3CRLC

Crystal structure of the pdhk2-l2 complex.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
86
Chain Sequence
b'SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 14
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crlC00
4HR7B 3M4YA 4G7OC 1Q1BA 5JEAH 2R6GA 3RLFA 1ZYRC 2EDGA 5K36G 1LACA 3A7AB 2CW0C 1GUGA 3EQLC 1Y8PB 5KNCA 4IFDG 1E2WA 3IFTA 2PPBC 2IT1A 1VDZA 2PCFB 2V4DA 4LK1C 3PUZA 3M85A 1QJOA 1HPCA 3VR4A 4BA2I 1Q90A 2EVBA 1GUOA 2D62A 3M7NA 1SMYC 3LNNA 1GHJA 3PUXA 1OXVA 3BG3A 2K33A 3NE5B 2BE5C 3HGBA 5A35A 1CTMA 2AWOA 1IW7C 3BDOA 3PUVA 4IQZA 4KN4C 2JEAI 1DD2A 1IW7D 1Y69U 3N6RA 1K8OA 2DN8A 2A68D 5BN5A 4H44C 4XTCS 3TZUA 1Z7TA 3CRKC 1O78A 2E76C 1V8QA 2A6HC 3T51B 4DNTB 5C0XG 1V43A 2O5IC 5K36H 1GHKA 4JBWA 1FYCA 3I72A 2YYZA 1B9MA 4L8JA 2A6HD 2DNCA 4IFDH 2JE6I 1H9KA 4OO1G 1VF5C 2QF7A 3A7LA 4KKUA 1GJXA 3QIAA 1VF7A 2PNRC 2K7VA 3VR6A 2A69C 1CI3M 4DK0A 3VR3A 1K8MA 2A69D 4PV1C 2KA7A 1HCZA 1CFMA 2B8FA 4DK1A 1DXMA 2K32A 3WDNA 1IYVA 3PUYA 1FR3A 2EJFC 3A8IE 2A68C 3H94A 2F1MA 2KCCA 4JK1C 4LJZC 2E74C 2L5TA 2NN6I 2E75C 3ND8A 2D2CC 1O7LA 1I6VC 2ZT9C 3P20A 4KMUC 2JXMB 4GZYC 1H9JA 5C0XH 3SDZA 3I73A 1A6XA 2BA0A 3QJYA 2AUKA 3MFYA 1GUTA 1H9SA 3GD7A 1OXTA 1OXXK 3A8KE 3OPOA 3L7ZC 1GUNA 1T5EA 1H9MA 4KKTA 4OO1H 3PUWA 4KI0A 1GUSA 2NN6G 2D5DA 3D4RA 2Q8IB 1HTPA 3DXJC 4BA1I 4H0LC 1HQMC 1Q12A 1ZKOA 1OXUA 1B9NA 4KN7C 3U9SA 1ONLA 1TU2B 3GQBA 4TKOB 1VCIA 1OXSC 3VA7A 3AB9A 3ND9A 3A8JE 3PV0A 4KKSA 1IYUA 1E2ZA 4TQUS 3VR2A 4DNRB 1YNNC 3T56B 3W3AA 5JEAG 1BDOA 1DCZA 1LABA 3T53B 1Y8NB 2EJGC 3VR5A 4H13C 1YNJC 5KNBA 5BN4A 2LMCB 3KLRA 4I7ZC 2EJMA 1Z6HA 2BDOA 1TKWB 2B8GA 2JEBI 3CRLC 3FMCA 1PMRA 1Q1EA 3FPPA 4G7HC 4OGQC 2A6EC 2NN6H 3D31A 1E2VA 5KNDA 3MXUA 3LWUA 2A6ED 1Y8OB 3I4LA 3OW7A 2BA1A 4KHZA 1EWHA 1H9RA 2BE5D 5BN3A 1H9SB 3SE0A 2AUJD 4G7ZC 1G291 4RCNA 3IKJA 2DNEA 3OOCA 3QG1A 4XIGS 2O5JC
chains in the Genus database with same CATH superfamily
2EOTA 4HIDA 2UUAQ 5K36G 2EDGA 3MTSA 4KD4A 4B3RQ 1Y8PB 2UUCQ 4ZRZA 1EEID 4DK3C 1PFMA 1Q90A 5C44H 3CP0A 4A3JB 1QILA 1PFBA 2YV5A 1PRTC 1OXVA 1STAA 2E2IH 4RH6A 1DOLA 1EIYB 3K59A 5A35A 1M90C 1IW7D 3H15A 5KGUA 1KDAA 2KEDA 5C3EB 1K8OA 1WTQA 5GAHC 3KUPA 3CRKC 5ISRA 5LHY1 1SNPA 1KLGD 1FYCA 4K5WA 2VZAA 4KJOA 4U673 3RN2A 4OO1G 1EEFD 3UDFA 3LGJA 3VR6A 3ULPA 4A3DB 4A3JH 1HR0W 4U68A 4A3IG 4V190 4PV1C 3A0JA 4CKCA 2MJ8A 1JOOA 2RDGA 4R4CA 2PW7A 4KY7A 4DAYB 1K3RA 1PRTB 1I6VC 5C3EH 4L5RC 1X9NA 5TSSA 2K05A 5CBAE 3I73A 2CWPA 4J15A 2AUKA 5D3IB 2A1AA 1U4PA 1IL2A 5IYBG 3HOUG 2QEXA 2FHTA 1KIXA 2WB1B 4APVA 2K03A 5JJIA 1N9WA 3U9SA 1K9MC 4NXMQ 5I2XA 2K5VA 1NE3A 1RL2A 4GOPC 4DAPA 2B29A 5E4WC 4YCWA 3KLWA 4XQNA 4IUTA 4RWSC 1U4MA 4O42A 5FLMG 4X3TA 4DV2Q 2Z4HA 1I6HB 1UUPA 1Z6HA 5IODA 3V05A 1J6QA 3BZKA 3PF5A 3MXUA 1RKNA 3GTKB 4ID6A 3M4QA 1H9RA 4QIWB 2Z6KC 1P8LA 1QB5D 3IRBA 3MEHA 4JV5L 4DV3L 5G3LF 1Q1BA 1ZYRC 2K6AA 4KY6A 1IBML 2CW0C 3GV6A 2A74C 4FXKC 4O1NA 4GOPB 4GNXA 4LK1C 2VB3X 1I6HH 1VQKA 4JOIA 3P7JA 3K0YA 3AEVA 3E3XA 1SYEA 3LNNA 4RFBA 5C0XI 3BG3A 3CCQA 1LTSD 2F0PA 3NE5B 2BE5C 1TWHH 4LUVA 2H1EA 1D6EC 3ONAB 4RA8A 2JP1A 3RZDB 2DJGC 2SDFA 1Y69U 3HOVB 1ILQA 4XTCS 2EYLA 1FJGL 4GKJQ 5K5PA 4ME3A 1D5XC 2FFKB 3ULJA 1PH5A 4XYQA 3MXGA 1CZGA 4EQNA 4H7BA 2K7VA 2L12A 1IXRA 4NDXA 2X69A 4C2MB 4BBSB 3HOYG 2JA5H 2BH2A 1VQ9A 4JG2A 3PUYA 3A8IE 3RZDH 2WB1E 4KV6A 4K2LA 4JYAQ 3U9OA 4KTAA 2AQ2B 5C0XH 1W2BA 5IGDA 4JI8L 2JA7B 2ZTCA 4FF1A 1G6ZA 1NTGA 1EQTA 4IUUA 1EFID 1QUQB 4GKKQ 4LF7Q 2I5MX 2HQEA 3W1GA 4EQOA 2BDNA 3D4RA 2UUAL 5M3FG 1SNCA 4B3RL 2UUCL 2VUMB 1E1OA 4A3FB 1OXUA 1EOTA 1TU2B 2NVTB 4FDBA 3J80i 4BBSH 3NBHA 1EUJA 3AB9A 4M8AA 3E5SA 1AP0A 3NQTA 1QZHA 3T56B 3K81C 1PH6A 5FOBB 5C3WA 1KRTA 2V1CC 4R4TA 1VQ5A 4QIWE 1DYQA 2MO1A 5BN4A 2JA7H 2KHJA 4LF8Q 3C46A 2PZUA 1VQ4A 5JAVA 4CJ1B 4PQXA 2VUMH 4A3FH 5HGQA 4QL5A 4WJ4A 1WCMB 3TP6A 2NVTH 3QG1A 3ER0A 3PIP3 5CBEE 2UXBQ 1MSHA 2F0MA 4RG1A 2D0OA 1R4PB 5EJWA 4QY7A 3EJIA 1ICWA 2LXJA 4XT3B 2PPBC 4GNXC 4GN3B 1VQ8A 1ML0D 1AZQA 1W6JA 4JOIC 1LTTD 1X6OA 3L0OA 3HEJA 3NEMA 4B3MQ 3ZYYX 4OO1I 1PV4A 1X32A 1DD2A 4Q0FA 1XMQQ 3OTOQ 4IOCA 1XYIA 1KNAA 4K2KA 3RR5A 1B2TA 4ZYSA 3VYRA 2G9DA 3BYYB 5K36H 4NXML 3T4AC 2M2LA 4KKUA 1VQBA 2VS1A 1VF7A 4A3IB 1QCBD 2K04A 1QWYA 3MZ5A 2EIFA 4DV2L 1RCVD 4GNXB 3R93A 5IGCA 5J22A 1TQOA 1M1KC 2L5TA 1NR4A 1WD1A 4BWGB 1EY4A 1VQOA 5I6YA 5KYIA 3QJYA 3AFPA 1H9SA 3GD7A 4X3UA 1T5EA 4X62Q 4BS9A 4OO1H 3MXNB 1EY6A 2F0DA 1RTNA 4GLVB 2NN6G 1ILPA 2E2JB 4DV4Q 1C4QA 4FXGC 5JVH3 1N8RC 4A3IH 2F0WA 1CQFA 4UP9A 4A3GG 2K5HA 2RSNA 1G8ZD 4M1UB 2YU9B 4ZUJA 1SBBB 1II3A 3A8JE 4TQUS 2WACA 1T9HA 1V1QA 1R4QB 4AYBG 3E0EA 3JAME 1ZYRD 3CPFA 3KYHC 1EYAA 3AQQA 3KF6A 2CW0D 3O13A 3GTPB 2J4XA 2SNMA 3HOUH 5IYBH 3GO5A 4XT1B 5I9OA 2Q2IA 2TMPA 1MJEA 5DNFA 4GKJL 4IUQA 1E2VA 2N78A 3X3NA 2A6ED 4C3HG 2E2JH 2UXDQ 1SRUA 4AIMA 2QGQA 2BE5D 1Y1VG 2PQAA 4ILWA 2YU9H 2XN9C 1B4OA 1PXUA 2SEBD 2RSOA 4F87A 1WFQA 4WFN3 3M4YA 3TP8A 3MWYW 1CK1A 2F03A 1U0LA 1I5FA 2Z1CA 2C5CA 2NTSA 5FLMH 3S15H 1F9RA 3K6OA 3CCEA 3NBHB 3GTPH 2Y0SG 3M85A 4JYAL 3VR4A 4LFBQ 3A54A 3HGBA 4POGA 4PMWA 1F9PA 4GKKL 4LF7L 4K5VA 4BXXG 3K8AA 1BBXC 1YI2A 4ZCKA 5T1GA 1AE2A 5EPKA 3T51B 2D0PA 3GTJB 3QWNA 3SK5A 3C1FA 2N55A 2QF7A 4EGVA 5FKAC 1EWCA 3T1YQ 1EU4A 3MHBA 1K8MA 2A69D 3HOYB 1A15A 4IN3A 5JVG3 1KD1C 2Z0SA 4J6HA 1KDCA 2K5NA 4LF8L 3GDEA 4JI4Q 1S5CD 3P20A 2EXDA 2JXMB 2HIXA 5C3EG 4JI1Q 2K5DA 1HNWQ 2OEOA 1SN8A 4GN5A 2F0VA 3GTJH 1PH8A 2F3IA 2GVAA 1ENCA 2UXBL 3PO3G 3EFXD 5M3FB 4OEMB 3QR8A 3M3YB 3I3CA 3SK8A 2Q2TA 2LFNA 3HOXB 1LM0A 3IFDA 3F2DA 4A3DG 1NAPA 1O7ZA 3HOYH 3FDTA 4NPSA 2NWGA 2VL6A 3I90A 1IKMA 2NBFA 3PV0A 2NYZD 1PZKD 2NVXB 5IYCH 2EJGC 3H6MA 2ZJQA 1E3PA 4B3ML 3K5OA 5KNBA 1ESRA 3HFZB 3BJUA 1XMQL 3OTOL 3I91A 3S2HH 4A75A 5M3FH 4A3KG 5I6WA 1TY0A 4XDXA 4A3CG 1H9SB 3SE0A 4OIKA 1B70B 2CQOA 3DLLA 5CGKA 4FNFA 2F0TA 2Q8TA 1LTBD 1L1OA 1YZ6A 4LMQD 2NVXH 3A7AB 1SE8A 1D1IA 4TSSA 5FLXE 1E2WA 2CFMA 1A63A 3K7AH 3J7A5 4QUFA 2PCFB 3BZDB 5GROA 1QJOA 4UY8C 1VQIA 1HNXQ 2IW3A 4WJWA 1GHJA 3H3VI 1D1KA 2KEEA 1MBYA 3KF6B 1PYBA 4X62L 2ZJPA 2YTXA 1B7YB 4DV0Q 4DR7Q 2DN8A 4IUNA 4DV4L 3I2ZA 3HP3A 3BDLA 4HEDA 1BKBA 1V8QA 3A55A 5M5XB 1GHKA 2PQAB 4AH6A 2A6HD 2DNCA 4PMCA 1Q82C 1HR0Q 4RHSA 1H9KA 3JAMc 2Q2HA 4ODGA 3GTLB 5C4XG 2IWHA 3KF8A 1NJIC 1JICA 3DEPA 4LF9Q 3QOJA 1PH7A 2KA7A 4C1NK 1A8VA 3I4OA 2XTIA 2A68C 2KVMA 2NN6I 4DV6Q 2AQ3B 2UXDL 3HOVG 1XNQQ 3H3VH 4Z9CB 5KRUA 2E2DC 4RCOA 3DEOA 1CKMA 5M5XH 2UUBQ 1LO5D 2ZM6Q 4DR2Q 2RCFA 2LSSA 1PH2A 5FO8B 4BY7G 5IY0A 3R8BA 4H0LC 2CQAA 3TRZA 4A3GB 1TS2A 1TR5A 2WFWA 1XXGA 2DJFC 1PH4A 1PRTF 3B6YA 4KKSA 2IHEA 1G2SA 4LFBL 2NZHA 4AYBB 1YNNC 3GTMB 3SR1A 3TZDA 2I0QA 3EBEA 1AZPA 4JBKA 3NUCA 4DR4Q 4P75A 2K5QA 3CRLC 2NN6H 3D31A 