH 2KVMA 4UPAA 3I4MG 3SR1A 1PXUA 1SEBD 1H9SB 3WWVA 1QUQA 4BS9A 2BOSA 4QGUA 3OOCA 1EY6A 4DR5L
chains in the Genus database with same CATH topology
4HAEA 4NP5A 2QKIC 4J6HA 3VR6A 4MN3A 4J1MA 3V96A 3U9SA 3SK4A 2PQEA 2D62A 3SK6A 4DNTB 4L63B 1H9JA 1I4PA 1V1PA 3RZOB 1IYVA 1RCVD 1XYIA 3DHQA 3HOZB 1ML0D 1WVLA 1UAPA 2V4DA 2HUGA 3VA7A 5JEAJ 2XWJB 2RSNA 4HSVA 3G6JB 1F9SA 4C1NI 3H91A 1ZEQX 1TY0A 2ZT9C 1GUNA 2L5TA 1I4GA 4K6LA 4G7ZC 4FF3A 4QIWB 3V05A 2F0PA 3K6OA 1GOZA 4PQXA 1S5DD 1LV9A 2KA7A 2K03A 1DXMA 1O7ZA 2EPBA 1D1IA 1NUCA 1R4QB 2LKVA 4UAIA 4HEDA 2JA7B 3QJYA 4RKBA 5EPKA 1HRJA 2F0QA 4R9WA 1TWGB 1V8QA 2NUCA 4V190 2PZTA 4K5WA 3ONAB 1LTBD 3QOJA 3S17B 1I50B 1ET9A 1XX8A 3AU7A 5EGTA 2JXMB 2K32A 1LACA 2QF7A 3VYSA 2F0VA 1EIGA 4OIJA 5EQ0A 2AQ1B 2PCFB 1CHQD 2XSCA 3J80L 2E2HB 1HHVA 2NN6I 1GUSA 2EY5A 4RGTA 4XXEA 3HRZC 5ELEA 4R8IA 3E0JA 3NP8A 1NR4A 4C2MB 2QDBA 1B2TA 4N9PA 5COYA 2IL8A 3HGBA 2HCIA 4RFBA 2PZWA 2NYZD 1LT5D 1EQTA 2TMPA 4H44C 2A73B 2F0JA 1AZPA 5C3XA 4FXKC 3IFTA 3OIPA 1SNPA 5JOBA 1SFOB 4DF7A 1JOOA 2SDFA 3R3OA 1KDBA 5M5WB 3E5SA 1TWAB 1SE3A 3DWPA 4IUPA 3BYYB 3AMUA 1Y8OB 2JA8B 1TIID 4ZYSA 2BDOA 1EY5A 1STEA 2NVTB 2WV6D 3Q24A 3OWEB 1A3TA 2NN6H 1BF4A 1DZ1A 1QILA 4L8JA 1E0BA 2EVBA 3M4YA 1S5CD 4TSSA 2BDNA 3PUYA 1W6KA 1PRTC 3T51B 1LTTD 1PTOF 2K1BA 1B1ZA 2EY1A 1STAA 3PO2B 3J80E 5EBDA 5ELFA 1BNZA 1F9RA 2EYMA 5KYLA 3TP8A 2F0DA 3UI2A 1JOKA 4IALA 4C56C 2FINB 1Y8NB 2XRQD 3R8BA 2J0TD 2YYZA 1PLFA 3A8IE 3HOYB 2F0NA 1A2TA 2K5WA 2B2TA 5ELDA 2R6GA 1PTOD 4K6DA 1ENCA 2GA4B 4ZAIA 5JPNC 5EKIA 3K7AB 3PUXA 1VMCA 4ME5A 1SNCA 1TQOA 3MA2B 4XQNA 3I3CA 3R93A 1AW7A 4KD4A 3A56A 2VUMB 1QWYA 3S9WA 4J8QA 1CZWA 3RMHA 3T13A 1ZYRD 3K5MA 1O7YA 1EWCA 1BOSA 3KF8A 2AUJD 3SVMA 2F0LA 4B9WA 1O7LA 4RHRA 5C0XG 1KAAA 5FO8B 3WDNA 2WIIB 2VB2X 1ILPA 2IPKD 4TKOB 1STHA 2ICIA 3U9OA 3BDOA 1L0YB 3H6MA 3M7NA 3CKIB 2NWGA 2AWOA 2FMMA 3SHLA 1L0XB 3DUZA 2VNUD 4EQPA 2B8FA 2F03A 1F9PA 3H0GB 3TP5A 4XTCS 4FXDA 3H94A 4C3JB 1TKWB 1Y1VB 1DCZA 3GTLB 3VR4A 2DNEA 4RHSA 2E2DC 5KRUA 4A3GB 3E6ZX 3Q23A 5KEEA 5C5LA 1I6VC 4ILWA 4KI0A 4MIUA 3DWAA 2SEBD 4GZYC 5K36H 3CRKC 1EY0A 1YNJC 1EEID 1I4QA 1HFNA 1ONLA 2E2JB 3I91A 4DN4M 4Q5VA 4XYOA 4F8MA 3BG3A 2B2VA 3VR5A 3MWYW 1XXGA 2B2TC 5DEHA 4QMGA 4IUNA 4FP5D 4AYBB 1EL0A 1U9RA 4BBRB 4CBVA 2PZUA 3A8KE 3S1MB 4Q0FA 1NSNS 5ELBA 4XQJA 2DY8A 2XWBB 4RCOA 1A6XA 1YNNC 1CZGA 5IOCA 1MGSA 1EYAA 2JYOA 1CTMA 4DFAA 4OHJA 3D4RA 2IX1A 3HOVB 5CV5A 3C1FA 3GTGB 3K5NA 1Q90A 1RF2D 4CKCA 4IURA 1PYWD 3O13A 1SNOA 1HA6A 1RDPD 1BCPC 2F0HA 3WOEA 3I73A 4IN3A 4C3JG 1V1OA 2Z8LA 2WACA 1STBA 2B8GA 3BS1A 1G91A 1SYGA 4X3KA 3I8ZA 1Q12A 1AZQA 1D2BA 2MUYA 2ICEC 5LHY1 1WTOA 3TN2A 1U4MA 1E2VA 2F0WA 3S15B 3DEOA 3MXUA 3OMCA 4IFDJ 4RCNA 3F2UA 1BCPD 3D31A 4TQUS 4M8AA 5EBCA 3KLSA 3D8GA 3A7AB 4Z9CB 2RA4A 4B9XA 3T53B 5CV8A 5JEAG 3R2IA 2X69A 3TP7A 1JICA 2RDHA 3BDLA 4WJWA 2NB0A 1ZXTA 3I4LA 2CW0C 5IGDA 4QUFA 2B2VC 5NUCA 3OW7A 2K01A 2JEBI 1BR9A 3KK7A 4FVMA 4KJOA 3C46A 2WP8J 2B39A 1QOHA 5CBEE 1RTNA 1QG7A 4X3SA 3J7AF 1OXXK 3L7ZC 3KLSX 3A7LA 4B08A 5D65A 1H9MA 1GXDC 4C1NK 3L9AX 5HGTA 4A3IB 3GTOB 1T5XD 2K05A 1FD7D 1TVXA 4X3UA 3SK8A 1K8OA 1CI3M 3FRPB 2WINB 1BQQT 3FDTA 1DD2A 3NE5B 1B3AA 2NVQB 1SE2A 2LY7A 2LFNA 2Q8RE 3S2HB 3GP7A 1C8CA 4A3BB 3G7LA 3KLRA 2LS01 1JWSD 3M7GA 1B50A 5C3WA 1VF5C 4BA2I 2MHVA 1ENAA 2I07B 1NAPA 1PMRA 4A3MB 2Y0SB 1TS3A 4BY7B 1S4ZA 1SYFA 1EU4A 3W2DA 4OIKA 1CQFA 3M4OB 3OPOA 1F2YA 3MHBA 3TZDA 1WCMB 5CYUA 3VR3A 1JOQA 1PFMA 2J7ZA 1A3UA 1EWHA 3D6CA 3HG9A 1XWEA 4C3HB 3BVMA 5M5YB 1VMPA 5M3FB 1NCVA 3LWEA 5I2XA 2Q8IB 4KJNA 4K8IA 1U4RA 4NKLA 1MSGA 1GHKA 1WTQA 3V2TA 4IUVA 4UDUC 3D4WA 1TY2A 4DXGA 3S14B 3EQLC 1TWHB 5JAVA 1EY4A 3HOUB 1G8ZD 2NTSA 4K5XA 4G7OC 4A3DB 3VR2A 1AEXA 2XRSD 4F7XA 2N55A 2L1BA 4NW2A 4HTHA 2BE5C 4NMZA 1KDAA 4WRDA 1SYDA 1ET6A 3K57A 2X6LA 3J7AV 1F9QA 3WOFA 1JE4A 2EJFC 1SNQA 2M00A 1HQRD 3EVQA 4IUQA 1GJXA 1CM9A 4BY1B 1CK1A 2NTTA 2IJ0A 1STYA 1VCIA 2KECA 1CQVA 2F0GA 1HXYD 4KMUC 2WAQB 1S5FD 3N6RA 2B2WA 3A8JE 2H1EA 3SXHA 2FFKB 1LTID 5IGCA 3JAML 2EY6A 2NVXB 3NTIA 3HOWB 4C3HG 2A6EC 1R9TB 4KY7A 1AN8A 5IGBA 5A35A 1D5XC 2MPMA 3GTPB 3SDZA 1FNWA 5FK9C 1B4OA 2PW5A 1I6HB 1B9NA 4CKEA 1AFPA 3GV6A 2L9HA 1Z47A 5CV4A 1QE6A 2K28A 3S16B 1C4QA 2SNMA 1B9MA 1OXVA 2YU9B 2RBMA 3TBIB 1PRTF 5E1FA 3TDQA 2VXWA 4Y7NB 5LL6S 4O1NA 4CHTB 3S2DB 3FPPA 2Z4HA 3KBGA 4BA1I 1DOKA 3R2TA 5CR3A 1J8IA 3Q22A 3LX0A 2JA5B 4CKBA 3KUPA 2LMCB 2A68C 4WFN3 1V1PB 4HR7B 3RUZA 1G2TA 1ZKOA 3FKIB 1T5EA 2R7ZB 1PRTD 3QOLA 2IX3A 1V43A 1LTGD 5C0XI 2R61A 1EU3A 5C4ZA 1IW7C 2F0FA 4ABNA 1PTOB 3TP6A 3JAME 1MD2D 1PRTB 3D3RA 1EFID 1D5MC 2F3VA 1U4LA 4RKLA 1HTLD 2ZXOA 2EYJA 5I2YA 2BCOA 2K33A 1Q1EA 1STGA 1X3QA 3CQZB 3CU7A 4RGMA 1UUPA 1SMYC 2B2WC 1LTAD 2EJGC 2MGSA 2OEOA 4DU9A 4U673 3GV3A 5D14A 1LT4D 2QILA 1LTSD 1E2ZA 4ZK9B 1DOLA 5C0XH 5I6WA 4ZQ3A 1GUWA 3PUVA 3VYRA 5M3MB 2L0CA 2RSOA 3T16A 3OHXC 3QWNA 1HPCA 1JWUD 4V0BA 1WTWA 4XYQA 2K04A 2EY2A 4KHZA 1RHPA 3NBHA 4EQOA 2DN8A 5A2QE 1SYEA 3W3AA 5FO7B 2EYPA 2OF1A 2HCCA 2F3WA 2FMCA 1KNEA 3VYTA 3S1NB 5C3EB 4PMWA 5CV7A 4KD3A 3BVGA 5EKKA 2WKCA 1H9SA 3VA5A 5JJZA 3NBIA 4FNFA 5KNCA 4IFDG 1M4VA 1Z7TA 5I9PA 5DM63 3NK9A 2XIWA 1SDFA 5I6YA 2KHSA 1PZJD 4OO1G 1IKMA 4CGYB 4F87A 1O78A 1PTOH 4LJZC 2O5IC 1KLUD 2CHBD 5KYIA 1LT6D 2WKDA 5JVH3 4KN7C 1FYCA 2A6HC 3GTMB 4ID6A 4PMCA 1Q3LA 3PUWA 3H3VC 1YNJD 1JCKB 2A69C 5KIXA 3QO2A 5DAUA 2PNRC 5IT9L 2E74C 2K5DA 4A3JB 2F1MA 2K5QA 1F2ZA 2E76C 1DONA 2KEDA 5ISRA 1BCPF 4X3TA 1TU2B 4A3EB 4KY5A 1SYCA 5C4XB 2O2LD 4PMBA 2FHTA 1EOTA 1Q8IA 3NXWA 1D6EC 2EE1A 1YNND 4RH6A 2CVRA 2EXZA 3OSOA 5C5MA 4DNRB 1Q1BA 2F0TA 4RWSC 2N88A 2D5DA 1TWFB 4IUUA 2BA0A 4KKTA 2EYLA 1SNDA 1HTPA 2IWHA 4R8NA 4LMQD 5E3FA 5C44B 4BBSB 3IL8A 2RDFA 3C1EA 3TZUA 4WORA 1EY8A 3DMUA 1TS5A 1CA6A 3EFXD 1JB3A 5J39A 1EZ6A 1BCPB 3SK5A 4IQZA 1TR5A 5F2DA 1BBXC 2ID0A 1G291 3HKZB 4JBWA 3MFGA 2MP1A 2HQEA 2Z1CA 1STNA 5ELCA 2F0MA 4A93B 1LABA 2NZ1D 2C5CA 3EJIA 1A15A 5JEAH 3NQTA 3ITPA 3DEPA 3FVQA 5IT9E 2VB3X 1KNAA 1WD1A 3I4NB 2B2YA 3MAQA 4HN7A 1IYUA 5C4JB 2DNCA 5J1ZA 1X32A 3MZ5A 2EZVA 4E6IA 2FJ2A 4RA8A 1I4XA 2ENBA 2K6AA 2CW0D 4K14A 4OL7A 5M5XB 5IGGA 4RGNA 3P7JA 1WTPA 2TSSA 1OXUA 4OGQC 4I7ZC 3TMEA 3MXGA 