4C3HB 1BNZA 5DEHA 2VY3A 2QW7A 3LWUA 2F52A 3KLSA 1X3QA 2R61A 4PMBA 2MUYA 3ULLA 3ICEA 1NNXA 3P1HA 3TREA 1WTPA 4A3GH 4NW2A 2HCCA 5C4ZA 1IKLA 1EQRA 2R7DA 3OOCA 5FO7B 1JWMD 5EKIA 3T1YL 3I70A 4RAUC 1L1OC 2MPMA 3EROA 2Y0SB 1VQNA 5FLXL 1HPCA 2PYKA 1SDFA 2RDFA 2D62A 4DF7A 4JI1L 4C3HH 1JE5A 2HDMA 2NZOA 1VQCA 2KUMA 1HNWL 2AMCB 1XNRQ 4LF4Q 4LW1A 2QDBA 1CQVA 1JWSD 5LMUQ 3Q8DA 2B2WA 3I7FA 4YY3Q 1K83B 2B2UA 5E3FA 3PIPA 1WCMG 3S1RH 5AFWA 2DGYA 2VQEQ 4HAEA 3I72A 5CMDA 1B44D 2FMMA 3CCRA 5M5YB 1NSNS 4MTNA 1X3GA 5C0XJ 3QIAA 4WJ3M 1PZJD 1K73C 4YIJA 3BS1A 3VR3A 4GLXA 1PA6A 3J80E 4LUOA 4K5XA 3SGIA 1D5ZC 2ZXPA 1FL0A 4JK1C 3SK6A 4BXXH 4P71A 1VQFA 3K80C 1B3AA 4R1JA 3SDZA 3W5OA 3PO3B 4IURA 2FMCA 3PF4A 5FLXc 3A5ZB 4AYBE 1LUZA 2D5DA 3MFGA 3K58A 5FO9B 1Q12A 5IWAQ 1VCIA 1JOQA 4A3LG 1AH9A 4KD3A 2CH4W 2VXWA 1HNXL 4B3TQ 4FYDA 1SYBA 2WV6D 4LF6L 3KF8B 4JI0Q 5DM73 3D6CA 4UP7A 4DR3Q 1EQVA 1X65A 2JA6G 3HKZG 1IBKQ 2F3VA 2JSOA 1PTOF 4DV0L 4DR7L 1IBLQ 2N3SA 1NUCA 3F1ZA 3PO3H 1TS3A 4YWKA 1X3EA 4B08A 4A3KB 4B3SQ 3CKIB 3KOJA 5LMNQ 2NZ1D 4F88A 3Q23A 2PO4A 1HR0L 4A3DH 2Y0SE 1DZ1A 1EZ8A 3OSOA 1PYWD 2R7ZG 2K4KA 1SNQA 4K8JA 1D2BA 4LF9L 1FNUA 4LUZA 1F2ZA 3STBD 4TRDA 4ALPA 1TXYA 3PGZA 4DV6L 5HY6A 3TDQA 3URYA 2ICIA 1F9QA 1LT5D 1MI2A 2QDLA 1XNQL 3H0GG 1K8AC 4A3KH 4OIJA 1BF4A 3TSSA 3RUZA 4K6DA 2UUBL 4A3CH 2ZM6L 1YITA 4EVOA 1TWCB 3KBGA 4DR2L 1V1OA 3N6RA 2EYHA 2B2WC 2A68D 5HURA 3TEHB 2B2UC 1WTRA 1A6XA 2E76C 2A73B 1HZ9A 2QCPX 1KHIA 3GTGB 1TS4A 5C4XB 5GQOA 1TIID 4HSVA 1LTLA 2OXPA 4CJ2C 3SK4A 3D4DA 3Q24A 4DR4L 4CDCC 3GTKH 3J80L 4BBRB 3MVVA 2F4IA 1UE7A 1ICFB 1TWCH 4LJZC 3D8GA 1HA5A 2EPBA 1QNKA 1PTOC 2C35B 4DR6Q 4JI3Q 3RZOB 1L2FA 3DM3A 1YNND 1VS0A 4NB3A 1S5DD 3I56A 1I4XA 1JC7A 4FVMA 4KHVA 5C4XH 4BY7B 3Q0AA 1LTID 3DXJC 1Q8IA 1FNVA 1RDPD 3F2CA 1UWVA 4C56C 1A2TA 3DWAA 3CCMA 3HOZB 4X66Q 1UAPA 1F2MA 1STYA 3WWVA 1F2YA 2JQOA 1E22A 2MFIA 3BYTB 3HOVH 4A3BB 5JEAG 2KCTA 4DAMA 4DV1Q 1XNRL 5IYCG 4LF4L 3RZOH 1XPUA 2VB2X 1MKHA 1A0IA 3BU2A 1JJ2A 5LMUL 4P2CB 2OTLA 4YY3L 3KLRA 4XYOA 2B8GA 1PTOB 4RHRA 1STEA 2L55A 1BOSA 2VQEL 4BY7H 3NELA 3CC2A 3OW7A 1EY5A 3W1BA 4QB4A 3HOXG 4IUPA 1BBWA 4C2MH 4RGTA 3J80c 1HZBA 1TWGB 2HD3A 5D14A 3NENA 4NP5A 3CHBD 1VMCA 1QVGA 1ZXTA 1SR3A 1E7ZA 5KNCA 3NPPA 3K5LA 4ABNA 2V4DA 1ESFA 2KHIA 4ME5A 2EVBA 1XTCD 1PTOH 3PUXA 1HZAA 2K33A 2CHBD 1LTGD 5DM63 2FXQA 4OWWB 1EOVA 1PRTD 4OELB 1UE6A 3HOWG 2R92G 3I4MB 3L9AX 4RGMA 4LWCA 4Y7NB 2F0GA 3U50C 2GVBA 2NTTA 4L63B 4XQJA 2GN5A 5IWAL 1O78A 3BZCA 4HSPA 1HUNA 4DAVA 4B3TL 4DA2A 4AQYQ 4JI0L 3DWQA 3BVZA 4DR3L 4DK0A 1IBKL 1RTOA 3HS0C 4KJNA 1IBLL 3PSIA 2F0KA 1C7YA 1B8AA 1GUWA 3H94A 4RMFA 1SLJA 2E74C 4B3SL 2E75C 5ELNA 4KMUC 1WCMH 5LMNL 2KQ3A 4PG3A 4HJAA 2XWJB 5CV9A 1Y14B 3MFYA 5BR8Q 1PVOA 5JEAJ 2L15A 3K5MA 1A2UA 3CCLA 1L0WA 4FF3A 1QG7A 1J5EQ 4BA1I 1EWIA 1B53A 3VYSA 2CVRA 3WOFA 1OXSC 3VA7A 3AYHB 2LS01 5IP9G 1S72A 4HIOA 4L5TA 3W3AA 2JA6B 3HKZB 1LT4D 4H13C 4IPGA 4YHHL 5LL6S 2F0HA 2BOSA 4HTHA 3I4NG 3I8ZA 3R2TA 2ALYB 2Q8RE 5I4DA 1YJWA 5DLQE 2MP1A 2QEJC 3KFUA 5COYA 2IL8A 4DV7Q 4QMGA 1CKNA 1XPOA 3IAYA 4OHJA 2X6LA 4A3LH 1G291 2K14A 4BY1B 2R7ZB 4XIGS 4QQBX 4EQPA 4JW0A 2XRQD 1LACA 1J9OA 2JA6H 2EE1A 3ERSX 2IT1A 1VDZA 3KDFA 4LFCQ 3H0GB 3U4ZA 4JI3L 4DR6L 1RJTA 3H91A 1QVFA 2O4XA 1EY8A 5I9PA 4PNYA 5CV7A 3NBIA 2SNSA 1UE5A 5BN5A 2R7ZH 3CF5A 1CSQA 4J1MA 3A56A 1PTOD 2F0QA 3J7AF 1RF2D 1EU3A 2LXKA 1YJ9A 2MGSA 3NTKA 1VQDA 4X66L 2EYJA 3G6JB 1EYCA 2N88A 4DV1L 3H0GH 1X3PA 2JA8B 1T5XD 2R7FA 2TSSA 1QE6A 2RA4A 3M4OB 2O2LD 1DXMA 3FVQA 1DONA 4JPBW 1N34Q 2MNAA 2UU9Q 1SYGA 2PQEA 4JBJA 4QF4A 4QUCA 3ND8A 4ZKCB 2D2CC 3KK7A 1H9JA 4L6TB 4A4IA 1PLFA 2QILA 1G6PA 1GKHA 2RBMA 2E2HB 2F3WA 3BDCA 4DU9A 3G48A 4KI0A 5M9OA 5IP7G 2G5DA 3RMHA 1C0AA 3HKZE 3FEWX 4IPHA 3T13A 4KN7C 5EBCA 2N8NA 4OL7A 1WD0A 3VYUA 3CMEA 2RDHA 4KLKA 1HTLD 4F8MA 1HNZQ 5D65A 1N32Q 1G51A 3I55A 1SNDA 2BCOA 1BCPC 3UDIA 4ZKBB 4LNQA 4K14A 3WOEA 1MGSA 2HIVA 1JCKB 2BDOA 1TKWB 1NR2A 2E2HH 3RLNA 4UAIA 4JI7Q 3SEBA 4POFA 4DXFA 1VQHA 2F0EA 1CHPD 2XGTA 2C9OA 2JK8A 3L2PA 3CC7A 2AUJD 4A3MG 1RHPA 4G7ZC 4AQYL 1I50B 4CJ0B 5CR3A 3HG9A 1EIGA 2ASBA 2YTYA 5C5LA 3J7ZC 4A3EB 3NQIA 1Q8KA 2UXCQ 5JEAH 2A8VA 3CQZB 2RKSA 1I94Q 2J0TD 5KYLA 5M3MG 1VQPA 2ES2A 2DY8A 3S17B 5J39A 1BCPB 4FO2A 5BR8L 4L5SA 3M3YH 3HKSA 3HOWB 2R92B 1EIFA 4FF2A 2AWOA 1IW7C 1K28A 1STBA 4CKBA 3HOXH 3CD6A 1JB7A 1I50H 5EAYA 3UE0A 1J5EL 1STGA 2BH8A 3IL8A 4EX5A 4KHPQ 1RODA 4WORA 4DNTB 4JI6Q 1WYDA 1KC8C 1FGBD 3G4SA 4DR5Q 1CKNB 1JJGA 3CQZH 1F2LA 1UEBA 3J81i 2WIIB 5GAGC 4C3JG 3J7YW 3A7LA 1LT6D 1HFNA 1FGUA 2EQSA 4LF6Q 1Q3LA 5EPJA 3UDXA 3CXCA 1HCZA 2B8FA 2K32A 2ZTDA 1C9OA 1HRJA 2K01A 1A3VA 2R92H 3HOWH 2KHSA 4R4IA 4YCVA 1PH1A 1I3QB 4ZAIA 1H95A 2PZTA 2G9HD 4DV7L 2R93B 1LT3D 1TY2A 1GXDC 1A3UA 1H9MA 2ZXOA 4S3SA 3PO2G 4GN4B 1WOCA 2CWAA 2H5XA 4I7AA 4DR1Q 5AJ3Q 4FF4A 3CCVA 3OWEB 4UHVA 3V96A 4LFCL 3TS2A 4BBRG 1D8LA 2AWNA 2B2YA 2LY7A 1I3QH 2ATWA 3T53B 3N52A 3I4NB 1S40A 1MHWC 1TVXA 1E24A 2DUDA 3D6WA 1C8CA 5C6AA 1QNUA 1B50A 1MIUA 1AFPA 2IX3A 1A3TA 1G91A 4UDUC 1O80A 1QZGA 3GTLH 2OCEA 4KHZA 1Z47A 3RNUA 5JJKA 2IJ0A 5EKLA 5IP9H 3HOZG 2M00A 1KLUD 2QA4A 3QB3A 2RHSB 4G7OC 3U4VA 1CHQD 1XWEA 2JYOA 5FJ8G 4A3BG 3NTIA 4H02A 4F7XA 1N34L 2UU9L 4IFDG 1EY7A 3I4NH 1B3QA 1S3OA 2H4OA 4QGUA 2OQKA 3FRPB 4IJHA 3PUVA 3QO2A 1K0SA 1VQLA 3C3LA 2WAQB 4KN4C 3PIO3 3S9WA 2PMZB 3T16A 2AHOB 3D3RA 4N9TA 3ITPA 4N9PA 2XVSA 1SNOA 2O5IC 1XMOQ 5E4XA 1SJHD 2RQXA 3GTMH 3KLSX 1JT8A 1KABA 2FJ2A 1KQSA 3TBIB 1VQMA 1HNZL 2J7ZA 2IX1A 2F0UA 2KENA 2PW5A 1N32L 3ERQA 1GJXA 1EQQA 1D5MC 3EN2A 3GTQB 5EGTA 1G2TA 3S2DB 3FPUB 1SMXA 5IGBA 3FP9A 3WDNA 1DGSA 3I4MG 4JI7L 3NSWA 3MXPA 1X54A 2AKWB 2RVLA 3GP7A 4HIKA 1CA6A 4K0KQ 2PZWA 1DOMA 2ENBA 2K75A 4JC0A 5A2QL 1SSOA 1QVCA 1BCPD 5HGTA 2ZXRA 5IGGA 3A8KE 3OPOA 5C3XA 5C44B 2UXCL 1SAPA 1VQEA 3Q22A 1I94L 1L1OB 1HZCA 2XSCA 5ELEA 3GTQH 5IIFA 5CC4A 1ONLA 1O7YA 1OO9B 4IZ8A 1TT2A 3S2DH 3L3OC 1FNWA 3QOLA 4MHEA 4CGYB 5IE8A 4ZUIA 1W3SA 1K83H 2EYOA 2Z8LA 1YEZA 3GV3A 3UE1A 2B2YC 4QJFA 3VR5A 1LLRD 4I7ZC 2EJMA 2IX0A 4DPGA 5M5YH 1GO3E 4X65Q 4KHPL 5IP7H 4JI6L 1I4QA 4IFDJ 3MAQA 1PZID 1SYCA 1V9PA 1BXTA 4DR5L 2BA1A 1EWHA 1ET9A 1MD2D 4A3MB 3LX0A 4IALA 1QUQA 1VQ6A 5IOCA 2B39A 1JJCB 5JJLA 1UNSA 4LFAQ 4KY5A 1EYGA 2O5JC 1STNA 3OMGA 2R6GA 1CKOA 2OTJA 3RLFA 5M3MB 2QKIC 4LF5Q 1L0XB 2NUCA 1VQJA 2WAQE 3F8TA 3M4PA 4CDEC 5CYUA 2PMZE 3K5NA 1S5BD 4OONA 3M7NA 1AE3A 1KDBA 3A74A 5IGEA 3MEFA 1Q86C 2OF1A 3DMUA 3BDOA 1HH2P 4IQZA 1E1TA 3EA6A 4A3MH 1UEAB 1PH9A 2JEAI 2VW9A 3OWFA 1AEXA 4H44C 4BY1G 4GS3A 4DR1L 5AJ3L 1M4VA 3ZJYC 4UPAA 1ET6A 3TP5A 5M3MH 2K28A 5NUCA 1S4ZA 4C3JB 1DM0B 1EIHA 2KJXA 2PNRC 1VQ7A 3R3OA 2IY5B 1U4LA 2CKZB 4FXDA 1WI5A 4YHHQ 2HQLA 4HJ8A 1FR3A 2EY1A 4G4KA 3U58A 1I4PA 1FD7D 5GADC 1TWFB 1BR9A 1W6KA 1SE3A 1JE4A 2WKCA 3M9BA 4DXGA 3PO2B 1GUNA 1HHVA 4C3JH 1SE4A 1HFGA 1TWHB 1HTPA 4FP5D 1IHZA 1K3BC 1ZKOA 3BVMA 2JA8G 2OQ0A 4K8IA 2WINB 3TQYA 4R8NA 4O2DA 1HXYD 3KBXA 3RLOA 1PH3A 4DNIA 1DCZA 2Z4IA 4MTKA 1BBUA 2B63G 4NKLA 1TWFH 3OW2A 1HA6A 4CHTB 5IYDG 4OWTB 3RD4A 5GAEC 2EYFA 2B3GA 3PO2H 4G7HC 3GTGH 4UP8A 3OYYA 4DN4M 2A6EC 1I4GA 5JPMC 1XMOL 1P16A 3S24A 1Y8OB 2JA5B 5EPLA 1UE1A 4IFDI 3CAMA 4P74A 3MXNA 1YBYA 1YHAA 5D3DA 4BBRH 4N8FA 1QOHA 2OT2A 3CMAA 3TMEA 2L4NA 2I07B 4DGZA 5CV5A 3FKIG 3VYTA 4JI5Q 1SYDA 4BA2I 4K0KL 1GUOA 2L9HA 1SMYC 4B9XA 1CTMA 3NXWA 3D4WA 1JB3A 1IL8A 3HOZH 4G57A 3TZUA 1Z7TA 2EY6A 4A3EG 5FJ8H 4A3BH 1S5FD 4L8JA 4IFDH 2JE6I 1VF5C 2A69C 2AQ1B 4ZLTF 4OXPA 4DUZQ 1K8GA 2HCIA 4X64Q 1HUMA 1SEBD 3MC0B 1HJPA 4PZ7A 4X65L 2FINB 1S5ED 2Q2UA 2ZT9C 1IZ6A 2ICEC 4JCVE 5KIXA 4HN7A 1TWGH 5E7NA 4GZYC 1Q46A 2GA4B 1VMPA 4MIUA 3PUWA 4LFAL 1GUSA 2MO0A 1BVSA 5LL6X 1WTXA 1YIJA 4IUVA 4LF5L 2HDLA 4HIMA 4YWMA 1B9NA 4IJLA 1CSPA 3GQBA 5LMNW 2NB0A 3I4MH 1YHBA 1IYUA 1EL0A 1OTCA 1NBWA 3DM1A 3T1HQ 4A93G 2EYPA 4Y7NH 1LTAD 3KJPA 4ULLA 3G7LA 2R93G 1JQYD 3NWTA 3FMCA 2F0IA 4X6AH 3K57A 4OGQC 2A19A 4EQ5A 5KNDA 5ELDA 5F2DA 4HMIA 5BN3A 3NP8A 3F2BA 4RCNA 1YVCA 3J7AV 5CORA 5J1ZA 1F77A 5L37A 3TN2A 5ELFA 3VDYA 2PI2A 3J81E 2P5ZX 4QCLA 5DAUA 1CUKA 2B2VA 1D7QA 3KJOA 4HJ7A 3SHLA 3E9IA 1YHQA 1PDQA 1YJNA 3CCUA 2K1BA 4A76A 3UDGA 3S1MB 5M5WB 3W2DA 4OX9Q 1LV9A 3R2IA 3DUZA 4JI2Q 4N8X1 1Y1WG 1O7IA 1GM5A 1NCVA 2EYMA 1DJRD 2CH4A 4GLAC 5FK9C 4XQQA 5EQ0A 1J8IA 2F0OA 4MNOA 2A6HC 2HT1A 1V43A 3HOUB 1M8AA 1SJED 2YYZA 1N33Q 1ASZA 1BCPF 1NY4A 2F0NA 1EZ6A 3NHHA 3S1MH 2ZTEA 2LKVA 4HCSA 5M5WH 1SXTA 5C4HA 1A62A 1V1PA 4PZ8A 1XPRA 3PIOA 4K6LA 1JORA 2E5LQ 3C1EA 2WAQG 3TP7A 4BY1H 2X6GA 5KEEA 4DK6C 3S15B 2PNHA 1STHA 2BA0A 4HMJA 2SOBA 3G6EA 4HJ5A 1TWAB 3MA2B 1OXXK 1EY9A 1XTDA 3CW2C 2YTVA 4C3IG 1FVIA 3E6ZX 2Q8IB 1HQMC 3CCSA 3A5UA 1SFOB 1Q81C 1VQGA 2I46A 2KOLA 3FHWA 4JI5L 2Z6BA 1NMGA 3NWSA 2F0LA 2RHQB 4P73A 3SVMA 5IT9E 4J8QA 1WTOA 1PFNA 1BDOA 1U5KA 2XNAC 1Y8NB 2B63B 2F4VQ 1YNJC 2KBNA 4V0BA 3Q6SA 1PYSB 3S1QB 1EYDA 1TWAH 2JEBI 4HCEA 3V2TA 4B9WA 5C44G 5CV6A 2HHHQ 4DV5Q 1SMYD 1GOZA 3E9HA 2OWOA 3AU7A 2WKDA 3S1NB 3VA5A 3X3MA 3CCJA 2JA8H 1SFOH 2CCZA 3M4OH 3IKJA 4NMZA 2MHVA 4NXNQ 4DUZL 1X3FA 3HZXA 3JC66 4HR7B 1N36Q 2L0CA 4X64L 1WTVA 1KL9A 2I5HA 3EQLC 2KCMA 1SROA 3IFTA 3J81L 2B63H 1XX8A 3FKIB 4Y52H 2B2VC 3DHQA 4ZQ3A 5IYDH 3PUZA 2K52A 3S1QH 2VNUD 4RKBA 2E8GA 3PQIA 4CDDC 2M9VA 1X55A 4A3JG 4CDFC 2VQFQ 1JR0D 1PFSA 5IGFA 5G3LD 3S1NH 2K5WA 1BUVT 4DFAA 1JWUD 4R4QA 3CC4A 2NVQB 4YWLA 4IO9A 1KNEA 1I4RA 1SNMA 3NK9A 3EVQA 1CA5A 2XWBB 4JBWA 1B9MA 3S2HB 4PZ6A 1GVPA 3FKIH 4IOAA 4Q5VA 4DUYQ 3T1HL 1KRSA 1CI3M 1I4HA 1U4RA 2B2TA 4HJ9A 4DK1A 1CFMA 2F0FA 3E0JA 1Q7YC 4X3SA 2EJFC 2F1MA 2I5LX 4R8IA 1KTKA 1U9RA 5ELCA 5J3BA 2NVQH 1NMFA 4RGOS 2KECA 3K7AB 4A3EH 1EFWA 3JAML 2F0JA 4LAAA 2WP8J 3S16B 2R3ZA 1ASYA 4KKTA 3J81c 3DWPA 5ELBA 4O0AA 1ENAA 3S17H 4L5QA 1PHJA 3H3VC 2WB1G 4X3KA 2D9UA 4I65A 4MN3A 5EKKA 4TKOB 3EIVA 2JJQA 3ND9A 3KDFB 4DKAC 1GD7A 2JA9A 5CV4A 3VR2A 4DNRB 4A93B 1MJCA 2L11A 3UI2A 2Z9HA 1CT1D 5A2QE 4OX9L 5IT9L 4JI2L 1X56A 1V1PB 2LMCB 2N49A 3S16H 3FPPA 5JPNC 5CV8A 1ENFA 3D0FA 2EXZA 4TVAB 3I4LA 2JN4A 1KAWA 1F9SA 3F2UA 1N33L 1RIPA 2IHFA 3OMCA 3AMUA 3CPWA 3K7UC 2A5HA 3LWEA 1JMCA 1VQAA 3OIPA 2RF4A 4MZ9A 4JBMA 3STBC 4A93H 1LYLA 3M7GA 1CZWA 3BVGA 5E1FA 5JOBA 1GUGA 1WTHA 2RCNA 5JJZA 2E5LL 3JAMi 2R93H 1C48A 2DY7A 3SXHA 4DAYA 3H09A 2HUGA 3GTOB 3J81j 1Y1WB 1L0YB 1TS5A 2JA5G 1SYFA 2NVYB 4KK7A 3OHXC 5C4JB 3TS0A 5EBDA 2PI2E 1BQQT 1WJJA 5C0XG 5C5MA 3CU7A 3OIQA 5T1IA 4IPCA 3G71A 5IT9c 1JOKA 4P72A 4XXEA 1DOKA 4JV5Q 2F4VL 4DV3Q 3GTOH 2B2TC 1SE2A 1IBMQ 1CM9A 1HQRD 4CKEA 2XRSD 1Y1WH 4BBSG 1IYVA 2KCCA 1KXLA 1E0BA 2NVYH 2HHHL 4DV5L 3HRZC 1O7LA 1IYJB 1YNXA 5C4JH 4RGNA 1R9TB 2F0SA 1GUTA 4R4OA 1YNJD 4CBVA 3PCOB 1OXTA 2JA7G 3L7ZC 4JVZA 4C3IB 2MQHA 4NXNL 4RKLA 4WRDA 1XJVA 2EY2A 3PMFA 2EZVA 1N36L 1RD9D 3AFQA 4R9WA 1Y1VB 1FJGQ 3S14B 4YCUA 2VUMG 4A3FG 4GOPA 1EY0A 2EY5A 1K0RA 4OWXB 2XIWA 1LTRD 3K0XA 3S1RB 1AW7A 1E2ZA 4ZK9B 1KAAA 1LABA 2VQFL 1B1ZA 2L1BA 1WVLA 1R9TH 2ID0A 2ZJRA 4JI4L 1AN8A 1PMRA 1Q1EA 4C3IH 5H1SE 1MSGA 3NTHA 2E2IB 2K50A 3C2PA 1ZEQX 4C1NI 1BO0A 1Z9FA 1WTWA 1Y1VH 5ELOA 3S14H 2KCNA 2Z6KA 4JI8Q 2IPKD 3RN5A 2DNEA 3P75A 4DUYL 5I2YA 4IPDA 4E6IA
chains in the Genus database with same CATH topology
2EOTA 5K36G 2EDGA 3MTSA 4KD4A 1Y8PB 4ZRZA 1EEID 1PFMA 1Q90A 4A3JB 1QILA 1PFBA 1PRTC 1OXVA 1STAA 4RH6A 1DOLA 3K59A 5A35A 1IW7D 5KGUA 1KDAA 2KEDA 5C3EB 1K8OA 1WTQA 3KUPA 3CRKC 5ISRA 5LHY1 1SNPA 1KLGD 1FYCA 4K5WA 4KJOA 4U673 4OO1G 1EEFD 3VR6A 4A3DB 4U68A 4V190 4PV1C 4CKCA 2MJ8A 1JOOA 2RDGA 2PW7A 4KY7A 1PRTB 1I6VC 5TSSA 2K05A 5CBAE 3I73A 2AUKA 5D3IB 1U4PA 2FHTA 2WB1B 2K03A 3U9SA 5I2XA 4DAPA 5E4WC 4XQNA 4IUTA 4RWSC 1U4MA 4O42A 4X3TA 2Z4HA 1I6HB 1UUPA 1Z6HA 5IODA 3V05A 3MXUA 1RKNA 3GTKB 4ID6A 1H9RA 4QIWB 1QB5D 3MEHA 5G3LF 1Q1BA 1ZYRC 2K6AA 4KY6A 2CW0C 3GV6A 2A74C 4FXKC 4O1NA 4LK1C 2VB3X 3P7JA 3K0YA 1SYEA 3LNNA 4RFBA 5C0XI 3BG3A 1LTSD 2F0PA 3NE5B 2BE5C 2H1EA 1D6EC 3ONAB 4RA8A 2JP1A 3RZDB 2SDFA 1Y69U 3HOVB 1ILQA 4XTCS 2EYLA 5K5PA 1D5XC 2FFKB 4XYQA 3MXGA 1CZGA 4EQNA 4H7BA 2K7VA 2L12A 4NDXA 2X69A 4C2MB 4BBSB 3PUYA 3A8IE 4KV6A 4K2LA 3U9OA 4KTAA 2AQ2B 5C0XH 5IGDA 2JA7B 4FF1A 1G6ZA 1EQTA 4IUUA 1EFID 2HQEA 4EQOA 2BDNA 3D4RA 1SNCA 2VUMB 4A3FB 1OXUA 1EOTA 1TU2B 2NVTB 3NBHA 3AB9A 4M8AA 3E5SA 1AP0A 3NQTA 3T56B 5FOBB 5C3WA 1DYQA 5BN4A 3C46A 2PZUA 5JAVA 4CJ1B 4PQXA 1WCMB 3TP6A 3QG1A 3PIP3 5CBEE 1MSHA 2F0MA 1R4PB 5EJWA 3EJIA 1ICWA 4XT3B 2PPBC 1ML0D 1AZQA 1W6JA 1LTTD 3HEJA 3ZYYX 4OO1I 1X32A 1DD2A 4Q0FA 1XYIA 1KNAA 4K2KA 1B2TA 4ZYSA 3VYRA 2G9DA 3BYYB 5K36H 3T4AC 2M2LA 4KKUA 1VF7A 4A3IB 1QCBD 2K04A 1QWYA 3MZ5A 1RCVD 3R93A 5IGCA 5J22A 1TQOA 2L5TA 1NR4A 1WD1A 4BWGB 1EY4A 5I6YA 5KYIA 3QJYA 1H9SA 3GD7A 4X3UA 1T5EA 4BS9A 4OO1H 1EY6A 2F0DA 1RTNA 2NN6G 1ILPA 2E2JB 1C4QA 4FXGC 5JVH3 2F0WA 1CQFA 2RSNA 1G8ZD 4M1UB 2YU9B 4ZUJA 1SBBB 1II3A 3A8JE 4TQUS 2WACA 1R4QB 3JAME 1ZYRD 1EYAA 2CW0D 3O13A 3GTPB 2J4XA 2SNMA 3GO5A 4XT1B 5I9OA 2TMPA 5DNFA 4IUQA 1E2VA 3X3NA 2A6ED 4C3HG 2BE5D 4ILWA 2XN9C 1B4OA 1PXUA 2SEBD 2RSOA 4F87A 4WFN3 3M4YA 3TP8A 3MWYW 1CK1A 2F03A 2Z1CA 2C5CA 2NTSA 1F9RA 3K6OA 3M85A 3VR4A 3A54A 3HGBA 4PMWA 1F9PA 4K5VA 1BBXC 5T1GA 5EPKA 3T51B 3GTJB 3QWNA 3SK5A 3C1FA 2N55A 2QF7A 4EGVA 5FKAC 1EWCA 1EU4A 3MHBA 1K8MA 2A69D 3HOYB 1A15A 4IN3A 5JVG3 4J6HA 1KDCA 1S5CD 3P20A 2JXMB 2K5DA 2OEOA 2F0VA 1ENCA 3EFXD 5M3FB 3M3YB 3I3CA 3SK8A 2LFNA 3HOXB 3IFDA 1NAPA 1O7ZA 3FDTA 2NWGA 3I90A 1IKMA 2NBFA 3PV0A 2NYZD 1PZKD 2NVXB 2EJGC 3H6MA 3K5OA 5KNBA 1ESRA 