2C9OA 4QCLA 1BO0A 2XN9C 2PPBC 3HS0C 2QCPX 1QNKA 3A55A 4FF4A 4C3IB 1M8AA 3HZXA 4HMIA 2RVLA 1X3PA 1FNVA 3PV0A 4CJ2C 2PO4A 2F0UA 4H13C 3BDCA 3M85A 2PMZB 2JEAI 4KN4C 2BA1A 3KBXA 2AWNA 4KTAA 4JK1C 1EZ8A 4ZKBB 5D3DA 3OMGA 3QIAA 2JP1A 4N9TA 2SOBA 1MSHA 4HSPA 5I4DA 5I9OA 1TS2A 4A3KB 1DM0B 1JR0D 1I4HA 5JPMC 3RD4A 2AQ3B 4KKSA 4CJ0B 1NR2A 1S5ED 1FNUA 1I3QB 5DM73 4G57A 1H9KA 2NBFA 5HURA 2R3ZA 1EEFD 1K8MA 4QB4A 4CJ1B 2XVSA 2B63B 1LLRD 2JSOA 2XNAC 4K2KA 3FMCA 3P20A 4FF2A 4M1UB 1GUTA 4H7BA 2D2CC 3HP3A 2EYHA 1EY9A 1TT2A 2SNSA 4DAPA 2KJXA 2OT2A 1EYCA 2B2YC 4C3IG 1OXSC 2K7VA 4HCEA 3BZDB 4QUCA 2RDGA 3BVZA 3LNNA 5IODA 4KHVA 1D5ZC 1PZKD 3EA6A 3C2PA 1PFNA 1TWCB 1WD0A 4FYDA 4ZUIA 5CC4A 3L3OC 3PIO3 1PZID 1JWMD 3IFDA 1SSOA 5G3LF 5EJWA 1QJOA 5J22A 1QNUA 1SXTA 3K5LA 4IZ8A 3BYTB 2BE5D 3HOXB 2NN6G 1JQYD 1BUVT 1B53A 1BXTA 3QB3A 3SE0A 4ZLTF 1HFGA 4KK7A 2KQ3A 3DXJC 4U68A 1U4PA 5C4HA 3MTSA 2KCNA 3S1QB 2R93B 5G3LD 2KOLA 1BDOA 2ZXRA 1HQMC 3P75A 1HUNA 5FLXL 1SBBB 4DA2A 5LL6X 1HCZA 2KEEA 2QEJC 5TSSA 2NVYB 2AQ2B 1IKLA 1GHJA 2A6ED 3GTQB 1PTOC 5DNFA 4QF4A 3ND8A 2G9HD 1EIHA 1S5BD 4FO2A 3HEJA 5FOBB 3K0YA 1EYDA 1SJHD 1Y8PB 3IAYA 4LAAA 5A2QL 1CT1D 2CQAA 3J81L 4K5VA 5KGUA 4XIGS 1ZYRC 2F0KA 4G4KA 3N52A 5IGEA 2OXPA 5EKLA 3D6WA 2F0SA 5K5PA 4FF1A 2H4OA 3NUCA 1JORA 2D9UA 4L6TB 1QCBD 4ZKCB 5CV9A 1XTCD 1O80A 5C6AA 2L12A 3X3MA 3MFYA 2HDMA 2L11A 1PFBA 1J9OA 2A68D 3ZYYX 3RLFA 2L55A 4DAVA 5AFWA 5FKAC 5E4WC 1A2UA 5BN4A 1UEAB 1F77A 3GQBA 3H09A 1VDZA 1MI2A 3T4AC 3OIQA 3PO3B 3I90A 3M3YB 2F0IA 2WB1B 2RQXA 1II3A 4DK0A 1K83B 5CMDA 5FLXE 5E4XA 5BN5A 5M9OA 1IW7D 3A54A 1HUMA 5D3IB 3NQIA 4ODGA 1DYQA 4PV1C 3GD7A 1LTRD 2Z4IA 1E2WA 3NTHA 3MEHA 4K2LA 1D1KA 4K8JA 3GO5A 4KKUA 4P2CB 3DM1A 2EJMA 2J4XA 2L4NA 4H0LC 3T56B 4EVOA 3TSSA 2IX0A 2E2IB 1KLGD 2PW7A 1MBYA 1SMYD 4LK1C 4O42A 1ILQA 4DAYA 4IFDI 3J81E 4DK1A 2IW3A 4RAUC 5T1GA 3I72A 5K36G 2EDGA 3CRLC 3C3LA 1CFMA 1PDQA 1F2LA 1VF7A 5KNBA 1CA5A 1SE4A 4OO1I 2JA6B 3VYUA 3FPUB 3PMFA 3NHHA 1EY7A 4ZUJA 1UNSA 3ND9A 4IUTA 2MJ8A 3URYA 3K5OA 2Q8TA 2M2LA 1R4PB 2G9DA 1RODA 2F0EA 5IGFA 2F4IA 5EPLA 3QG1A 4FXGC 4NDXA 1FGBD 3PUZA 5C0XJ 2PYKA 2B2UA 4A3FB 5CBAE 4IFDH 1ESRA 4I65A 1JC7A 5KNDA 1RTOA 2HDLA 4F88A 2KCCA 5FO9B 1F2MA 4XT3B 3J7YW 5CV6A 1HA5A 4OO1H 3LWUA 2A74C 2EYOA 1ICWA 1ESFA 1Y69U 3NWSA 4PNYA 3MXPA 3NPPA 4HMJA 3I70A 1RD9D 2EYFA 3EROA 5JVG3 1C48A 1RKNA 1Y1WB 3SEBA 1TS4A 2A6HD 5CORA 5T1IA 1W6JA 2DY7A 2IT1A 2A69D 2I46A 2E75C 2ZXPA 1KDCA 2AUKA 1SYBA 1OO9B 3Q6SA 4XT1B 2JE6I 3PIP3 3NSWA 2EOTA 1WTRA 1LT3D 1EQVA 3S1RB 1G6ZA 3I4MB 5CGKA 4DGZA 3NWTA 5IIFA 4XDXA 1WTXA 1KTKA 1OXTA 1DJRD 3MVVA 2R92B 4KY6A 3K59A 3D4DA 1LO5D 3K58A 2RKSA 3AB9A 3GTJB 1B44D 4ZRZA 2KUMA 4MHEA 2M9VA 2O5JC 1H9RA 1SJED 3DWQA 1DOMA 2A5HA 3OWFA 1SNMA 2F0OA 4XQQA 4YIJA 1IL8A 1IHZA 3GTKB 4HCSA 4BWGB 3MC0B 1AP0A 1QB5D 3MXNA 1WTVA 1KABA 3ERQA 2O4XA 5BN3A 4S3SA 3X3NA 2X6GA 3Q0AA 1I4RA 1Z6HA 1ENFA 1G2SA 3RZDB 5EPJA 1GUOA 3NTKA 2B2UC 4ULLA 1RJTA 3FEWX 3CHBD 3P1HA 1GUGA 4G7HC 4DXFA 1FR3A 4TRDA 1SAPA 4RGOS 4EQNA 1A3VA 1CHPD 3IKJA 4EGVA 4KV6A 2KVMA 3SR1A 1PXUA 1SEBD 1H9SB 4BS9A 2BOSA 3OOCA 1EY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHK A;  3L7Z C;  1SMY C;  3QIA A;  2B8F A;  3I73 A;  1G29 1;  2EJG C;  4JBW A;  3MFY A;  2NN6 I;  3A7L A;  1GUS A;  3VR6 A;  2BE5 D;  3ND9 A;  1OXT A;  4XTC S;  3U9S A;  1H9M A;  4KN7 C;  1FYC A;  1Y8N B;  2A6H C;  2NN6 G;  3H94 A;  1B9M A;  2A68 D;  1OXV A;  3PUW A;  2B8G A;  2D62 A;  1TKW B;  1DCZ A;  3RLF A;  2A69 C;  1LAB A;  2YYZ A;  3EQL C;  4DNT B;  3VR4 A;  1H9J A;  4KKS A;  2DNE A;  3A8I E;  3SE0 A;  5BN4 A;  3GQB A;  1IYV A;  1VDZ A;  5JEA H;  1E2Z A;  3DXJ C;  5C0X H;  3HGB A;  1H9K A;  2PNR C;  2R6G A;  3FPP A;  4BA1 I;  2V4D A;  1K8O A;  3QG1 A;  1Q12 A;  1I6V C;  3VA7 A;  1CI3 M;  3PUV A;  2E74 C;  1K8M A;  3AB9 A;  4G7O C;  4KI0 A;  3VR2 A;  2F1M A;  3PUX A;  3PUZ A;  1DD2 A;  4DK0 A;  4H44 C;  1BDO A;  2O5J C;  1H9R A;  3NE5 B;  2E76 C;  1HQM C;  2BE5 C;  1HPC A;  4IFD H;  4GZY C;  3IFT A;  1TU2 B;  2ZT9 C;  1GUN A;  1E2V A;  1IYU A;  2L5T A;  5BN5 A;  5KND A;  5K36 H;  2LMC B;  2A68 C;  3CRK C;  1HCZ A;  3FMC A;  2DNC A;  4G7Z C;  1YNJ C;  3P20 A;  3KLR A;  4HR7 B;  3MXU A;  4KHZ A;  1IW7 D;  2DN8 A;  2KCC A;  4RCN A;  1ONL A;  1ZKO A;  1GHJ A;  1GUT A;  1VF5 C;  4PV1 C;  3D31 A;  3W3A A;  2D2C C;  2EJF C;  2A6E D;  2KA7 A;  3BG3 A;  3GD7 A;  3LWU A;  4TQU S;  3VR5 A;  5BN3 A;  4BA2 I;  1T5E A;  1DXM A;  1OXU A;  4OGQ C;  4I7Z C;  1PMR A;  1Y8O B;  1E2W A;  3A7A B;  1Y69 U;  1GJX A;  4DNR B;  1Q1B A;  1Z6H A;  4KKU A;  2AUJ D;  3T53 B;  1V43 A;  2EJM A;  2BDO A;  4H0L C;  2D5D A;  1GUO A;  1O7L A;  1VCI A;  3ND8 A;  3QJY A;  3T56 B;  5JEA G;  1OXS C;  2K7V A;  2NN6 H;  4KMU C;  1V8Q A;  5C0X G;  2PPB C;  3A8K E;  2BA0 A;  4KKT A;  1H9S A;  3OPO A;  3WDN A;  1HTP A;  1Y8P B;  3I4L A;  3N6R A;  3A8J E;  4L8J A;  4LK1 C;  1IW7 C;  4TKO B;  2EVB A;  3LNN A;  3M4Y A;  1GUG A;  3VR3 A;  3PV0 A;  1A6X A;  5KNC A;  4DK1 A;  1YNN C;  2CW0 C;  4G7H C;  3PUY A;  1FR3 A;  2A6H D;  4IFD G;  2A6E C;  4XIG S;  1Z7T A;  1ZYR C;  3TZU A;  1EWH A;  3BDO A;  3I72 A;  5K36 G;  2EDG A;  2IT1 A;  3M7N A;  3OW7 A;  2A69 D;  3T51 B;  2E75 C;  3CRL C;  1CFM A;  1CTM A;  2JEB I;  2AUK A;  5A35 A;  1VF7 A;  5KNB A;  4H13 C;  2JXM B;  2K32 A;  1LAC A;  3IKJ A;  2QF7 A;  2JE6 I;  3D4R A;  3M85 A;  2JEA I;  2AWO A;  2K33 A;  4KN4 C;  2BA1 A;  1Q1E A;  4OO1 H;  3SDZ A;  4OO1 G;  2PCF B;  2Q8I B;  1H9S B;  4JK1 C;  1O78 A;  1Q90 A;  1QJO A;  1B9N A;  4LJZ C;  4IQZ A;  3OOC A;  2O5I C;  1OXX K; 
#chains in the Genus database with same CATH topology