3I91A 5I6WA 1TY0A 4XDXA 1H9SB 3SE0A 4OIKA 5CGKA 4FNFA 2F0TA 2Q8TA 1LTBD 4LMQD 3A7AB 1D1IA 4TSSA 5FLXE 1E2WA 4QUFA 2PCFB 3BZDB 1QJOA 2IW3A 4WJWA 1GHJA 1D1KA 2KEEA 1MBYA 2DN8A 4IUNA 3HP3A 3BDLA 4HEDA 1V8QA 3A55A 5M5XB 1GHKA 2A6HD 2DNCA 4PMCA 4RHSA 1H9KA 4ODGA 3GTLB 2IWHA 3KF8A 1JICA 3DEPA 3QOJA 2KA7A 4C1NK 2A68C 2KVMA 2NN6I 2AQ3B 4Z9CB 5KRUA 2E2DC 4RCOA 3DEOA 1LO5D 5FO8B 3R8BA 4H0LC 2CQAA 4A3GB 1TS2A 1TR5A 1XXGA 1PRTF 4KKSA 1G2SA 4AYBB 1YNNC 3GTMB 3SR1A 3TZDA 1AZPA 3NUCA 2K5QA 3CRLC 2NN6H 3D31A 4C3HB 1BNZA 5DEHA 3LWUA 3KLSA 1X3QA 2R61A 4PMBA 2MUYA 3P1HA 1WTPA 4NW2A 2HCCA 5C4ZA 1IKLA 3OOCA 5FO7B 1JWMD 5EKIA 3I70A 4RAUC 2MPMA 3EROA 2Y0SB 5FLXL 1HPCA 2PYKA 1SDFA 2RDFA 2D62A 4DF7A 2HDMA 2KUMA 2QDBA 1CQVA 1JWSD 2B2WA 1K83B 2B2UA 5E3FA 5AFWA 4HAEA 3I72A 5CMDA 1B44D 2FMMA 5M5YB 1NSNS 5C0XJ 3QIAA 1PZJD 4YIJA 3BS1A 3VR3A 3J80E 4K5XA 1D5ZC 2ZXPA 4JK1C 3SK6A 1B3AA 3SDZA 3PO3B 4IURA 2FMCA 2D5DA 3MFGA 3K58A 5FO9B 1Q12A 1VCIA 1JOQA 4KD3A 2VXWA 4FYDA 1SYBA 2WV6D 5DM73 3D6CA 1EQVA 2F3VA 2JSOA 1PTOF 1NUCA 1TS3A 4B08A 4A3KB 3CKIB 2NZ1D 4F88A 3Q23A 2PO4A 1DZ1A 1EZ8A 3OSOA 1PYWD 1SNQA 4K8JA 1D2BA 1FNUA 1F2ZA 4TRDA 3TDQA 3URYA 2ICIA 1F9QA 1LT5D 1MI2A 4OIJA 1BF4A 3TSSA 3RUZA 4K6DA 4EVOA 1TWCB 3KBGA 1V1OA 3N6RA 2EYHA 2B2WC 2A68D 5HURA 2B2UC 1WTRA 1A6XA 2E76C 2A73B 2QCPX 3GTGB 1TS4A 5C4XB 1TIID 4HSVA 4CJ2C 2OXPA 3SK4A 3D4DA 3Q24A 3J80L 4BBRB 3MVVA 2F4IA 4LJZC 1HA5A 3D8GA 2EPBA 1QNKA 1PTOC 3RZOB 1YNND 1S5DD 1I4XA 1JC7A 4FVMA 4KHVA 4BY7B 3Q0AA 1LTID 3DXJC 1Q8IA 1FNVA 1RDPD 4C56C 1A2TA 3DWAA 3HOZB 1UAPA 1F2MA 1STYA 1F2YA 3BYTB 4A3BB 5JEAG 2VB2X 4P2CB 3KLRA 4XYOA 2B8GA 1PTOB 4RHRA 1STEA 2L55A 1BOSA 3OW7A 1EY5A 4QB4A 4IUPA 4RGTA 1TWGB 5D14A 4NP5A 3CHBD 1VMCA 1ZXTA 5KNCA 3NPPA 3K5LA 4ABNA 2V4DA 1ESFA 4ME5A 2EVBA 1XTCD 1PTOH 3PUXA 2K33A 2CHBD 1LTGD 5DM63 1PRTD 3I4MB 3L9AX 4RGMA 4Y7NB 2F0GA 2NTTA 4L63B 4XQJA 1O78A 4HSPA 1HUNA 4DAVA 4DA2A 3DWQA 3BVZA 4DK0A 1RTOA 3HS0C 4KJNA 2F0KA 1GUWA 3H94A 2E74C 2E75C 4KMUC 2KQ3A 2XWJB 5CV9A 3MFYA 5JEAJ 3K5MA 1A2UA 4FF3A 1QG7A 4BA1I 1B53A 3VYSA 2CVRA 3WOFA 1OXSC 3VA7A 2LS01 3W3AA 2JA6B 3HKZB 1LT4D 4H13C 5LL6S 2F0HA 2BOSA 4HTHA 3I8ZA 3R2TA 2Q8RE 5I4DA 2MP1A 2QEJC 5COYA 2IL8A 4QMGA 3IAYA 4OHJA 2X6LA 1G291 4BY1B 2R7ZB 4XIGS 4EQPA 2XRQD 1LACA 1J9OA 2EE1A 2IT1A 1VDZA 3H0GB 1RJTA 3H91A 2O4XA 1EY8A 5I9PA 4PNYA 5CV7A 3NBIA 2SNSA 5BN5A 4J1MA 3A56A 1PTOD 2F0QA 3J7AF 1RF2D 1EU3A 2MGSA 3NTKA 2EYJA 3G6JB 1EYCA 2N88A 1X3PA 2JA8B 1T5XD 2TSSA 1QE6A 2RA4A 3M4OB 2O2LD 1DXMA 3FVQA 1DONA 1SYGA 2PQEA 4QF4A 4QUCA 3ND8A 4ZKCB 2D2CC 3KK7A 1H9JA 4L6TB 1PLFA 2QILA 2RBMA 2E2HB 2F3WA 3BDCA 4DU9A 4KI0A 5M9OA 3RMHA 3FEWX 3T13A 4KN7C 5EBCA 4OL7A 1WD0A 3VYUA 2RDHA 1HTLD 4F8MA 5D65A 1SNDA 2BCOA 1BCPC 4ZKBB 4K14A 3WOEA 1MGSA 1JCKB 2BDOA 1TKWB 1NR2A 4UAIA 3SEBA 4DXFA 2F0EA 1CHPD 2C9OA 2AUJD 1RHPA 4G7ZC 1I50B 4CJ0B 5CR3A 3HG9A 1EIGA 5C5LA 4A3EB 3NQIA 5JEAH 3CQZB 2RKSA 2J0TD 5KYLA 2DY8A 3S17B 5J39A 1BCPB 4FO2A 3HOWB 2R92B 4FF2A 2AWOA 1IW7C 4CKBA 1STBA 1STGA 3IL8A 1RODA 4WORA 4DNTB 1FGBD 1F2LA 2WIIB 4C3JG 3J7YW 3A7LA 1LT6D 1HFNA 1Q3LA 5EPJA 1HCZA 2B8FA 2K32A 1HRJA 2K01A 1A3VA 2KHSA 1I3QB 4ZAIA 2PZTA 2G9HD 2R93B 1LT3D 1TY2A 1GXDC 1A3UA 1H9MA 2ZXOA 4S3SA 4FF4A 3OWEB 3V96A 2AWNA 2B2YA 2LY7A 3T53B 3N52A 3I4NB 1TVXA 3D6WA 1C8CA 5C6AA 1QNUA 1B50A 1AFPA 2IX3A 1A3TA 1G91A 4UDUC 1O80A 4KHZA 1Z47A 2IJ0A 5EKLA 2M00A 1KLUD 3QB3A 4G7OC 1CHQD 1XWEA 2JYOA 3NTIA 4F7XA 4IFDG 1EY7A 2H4OA 3FRPB 3PUVA 3QO2A 3C3LA 2WAQB 4KN4C 3PIO3 3S9WA 2PMZB 3T16A 3D3RA 4N9TA 3ITPA 4N9PA 2XVSA 1SNOA 2O5IC 5E4XA 1SJHD 2RQXA 3KLSX 1KABA 2FJ2A 3TBIB 2IX1A 2J7ZA 2F0UA 2PW5A 3ERQA 1GJXA 1D5MC 3GTQB 5EGTA 1G2TA 3S2DB 3FPUB 5IGBA 3WDNA 3NSWA 3MXPA 2RVLA 3GP7A 1CA6A 2PZWA 1DOMA 2ENBA 5A2QL 1SSOA 5HGTA 1BCPD 2ZXRA 5IGGA 3A8KE 3OPOA 5C3XA 5C44B 1SAPA 3Q22A 2XSCA 5ELEA 5IIFA 5CC4A 1ONLA 1O7YA 1OO9B 4IZ8A 1TT2A 3L3OC 1FNWA 3QOLA 4MHEA 4CGYB 4ZUIA 2EYOA 2Z8LA 3GV3A 2B2YC 3VR5A 1LLRD 4I7ZC 2EJMA 2IX0A 1I4QA 4IFDJ 3MAQA 1PZID 1SYCA 1BXTA 2BA1A 1EWHA 1ET9A 1MD2D 4A3MB 3LX0A 4IALA 5IOCA 2B39A 1UNSA 4KY5A 2O5JC 1STNA 3OMGA 2R6GA 3RLFA 5M3MB 2QKIC 1L0XB 2NUCA 5CYUA 3K5NA 1S5BD 3M7NA 1KDBA 5IGEA 2OF1A 3DMUA 3BDOA 4IQZA 3EA6A 2JEAI 1UEAB 3OWFA 1AEXA 4H44C 1M4VA 1ET6A 3TP5A 2K28A 5NUCA 1S4ZA 4C3JB 1DM0B 1EIHA 2KJXA 2PNRC 3R3OA 1U4LA 4FXDA 1FR3A 2EY1A 4G4KA 1I4PA 1FD7D 1TWFB 1BR9A 1W6KA 1SE3A 1JE4A 2WKCA 4DXGA 3PO2B 1GUNA 1HHVA 1SE4A 1HFGA 1TWHB 1HTPA 4FP5D 1IHZA 1ZKOA 3BVMA 4K8IA 2WINB 4R8NA 1HXYD 3KBXA 1DCZA 2Z4IA 4NKLA 1HA6A 4CHTB 3RD4A 2EYFA 4G7HC 4DN4M 2A6EC 1I4GA 5JPMC 1Y8OB 2JA5B 5EPLA 4IFDI 3MXNA 5D3DA 1QOHA 2OT2A 3TMEA 2L4NA 2I07B 4DGZA 5CV5A 3VYTA 1SYDA 4BA2I 1GUOA 2L9HA 1SMYC 4B9XA 1CTMA 3NXWA 3D4WA 1JB3A 1IL8A 4G57A 3TZUA 1Z7TA 2EY6A 1S5FD 4L8JA 4IFDH 2JE6I 1VF5C 2A69C 2AQ1B 4ZLTF 2HCIA 1HUMA 1SEBD 3MC0B 2FINB 1S5ED 2ZT9C 2ICEC 5KIXA 4HN7A 4GZYC 2GA4B 1VMPA 4MIUA 3PUWA 1GUSA 5LL6X 1WTXA 4IUVA 2HDLA 1B9NA 3GQBA 2NB0A 1IYUA 1EL0A 3DM1A 2EYPA 1LTAD 4ULLA 3G7LA 1JQYD 3NWTA 3FMCA 2F0IA 3K57A 4OGQC 5KNDA 5ELDA 5F2DA 4HMIA 5BN3A 3NP8A 4RCNA 3J7AV 5CORA 5J1ZA 1F77A 3TN2A 5ELFA 3J81E 4QCLA 5DAUA 2B2VA 3SHLA 1PDQA 2K1BA 3S1MB 5M5WB 3W2DA 1LV9A 3R2IA 3DUZA 1NCVA 2EYMA 1DJRD 5FK9C 4XQQA 5EQ0A 1J8IA 2F0OA 2A6HC 1V43A 3HOUB 1M8AA 1SJED 2YYZA 1BCPF 2F0NA 1EZ6A 3NHHA 2LKVA 4HCSA 1SXTA 5C4HA 1V1PA 4K6LA 1JORA 3C1EA 3TP7A 2X6GA 5KEEA 3S15B 1STHA 2BA0A 4HMJA 2SOBA 1TWAB 3MA2B 1OXXK 1EY9A 4C3IG 3E6ZX 2Q8IB 1HQMC 1SFOB 2I46A 2KOLA 3NWSA 2F0LA 3SVMA 5IT9E 4J8QA 1WTOA 1PFNA 1BDOA 2XNAC 1Y8NB 2B63B 1YNJC 4V0BA 3Q6SA 3S1QB 1EYDA 2JEBI 4HCEA 3V2TA 4B9WA 5CV6A 1SMYD 1GOZA 3AU7A 2WKDA 3S1NB 3VA5A 3X3MA 3IKJA 4NMZA 2MHVA 3HZXA 4HR7B 2L0CA 1WTVA 3EQLC 3IFTA 3J81L 1XX8A 3FKIB 2B2VC 3DHQA 4ZQ3A 3PUZA 2VNUD 4RKBA 2M9VA 1JR0D 5IGFA 5G3LD 2K5WA 1BUVT 4DFAA 1JWUD 2NVQB 1KNEA 1I4RA 1SNMA 3NK9A 3EVQA 1CA5A 2XWBB 4JBWA 1B9MA 3S2HB 4Q5VA 1CI3M 1I4HA 1U4RA 2B2TA 4DK1A 1CFMA 2F0FA 3E0JA 4X3SA 2EJFC 2F1MA 4R8IA 1KTKA 1U9RA 5ELCA 4RGOS 2KECA 3K7AB 3JAML 2F0JA 4LAAA 2WP8J 3S16B 2R3ZA 4KKTA 3DWPA 5ELBA 1ENAA 3H3VC 4X3KA 2D9UA 5EKKA 4I65A 4MN3A 4TKOB 3ND9A 5CV4A 3VR2A 4DNRB 4A93B 2L11A 3UI2A 1CT1D 5A2QE 5IT9L 1V1PB 2LMCB 3FPPA 5JPNC 5CV8A 1ENFA 2EXZA 3I4LA 1F9SA 3F2UA 3OMCA 3AMUA 2A5HA 3LWEA 3OIPA 3M7GA 1CZWA 3BVGA 5E1FA 5JOBA 1GUGA 5JJZA 1C48A 2DY7A 3SXHA 4DAYA 3H09A 2HUGA 3GTOB 1Y1WB 1L0YB 1TS5A 1SYFA 2NVYB 4KK7A 3OHXC 5C4JB 5EBDA 1BQQT 5C0XG 5C5MA 3CU7A 3OIQA 5T1IA 1JOKA 4XXEA 1DOKA 2B2TC 1SE2A 1CM9A 1HQRD 4CKEA 2XRSD 1IYVA 2KCCA 1E0BA 3HRZC 1O7LA 4RGNA 1R9TB 2F0SA 1GUTA 1YNJD 4CBVA 1OXTA 3L7ZC 4C3IB 4RKLA 4WRDA 2EY2A 3PMFA 2EZVA 1RD9D 4R9WA 1Y1VB 3S14B 1EY0A 