 4HAE A;  5FJ8 G;  4NP5 A;  3LGJ A;  2QKI C;  4J6H A;  3VR6 A;  4MN3 A;  4J1M A;  3U4Z A;  3V96 A;  3U9S A;  4LF9 L;  3SK4 A;  1IBL Q;  4YWL A;  2PQE A;  4JI2 L;  4AIM A;  2D62 A;  1TWF H;  3SK6 A;  4DNT B;  4L63 B;  2UXC L;  1XMO Q;  4QL5 A;  1H9J A;  1I4P A;  1V1P A;  4JI1 L;  3RZO B;  2VQF Q;  1IYV A;  1RCV D;  1XYI A;  1S3O A;  3DHQ A;  3HOZ B;  1ML0 D;  4BBS H;  1WVL A;  1UAP A;  2V4D A;  2HUG A;  3VA7 A;  5JEA J;  2XWJ B;  1J5E Q;  2RSN A;  3ULJ A;  1AH9 A;  1V9P A;  4HSV A;  3G6J B;  1F9S A;  4C1N I;  4GLA C;  3H91 A;  1PH7 A;  1ZEQ X;  1TY0 A;  2HHH L;  2ZT9 C;  1GUN A;  2L5T A;  1I4G A;  4K6L A;  4G7Z C;  4FF3 A;  4GKK Q;  4QIW B;  3V05 A;  2F0P A;  3K6O A;  1FVI A;  2NZH A;  3CCV A;  1GOZ A;  3I7F A;  4NPS A;  4PQX A;  1S5D D;  1LV9 A;  3A74 A;  3U4V A;  1U0L A;  2KA7 A;  1X3G A;  2K03 A;  1DXM A;  1O7Z A;  4DR4 Q;  1PV4 A;  2EPB A;  2VQE L;  1D1I A;  1NUC A;  2Z6B A;  1R4Q B;  2LKV A;  4DV0 L;  4UAI A;  4HED A;  4A93 H;  2JA7 B;  3QJY A;  4RKB A;  5EPK A;  4JI5 L;  2F0Q A;  1HRJ A;  4R9W A;  1TWG B;  1V8Q A;  2NUC A;  4V19 0;  1K3R A;  2PZT A;  1JE5 A;  2FXQ A;  3KOJ A;  4K5W A;  3ONA B;  1LTB D;  3QOJ A;  3S17 B;  3I4N H;  1I50 B;  1ET9 A;  1XX8 A;  1EIF A;  4CDC C;  5GAD C;  3AU7 A;  4R4Q A;  5EGT A;  2JXM B;  2K32 A;  3E0E A;  5C4J H;  1LAC A;  2QF7 A;  2CQO A;  3VYS A;  2F0V A;  1EIG A;  4OIJ A;  2N78 A;  5EQ0 A;  2AQ1 B;  2PCF B;  1CHQ D;  2XSC A;  3J80 L;  5M5X H;  2E2H B;  3ZJY C;  2ZJR A;  4HJ7 A;  4B3S L;  1N33 L;  2F4V L;  1HHV A;  2NN6 I;  1GUS A;  2EY5 A;  4RGT A;  3K8A A;  4XXE A;  2K5H A;  3HRZ C;  4PZ7 A;  5ELE A;  3CME A;  4R8I A;  3E0J A;  4LFA L;  1Y14 B;  3HOZ G;  3NP8 A;  4ZCK A;  1NR4 A;  4C2M B;  2QDB A;  1B2T A;  4N9P A;  4C3I H;  3CF5 A;  5COY A;  1IL2 A;  2IL8 A;  3HGB A;  2HCI A;  1VQ5 A;  4RFB A;  4B3T Q;  2PZW A;  2NYZ D;  1LT5 D;  1EFW A;  1EQT A;  1UE5 A;  2TMP A;  4H44 C;  2A73 B;  3TRE A;  2F0J A;  1AZP A;  3M4Q A;  5C3X A;  2UXB Q;  4FXK C;  3IFT A;  3AFP A;  3TRZ A;  4IPG A;  3OIP A;  3PCO B;  1X3F A;  1SNP A;  5JOB A;  1JMC A;  4OEM B;  5AJ3 Q;  1SFO B;  1G51 A;  4DF7 A;  1JOO A;  2SDF A;  3R3O A;  2CFM A;  1KDB A;  4MTN A;  2HD3 A;  3E5S A;  1TWA B;  1SE3 A;  5M5W B;  3DWP A;  4IUP A;  1HZC A;  3BYY B;  3AMU A;  1Y8O B;  2YTV A;  4LF9 Q;  2JA7 G;  2JA8 B;  1TII D;  2KHJ A;  2UXC Q;  3F1Z A;  4ZYS A;  2BDO A;  1EY5 A;  4JBK A;  1STE A;  2NVT B;  2WV6 D;  3Q24 A;  3OWE B;  1A3T A;  2NN6 H;  1BF4 A;  2Z6K A;  4WJ3 M;  1A63 A;  1I3Q H;  3KFU A;  1DZ1 A;  1QIL A;  4L8J A;  1E0B A;  5IYB G;  2EVB A;  3M4Y A;  1S5C D;  4TSS A;  2BDN A;  4LF4 Q;  3CCJ A;  4DR6 L;  3F8T A;  3PUY A;  1W6K A;  5IYD G;  2B63 H;  1PRT C;  3T51 B;  4JYA L;  2IHE A;  2HIV A;  2KBN A;  1CUK A;  1LTT D;  1PTO F;  4N8X 1;  2K1B A;  1B1Z A;  1YHQ A;  2EY1 A;  4B3M L;  1STA A;  3PO2 B;  3J80 E;  1UE6 A;  5EBD A;  5ELF A;  1BNZ A;  1F9R A;  2A1A A;  2EYM A;  5KYL A;  3TP8 A;  4JV5 L;  2F0D A;  3UI2 A;  1JOK A;  4IAL A;  4C56 C;  3J80 i;  5IY0 A;  1VQM A;  2FIN B;  1Y8N B;  2XRQ D;  5IWA Q;  3R8B A;  2J0T D;  3EIV A;  3KDF B;  2YYZ A;  1PLF A;  2UUC Q;  3A8I E;  3HOY B;  4BXX H;  1CKN A;  2F0N A;  1A2T A;  2BH2 A;  2K5W A;  2B2T A;  5ELD A;  2R6G A;  2B29 A;  3G71 A;  1PTO D;  4K6D A;  1ENC A;  2GA4 B;  4ZAI A;  1SLJ A;  5EKI A;  5JPN C;  4R4I A;  5IP9 H;  3K7A B;  3PUX A;  3G6E A;  1VMC A;  1TWC H;  4ME5 A;  1X3E A;  1GKH A;  1SNC A;  1TQO A;  3MA2 B;  4GN4 B;  4XQN A;  3I3C A;  3R93 A;  3NEM A;  1AW7 A;  4KD4 A;  3A56 A;  1UE7 A;  1QWY A;  1WI5 A;  3S9W A;  4J8Q A;  2VUM B;  1CZW A;  2JA8 G;  3RMH A;  3T13 A;  1ZYR D;  1WTH A;  1I5F A;  1K0S A;  3K5M A;  2K14 A;  1O7Y A;  1EWC A;  1Q86 C;  2OTL A;  1BOS A;  3KF8 A;  3HOX H;  4QIW E;  4LFC Q;  2AUJ D;  3SVM A;  2F0L A;  4B9W A;  1LM0 A;  3FP9 A;  1O7L A;  1B70 B;  4ME3 A;  4RHR A;  1EOV A;  5C0X G;  1KAA A;  1SFO H;  5FO8 B;  3WDN A;  1HNX L;  2MQH A;  2WII B;  4LFB L;  2VB2 X;  2PI2 A;  1ILP A;  2IPK D;  4TKO B;  1XNQ Q;  5M5W H;  1STH A;  2ICI A;  3U9O A;  3S1Q H;  3J7A 5;  2R93 H;  3BDO A;  1L0Y B;  3H6M A;  3M7N A;  2UUB Q;  4KHP Q;  1NNX A;  1L1O A;  3CKI B;  2Q2H A;  2NWG A;  2AWO A;  5JJK A;  2FMM A;  2NVY H;  4JI8 Q;  3SHL A;  1EWI A;  1X6O A;  3CAM A;  1L0X B;  2ATW A;  4K0K L;  1YIT A;  2Z6K C;  3DUZ A;  2VNU D;  5BR8 L;  4DV2 L;  4EQP A;  2B8F A;  3GTQ H;  1PVO A;  2F03 A;  1F9P A;  3H0G B;  3TP5 A;  1N36 L;  4PZ6 A;  2D0O A;  4XTC S;  3HOY G;  3KJO A;  4FXD A;  4DUY L;  3H94 A;  4DR3 Q;  3JC6 6;  4C3J B;  2JQO A;  1TKW B;  1Y1V B;  1DCZ A;  3J80 c;  2N49 A;  3GTL B;  2HT1 A;  3VR4 A;  2DNE A;  2JA9 A;  4YWM A;  4RHS A;  2E2D C;  5KRU A;  4A3G B;  3E6Z X;  3Q23 A;  5KEE A;  1VQ7 A;  5C5L A;  1I6V C;  4ILW A;  1K28 A;  5JJI A;  4KI0 A;  1PFS A;  4MIU A;  1NMF A;  3DWA A;  2VUM G;  2SEB D;  4GZY C;  3KLW A;  5K36 H;  3A0J A;  3FHW A;  3CRK C;  4NB3 A;  1S40 A;  1EY0 A;  1YNJ C;  4X64 L;  1XPU A;  1KHI A;  3CCR A;  1EEI D;  1I4Q A;  1HFN A;  1ONL A;  2E2J B;  3I91 A;  4DN4 M;  4Q5V A;  4XYO A;  4HJ5 A;  4F8M A;  3BG3 A;  2B2V A;  3VR5 A;  4X62 L;  3MWY W;  1XXG A;  2RF4 A;  5IYC H;  2B2T C;  5DEH A;  5GAE C;  4QMG A;  3ERS X;  1O7I A;  4FP5 D;  4IUN A;  3UE1 A;  4AYB B;  1EL0 A;  1U9R A;  4BBR B;  4DV1 Q;  2ZTC A;  4CBV A;  1XNR L;  4DR2 Q;  2PZU A;  4L5T A;  3A8K E;  3S1M B;  2EXD A;  5GQO A;  4Q0F A;  3PO3 H;  1NSN S;  1L0W A;  5ELB A;  4XQJ A;  2DY8 A;  3M3Y H;  3I2Z A;  2XWB B;  2KCT A;  4RCO A;  1A6X A;  1N32 Q;  1YNN C;  1CZG A;  5IOC A;  1MGS A;  1EYA A;  1K83 H;  2K5V A;  1WJJ A;  3W1G A;  2JYO A;  1CTM A;  1B7Y B;  4DFA A;  1IBL L;  4GS3 A;  4OHJ A;  3D4R A;  2IX1 A;  3HOV B;  5CV5 A;  4H02 A;  3C1F A;  3GTG B;  1EQQ A;  3K5N A;  3H0G G;  4P72 A;  3PIP A;  1Q90 A;  2VQF L;  1RF2 D;  4CKC A;  4IUR A;  1PYW D;  3CPF A;  3O13 A;  1SNO A;  1HA6 A;  4R1J A;  1RDP D;  1BCP C;  2F0H A;  3EBE A;  3WOE A;  4IJL A;  1VQH A;  3I73 A;  4DUZ Q;  4IN3 A;  2K75 A;  4C3J G;  1PH9 A;  1Y1V G;  5LMU Q;  1X9N A;  1J5E L;  5GAG C;  1V1O A;  2Z8L A;  2WAC A;  1STB A;  4A3G G;  2B8G A;  3BS1 A;  1G91 A;  4OX9 Q;  2E2I H;  1SYG A;  2CH4 A;  4GNX B;  1L1O C;  4YHH Q;  4X3K A;  2KEN A;  4GKK L;  3I8Z A;  3ICE A;  1Q12 A;  4RG1 A;  3H0G H;  1AZQ A;  1D2B A;  1K8G A;  4CDE C;  2MUY A;  2ICE C;  3U58 A;  5LHY 1;  1IBM Q;  1WTO A;  4DR4 L;  4EQ5 A;  3TN2 A;  3TEH B;  1UWV A;  3GTL H;  1U4M A;  1E2V A;  2UU9 Q;  2F0W A;  3S15 B;  1PH4 A;  3DEO A;  3MXU A;  3OMC A;  2JA6 H;  4IFD J;  4RCN A;  3F2U A;  1BCP D;  2EIF A;  1C9O A;  1Q8K A;  2I0Q A;  3D31 A;  4TQU S;  4UHV