2EY5A 2XIWA 1LTRD 3S1RB 1AW7A 1E2ZA 4ZK9B 1KAAA 1LABA 1B1ZA 2L1BA 1WVLA 2ID0A 1AN8A 1PMRA 1Q1EA 1MSGA 3NTHA 2E2IB 3C2PA 1ZEQX 4C1NI 1BO0A 1WTWA 2KCNA 2IPKD 2DNEA 3P75A 5I2YA 4E6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR7 B;  3M4Y A;  4G7O C;  1Q1B A;  5JEA H;  2R6G A;  3RLF A;  1ZYR C;  2EDG A;  5K36 G;  1LAC A;  3A7A B;  2CW0 C;  1GUG A;  3EQL C;  1Y8P B;  5KNC A;  4IFD G;  1E2W A;  3IFT A;  2PPB C;  2IT1 A;  1VDZ A;  2PCF B;  2V4D A;  4LK1 C;  3PUZ A;  3M85 A;  1QJO A;  1HPC A;  3VR4 A;  4BA2 I;  1Q90 A;  2EVB A;  1GUO A;  2D62 A;  3M7N A;  1SMY C;  3LNN A;  1GHJ A;  3PUX A;  1OXV A;  3BG3 A;  2K33 A;  3NE5 B;  2BE5 C;  3HGB A;  5A35 A;  1CTM A;  2AWO A;  1IW7 C;  3BDO A;  3PUV A;  4IQZ A;  4KN4 C;  2JEA I;  1DD2 A;  1IW7 D;  1Y69 U;  3N6R A;  1K8O A;  2DN8 A;  2A68 D;  5BN5 A;  4H44 C;  4XTC S;  3TZU A;  1Z7T A;  3CRK C;  1O78 A;  2E76 C;  1V8Q A;  2A6H C;  3T51 B;  4DNT B;  5C0X G;  1V43 A;  2O5I C;  5K36 H;  1GHK A;  4JBW A;  1FYC A;  3I72 A;  2YYZ A;  1B9M A;  4L8J A;  2A6H D;  2DNC A;  4IFD H;  2JE6 I;  1H9K A;  4OO1 G;  1VF5 C;  2QF7 A;  3A7L A;  4KKU A;  1GJX A;  3QIA A;  1VF7 A;  2PNR C;  2K7V A;  3VR6 A;  2A69 C;  1CI3 M;  4DK0 A;  3VR3 A;  1K8M A;  2A69 D;  4PV1 C;  2KA7 A;  1HCZ A;  1CFM A;  2B8F A;  4DK1 A;  1DXM A;  2K32 A;  3WDN A;  1IYV A;  3PUY A;  1FR3 A;  2EJF C;  3A8I E;  2A68 C;  3H94 A;  2F1M A;  2KCC A;  4JK1 C;  4LJZ C;  2E74 C;  2L5T A;  2NN6 I;  2E75 C;  3ND8 A;  2D2C C;  1O7L A;  1I6V C;  2ZT9 C;  3P20 A;  4KMU C;  2JXM B;  4GZY C;  1H9J A;  5C0X H;  3SDZ A;  3I73 A;  1A6X A;  2BA0 A;  3QJY A;  2AUK A;  3MFY A;  1GUT A;  1H9S A;  3GD7 A;  1OXT A;  1OXX K;  3A8K E;  3OPO A;  3L7Z C;  1GUN A;  1T5E A;  1H9M A;  4KKT A;  4OO1 H;  3PUW A;  4KI0 A;  1GUS A;  2NN6 G;  2D5D A;  3D4R A;  2Q8I B;  1HTP A;  3DXJ C;  4BA1 I;  4H0L C;  1HQM C;  1Q12 A;  1ZKO A;  1OXU A;  1B9N A;  4KN7 C;  3U9S A;  1ONL A;  1TU2 B;  3GQB A;  4TKO B;  1VCI A;  1OXS C;  3VA7 A;  3AB9 A;  3ND9 A;  3A8J E;  3PV0 A;  4KKS A;  1IYU A;  1E2Z A;  4TQU S;  3VR2 A;  4DNR B;  1YNN C;  3T56 B;  3W3A A;  5JEA G;  1BDO A;  1DCZ A;  1LAB A;  3T53 B;  1Y8N B;  2EJG C;  3VR5 A;  4H13 C;  1YNJ C;  5KNB A;  5BN4 A;  2LMC B;  3KLR A;  4I7Z C;  2EJM A;  1Z6H A;  2BDO A;  1TKW B;  2B8G A;  2JEB I;  3CRL C;  3FMC A;  1PMR A;  1Q1E A;  3FPP A;  4G7H C;  4OGQ C;  2A6E C;  2NN6 H;  3D31 A;  1E2V A;  5KND A;  3MXU A;  3LWU A;  2A6E D;  1Y8O B;  3I4L A;  3OW7 A;  2BA1 A;  4KHZ A;  1EWH A;  1H9R A;  2BE5 D;  5BN3 A;  1H9S B;  3SE0 A;  2AUJ D;  4G7Z C;  1G29 1;  4RCN A;  3IKJ A;  2DNE A;  3OOC A;  3QG1 A;  4XIG S;  2O5J C; 
#chains in the Genus database with same CATH topology
 2EOT A;  4HID A;  2UUA Q;  5K36 G;  2EDG A;  3MTS A;  4KD4 A;  4B3R Q;  1Y8P B;  2UUC Q;  4ZRZ A;  1EEI D;  4DK3 C;  1PFM A;  1Q90 A;  5C44 H;  3CP0 A;  4A3J B;  1QIL A;  1PFB A;  2YV5 A;  1PRT C;  1OXV A;  1STA A;  2E2I H;  4RH6 A;  1DOL A;  1EIY B;  3K59 A;  5A35 A;  1M90 C;  1IW7 D;  3H15 A;  5KGU A;  1KDA A;  2KED A;  5C3E B;  1K8O A;  1WTQ A;  5GAH C;  3KUP A;  3CRK C;  5ISR A;  5LHY 1;  1SNP A;  1KLG D;  1FYC A;  4K5W A;  2VZA A;  4KJO A;  4U67 3;  3RN2 A;  4OO1 G;  1EEF D;  3UDF A;  3LGJ A;  3VR6 A;  3ULP A;  4A3D B;  4A3J H;  1HR0 W;  4U68 A;  4A3I G;  4V19 0;  4PV1 C;  3A0J A;  4CKC A;  2MJ8 A;  1JOO A;  2RDG A;  4R4C A;  2PW7 A;  4KY7 A;  4DAY B;  1K3R A;  1PRT B;  1I6V C;  5C3E H;  4L5R C;  1X9N A;  5TSS A;  2K05 A;  5CBA E;  3I73 A;  2CWP A;  4J15 A;  2AUK A;  5D3I B;  2A1A A;  1U4P A;  1IL2 A;  5IYB G;  3HOU G;  2QEX A;  2FHT A;  1KIX A;  2WB1 B;  4APV A;  2K03 A;  5JJI A;  1N9W A;  3U9S A;  1K9M C;  4NXM Q;  5I2X A;  2K5V A;  1NE3 A;  1RL2 A;  4GOP C;  4DAP A;  2B29 A;  5E4W C;  4YCW A;  3KLW A;  4XQN A;  4IUT A;  4RWS C;  1U4M A;  4O42 A;  5FLM G;  4X3T A;  4DV2 Q;  2Z4H A;  1I6H B;  1UUP A;  1Z6H A;  5IOD A;  3V05 A;  1J6Q A;  3BZK A;  3PF5 A;  3MXU A;  1RKN A;  3GTK B;  4ID6 A;  3M4Q A;  1H9R A;  4QIW B;  2Z6K C;  1P8L A;  1QB5 D;  3IRB A;  3MEH A;  4JV5 L;  4DV3 L;  5G3L F;  1Q1B A;  1ZYR C;  2K6A A;  4KY6 A;  1IBM L;  2CW0 C;  3GV6 A;  2A74 C;  4FXK C;  4O1N A;  4GOP B;  4GNX A;  4LK1 C;  2VB3 X;  1I6H H;  1VQK A;  4JOI A;  3P7J A;  3K0Y A;  3AEV A;  3E3X A;  1SYE A;  3LNN A;  4RFB A;  5C0X I;  3BG3 A;  3CCQ A;  1LTS D;  2F0P A;  3NE5 B;  2BE5 C;  1TWH H;  4LUV A;  2H1E A;  1D6E C;  3ONA B;  4RA8 A;  2JP1 A;  3RZD B;  2DJG C;  2SDF A;  1Y69 U;  3HOV B;  1ILQ A;  4XTC S;  2EYL A;  1FJG L;  4GKJ Q;  5K5P A;  4ME3 A;  1D5X C;  2FFK B;  3ULJ A;  1PH5 A;  4XYQ A;  3MXG A;  1CZG A;  4EQN A;  4H7B A;  2K7V A;  2L12 A;  1IXR A;  4NDX A;  2X69 A;  4C2M B;  4BBS B;  3HOY G;  2JA5 H;  2BH2 A;  1VQ9 A;  4JG2 A;  3PUY A;  3A8I E;  3RZD H;  2WB1 E;  4KV6 A;  4K2L A;  4JYA Q;  3U9O A;  4KTA A;  2AQ2 B;  5C0X H;  1W2B A;  5IGD A;  4JI8 L;  2JA7 B;  2ZTC A;  4FF1 A;  1G6Z A;  1NTG A;  1EQT A;  4IUU A;  1EFI D;  1QUQ B;  4GKK Q;  4LF7 Q;  2I5M X;  2HQE A;  3W1G A;  4EQO A;  2BDN A;  3D4R A;  2UUA L;  5M3F G;  1SNC A;  4B3R L;  2UUC L;  2VUM B;  1E1O A;  4A3F B;  1OXU A;  1EOT A;  1TU2 B;  2NVT B;  4FDB A;  3J80 i;  4BBS H;  3NBH A;  1EUJ A;  3AB9 A;  4M8A A;  3E5S A;  1AP0 A;  3NQT A;  1QZH A;  3T56 B;  3K81 C;  1PH6 A;  5FOB B;  5C3W A;  1KRT A;  2V1C C;  4R4T A;  1VQ5 A;  4QIW E;  1DYQ A;  2MO1 A;  5BN4 A;  2JA7 H;  2KHJ A;  4LF8 Q;  3C46 A;  2PZU A;  1VQ4 A;  5JAV A;  4CJ1 B;  4PQX A;  2VUM H;  4A3F H;  5HGQ A;  4QL5 A;  4WJ4 A;  1WCM B;  3TP6 A;  2NVT H;  3QG1 A;  3ER0 A;  3PIP 3;  5CBE E;  2UXB Q;  1MSH A;  2F0M A;  4RG1 A;  2D0O A;  1R4P B;  5EJW A;  4QY7 A;  3EJI A;  1ICW A;  2LXJ A;  4XT3 B;  2PPB C;  4GNX C;  4GN3 B;  1VQ8 A;  1ML0 D;  1AZQ A;  1W6J A;  4JOI C;  1LTT D;  1X6O A;  3L0O A;  3HEJ A;  3NEM A;  4B3M Q;  3ZYY X;  4OO1 I;  1PV4 A;  1X32 A;  1DD2 A;  4Q0F A;  1XMQ Q;  3OTO Q;  4IOC A;  1XYI A;  1KNA A;  4K2K A;  3RR5 A;  1B2T A;  4ZYS A;  3VYR A;  2G9D A;  3BYY B;  5K36 H;  4NXM L;  3T4A C;  2M2L A;  4KKU A;  1VQB A;  2VS1 A;  1VF7 A;  4A3I B;  1QCB D;  2K04 A;  1QWY A;  3MZ5 A;  2EIF A;  4DV2 L;  1RCV D;  4GNX B;  3R93 A;  5IGC A;  5J22 A;  1TQO A;  1M1K C;  2L5T A;  1NR4 A;  1WD1 A;  4BWG B;  1EY4 A;  1VQO A;  5I6Y A;  5KYI A;  3QJY A;  3AFP A;  1H9S A;  3GD7 A;  4X3U A;  1T5E A;  4X62 Q;  4BS9 A;  4OO1 H;  3MXN B;  1EY6 A;  2F0D A;  1RTN A;  4GLV B;  2NN6 G;  1ILP A;  2E2J B;  4DV4 Q;  1C4Q A;  4FXG C;  5JVH 3;  1N8R C;  4A3I H;  2F0W A;  1CQF A;  4UP9 A;  4A3G G;  2K5H A;  2RSN A;  1G8Z D;  4M1U B;  2YU9 B;  4ZUJ A;  1SBB B;  1II3 A;  3A8J E;  4TQU S;  2WAC A;  1T9H A;  1V1Q A;  1R4Q B;  4AYB G;  3E0E A;  3JAM E;  1ZYR D;  3CPF A;  3KYH C;  1EYA A;  3AQQ A;  3KF6 A;  2CW0 D;  3O13 A;  3GTP B;  2J4X A;  2SNM A;  3HOU H;  5IYB H;  3GO5 A;  4XT1 B;  5I9O A;  2Q2I A;  2TMP A;  1MJE A;  5DNF A;  4GKJ L;  4IUQ A;  1E2V A;  2N78 A;  3X3N A;  2A6E D;  4C3H G;  2E2J H;  2UXD Q;  1SRU A;  4AIM A;  2QGQ A;  2BE5 D;  1Y1V G;  2PQA A;  4ILW A;  2YU9 H;  2XN9 C;  1B4O A;  1PXU A;  2SEB D;  2RSO A;  4F87 A;  1WFQ A;  4WFN 3;  3M4Y A;  3TP8 A;  3MWY W;  1CK1 A;  2F03 A;  1U0L A;  1I5F A;  2Z1C A;  2C5C A;  2NTS A;  5FLM H;  3S15 H;  1F9R A;  3K6O A;  3CCE A;  3NBH B;  3GTP H;  2Y0S G;  3M85 A;  4JYA L;  3VR4 A;  4LFB Q;  3A54 A;  3HGB A;  4POG A;  4PMW A;  1F9P A;  4GKK L;  4LF7 L;  4K5V A;  4BXX G;  3K8A A;  1BBX C;  1YI2 A;  4ZCK A;  5T1G A;  1AE2 A;  5EPK A;  3T51 B;  2D0P A;  3GTJ B;  3QWN A;  3SK5 A;  3C1F A;  2N55 A;  2QF7 A;  4EGV A;  5FKA C;  1EWC A;  3T1Y Q;  1EU4 A;  3MHB A;  1K8M A;  2A69 D;  3HOY B;  1A15 A;  4IN3 A;  5JVG 3;  1KD1 C;  2Z0S A;  4J6H A;  1KDC A;  2K5N A;  4LF8 L;  3GDE A;  4JI4 Q;  1S5C D;  3P20 A;  2EXD A;  2JXM B;  2HIX A;  5C3E G;  4JI1 Q;  2K5D A;  1HNW Q;  2OEO A;  1SN8 A;  4GN5 A;  2F0V A;  3GTJ H;  1PH8 A;  2F3I A;  2GVA A;  1ENC A;  2UXB L;  3PO3 G;  3EFX D;  5M3F B;  4OEM B;  3QR8 A;  3M3Y B;  3I3C A;  3SK8 A;  2Q2T A;  2LFN A;  3HOX B;  1LM0 A;  3IFD A;  3F2D A;  4A3D G;  1NAP A;  1O7Z A;  3HOY H;  3FDT A;  4NPS A;  2NWG A;  2VL6 A;  3I90 A;  1IKM A;  2NBF A;  3PV0 A;  2NYZ D;  1PZK D;  2NVX B;  5IYC H;  2EJG C;  3H6M A;  2ZJQ A;  1E3P A;  4B3M L;  3K5O A;  5KNB A;  1ESR A;  3HFZ B;  3BJU A;  1XMQ L;  3OTO L;  3I91 A;  3S2H H;  4A75 A;  5M3F H;  4A3K G;  5I6W A;  1TY0 A;  4XDX A;  4A3C G;  1H9S B;  3SE0 A;  4OIK A;  1B70 B;  2CQO A;  3DLL A;  5CGK A;  4FNF A;  2F0T A;  2Q8T A;  1LTB D;  1L1O A;  1YZ6 A;  4LMQ D;  2NVX H;  3A7A B;  1SE8 A;  1D1I A;  4TSS A;  5FLX E;  1E2W A;  2CFM A;  1A63 A;  3K7A H;  3J7A 5;  4QUF A;  2PCF B;  3BZD B;  5GRO A;  1QJO A;  4UY8 C;  1VQI A;  1HNX Q;  2IW3 A;  4WJW A;  1GHJ A;  3H3V I;  1D1K A;  2KEE A;  1MBY A;  3KF6 B;  1PYB A;  4X62 L;  2ZJP A;  2YTX A;  1B7Y B;  4DV0 Q;  4DR7 Q;  2DN8 A;  4IUN A;  4DV4 L;  3I2Z A;  3HP3 A;  3BDL A;  4HED A;  1BKB A;  1V8Q A;  3A55 A;  5M5X B;  1GHK A;  2PQA B;  4AH6 A;  2A6H D;  2DNC A;  4PMC A;  1Q82 C;  1HR0 Q;  4RHS A;  1H9K A;  3JAM c;  2Q2H A;  4ODG A;  3GTL B;  5C4X G;  2IWH A;  3KF8 A;  1NJI C;  1JIC A;  3DEP A;  4LF9 Q;  3QOJ A;  1PH7 A;  2KA7 A;  4C1N K;  1A8V A;  3I4O A;  2XTI A;  2A68 C;  2KVM A;  2NN6 I;  4DV6 Q;  2AQ3 B;  2UXD L;  3HOV G;  1XNQ Q;  3H3V H;  4Z9C B;  5KRU A;  2E2D C;  4RCO A;  3DEO A;  1CKM A;  5M5X H;  2UUB Q;  1LO5 D;  2ZM6 Q;  4DR2 Q;  2RCF A;  2LSS A;  1PH2 A;  5FO8 B;  4BY7 G;  5IY0 A;  3R8B A;  4H0L C;  2CQA A;  3TRZ A;  4A3G B;  1TS2 A;  1TR5 A;  2WFW A;  1XXG A;  2DJF C;  1PH4 A;  1PRT F;  3B6Y A;  4KKS A;  2IHE A;  1G2S A;  4LFB L;  2NZH A;  4AYB B;  1YNN C;  3GTM B;  3SR1 A;  3TZD A;  2I0Q A;  3EBE A;  1AZP A;  4JBK A;  3NUC A;  4DR4 Q;  4P75 A;  2K5Q A;  3CRL C;  2NN6 H;  3D31 A;  4C3H B;  1BNZ A;  5DEH A;  2VY3 A;  2QW7 A;  3LWU A;  2F52 A;  3KLS A;  1X3Q A;  2R61 A;  4PMB A;  2MUY A;  3ULL A;  3ICE A;  1NNX A;  3P1H A;  3TRE A;  1WTP A;  4A3G H;  4NW2 A;  2HCC A;  5C4Z A;  1IKL A;  1EQR A;  2R7D A;  3OOC A;  5FO7 B;  1JWM D;  5EKI A;  3T1Y L;  3I70 A;  4RAU C;  1L1O C;  2MPM A;  3ERO A;  2Y0S B;  1VQN A;  5FLX L;  1HPC A;  2PYK A;  1SDF A;  2RDF A;  2D62 A;  4DF7 A;  4JI1 L;  4C3H H;  1JE5 A;  2HDM A;  2NZO A;  1VQC A;  2KUM A;  1HNW L;  2AMC B;  1XNR Q;  4LF4 Q;  4LW1 A;  2QDB A;  1CQV A;  1JWS D;  5LMU Q;  3Q8D A;  2B2W A;  3I7F A;  4YY3 Q;  1K83 B;  2B2U A;  5E3F A;  3PIP A;  1WCM G;  3S1R H;  5AFW A;  2DGY A;  2VQE Q;  4HAE A;  3I72 A;  5CMD A;  1B44 D;  2FMM A;  3CCR A;  5M5Y B;  1NSN S;  4MTN A;  1X3G A;  5C0X J;  3QIA A;  4WJ3 M;  1PZJ D;  1K73 C;  4YIJ A;  3BS1 A;  3VR3 A;  4GLX A;  1PA6 A;  3J80 E;  4LUO A;  4K5X A;  3SGI A;  1D5Z C;  2ZXP A;  1FL0 A;  4JK1 C;  3SK6 A;  4BXX H;  4P71 A;  1VQF A;  3K80 C;  1B3A A;  4R1J A;  3SDZ A;  3W5O A;  3PO3 B;  4IUR A;  2FMC A;  3PF4 A;  5FLX c;  3A5Z B;  4AYB E;  1LUZ A;  2D5D A;  3MFG A;  3K58 A;  5FO9 B;  1Q12 A;  5IWA Q;  1VCI A;  1JOQ A;  4A3L G;  1AH9 A;  4KD3 A;  2CH4 W;  2VXW A;  1HNX L;  4B3T Q;  4FYD A;  1SYB A;  2WV6 D;  4LF6 L;  3KF8 B;  4JI0 Q;  5DM7 3;  3D6C A;  4UP7 A;  4DR3 Q;  1EQV A;  1X65 A;  2JA6 G;  3HKZ G;  1IBK Q;  2F3V A;  2JSO A;  1PTO F;  4DV0 L;  4DR7 L;  1IBL Q;  2N3S A;  1NUC A;  3F1Z A;  3PO3 H;  1TS3 A;  4YWK A;  1X3E A;  4B08 A;  4A3K B;  4B3S Q;  3CKI B;  3KOJ A;  5LMN Q;  2NZ1 D;  4F88 A;  3Q23 A;  2PO4 A;  1HR0 L;  4A3D H;  2Y0S E;  1DZ1 A;  1EZ8 A;  3OSO A;  1PYW D;  2R7Z G;  2K4K A;  1SNQ A;  4K8J A;  1D2B A;  4LF9 L;  1FNU A;  4LUZ A;  1F2Z A;  3STB D;  4TRD A;  4ALP A;  1TXY A;  3PGZ A;  4DV6 L;  5HY6 A;  3TDQ A;  3URY A;  2ICI A;  1F9Q A;  1LT5 D;  1MI2 A;  2QDL A;  1XNQ L;  3H0G G;  1K8A C;  4A3K H;  4OIJ A;  1BF4 A;  3TSS A;  3RUZ A;  4K6D A;  2UUB L;  4A3C H;  2ZM6 L;  1YIT A;  4EVO A;  1TWC B;  3KBG A;  4DR2 L;  1V1O A;  3N6R A;  2EYH A;  2B2W C;  2A68 D;  5HUR A;  3TEH B;  2B2U C;  1WTR A;  1A6X A;  2E76 C;  2A73 B;  1HZ9 A;  2QCP X;  1KHI A;  3GTG B;  1TS4 A;  5C4X B;  5GQO A;  1TII D;  4HSV A;  1LTL A;  2OXP A;  4CJ2 C;  3SK4 A;  3D4D A;  3Q24 A;  4DR4 L;  4CDC C;  3GTK H;  3J80 L;  4BBR B;  3MVV A;  2F4I A;  1UE7 A;  1ICF B;  1TWC H;  4LJZ C;  3D8G A;  1HA5 A;  2EPB A;  1QNK A;  1PTO C;  2C35 B;  4DR6 Q;  4JI3 Q;  3RZO B;  1L2F A;  3DM3 A;  1YNN D;  1VS0 A;  4NB3 A;  1S5D D;  3I56 A;  1I4X A;  1JC7 A;  4FVM A;  4KHV A;  5C4X H;  4BY7 B;  3Q0A A;  1LTI D;  3DXJ C;  1Q8I A;  1FNV A;  1RDP D;  3F2C A;  1UWV A;  4C56 C;  1A2T A;  3DWA A;  3CCM A;  3HOZ B;  4X66 Q;  1UAP A;  1F2M A;  1STY A;  3WWV A;  1F2Y A;  2JQO A;  1E22 A;  2MFI A;  3BYT B;  3HOV H;  4A3B B;  5JEA G;  2KCT A;  4DAM A;  4DV1 Q;  1XNR L;  5IYC G;  4LF4 L;  3RZO H;  1XPU A;  2VB2 X;  1MKH A;  1A0I A;  3BU2 A;  1JJ2 A;  5LMU L;  4P2C B;  2OTL A;  4YY3 L;  3KLR A;  4XYO A;  2B8G A;  1PTO B;  4RHR A;  1STE A;  2L55 A;  1BOS A;  2VQE L;  4BY7 H;  3NEL A;  3CC2 A;  3OW7 A;  1EY5 A;  3W1B A;  4QB4 A;  3HOX G;  4IUP A;  1BBW A;  4C2M H;  4RGT A;  3J80 c;  1HZB A;  1TWG B;  2HD3 A;  5D14 A;  3NEN A;  4NP5 A;  3CHB D;  1VMC A;  1QVG A;  1ZXT A;  1SR3 A;  1E7Z A;  5KNC A;  3NPP A;  3K5L A;  4ABN A;  2V4D A;  1ESF A;  2KHI A;  4ME5 A;  2EVB A;  1XTC D;  1PTO H;  3PUX A;  1HZA A;  2K33 A;  2CHB D;  