A;  4HJ9 A;  4AYB G;  4M8A A;  5EBC A;  4LF7 Q;  2E5L Q;  3KLS A;  3D8G A;  4O2D A;  4BBR G;  3A7A B;  4Z9C B;  3IRB A;  2RA4 A;  4B9X A;  1EYG A;  3T53 B;  4OXP A;  5CV8 A;  5JEA G;  3R2I A;  2X69 A;  2UXD Q;  3TP7 A;  1JIC A;  2RDH A;  3RR5 A;  3BDL A;  3KF6 B;  4WJW A;  2NB0 A;  2ZTD A;  1ZXT A;  3H15 A;  1K3B C;  3I4L A;  4A3L G;  2B3G A;  1GVP A;  2CW0 C;  4ALP A;  5IGD A;  4QUF A;  3HOV G;  4A3F H;  2B2V C;  5NUC A;  3OW7 A;  3UDG A;  2K01 A;  2JEB I;  1BR9 A;  3KK7 A;  4FVM A;  4KJO A;  3C46 A;  2Q2T A;  2WP8 J;  2B39 A;  1QOH A;  5CBE E;  3H3V I;  2ASB A;  3BZC A;  1RTN A;  1W2B A;  1QG7 A;  4X3S A;  3J7A F;  1OXX K;  4DAY B;  3L7Z C;  3UDX A;  4TVA B;  3KLS X;  1CSP A;  3A7L A;  4B3T L;  4B08 A;  5D65 A;  1H9M A;  1GXD C;  1D8L A;  4C1N K;  3L9A X;  2UXB L;  4IOC A;  5HGT A;  4A3I B;  1EQR A;  4CDD C;  4PG3 A;  3CD6 A;  3GTO B;  1T5X D;  2K05 A;  1FD7 D;  4LW1 A;  1Y1W H;  1TVX A;  2DUD A;  2DJF C;  4X3U A;  3SK8 A;  1K8O A;  5AJ3 L;  1CI3 M;  3FRP B;  2WIN B;  2R92 G;  1BQQ T;  5DLQ E;  3FDT A;  4LWC A;  1DD2 A;  3NE5 B;  4POF A;  1K73 C;  1B3A A;  2NVQ B;  1SE2 A;  2LY7 A;  1KC8 C;  1M90 C;  1HNZ Q;  2LFN A;  2Q8R E;  3S2H B;  3GP7 A;  1C8C A;  1T9H A;  3ULP A;  1K9M C;  4A3B B;  3L0O A;  2CWA A;  3G7L A;  3KLR A;  2LS0 1;  1JWS D;  1FJG L;  4APV A;  3S1R H;  3M7G A;  4LF8 Q;  1B50 A;  5C3W A;  1VF5 C;  3I4M H;  1VQ8 A;  4BA2 I;  5LMN W;  2MHV A;  1OTC A;  1ENA A;  2I07 B;  4DV7 Q;  1NAP A;  1PMR A;  3H3V H;  4A3M B;  2Y0S B;  4LF4 L;  1TS3 A;  1WOC A;  4BY7 B;  1S4Z A;  5FJ8 H;  2R92 H;  1SYF A;  1EU4 A;  3W2D A;  4OIK A;  3S15 H;  4DV6 Q;  3PF4 A;  1CQF A;  3M4O B;  3OPO A;  1F2Y A;  3I56 A;  3MHB A;  3TZD A;  1WCM B;  5CYU A;  3PF5 A;  4AYB E;  3GTJ H;  3VR3 A;  1XMQ Q;  4UY8 C;  1JOQ A;  1PFM A;  2J7Z A;  2KHI A;  1A3U A;  1EWH A;  3D6C A;  3NEL A;  2RHQ B;  3L2P A;  1X55 A;  1XWE A;  2KCM A;  3HG9 A;  1HZB A;  4C3H B;  3BVM A;  2HIX A;  5IWA L;  5M5Y B;  1VMP A;  3GTK H;  5M3F B;  1NCV A;  1VS0 A;  3LWE A;  1WFQ A;  5I2X A;  1PH1 A;  2OQK A;  2Q8I B;  4KJN A;  2UUC L;  4K8I A;  1YHA A;  1BKB A;  1HH2 P;  1U4R A;  4NKL A;  1MSG A;  1GHK A;  1WTQ A;  3V2T A;  4IUV A;  4UDU C;  4A3I G;  1IBK Q;  4NXM Q;  3RZD H;  3CW2 C;  3D4W A;  1TY2 A;  4DXG A;  4DK6 C;  3S14 B;  1ASY A;  3U50 C;  3EQL C;  5IT9 c;  5GAH C;  4P71 A;  1TWH B;  5JAV A;  2P5Z X;  1EY4 A;  3HOU B;  1G8Z D;  3PIO A;  2NTS A;  1KRS A;  4K5X A;  4G7O C;  4A3D B;  3VR2 A;  1AEX A;  2XRS D;  4F7X A;  4IPD A;  2N55 A;  5LMN Q;  1QZG A;  4A3B G;  2L1B A;  4NW2 A;  4HTH A;  3CPW A;  2BE5 C;  4NMZ A;  1KDA A;  4N8F A;  4A3I H;  4WRD A;  1DGS A;  1SRU A;  1SYD A;  4LFC L;  4X65 Q;  2HQL A;  1ET6 A;  3K57 A;  4DV4 Q;  2X6L A;  3J7A V;  1F9Q A;  4J15 A;  4A3M G;  2Y0S G;  3WOF A;  1JE4 A;  1BBU A;  4LUV A;  4BY7 G;  2EJF C;  1SNQ A;  1YVC A;  2M00 A;  1HQR D;  3EVQ A;  1XNQ L;  4IUQ A;  1GJX A;  1CM9 A;  2MO0 A;  4BY1 B;  1CK1 A;  2NTT A;  2IJ0 A;  1STY A;  1VCI A;  2KEC A;  1CQV A;  2F0G A;  1HXY D;  2UUB L;  3RZO H;  4KHP L;  1WCM G;  4KMU C;  4QJF A;  3AFQ A;  1PH5 A;  1SRO A;  3CCS A;  2WAQ B;  1S5F D;  3N6R A;  3HOZ H;  2B2W A;  3A8J E;  2H1E A;  4JI8 L;  2GN5 A;  3SXH A;  2FFK B;  2C35 B;  2QEX A;  1LTI D;  5IGC A;  3OTO Q;  2MO1 A;  3JAM L;  2EY6 A;  2NVX B;  3NTI A;  3HOW B;  4C3H G;  4UP7 A;  2A6E C;  3I4O A;  1R9T B;  4DAM A;  4KY7 A;  5M3F G;  1AN8 A;  5IGB A;  5A35 A;  4IJH A;  1D5X C;  4DR3 L;  4UP9 A;  2MPM A;  1FJG Q;  3GTP B;  3HKZ E;  1FNW A;  3SDZ A;  2JJQ A;  4LF5 Q;  5FK9 C;  1B4O A;  2PW5 A;  1I6H B;  1B9N A;  4CKE A;  5IE8 A;  1AFP A;  3GV6 A;  2L9H A;  1A0I A;  1Z47 A;  2Z0S A;  5CV4 A;  1QE6 A;  2Q2I A;  2K28 A;  3S16 B;  2A8V A;  1C4Q A;  3E9I A;  2SNM A;  1BVS A;  1B9M A;  2JA7 H;  1OXV A;  3HOU G;  1XJV A;  2YU9 B;  2RBM A;  3TBI B;  1TWG H;  1PRT F;  5E1F A;  3TDQ A;  4A3D G;  2VXW A;  4Y7N B;  1YI2 A;  4YWK A;  5LL6 S;  4O1N A;  4CHT B;  3S2D B;  1QUQ B;  3FPP A;  2Z4H A;  3KBG A;  4BA1 I;  1DOK A;  4JG2 A;  3S17 H;  3R2T A;  5CR3 A;  5IYB H;  1I50 H;  1J8I A;  4GN5 A;  3Q22 A;  1P8L A;  4AQY Q;  3LX0 A;  2JA5 B;  4CKB A;  3KUP A;  3M4P A;  4DNI A;  5IYD H;  2LMC B;  2A68 C;  4WFN 3;  3HOU H;  1V1P B;  4HR7 B;  4DV1 L;  1PH8 A;  3RUZ A;  4DR2 L;  4JOI A;  2E2H H;  1G2T A;  4JBJ A;  1NJI C;  1ZKO A;  4A3D H;  3FKI B;  4BY1 G;  1T5E A;  2R7Z B;  1PRT D;  3HFZ B;  3QOL A;  2A19 A;  2IX3 A;  1N32 L;  1V43 A;  1LTG D;  2WAQ G;  3DM3 A;  5C0X I;  1NBW A;  2R61 A;  4MZ9 A;  3ER0 A;  4C2M H;  3RN5 A;  2K4K A;  1EU3 A;  3HOW G;  2Y0S E;  5C4Z A;  4JC0 A;  1IW7 C;  2F0F A;  5HGQ A;  4ABN A;  1PTO B;  3TP6 A;  3JAM E;  1MD2 D;  1PRT B;  3D3R A;  4MTK A;  1EFI D;  1C7Y A;  1D5M C;  3CP0 A;  4JPB W;  4DUZ L;  2F3V A;  1U4L A;  4RKL A;  1HTL D;  5LMU L;  3RNU A;  1IZ6 A;  2ZXO A;  3JAM i;  2EYJ A;  5I2Y A;  1CKO A;  4GLX A;  1A8V A;  2BCO A;  1NTG A;  4B3R Q;  3T1H Q;  4A3C G;  2XTI A;  1JB7 A;  2OQ0 A;  2K33 A;  1Q1E A;  1YJN A;  1STG A;  4DV5 Q;  4OX9 L;  1VQB A;  1X3Q A;  3CQZ B;  4L5R C;  1W3S A;  3CU7 A;  4RGM A;  2PQA A;  1UUP A;  4YHH L;  1TWA H;  4HJ8 A;  1SMY C;  2JA8 H;  2B2W C;  1LTA D;  2EJG C;  2MGS A;  2OEO A;  4DU9 A;  4U67 3;  3GV3 A;  2AKW B;  4HIK A;  1KRT A;  5D14 A;  1IBM L;  2NVT H;  3KF6 A;  1LT4 D;  2QIL A;  3PO2 G;  2YV5 A;  1LTS D;  4QQB X;  1E2Z A;  2UU9 L;  1G6P A;  4ZK9 B;  1DOL A;  5C0X H;  5I6W A;  4RMF A;  2E8G A;  4ZQ3 A;  1GUW A;  3PUV A;  3VYR A;  2JA5 G;  4HIO A;  5M3M B;  2L0C A;  1J6Q A;  2RSO A;  4LF7 L;  2E5L L;  1M1K C;  3T16 A;  3OHX C;  4GN3 B;  3QWN A;  1HPC A;  4JI6 Q;  1VQ6 A;  1JWU D;  4V0B A;  1WTW A;  4XYQ A;  2K04 A;  2EY2 A;  4KHZ A;  2UXD L;  1RHP A;  3FKI G;  1IYJ B;  3NBH A;  4EQO A;  3S2D H;  3PO2 H;  4GKJ Q;  2DN8 A;  2R7Z G;  5A2Q E;  1VQL A;  4P74 A;  3QR8 A;  1SYE A;  4AH6 A;  3W3A A;  5FO7 B;  2EYP A;  5GRO A;  3B6Y A;  2OF1 A;  2HCC A;  2F3W A;  4JI3 Q;  2FMC A;  1KNE A;  3VYT A;  2MFI A;  4GOP A;  1PA6 A;  3S1N B;  2K50 A;  5C3E B;  4PMW A;  3HOY H;  5CV7 A;  2ES2 A;  4KD3 A;  3BVG A;  4LF6 Q;  5EKK A;  2WKC A;  1H9S A;  1K0R A;  3VA5 A;  5JJZ A;  3RN2 A;  1QZH A;  3NBI A;  3CXC A;  4FNF A;  5KNC A;  1Q7Y C;  4JOI C;  1KD1 C;  1KAW A;  3K7A H;  2AMC B;  4IFD G;  1M4V A;  4HJA A;  1Z7T A;  5I9P A;  3T1Y Q;  5DM6 3;  1VQF A;  1JJC B;  2WAQ E;  3NK9 A;  2XIW A;  1SDF A;  5I6Y A;  2GVB A;  4DKA C;  1LUZ A;  2KHS A;  1MKH A;  2VUM H;  3JAM c;  1PZJ D;  4OO1 G;  1IKM A;  4CGY B;  4F87 A;  1O78 A;  1PTO H;  4LJZ C;  3DLL A;  2O5I C;  1KLU D;  2CHB D;  5KYI A;  1LT6 D;  2WKD A;  2R7F A;  5JVH 3;  1YEZ A;  4DR1 Q;  4KN7 C;  1FYC A;  2A6H C;  3GTM B;  4ID6 A;  4PMC A;  4O0A A;  1Q3L A;  3PUW A;  3H3V C;  1YNJ D;  1JCK B;  2A69 C;  4JCV E;  4MNO A;  1HNZ L;  5KIX A;  3QO2 A;  1K8A C;  1UEB A;  4OWX B;  5M3M G;  5DAU A;  4JI4 Q;  2PNR C;  5IT9 L;  3W5O A;  1TXY A;  5FLX c;  2E74 C;  1EIY B;  4LF8 L;  2K5D A;  5FLM G;  4A3J B;  2F1M A;  1XPO A;  3J7Z C;  2K5Q A;  3KJP A;  4DV7 L;  1F2Z A;  2E76 C;  1DON A;  2KED A;  1YIJ A;  5ISR A;  1BCP F;  4X3T A;  4IPH A;  1TU2 B;  4OWW B;  4A3E B;  4KY5 A;  1NY4 A;  1SYC A;  5C4X B;  2O2L D;  1CKN B;  4PMB A;  4DV6 L;  2FHT A;  1EOT A;  1GO3 E;  1Q8I A;  3NXW A;  4A75 A;  1D6E C;  2EE1 A;  1YNN D;  4IO9 A;  1QVG A;  3CCQ A;  3M9B A;  4RH6 A;  2CVR A;  2N8N A;  2EXZ A;  2VW9 A;  3OSO A;  5C5M A;  5C3E G;  1GD7 A;  1XMQ L;  4DNR B;  1Q1B A;  2F0T A;  4RWS C;  2QW7 A;  4C3J H;  2EQS A;  2K5N A;  1Y1V H;  2N88 A;  2D5D A;  1TWF B;  4IUU A;  1KQS A;  2BA0 A;  3J81 c;  4A3G H;  4KKT A;  2EYL A;  1SND A;  1HTP A;  2IWH A;  4R8N A;  4LMQ D;  5E3F A;  5C44 B;  4BBS B;  3IL8 A;  2RDF A;  3C1E A;  4R4C A;  3TZU A;  4WOR A;  2ZM6 Q;  3KF8 B;  1EY8 A;  3DMU A;  1VQK A;  2ZJP A;  1TS5 A;  4JI0 Q;  1IBK L;  4NXM L;  1CA6 A;  3EFX D;  3UDF A;  1JB3 A;  5J39 A;  4GOP C;  1EZ6 A;  1BCP B;  3SK5 A;  2E2J H;  4IQZ A;  2RHS B;  1TR5 A;  5F2D A;  3STB C;  2OCE A;  1BBX C;  1WYD A;  2ID0 A;  1JT8 A;  1G29 1;  3HKZ B;  4JBW A;  3MFG A;  2MP1 A;  2HQE A;  1U5K A;  3NEN A;  2Z1C A;  2JK8 A;  1H95 A;  4YY3 Q;  1STN A;  5ELC A;  4BBR H;  5LMN L;  2F0M A;  1L1O B;  4A93 B;  1LAB A;  2NZ1 D;  2C5C A;  3S1M H;  3EJI A;  1A15 A;  2R7D A;  5JEA H;  3BU2 A;  3NQT A;  4A3J G;  4X65 L;  3ITP A;  3DEP A;  4DV4 L;  3FVQ A;  5IT9 E;  1HR0 W;  2VB3 X;  1KNA A;  4A3L H;  1QVC A;  4A3E G;  1WD1 A;  3I4N B;  2B2Y A;  1VQD A;  3MAQ A;  5C4X G;  1N34 Q;  2CCZ A;  1VQN A;  3HOV H;  4HN7 A;  1IYU A;  5C4J B;  2DNC A;  5J1Z A;  1X32 A;  3GTG H;  4LUZ A;  3MZ5 A;  3E3X A;  2EZV A;  4E6I A;  2FJ2 A;  4RA8 A;  1I4X A;  1YBY A;  2ENB A;  2CW0 D;  2K6A A;  4K14 A;  4OL7 A;  5IGG A;  4RGN A;  5M5X B;  1JJG A;  3P7J A;  1WTP A;  3D0F A;  2TSS A;  1E1T A;  1OXU A;  4OGQ C;  4I7Z C;  3TME A;  1MJC A;  3OTO L;  4IOA A;  3MXG A;  2C9O A;  3BJU A;  4A3E H;  2D0P A;  4QCL A;  1BO0 A;  1CSQ A;  2XN9 C;  1MHW C;  2PPB C;  5C44 G;  4BBS G;  3HS0 C;  2QCP X;  1QNK A;  2WFW A;  3A55 A;  4FF4 A;  4C3I B;  3F2C A;  1M8A A;  2JN4 A;  3HZX A;  4HMI A;  2RVL A;  1JJ2 A;  4LF5 L;  1X3P A;  1FNV A;  5HY6 A;  3PV0 A;  4UP8 A;  4CJ2 C;  1HJP A;  2UUA Q;  1B3Q A;  2PO4 A;  3PSI A;  2F0U A;  1LYL A;  1B8A A;  3RLO A;  3KDF A;  3SGI A;  4H13 C;  3BDC A;  1D7Q A;  3M85 A;  1KL9 A;  2PMZ B;  3J81 j;  2JEA I;  2RCF A;  4KN4 C;  2BA1 A;  3KBX A;  2AWN A;  4KTA A;  4DR7 Q;  4JK1 C;  3HKZ G;  5C44 H;  1S72 A;  1EZ8 A;  1VQI A;  3TQY A;  5D3D A;  2QDL A;  4ZKB B;  3EN2 A;  3OMG A;  3QIA A;  4JI7 L;  2JP1 A;  4KLK A;  4YCU A;  4P73 A;  1HR0 Q;  4N9T A;  4A93 G;  2SOB A;  1MSH A;  4HSP A;  1SMX A;  5I4D A;  5I9O A;  1TS2 A;  4A3K B;  1XPR A;  1DM0 B;  1JR0 D;  1KIX A;  1I4H A;  5JPM C;  4NXN L;  3K0X A;  3RD4 A;  3AYH B;  2AQ3 B;  4AQY L;  4KKS A;  4CJ0 B;  1NR2 A;  4CDF C;  1S5E D;  1FNU A;  1I3Q B;  5DM7 3;  4G57 A;  1H9K A;  3I4N G;  2NBF A;  5HUR A;  1QVF A;  2R3Z A;  1EEF D;  1K8M A;  4QB4 A;  4A76 A;  4CJ1 B;  1SR3 A;  2XVS A;  3K81 C;  4P75 A;  2B63 B;  1LLR D;  2QA4 A;  1PYB A;  1YJW A;  2JSO A;  2XNA C;  4K2K A;  3FMC A;  4L5S A;  3CC7 A;  3P20 A;  5IP7 G;  4X66 Q;  4FF2 A;  4M1U B;  1GUT A;  5J3B A;  4H7B A;  2D2C C;  3HP3 A;  1E22 A;  1I94 L;  2EYH A;  1EY9 A;  2ALY B;  1TT2 A;  2SNS A;  4DAP A;  1HNW Q;  2KJX A;  1N8R C;  1UE1 A;  2AHO B;  2OT2 A;  1EYC A;  2B2Y C;  4C3I G;  1OXS C;  2K7V A;  4HCE A;  1E1O A;  1N9W A;  4B3R L;  3BZD B;  3GTO H;  4QUC A;  3GDE A;  3T1H L;  2RDG A;  4QY7 A;  3OYY A;  3CCU A;  4DV5 L;  3BVZ A;  3LNN A;  5IP7 H;  5IOD A;  1Q81 C;  4KHV A;  1D5Z C;  3PQI A;  1PZK D;  2OWO A;  2I5L X;  3EA6 A;  3C2P A;  2NVQ H;  1PFN A;  1TWC B;  1WD0 A;  3G4S A;  4FYD A;  4ZUI A;  4OEL B;  5CC4 A;  3S2H H;  3L3O C;  3Q8D A;  1CKM A;  2VZA A;  3PIO 3;  4A3B H;  2V1C C;  1PZI D;  1JWM D;  3IFD A;  1SSO A;  5G3L F;  3RLN A;  5EJW A;  2NZO A;  5ELO A;  1X54 A;  1QJO A;  3AEV A;  5J22 A;  1QNU A;  3MXN B;  1SXT A;  4A3K G;  3K5L A;  1LTL A;  4IZ8 A;  4A3M H;  3BYT B;  2BE5 D;  4BY7 H;  3HOX B;  2NN6 G;  2XGT A;  1JQY D;  1BUV T;  4OWT B;  3M4O H;  2PI2 E;  4IPC A;  1B53 A;  2LXK A;  1BXT A;  3QB3 A;  3SE0 A;  4JI6 L;  4ZLT F;  1HFG A;  4KK7 A;  3UDI A;  2KQ3 A;  3DXJ C;  4DR5 Q;  1WCM H;  4U68 A;  1U4P A;  4GKJ L;  5C4H A;  3F2D A;  3MTS A;  2B63 G;  2KCN A;  3S1Q B;  2R93 B;  5G3L D;  2KOL A;  4JI2 Q;  4A3K H;  1BDO A;  2ZXR A;  4LNQ A;  1HQM C;  3P75 A;  4JI3 L;  4C3H H;  1HUN A;  4JI1 Q;  5FLX L;  1SBB B;  5M5Y H;  4DA2 A;  5M3F H;  5LL6 X;  1HCZ A;  2KEE A;  2QEJ C;  5TSS A;  1VQE A;  1HZ9 A;  2NVY B;  2AQ2 B;  4DPG A;  1IKL A;  1PHJ A;  4LF6 L;  4JI7 Q;  1GHJ A;  2VL6 A;  2A6E D;  2DJG C;  3GTQ B;  1PTO C;  3W1B A;  2HHH Q;  1RIP A;  1E3P A;  5DNF A;  4NXN Q;  4BXX G;  4DK3 C;  3S14 H;  4QF4 A;  3ND8 A;  3T1Y L;  2G9H D;  1EIH A;  1S5B D;  4FO2 A;  4YCW A;  1TWH H;  3HEJ A;  5FOB B;  3OW2 A;  3F2B A;  3K0Y A;  1EYD A;  1SJH D;  1Y8P B;  3IAY A;  5IP9 G;  4LAA A;  5A2Q L;  1FL0 A;  1CT1 D;  2CQA A;  2VQE Q;  3J81 L;  1BBW A;  3TS0 A;  4K5V A;  4DV0 Q;  3A5U A;  5KGU A;  4XIG S;  1ZYR C;  2F0K A;  4G4K A;  1NE3 A;  4JI5 Q;  3N52 A;  3ULL A;  3K80 C;  5IGE A;  1VQP A;  2OXP A;  4DR1 L;  2CKZ B;  2L15 A;  5EKL A;  3D6W A;  2F0S A;  3S24 A;  5K5P A;  4GNX A;  4FF1 A;  2LSS A;  1X65 A;  3BZK A;  2H4O A;  3NUC A;  1JOR A;  2D9U A;  4PZ8 A;  4L6T B;  1GM5 A;  1I94 Q;  1QCB D;  4ZKC B;  2ZTE A;  5CV9 A;  1XTC D;  3HOX G;  1O80 A;  5C6A A;  3PGZ A;  3CCL A;  4JI4 L;  4WJ4 A;  2L12 A;  3X3M A;  3MFY A;  2HDM A;  2PMZ E;  3CCE A;  2L11 A;  1PFB A;  1PYS B;  1Q82 C;  4BY1 H;  1J9O A;  2A68 D;  3ZYY X;  1VQ4 A;  3RLF A;  2L55 A;  4DAV A;  5AFW A;  5FKA C;  5E4W C;  1A2U A;  3CCM A;  5BN4 A;  1UEA B;  1F77 A;  3GQB A;  3H09 A;  4JBM A;  1VDZ A;  5EAY A;  3VDY A;  2R93 G;  1MI2 A;  4B3S Q;  3T4A C;  3OIQ A;  1N33 Q;  3PO3 B;  3I90 A;  2F4V Q;  3K7U C;  2LXJ A;  2NVX H;  3M3Y B;  2CH4 W;  2F0I A;  3HOW H;  2WB1 B;  4HIM A;  1R9T H;  2RQX A;  1II3 A;  4DK0 A;  1NMG A;  4LFA Q;  1MIU A;  4YCV A;  1K83 B;  5CMD A;  4EX5 A;  5FLX E;  5E4X A;  5BN5 A;  1VQO A;  3GTP H;  5M9O A;  1IW7 D;  3A54 A;  1C0A A;  1HUM A;  5D3I B;  3NQI A;  1I6H H;  2H5X A;  4A3C H;  4ODG A;  1DYQ A;  4PV1 C;  2K52 A;  3GD7 A;  1LTR D;  3G48 A;  2Z4I A;  1E2W A;  3NTH A;  3MEH A;  4K2L A;  3S16 H;  1D1K A;  4K8J A;  4FDB A;  3GO5 A;  4KKU A;  4P2C B;  3DM1 A;  2YU9 H;  2EJM A;  2J4X A;  2L4N A;  2VY3 A;  4H0L C;  3T56 B;  4EVO A;  2ZM6 L;  2I5M X;  2Z9H A;  4JI0 L;  3TSS A;  2F52 A;  2IX0 A;  2E2I B;  4Y7N H;  4POG A;  1KLG D;  2PW7 A;  1MBY A;  1SMY D;  4LK1 C;  4O42 A;  1ILQ A;  1Z9F A;  4DAY A;  4IFD I;  1E24 A;  3J81 E;  4DK1 A;  2IW3 A;  4RAU C;  5T1G A;  3AQQ A;  3I72 A;  5K36 G;  2EDG A;  4LUO A;  2JA5 H;  3CRL C;  3C3L A;  1CFM A;  1PDQ A;  1Q46 A;  1F2L A;  1VF7 A;  5KNB A;  3J81 i;  1CA5 A;  1SE4 A;  2RCN A;  4YY3 L;  4OO1 I;  2QGQ A;  4R4O A;  4DV3 L;  2IHF A;  1XTD A;  1RL2 A;  2JA6 B;  3VYU A;  3FPU B;  3PMF A;  5IYC G;  1SN8 A;  4DR6 Q;  1VQ9 A;  3FKI H;  3NHH A;  2R7Z H;  1EY7 A;  4ZUJ A;  4JYA Q;  1UNS A;  3ND9 A;  4IUT A;  1VQG A;  1E7Z A;  2MJ8 A;  3URY A;  1AE2 A;  4B3M Q;  3K5O A;  2YTX A;  3PO3 G;  1N34 L;  5JJL A;  2Q8T A;  1VQC A;  2M2L A;  1PH3 A;  3CC2 A;  1R4P B;  2G9D A;  2WB1 G;  1ROD A;  2F0E A;  5IGF A;  1PH2 A;  3CMA A;  1YHB A;  4GNX C;  4JV5 Q;  2F4I A;  5EPL A;  3QG1 A;  1IXR A;  4FXG C;  4NDX A;  1FGB D;  3MEF A;  4X6A H;  3PUZ A;  5C0X J;  1P16 A;  2PYK A;  2B2U A;  4A3F B;  5CBA E;  4IFD H;  1ESR A;  4I65 A;  1JC7 A;  1V1Q A;  5KND A;  4HID A;  2G5D A;  1RTO A;  2DGY A;  2HDL A;  1A62 A;  3CQZ H;  4F88 A;  2KCC A;  5FO9 B;  1F2M A;  4I7A A;  4XT3 B;  3J7Y W;  5CV6 A;  1HA5 A;  1ASZ A;  4OO1 H;  3LWU A;  3E9H A;  2A74 C;  4R4T A;  2EYO A;  1ICW A;  1ESF A;  1Y69 U;  3NWS A;  4PNY A;  3MXP A;  3NPP A;  4HMJ A;  1PH6 A;  2UUA L;  3I70 A;  1RD9 D;  2EYF A;  2F3I A;  1XMO L;  2Q2U A;  3ERO A;  5JVG 3;  1FGU A;  1C48 A;  3CC4 A;  1RKN A;  1Y1W B;  1AE3 A;  4DR7 L;  2N3S A;  1HZA A;  3SEB A;  1TS4 A;  3HKS A;  5M3M H;  2A6H D;  5COR A;  2VS1 A;  5T1I A;  1W6J A;  5H1S E;  3UE0 A;  2DY7 A;  2IT1 A;  1HR0 L;  2A69 D;  2I46 A;  2E75 C;  2ZXP A;  5FLM H;  1KDC A;  2AUK A;  1SYB A;  2JA6 G;  1OO9 B;  3Q6S A;  4OON A;  4XT1 B;  2JE6 I;  2BH8 A;  3PIP 3;  1HNX Q;  4Y52 H;  3NSW A;  4LFB Q;  4JVZ A;  2EOT A;  1WTR A;  1LT3 D;  1EQV A;  3S1R B;  1G6Z A;  1YNX A;  3I4M B;  5CGK A;  4DGZ A;  1VQA A;  3NWT A;  5IIF A;  4XDX A;  1WTX A;  1KTK A;  1OXT A;  1DJR D;  5E7N A;  3MVV A;  3S1N H;  5C3E H;  2R92 B;  1EUJ A;  1YJ9 A;  4KY6 A;  3A5Z B;  3K59 A;  3D4D A;  1LO5 D;  5ELN A;  3K58 A;  4K0K Q;  4L5Q A;  5BR8 Q;  4DV2 Q;  4X66 L;  2RKS A;  2PQA B;  1N36 Q;  5L37 A;  4A3F G;  2CWP A;  3AB9 A;  3GTJ B;  1B44 D;  4ZRZ A;  2KUM A;  4DUY Q;  4MHE A;  2M9V A;  2O5J C;  1H9R A;  1SJE D;  1YZ6 A;  1DOM A;  2A5H A;  3DWQ A;  3OWF A;  2I5H A;  2IY5 B;  1HNW L;  1SNM A;  4DV3 Q;  2F0O A;  1X56 A;  4XQQ A;  1MJE A;  4YIJ A;  1IL8 A;  1IHZ A;  3GTK B;  4JW0 A;  4HCS A;  4BWG B;  2WB1 E;  3MC0 B;  1AP0 A;  1QB5 D;  3MXN A;  1SE8 A;  1WTV A;  1KAB A;  3ERQ A;  1ICF B;  2O4X A;  5BN3 A;  2ZJQ A;  1L2F A;  4S3S A;  3X3N A;  2X6G A;  3Q0A A;  2GVA A;  2YTY A;  2PNH A;  1I4R A;  3GTM H;  1Z6H A;  1ENF A;  1G2S A;  3RZD B;  5EPJ A;  2MNA A;  4X64 Q;  1GUO A;  3NTK A;  1KXL A;  2OTJ A;  1Y1W G;  2B2U C;  4ULL A;  1RJT A;  4A4I A;  3STB D;  3NBH B;  3FEW X;  4X62 Q;  3KYH C;  3CHB D;  3P1H A;  1GUG A;  4A3J H;  4GLV B;  1VQJ A;  4G7H C;  4DXF A;  1FR3 A;  3TS2 A;  4TRD A;  1SAP A;  4RGO S;  1XNR Q;  4EQN A;  1A3V A;  1CHP D;  4GOP B;  3I55 A;  3IKJ A;  4EGV A;  4KV6 A;  5C4X H;  2KVM A;  4UPA A;  3I4M G;  3SR1 A;  1PXU A;  1SEB D;  1H9S B;  3WWV A;  1QUQ A;  4BS9 A;  2BOS A;  4QGU A;  3OOC A;  1EY6 A;  4DR5 L; 
#chains in the Genus database with same CATH homology
 4HAE A;  4NP5 A;  2QKI C;  4J6H A;  3VR6 A;  4MN3 A;  4J1M A;  3V96 A;  3U9S A;  3SK4 A;  2PQE A;  2D62 A;  3SK6 A;  4DNT B;  4L63 B;  1H9J A;  1I4P A;  1V1P A;  3RZO B;  1IYV A;  1RCV D;  1XYI A;  3DHQ A;  3HOZ B;  1ML0 D;  1WVL A;  1UAP A;  2V4D A;  2HUG A;  3VA7 A;  5JEA J;  2XWJ B;  2RSN A;  4HSV A;  3G6J B;  1F9S A;  4C1N I;  3H91 A;  1ZEQ X;  1TY0 A;  2ZT9 C;  1GUN A;  2L5T A;  1I4G A;  4K6L A;  4G7Z C;  4FF3 A;  4QIW B;  3V05 A;  2F0P A;  3K6O A;  1GOZ A;  4PQX A;  1S5D D;  1LV9 A;  2KA7 A;  2K03 A;  1DXM A;  1O7Z A;  2EPB A;  1D1I A;  1NUC A;  1R4Q B;  2LKV A;  4UAI A;  4HED A;  2JA7 B;  3QJY A;  4RKB A;  5EPK A;  1HRJ A;  2F0Q A;  4R9W A;  1TWG B;  1V8Q A;  2NUC A;  4V19 0;  2PZT A;  4K5W A;  3ONA B;  1LTB D;  3QOJ A;  3S17 B;  1I50 B;  1ET9 A;  1XX8 A;  3AU7 A;  5EGT A;  2JXM B;  2K32 A;  1LAC A;  2QF7 A;  3VYS A;  2F0V A;  1EIG A;  4OIJ A;  5EQ0 A;  2AQ1 B;  2PCF B;  1CHQ D;  2XSC A;  3J80 L;  2E2H B;  1HHV A;  2NN6 I;  1GUS A;  2EY5 A;  4RGT A;  4XXE A;  3HRZ C;  5ELE A;  4R8I A;  3E0J A;  3NP8 A;  1NR4 A;  4C2M B;  2QDB A;  1B2T A;  4N9P A;  5COY A;  2IL8 A;  3HGB A;  2HCI A;  4RFB A;  2PZW A;  2NYZ D;  1LT5 D;  1EQT A;  2TMP A;  4H44 C;  2A73 B;  2F0J A;  1AZP A;  5C3X A;  4FXK C;  3IFT A;  3OIP A;  1SNP A;  5JOB A;  1SFO B;  4DF7 A;  1JOO A;  2SDF A;  3R3O A;  1KDB A;  5M5W B;  3E5S A;  1TWA B;  1SE3 A;  3DWP