1LTG D;  5DM6 3;  2FXQ A;  4OWW B;  1EOV A;  1PRT D;  4OEL B;  1UE6 A;  3HOW G;  2R92 G;  3I4M B;  3L9A X;  4RGM A;  4LWC A;  4Y7N B;  2F0G A;  3U50 C;  2GVB A;  2NTT A;  4L63 B;  4XQJ A;  2GN5 A;  5IWA L;  1O78 A;  3BZC A;  4HSP A;  1HUN A;  4DAV A;  4B3T L;  4DA2 A;  4AQY Q;  4JI0 L;  3DWQ A;  3BVZ A;  4DR3 L;  4DK0 A;  1IBK L;  1RTO A;  3HS0 C;  4KJN A;  1IBL L;  3PSI A;  2F0K A;  1C7Y A;  1B8A A;  1GUW A;  3H94 A;  4RMF A;  1SLJ A;  2E74 C;  4B3S L;  2E75 C;  5ELN A;  4KMU C;  1WCM H;  5LMN L;  2KQ3 A;  4PG3 A;  4HJA A;  2XWJ B;  5CV9 A;  1Y14 B;  3MFY A;  5BR8 Q;  1PVO A;  5JEA J;  2L15 A;  3K5M A;  1A2U A;  3CCL A;  1L0W A;  4FF3 A;  1QG7 A;  1J5E Q;  4BA1 I;  1EWI A;  1B53 A;  3VYS A;  2CVR A;  3WOF A;  1OXS C;  3VA7 A;  3AYH B;  2LS0 1;  5IP9 G;  1S72 A;  4HIO A;  4L5T A;  3W3A A;  2JA6 B;  3HKZ B;  1LT4 D;  4H13 C;  4IPG A;  4YHH L;  5LL6 S;  2F0H A;  2BOS A;  4HTH A;  3I4N G;  3I8Z A;  3R2T A;  2ALY B;  2Q8R E;  5I4D A;  1YJW A;  5DLQ E;  2MP1 A;  2QEJ C;  3KFU A;  5COY A;  2IL8 A;  4DV7 Q;  4QMG A;  1CKN A;  1XPO A;  3IAY A;  4OHJ A;  2X6L A;  4A3L H;  1G29 1;  2K14 A;  4BY1 B;  2R7Z B;  4XIG S;  4QQB X;  4EQP A;  4JW0 A;  2XRQ D;  1LAC A;  1J9O A;  2JA6 H;  2EE1 A;  3ERS X;  2IT1 A;  1VDZ A;  3KDF A;  4LFC Q;  3H0G B;  3U4Z A;  4JI3 L;  4DR6 L;  1RJT A;  3H91 A;  1QVF A;  2O4X A;  1EY8 A;  5I9P A;  4PNY A;  5CV7 A;  3NBI A;  2SNS A;  1UE5 A;  5BN5 A;  2R7Z H;  3CF5 A;  1CSQ A;  4J1M A;  3A56 A;  1PTO D;  2F0Q A;  3J7A F;  1RF2 D;  1EU3 A;  2LXK A;  1YJ9 A;  2MGS A;  3NTK A;  1VQD A;  4X66 L;  2EYJ A;  3G6J B;  1EYC A;  2N88 A;  4DV1 L;  3H0G H;  1X3P A;  2JA8 B;  1T5X D;  2R7F A;  2TSS A;  1QE6 A;  2RA4 A;  3M4O B;  2O2L D;  1DXM A;  3FVQ A;  1DON A;  4JPB W;  1N34 Q;  2MNA A;  2UU9 Q;  1SYG A;  2PQE A;  4JBJ A;  4QF4 A;  4QUC A;  3ND8 A;  4ZKC B;  2D2C C;  3KK7 A;  1H9J A;  4L6T B;  4A4I A;  1PLF A;  2QIL A;  1G6P A;  1GKH A;  2RBM A;  2E2H B;  2F3W A;  3BDC A;  4DU9 A;  3G48 A;  4KI0 A;  5M9O A;  5IP7 G;  2G5D A;  3RMH A;  1C0A A;  3HKZ E;  3FEW X;  4IPH A;  3T13 A;  4KN7 C;  5EBC A;  2N8N A;  4OL7 A;  1WD0 A;  3VYU A;  3CME A;  2RDH A;  4KLK A;  1HTL D;  4F8M A;  1HNZ Q;  5D65 A;  1N32 Q;  1G51 A;  3I55 A;  1SND A;  2BCO A;  1BCP C;  3UDI A;  4ZKB B;  4LNQ A;  4K14 A;  3WOE A;  1MGS A;  2HIV A;  1JCK B;  2BDO A;  1TKW B;  1NR2 A;  2E2H H;  3RLN A;  4UAI A;  4JI7 Q;  3SEB A;  4POF A;  4DXF A;  1VQH A;  2F0E A;  1CHP D;  2XGT A;  2C9O A;  2JK8 A;  3L2P A;  3CC7 A;  2AUJ D;  4A3M G;  1RHP A;  4G7Z C;  4AQY L;  1I50 B;  4CJ0 B;  5CR3 A;  3HG9 A;  1EIG A;  2ASB A;  2YTY A;  5C5L A;  3J7Z C;  4A3E B;  3NQI A;  1Q8K A;  2UXC Q;  5JEA H;  2A8V A;  3CQZ B;  2RKS A;  1I94 Q;  2J0T D;  5KYL A;  5M3M G;  1VQP A;  2ES2 A;  2DY8 A;  3S17 B;  5J39 A;  1BCP B;  4FO2 A;  5BR8 L;  4L5S A;  3M3Y H;  3HKS A;  3HOW B;  2R92 B;  1EIF A;  4FF2 A;  2AWO A;  1IW7 C;  1K28 A;  1STB A;  4CKB A;  3HOX H;  3CD6 A;  1JB7 A;  1I50 H;  5EAY A;  3UE0 A;  1J5E L;  1STG A;  2BH8 A;  3IL8 A;  4EX5 A;  4KHP Q;  1ROD A;  4WOR A;  4DNT B;  4JI6 Q;  1WYD A;  1KC8 C;  1FGB D;  3G4S A;  4DR5 Q;  1CKN B;  1JJG A;  3CQZ H;  1F2L A;  1UEB A;  3J81 i;  2WII B;  5GAG C;  4C3J G;  3J7Y W;  3A7L A;  1LT6 D;  1HFN A;  1FGU A;  2EQS A;  4LF6 Q;  1Q3L A;  5EPJ A;  3UDX A;  3CXC A;  1HCZ A;  2B8F A;  2K32 A;  2ZTD A;  1C9O A;  1HRJ A;  2K01 A;  1A3V A;  2R92 H;  3HOW H;  2KHS A;  4R4I A;  4YCV A;  1PH1 A;  1I3Q B;  4ZAI A;  1H95 A;  2PZT A;  2G9H D;  4DV7 L;  2R93 B;  1LT3 D;  1TY2 A;  1GXD C;  1A3U A;  1H9M A;  2ZXO A;  4S3S A;  3PO2 G;  4GN4 B;  1WOC A;  2CWA A;  2H5X A;  4I7A A;  4DR1 Q;  5AJ3 Q;  4FF4 A;  3CCV A;  3OWE B;  4UHV A;  3V96 A;  4LFC L;  3TS2 A;  4BBR G;  1D8L A;  2AWN A;  2B2Y A;  2LY7 A;  1I3Q H;  2ATW A;  3T53 B;  3N52 A;  3I4N B;  1S40 A;  1MHW C;  1TVX A;  1E24 A;  2DUD A;  3D6W A;  1C8C A;  5C6A A;  1QNU A;  1B50 A;  1MIU A;  1AFP A;  2IX3 A;  1A3T A;  1G91 A;  4UDU C;  1O80 A;  1QZG A;  3GTL H;  2OCE A;  4KHZ A;  1Z47 A;  3RNU A;  5JJK A;  2IJ0 A;  5EKL A;  5IP9 H;  3HOZ G;  2M00 A;  1KLU D;  2QA4 A;  3QB3 A;  2RHS B;  4G7O C;  3U4V A;  1CHQ D;  1XWE A;  2JYO A;  5FJ8 G;  4A3B G;  3NTI A;  4H02 A;  4F7X A;  1N34 L;  2UU9 L;  4IFD G;  1EY7 A;  3I4N H;  1B3Q A;  1S3O A;  2H4O A;  4QGU A;  2OQK A;  3FRP B;  4IJH A;  3PUV A;  3QO2 A;  1K0S A;  1VQL A;  3C3L A;  2WAQ B;  4KN4 C;  3PIO 3;  3S9W A;  2PMZ B;  3T16 A;  2AHO B;  3D3R A;  4N9T A;  3ITP A;  4N9P A;  2XVS A;  1SNO A;  2O5I C;  1XMO Q;  5E4X A;  1SJH D;  2RQX A;  3GTM H;  3KLS X;  1JT8 A;  1KAB A;  2FJ2 A;  1KQS A;  3TBI B;  1VQM A;  1HNZ L;  2J7Z A;  2IX1 A;  2F0U A;  2KEN A;  2PW5 A;  1N32 L;  3ERQ A;  1GJX A;  1EQQ A;  1D5M C;  3EN2 A;  3GTQ B;  5EGT A;  1G2T A;  3S2D B;  3FPU B;  1SMX A;  5IGB A;  3FP9 A;  3WDN A;  1DGS A;  3I4M G;  4JI7 L;  3NSW A;  3MXP A;  1X54 A;  2AKW B;  2RVL A;  3GP7 A;  4HIK A;  1CA6 A;  4K0K Q;  2PZW A;  1DOM A;  2ENB A;  2K75 A;  4JC0 A;  5A2Q L;  1SSO A;  1QVC A;  1BCP D;  5HGT A;  2ZXR A;  5IGG A;  3A8K E;  3OPO A;  5C3X A;  5C44 B;  2UXC L;  1SAP A;  1VQE A;  3Q22 A;  1I94 L;  1L1O B;  1HZC A;  2XSC A;  5ELE A;  3GTQ H;  5IIF A;  5CC4 A;  1ONL A;  1O7Y A;  1OO9 B;  4IZ8 A;  1TT2 A;  3S2D H;  3L3O C;  1FNW A;  3QOL A;  4MHE A;  4CGY B;  5IE8 A;  4ZUI A;  1W3S A;  1K83 H;  2EYO A;  2Z8L A;  1YEZ A;  3GV3 A;  3UE1 A;  2B2Y C;  4QJF A;  3VR5 A;  1LLR D;  4I7Z C;  2EJM A;  2IX0 A;  4DPG A;  5M5Y H;  1GO3 E;  4X65 Q;  4KHP L;  5IP7 H;  4JI6 L;  1I4Q A;  4IFD J;  3MAQ A;  1PZI D;  1SYC A;  1V9P A;  1BXT A;  4DR5 L;  2BA1 A;  1EWH A;  1ET9 A;  1MD2 D;  4A3M B;  3LX0 A;  4IAL A;  1QUQ A;  1VQ6 A;  5IOC A;  2B39 A;  1JJC B;  5JJL A;  1UNS A;  4LFA Q;  4KY5 A;  1EYG A;  2O5J C;  1STN A;  3OMG A;  2R6G A;  1CKO A;  2OTJ A;  3RLF A;  5M3M B;  2QKI C;  4LF5 Q;  1L0X B;  2NUC A;  1VQJ A;  2WAQ E;  3F8T A;  3M4P A;  4CDE C;  5CYU A;  2PMZ E;  3K5N A;  1S5B D;  4OON A;  3M7N A;  1AE3 A;  1KDB A;  3A74 A;  5IGE A;  3MEF A;  1Q86 C;  2OF1 A;  3DMU A;  3BDO A;  1HH2 P;  4IQZ A;  1E1T A;  3EA6 A;  4A3M H;  1UEA B;  1PH9 A;  2JEA I;  2VW9 A;  3OWF A;  1AEX A;  4H44 C;  4BY1 G;  4GS3 A;  4DR1 L;  5AJ3 L;  1M4V A;  3ZJY C;  4UPA A;  1ET6 A;  3TP5 A;  5M3M H;  2K28 A;  5NUC A;  1S4Z A;  4C3J B;  1DM0 B;  1EIH A;  2KJX A;  2PNR C;  1VQ7 A;  3R3O A;  2IY5 B;  1U4L A;  2CKZ B;  4FXD A;  1WI5 A;  4YHH Q;  2HQL A;  4HJ8 A;  1FR3 A;  2EY1 A;  4G4K A;  3U58 A;  1I4P A;  1FD7 D;  5GAD C;  1TWF B;  1BR9 A;  1W6K A;  1SE3 A;  1JE4 A;  2WKC A;  3M9B A;  4DXG A;  3PO2 B;  1GUN A;  1HHV A;  4C3J