A;  4IUP A;  3BYY B;  3AMU A;  1Y8O B;  2JA8 B;  1TII D;  4ZYS A;  2BDO A;  1EY5 A;  1STE A;  2NVT B;  2WV6 D;  3Q24 A;  3OWE B;  1A3T A;  2NN6 H;  1BF4 A;  1DZ1 A;  1QIL A;  4L8J A;  1E0B A;  2EVB A;  3M4Y A;  1S5C D;  4TSS A;  2BDN A;  3PUY A;  1W6K A;  1PRT C;  3T51 B;  1LTT D;  1PTO F;  2K1B A;  1B1Z A;  2EY1 A;  1STA A;  3PO2 B;  3J80 E;  5EBD A;  5ELF A;  1BNZ A;  1F9R A;  2EYM A;  5KYL A;  3TP8 A;  2F0D A;  3UI2 A;  1JOK A;  4IAL A;  4C56 C;  2FIN B;  1Y8N B;  2XRQ D;  3R8B A;  2J0T D;  2YYZ A;  1PLF A;  3A8I E;  3HOY B;  2F0N A;  1A2T A;  2K5W A;  2B2T A;  5ELD A;  2R6G A;  1PTO D;  4K6D A;  1ENC A;  2GA4 B;  4ZAI A;  5JPN C;  5EKI A;  3K7A B;  3PUX A;  1VMC A;  4ME5 A;  1SNC A;  1TQO A;  3MA2 B;  4XQN A;  3I3C A;  3R93 A;  1AW7 A;  4KD4 A;  3A56 A;  2VUM B;  1QWY A;  3S9W A;  4J8Q A;  1CZW A;  3RMH A;  3T13 A;  1ZYR D;  3K5M A;  1O7Y A;  1EWC A;  1BOS A;  3KF8 A;  2AUJ D;  3SVM A;  2F0L A;  4B9W A;  1O7L A;  4RHR A;  5C0X G;  1KAA A;  5FO8 B;  3WDN A;  2WII B;  2VB2 X;  1ILP A;  2IPK D;  4TKO B;  1STH A;  2ICI A;  3U9O A;  3BDO A;  1L0Y B;  3H6M A;  3M7N A;  3CKI B;  2NWG A;  2AWO A;  2FMM A;  3SHL A;  1L0X B;  3DUZ A;  2VNU D;  4EQP A;  2B8F A;  2F03 A;  1F9P A;  3H0G B;  3TP5 A;  4XTC S;  4FXD A;  3H94 A;  4C3J B;  1TKW B;  1Y1V B;  1DCZ A;  3GTL B;  3VR4 A;  2DNE A;  4RHS A;  2E2D C;  5KRU A;  4A3G B;  3E6Z X;  3Q23 A;  5KEE A;  5C5L A;  1I6V C;  4ILW A;  4KI0 A;  4MIU A;  3DWA A;  2SEB D;  4GZY C;  5K36 H;  3CRK C;  1EY0 A;  1YNJ C;  1EEI D;  1I4Q A;  1HFN A;  1ONL A;  2E2J B;  3I91 A;  4DN4 M;  4Q5V A;  4XYO A;  4F8M A;  3BG3 A;  2B2V A;  3VR5 A;  3MWY W;  1XXG A;  2B2T C;  5DEH A;  4QMG A;  4IUN A;  4FP5 D;  4AYB B;  1EL0 A;  1U9R A;  4BBR B;  4CBV A;  2PZU A;  3A8K E;  3S1M B;  4Q0F A;  1NSN S;  5ELB A;  4XQJ A;  2DY8 A;  2XWB B;  4RCO A;  1A6X A;  1YNN C;  1CZG A;  5IOC A;  1MGS A;  1EYA A;  2JYO A;  1CTM A;  4DFA A;  4OHJ A;  3D4R A;  2IX1 A;  3HOV B;  5CV5 A;  3C1F A;  3GTG B;  3K5N A;  1Q90 A;  1RF2 D;  4CKC A;  4IUR A;  1PYW D;  3O13 A;  1SNO A;  1HA6 A;  1RDP D;  1BCP C;  2F0H A;  3WOE A;  3I73 A;  4IN3 A;  4C3J G;  1V1O A;  2Z8L A;  2WAC A;  1STB A;  2B8G A;  3BS1 A;  1G91 A;  1SYG A;  4X3K A;  3I8Z A;  1Q12 A;  1AZQ A;  1D2B A;  2MUY A;  2ICE C;  5LHY 1;  1WTO A;  3TN2 A;  1U4M A;  1E2V A;  2F0W A;  3S15 B;  3DEO A;  3MXU A;  3OMC A;  4IFD J;  4RCN A;  3F2U A;  1BCP D;  3D31 A;  4TQU S;  4M8A A;  5EBC A;  3KLS A;  3D8G A;  3A7A B;  4Z9C B;  2RA4 A;  4B9X A;  3T53 B;  5CV8 A;  5JEA G;  3R2I A;  2X69 A;  3TP7 A;  1JIC A;  2RDH A;  3BDL A;  4WJW A;  2NB0 A;  1ZXT A;  3I4L A;  2CW0 C;  5IGD A;  4QUF A;  2B2V C;  5NUC A;  3OW7 A;  2K01 A;  2JEB I;  1BR9 A;  3KK7 A;  4FVM A;  4KJO A;  3C46 A;  2WP8 J;  2B39 A;  1QOH A;  5CBE E;  1RTN A;  1QG7 A;  4X3S A;  3J7A F;  1OXX K;  3L7Z C;  3KLS X;  3A7L A;  4B08 A;  5D65 A;  1H9M A;  1GXD C;  4C1N K;  3L9A X;  5HGT A;  4A3I B;  3GTO B;  1T5X D;  2K05 A;  1FD7 D;  1TVX A;  4X3U A;  3SK8 A;  1K8O A;  1CI3 M;  3FRP B;  2WIN B;  1BQQ T;  3FDT A;  1DD2 A;  3NE5 B;  1B3A A;  2NVQ B;  1SE2 A;  2LY7 A;  2LFN A;  2Q8R E;  3S2H B;  3GP7 A;  1C8C A;  4A3B B;  3G7L A;  3KLR A;  2LS0 1;  1JWS D;  3M7G A;  1B50 A;  5C3W A;  1VF5 C;  4BA2 I;  2MHV A;  1ENA A;  2I07 B;  1NAP A;  1PMR A;  4A3M B;  2Y0S B;  1TS3 A;  4BY7 B;  1S4Z A;  1SYF A;  1EU4 A;  3W2D A;  4OIK A;  1CQF A;  3M4O B;  3OPO A;  1F2Y A;  3MHB A;  3TZD A;  1WCM B;  5CYU A;  3VR3 A;  1JOQ A;  1PFM A;  2J7Z A;  1A3U A;  1EWH A;  3D6C A;  3HG9 A;  1XWE A;  4C3H B;  3BVM A;  5M5Y B;  1VMP A;  5M3F B;  1NCV A;  3LWE A;  5I2X A;  2Q8I B;  4KJN A;  4K8I A;  1U4R A;  4NKL A;  1MSG A;  1GHK A;  1WTQ A;  3V2T A;  4IUV A;  4UDU C;  3D4W A;  1TY2 A;  4DXG A;  3S14 B;  3EQL C;  1TWH B;  5JAV A;  1EY4 A;  3HOU B;  1G8Z D;  2NTS A;  4K5X A;  4G7O C;  4A3D B;  3VR2 A;  1AEX A;  2XRS D;  4F7X A;  2N55 A;  2L1B A;  4NW2 A;  4HTH A;  2BE5 C;  4NMZ A;  1KDA A;  4WRD A;  1SYD A;  1ET6 A;  3K57 A;  2X6L A;  3J7A V;  1F9Q A;  3WOF A;  1JE4 A;  2EJF C;  1SNQ A;  2M00 A;  1HQR D;  3EVQ A;  4IUQ A;  1GJX A;  1CM9 A;  4BY1 B;  1CK1 A;  2NTT A;  2IJ0 A;  1STY A;  1VCI A;  2KEC A;  1CQV A;  2F0G A;  1HXY D;  4KMU C;  2WAQ B;  1S5F D;  3N6R A;  2B2W A;  3A8J E;  2H1E A;  3SXH A;  2FFK B;  1LTI D;  5IGC A;  3JAM L;  2EY6 A;  2NVX B;  3NTI A;  3HOW B;  4C3H G;  2A6E C;  1R9T B;  4KY7 A;  1AN8 A;  5IGB A;  5A35 A;  1D5X C;  2MPM A;  3GTP B;  3SDZ A;  1FNW A;  5FK9 C;  1B4O A;  2PW5 A;  1I6H B;  1B9N A;  4CKE A;  1AFP A;  3GV6 A;  2L9H A;  1Z47 A;  5CV4 A;  1QE6 A;  2K28 A;  3S16 B;  1C4Q A;  2SNM A;  1B9M A;  1OXV A;  2YU9 B;  2RBM A;  3TBI B;  1PRT F;  5E1F A;  3TDQ A;  2VXW A;  4Y7N B;  5LL6 S;  4O1N A;  4CHT B;  3S2D B;  3FPP A;  2Z4H A;  3KBG A;  4BA1 I;  1DOK A;  3R2T A;  5CR3 A;  1J8I A;  3Q22 A;  3LX0 A;  2JA5 B;  4CKB A;  3KUP A;  2LMC B;  2A68 C;  4WFN 3;  1V1P B;  4HR7 B;  3RUZ A;  1G2T A;  1ZKO A;  3FKI B;  1T5E A;  2R7Z B;  1PRT D;  3QOL A;  2IX3 A;  1V43 A;  1LTG D;  5C0X I;  2R61 A;  1EU3 A;  5C4Z A;  1IW7 C;  2F0F A;  4ABN A;  1PTO B;  3TP6 A;  3JAM E;  1MD2 D;  1PRT B;  3D3R A;  1EFI D;  1D5M C;  2F3V A;  1U4L A;  4RKL A;  1HTL D;  2ZXO A;  2EYJ A;  5I2Y A;  2BCO A;  2K33 A;  1Q1E A;  1STG A;  1X3Q A;  3CQZ B;  3CU7 A;  4RGM A;  1UUP A;  1SMY C;  2B2W C;  1LTA D;  2EJG C;  2MGS A;  2OEO A;  4DU9 A;  4U67 3;  3GV3 A;  5D14 A;  1LT4 D;  2QIL A;  1LTS D;  1E2Z A;  4ZK9 B;  1DOL A;  5C0X H;  5I6W A;  4ZQ3 A;  1GUW A;  3PUV A;  3VYR A;  5M3M B;  2L0C A;  2RSO A;  3T16 A;  3OHX C;  3QWN A;  1HPC A;  1JWU D;  4V0B A;  1WTW A;  4XYQ A;  2K04 A;  2EY2 A;  4KHZ A;  1RHP A;  3NBH A;  4EQO A;  2DN8 A;  5A2Q E;  1SYE A;  3W3A A;  5FO7 B;  2EYP A;  2OF1 A;  2HCC A;  2F3W A;  2FMC A;  1KNE A;  3VYT A;  3S1N B;  5C3E B;  4PMW A;  5CV7 A;  4KD3 A;  3BVG A;  5EKK A;  2WKC A;  1H9S A;  3VA5 A;  5JJZ A;  3NBI A;  4FNF A;  5KNC A;  4IFD G;  1M4V A;  1Z7T A;  5I9P A;  5DM6 3;  3NK9 A;  2XIW A;  1SDF A;  5I6Y A;  2KHS A;  1PZJ D;  4OO1 G;  1IKM A;  4CGY B;  4F87 A;  1O78 A;  1PTO H;  4LJZ C;  2O5I C;  1KLU D;  2CHB D;  5KYI A;  1LT6 D;  2WKD A;  5JVH 3;  4KN7 C;  1FYC A;  2A6H C;  3GTM B;  4ID6 A;  4PMC A;  1Q3L A;  3PUW A;  3H3V C;  1YNJ D;  1JCK B;  2A69 C;  5KIX A;  3QO2 A;  5DAU A;  2PNR C;  5IT9 L;  2E74 C;  2K5D A;  4A3J B;  2F1M A;  2K5Q A;  1F2Z A;  2E76 C;  1DON A;  2KED A;  5ISR A;  1BCP F;  4X3T A;  1TU2 B;  4A3E B;  4KY5 A;  1SYC A;  5C4X B;  2O2L D;  4PMB A;  2FHT A;  1EOT A;  1Q8I A;  3NXW A;  1D6E C;  2EE1 A;  1YNN D;  4RH6 A;  2CVR A;  2EXZ A;  3OSO A;  5C5M A;  4DNR B;  1Q1B A;  2F0T A;  4RWS C;  2N88 A;  2D5D A;  1TWF B;  4IUU A;  2BA0 A;  4KKT A;  2EYL A;  1SND A;  1HTP A;  2IWH A;  4R8N A;  4LMQ D;  5E3F A;  5C44 B;  4BBS B;  3IL8 A;  2RDF A;  3C1E A;  3TZU A;  4WOR A;  1EY8 A;  3DMU A;  1TS5 A;  1CA6 A;  3EFX D;  1JB3 A;  5J39 A;  1EZ6 A;  1BCP B;  3SK5 A;  4IQZ A;  1TR5 A;  5F2D A;  1BBX C;  2ID0 A;  1G29 1;  3HKZ B;  4JBW A;  3MFG A;  2MP1 A;  2HQE A;  2Z1C A;  1STN A;  5ELC A;  2F0M A;  4A93 B;  1LAB A;  2NZ1 D;  2C5C A;  3EJI A;  1A15 A;  5JEA H;  3NQT A;  3ITP A;  3DEP A;  3FVQ A;  5IT9 E;  2VB3 X;  1KNA A;  1WD1 A;  3I4N B;  2B2Y A;  3MAQ A;  4HN7 A;  1IYU A;  5C4J B;  2DNC A;  5J1Z A;  1X32 A;  3MZ5 A;  2EZV A;  4E6I A;  2FJ2 A;  4RA8 A;  1I4X A;  2ENB A;  2K6A A;  2CW0 D;  4K14 A;  4OL7 A;  5M5X B;  5IGG A;  4RGN A;  3P7J A;  1WTP A;  2TSS A;  1OXU A;  4OGQ C;  4I7Z C;  3TME A;  3MXG A;  2C9O A;  4QCL A;  1BO0 A;  2XN9 C;  2PPB C;  3HS0 C;  2QCP X;  1QNK A;  3A55 A;  4FF4 A;  4C3I B;  1M8A A;  3HZX A;  4HMI A;  2RVL A;  1X3P A;  1FNV A;  3PV0 A;  4CJ2 C;  2PO4 A;  2F0U A;  4H13 C;  3BDC A;  3M85 A;  2PMZ B;  2JEA I;  4KN4 C;  2BA1 A;  3KBX A;  2AWN A;  4KTA A;  4JK1 C;  1EZ8 A;  4ZKB B;  5D3D A;  3OMG A;  3QIA A;  2JP1 A;  4N9T A;  2SOB A;  1MSH A;  4HSP A;  5I4D A;  5I9O A;  1TS2 A;  4A3K B;  1DM0 B;  1JR0 D;  1I4H A;  5JPM C;  3RD4 A;  2AQ3 B;  4KKS A;  4CJ0 B;  1NR2 A;  1S5E D;  1FNU A;  1I3Q B;  5DM7 3;  4G57 A;  1H9K A;  2NBF A;  5HUR A;  2R3Z A;  1EEF D;  1K8M A;  4QB4 A;  4CJ1 B;  2XVS A;  2B63 B;  1LLR D;  2JSO A;  2XNA C;  4K2K A;  3FMC A;  3P20 A;  4FF2 A;  4M1U B;  1GUT A;  4H7B A;  2D2C C;  3HP3 A;  2EYH A;  1EY9 A;  1TT2 A;  2SNS A;  4DAP A;  2KJX A;  2OT2 A;  1EYC A;  2B2Y C;  4C3I G;  1OXS C;  2K7V A;  4HCE A;  3BZD B;  4QUC A;  2RDG A;  3BVZ A;  3LNN A;  5IOD A;  4KHV A;  1D5Z C;  1PZK D;  3EA6 A;  3C2P A;  1PFN A;  1TWC B;  1WD0 A;  4FYD A;  4ZUI A;  5CC4 A;  3L3O C;  3PIO 3;  1PZI D;  1JWM D;  3IFD A;  1SSO A;  5G3L F;  5EJW A;  1QJO A;  5J22 A;  1QNU A;  1SXT A;  3K5L A;  4IZ8 A;  3BYT B;  2BE5 D;  3HOX B;  2NN6 G;  1JQY D;  1BUV T;  1B53 A;  1BXT A;  3QB3 A;  3SE0 A;  4ZLT F;  1HFG A;  4KK7 A;  2KQ3 A;  3DXJ C;  4U68 A;  1U4P A;  5C4H A;  3MTS A;  2KCN A;  3S1Q B;  2R93 B;  5G3L D;  2KOL A;  1BDO A;  2ZXR A;  1HQM C;  3P75 A;  1HUN A;  5FLX L;  1SBB B;  4DA2 A;  5LL6 X;  1HCZ A;  2KEE A;  2QEJ C;  5TSS A;  2NVY B;  2AQ2 B;  1IKL A;  1GHJ A;  2A6E D;  3GTQ B;  1PTO C;  5DNF A;  4QF4 A;  3ND8 A;  2G9H D;  1EIH A;  1S5B D;  4FO2 A;  3HEJ A;  5FOB B;  3K0Y A;  1EYD A;  1SJH D;  1Y8P B;  3IAY A;  4LAA A;  5A2Q L;  1CT1 D;  2CQA A;  3J81 L;  4K5V A;  5KGU A;  4XIG S;  1ZYR C;  2F0K A;  4G4K A;  3N52 A;  5IGE A;  2OXP A;  5EKL A;  3D6W A;  2F0S A;  5K5P A;  4FF1 A;  2H4O A;  3NUC A;  1JOR A;  2D9U A;  4L6T B;  1QCB D;  4ZKC B;  5CV9 A;  1XTC D;  1O80 A;  5C6A A;  2L12 A;  3X3M A;  3MFY A;  2HDM A;  2L11 A;  1PFB A;  1J9O A;  2A68 D;  3ZYY X;  3RLF A;  2L55 A;  4DAV A;  5AFW A;  5FKA C;  5E4W C;  1A2U A;  5BN4 A;  1UEA B;  1F77 A;  3GQB A;  3H09 A;  1VDZ A;  1MI2 A;  3T4A C;  3OIQ A;  3PO3 B;  3I90 A;  3M3Y B;  2F0I A;  2WB1 B;  2RQX A;  1II3 A;  4DK0 A;  1K83 B;  5CMD A;  5FLX E;  5E4X A;  5BN5 A;  5M9O A;  1IW7 D;  3A54 A;  1HUM A;  5D3I B;  3NQI A;  4ODG A;  1DYQ A;  4PV1 C;  3GD7 A;  1LTR D;  2Z4I A;  1E2W A;  3NTH A;  3MEH A;  4K2L A;  1D1K A;  4K8J A;  3GO5 A;  4KKU A;  4P2C B;  3DM1 A;  2EJM A;  2J4X A;  2L4N A;  4H0L C;  3T56 B;  4EVO A;  3TSS A;  2IX0 A;  2E2I B;  1KLG D;  2PW7 A;  1MBY A;  1SMY D;  4LK1 C;  4O42 A;  1ILQ A;  4DAY A;  4IFD I;  3J81 E;  4DK1 A;  2IW3 A;  4RAU C;  5T1G A;  3I72 A;  5K36 G;  2EDG A;  3CRL C;  3C3L A;  1CFM A;  1PDQ A;  1F2L A;  1VF7 A;  5KNB A;  1CA5 A;  1SE4 A;  4OO1 I;  2JA6 B;  3VYU A;  3FPU B;  3PMF A;  3NHH A;  1EY7 A;  4ZUJ A;  1UNS A;  3ND9 A;  4IUT A;  2MJ8 A;  3URY A;  3K5O A;  2Q8T A;  2M2L A;  1R4P B;  2G9D A;  1ROD A;  2F0E A;  5IGF A;  2F4I A;  5EPL A;  3QG1 A;  4FXG C;  4NDX A;  1FGB D;  3PUZ A;  5C0X J;  2PYK A;  2B2U A;  4A3F B;  5CBA E;  4IFD H;  1ESR A;  4I65 A;  1JC7 A;  5KND A;  1RTO A;  2HDL A;  4F88 A;  2KCC A;  5FO9 B;  1F2M A;  4XT3 B;  3J7Y W;  5CV6 A;  1HA5 A;  4OO1 H;  3LWU A;  2A74 C;  2EYO A;  1ICW A;  1ESF A;  1Y69 U;  3NWS A;  4PNY A;  3MXP A;  3NPP A;  4HMJ A;  3I70 A;  1RD9 D;  2EYF A;  3ERO A;  5JVG 3;  1C48 A;  1RKN A;  1Y1W B;  3SEB A;  1TS4 A;  2A6H D;  5COR A;  5T1I A;  1W6J A;  2DY7 A;  2IT1 A;  2A69 D;  2I46 A;  2E75 C;  2ZXP A;  1KDC A;  2AUK A;  1SYB A;  1OO9 B;  3Q6S A;  4XT1 B;  2JE6 I;  3PIP 3;  3NSW A;  2EOT A;  1WTR A;  1LT3 D;  1EQV A;  3S1R B;  1G6Z A;  3I4M B;  5CGK A;  4DGZ A;  3NWT A;  5IIF A;  4XDX A;  1WTX A;  1KTK A;  1OXT A;  1DJR D;  3MVV A;  2R92 B;  4KY6 A;  3K59 A;  3D4D A;  1LO5 D;  3K58 A;  2RKS A;  3AB9 A;  3GTJ B;  1B44 D;  4ZRZ A;  2KUM A;  4MHE A;  2M9V A;  2O5J C;  1H9R A;  1SJE D;  3DWQ A;  1DOM A;  2A5H A;  3OWF A;  1SNM A;  2F0O A;  4XQQ A;  4YIJ A;  1IL8 A;  1IHZ A;  3GTK B;  4HCS A;  4BWG B;  3MC0 B;  1AP0 A;  1QB5 D;  3MXN A;  1WTV A;  1KAB A;  3ERQ A;  2O4X A;  5BN3 A;  4S3S A;  3X3N A;  2X6G A;  3Q0A A;  1I4R A;  1Z6H A;  1ENF A;  1G2S A;  3RZD B;  5EPJ A;  1GUO A;  3NTK A;  2B2U C;  4ULL A;  1RJT A;  3FEW X;  3CHB D;  3P1H A;  1GUG A;  4G7H C;  4DXF A;  1FR3 A;  4TRD A;  1SAP A;  4RGO S;  4EQN A;  1A3V A;  1CHP D;  3IKJ A;  4EGV A;  4KV6 A;  2KVM A;  3SR1 A;  1PXU A;  1SEB D;  1H9S B;  4BS9 A;  2BOS A;  3OOC A;  1EY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...