H;  1SE4 A;  1HFG A;  1TWH B;  1HTP A;  4FP5 D;  1IHZ A;  1K3B C;  1ZKO A;  3BVM A;  2JA8 G;  2OQ0 A;  4K8I A;  2WIN B;  3TQY A;  4R8N A;  4O2D A;  1HXY D;  3KBX A;  3RLO A;  1PH3 A;  4DNI A;  1DCZ A;  2Z4I A;  4MTK A;  1BBU A;  2B63 G;  4NKL A;  1TWF H;  3OW2 A;  1HA6 A;  4CHT B;  5IYD G;  4OWT B;  3RD4 A;  5GAE C;  2EYF A;  2B3G A;  3PO2 H;  4G7H C;  3GTG H;  4UP8 A;  3OYY A;  4DN4 M;  2A6E C;  1I4G A;  5JPM C;  1XMO L;  1P16 A;  3S24 A;  1Y8O B;  2JA5 B;  5EPL A;  1UE1 A;  4IFD I;  3CAM A;  4P74 A;  3MXN A;  1YBY A;  1YHA A;  5D3D A;  4BBR H;  4N8F A;  1QOH A;  2OT2 A;  3CMA A;  3TME A;  2L4N A;  2I07 B;  4DGZ A;  5CV5 A;  3FKI G;  3VYT A;  4JI5 Q;  1SYD A;  4BA2 I;  4K0K L;  1GUO A;  2L9H A;  1SMY C;  4B9X A;  1CTM A;  3NXW A;  3D4W A;  1JB3 A;  1IL8 A;  3HOZ H;  4G57 A;  3TZU A;  1Z7T A;  2EY6 A;  4A3E G;  5FJ8 H;  4A3B H;  1S5F D;  4L8J A;  4IFD H;  2JE6 I;  1VF5 C;  2A69 C;  2AQ1 B;  4ZLT F;  4OXP A;  4DUZ Q;  1K8G A;  2HCI A;  4X64 Q;  1HUM A;  1SEB D;  3MC0 B;  1HJP A;  4PZ7 A;  4X65 L;  2FIN B;  1S5E D;  2Q2U A;  2ZT9 C;  1IZ6 A;  2ICE C;  4JCV E;  5KIX A;  4HN7 A;  1TWG H;  5E7N A;  4GZY C;  1Q46 A;  2GA4 B;  1VMP A;  4MIU A;  3PUW A;  4LFA L;  1GUS A;  2MO0 A;  1BVS A;  5LL6 X;  1WTX A;  1YIJ A;  4IUV A;  4LF5 L;  2HDL A;  4HIM A;  4YWM A;  1B9N A;  4IJL A;  1CSP A;  3GQB A;  5LMN W;  2NB0 A;  3I4M H;  1YHB A;  1IYU A;  1EL0 A;  1OTC A;  1NBW A;  3DM1 A;  3T1H Q;  4A93 G;  2EYP A;  4Y7N H;  1LTA D;  3KJP A;  4ULL A;  3G7L A;  2R93 G;  1JQY D;  3NWT A;  3FMC A;  2F0I A;  4X6A H;  3K57 A;  4OGQ C;  2A19 A;  4EQ5 A;  5KND A;  5ELD A;  5F2D A;  4HMI A;  5BN3 A;  3NP8 A;  3F2B A;  4RCN A;  1YVC A;  3J7A V;  5COR A;  5J1Z A;  1F77 A;  5L37 A;  3TN2 A;  5ELF A;  3VDY A;  2PI2 A;  3J81 E;  2P5Z X;  4QCL A;  5DAU A;  1CUK A;  2B2V A;  1D7Q A;  3KJO A;  4HJ7 A;  3SHL A;  3E9I A;  1YHQ A;  1PDQ A;  1YJN A;  3CCU A;  2K1B A;  4A76 A;  3UDG A;  3S1M B;  5M5W B;  3W2D A;  4OX9 Q;  1LV9 A;  3R2I A;  3DUZ A;  4JI2 Q;  4N8X 1;  1Y1W G;  1O7I A;  1GM5 A;  1NCV A;  2EYM A;  1DJR D;  2CH4 A;  4GLA C;  5FK9 C;  4XQQ A;  5EQ0 A;  1J8I A;  2F0O A;  4MNO A;  2A6H C;  2HT1 A;  1V43 A;  3HOU B;  1M8A A;  1SJE D;  2YYZ A;  1N33 Q;  1ASZ A;  1BCP F;  1NY4 A;  2F0N A;  1EZ6 A;  3NHH A;  3S1M H;  2ZTE A;  2LKV A;  4HCS A;  5M5W H;  1SXT A;  5C4H A;  1A62 A;  1V1P A;  4PZ8 A;  1XPR A;  3PIO A;  4K6L A;  1JOR A;  2E5L Q;  3C1E A;  2WAQ G;  3TP7 A;  4BY1 H;  2X6G A;  5KEE A;  4DK6 C;  3S15 B;  2PNH A;  1STH A;  2BA0 A;  4HMJ A;  2SOB A;  3G6E A;  4HJ5 A;  1TWA B;  3MA2 B;  1OXX K;  1EY9 A;  1XTD A;  3CW2 C;  2YTV A;  4C3I G;  1FVI A;  3E6Z X;  2Q8I B;  1HQM C;  3CCS A;  3A5U A;  1SFO B;  1Q81 C;  1VQG A;  2I46 A;  2KOL A;  3FHW A;  4JI5 L;  2Z6B A;  1NMG A;  3NWS A;  2F0L A;  2RHQ B;  4P73 A;  3SVM A;  5IT9 E;  4J8Q A;  1WTO A;  1PFN A;  1BDO A;  1U5K A;  2XNA C;  1Y8N B;  2B63 B;  2F4V Q;  1YNJ C;  2KBN A;  4V0B A;  3Q6S A;  1PYS B;  3S1Q B;  1EYD A;  1TWA H;  2JEB I;  4HCE A;  3V2T A;  4B9W A;  5C44 G;  5CV6 A;  2HHH Q;  4DV5 Q;  1SMY D;  1GOZ A;  3E9H A;  2OWO A;  3AU7 A;  2WKD A;  3S1N B;  3VA5 A;  3X3M A;  3CCJ A;  2JA8 H;  1SFO H;  2CCZ A;  3M4O H;  3IKJ A;  4NMZ A;  2MHV A;  4NXN Q;  4DUZ L;  1X3F A;  3HZX A;  3JC6 6;  4HR7 B;  1N36 Q;  2L0C A;  4X64 L;  1WTV A;  1KL9 A;  2I5H A;  3EQL C;  2KCM A;  1SRO A;  3IFT A;  3J81 L;  2B63 H;  1XX8 A;  3FKI B;  4Y52 H;  2B2V C;  3DHQ A;  4ZQ3 A;  5IYD H;  3PUZ A;  2K52 A;  3S1Q H;  2VNU D;  4RKB A;  2E8G A;  3PQI A;  4CDD C;  2M9V A;  1X55 A;  4A3J G;  4CDF C;  2VQF Q;  1JR0 D;  1PFS A;  5IGF A;  5G3L D;  3S1N H;  2K5W A;  1BUV T;  4DFA A;  1JWU D;  4R4Q A;  3CC4 A;  2NVQ B;  4YWL A;  4IO9 A;  1KNE A;  1I4R A;  1SNM A;  3NK9 A;  3EVQ A;  1CA5 A;  2XWB B;  4JBW A;  1B9M A;  3S2H B;  4PZ6 A;  1GVP A;  3FKI H;  4IOA A;  4Q5V A;  4DUY Q;  3T1H L;  1KRS A;  1CI3 M;  1I4H A;  1U4R A;  2B2T A;  4HJ9 A;  4DK1 A;  1CFM A;  2F0F A;  3E0J A;  1Q7Y C;  4X3S A;  2EJF C;  2F1M A;  2I5L X;  4R8I A;  1KTK A;  1U9R A;  5ELC A;  5J3B A;  2NVQ H;  1NMF A;  4RGO S;  2KEC A;  3K7A B;  4A3E H;  1EFW A;  3JAM L;  2F0J A;  4LAA A;  2WP8 J;  3S16 B;  2R3Z A;  1ASY A;  4KKT A;  3J81 c;  3DWP A;  5ELB A;  4O0A A;  1ENA A;  3S17 H;  4L5Q A;  1PHJ A;  3H3V C;  2WB1 G;  4X3K A;  2D9U A;  4I65 A;  4MN3 A;  5EKK A;  4TKO B;  3EIV A;  2JJQ A;  3ND9 A;  3KDF B;  4DKA C;  1GD7 A;  2JA9 A;  5CV4 A;  3VR2 A;  4DNR B;  4A93 B;  1MJC A;  2L11 A;  3UI2 A;  2Z9H A;  1CT1 D;  5A2Q E;  4OX9 L;  5IT9 L;  4JI2 L;  1X56 A;  1V1P B;  2LMC B;  2N49 A;  3S16 H;  3FPP A;  5JPN C;  5CV8 A;  1ENF A;  3D0F A;  2EXZ A;  4TVA B;  3I4L A;  2JN4 A;  1KAW A;  1F9S A;  3F2U A;  1N33 L;  1RIP A;  2IHF A;  3OMC A;  3AMU A;  3CPW A;  3K7U C;  2A5H A;  3LWE A;  1JMC A;  1VQA A;  3OIP A;  2RF4 A;  4MZ9 A;  4JBM A;  3STB C;  4A93 H;  1LYL A;  3M7G A;  1CZW A;  3BVG A;  5E1F A;  5JOB A;  1GUG A;  1WTH A;  2RCN A;  5JJZ A;  2E5L L;  3JAM i;  2R93 H;  1C48 A;  2DY7 A;  3SXH A;  4DAY A;  3H09 A;  2HUG A;  3GTO B;  3J81 j;  1Y1W B;  1L0Y B;  1TS5 A;  2JA5 G;  1SYF A;  2NVY B;  4KK7 A;  3OHX C;  5C4J B;  3TS0 A;  5EBD A;  2PI2 E;  1BQQ T;  1WJJ A;  5C0X G;  5C5M A;  3CU7 A;  3OIQ A;  5T1I A;  4IPC A;  3G71 A;  5IT9 c;  1JOK A;  4P72 A;  4XXE A;  1DOK A;  4JV5 Q;  2F4V L;  4DV3 Q;  3GTO H;  2B2T C;  1SE2 A;  1IBM Q;  1CM9 A;  1HQR D;  4CKE A;  2XRS D;  1Y1W H;  4BBS G;  1IYV A;  2KCC A;  1KXL A;  1E0B A;  2NVY H;  2HHH L;  4DV5 L;  3HRZ C;  1O7L A;  1IYJ B;  1YNX A;  5C4J H;  4RGN A;  1R9T B;  2F0S A;  1GUT A;  4R4O A;  1YNJ D;  4CBV A;  3PCO B;  1OXT A;  2JA7 G;  3L7Z C;  4JVZ A;  4C3I B;  2MQH A;  4NXN L;  4RKL A;  4WRD A;  1XJV A;  2EY2 A;  3PMF A;  2EZV A;  1N36 L;  1RD9 D;  3AFQ A;  4R9W A;  1Y1V B;  1FJG Q;  3S14 B;  4YCU A;  2VUM G;  4A3F G;  4GOP A;  1EY0 A;  2EY5 A;  1K0R A;  4OWX B;  2XIW A;  1LTR D;  3K0X A;  3S1R B;  1AW7 A;  1E2Z A;  4ZK9 B;  1KAA A;  1LAB A;  2VQF L;  1B1Z A;  2L1B A;  1WVL A;  1R9T H;  2ID0 A;  2ZJR A;  4JI4 L;  1AN8 A;  1PMR A;  1Q1E A;  4C3I H;  5H1S E;  1MSG A;  3NTH A;  2E2I B;  2K50 A;  3C2P A;  1ZEQ X;  4C1N I;  1BO0 A;  1Z9F A;  1WTW A;  1Y1V H;  5ELO A;  3S14 H;  2KCN A;  2Z6K A;  4JI8 Q;  2IPK D;  3RN5 A;  2DNE A;  3P75 A;  4DUY L;  5I2Y A;  4IPD A;  4E6I A; 
#chains in the Genus database with same CATH homology
 2EOT A;  5K36 G;  2EDG A;  3MTS A;  4KD4 A;  1Y8P B;  4ZRZ A;  1EEI D;  1PFM A;  1Q90 A;  4A3J B;  1QIL A;  1PFB A;  1PRT C;  1OXV A;  1STA A;  4RH6 A;  1DOL A;  3K59 A;  5A35 A;  1IW7 D;  5KGU A;  1KDA A;  2KED A;  5C3E B;  1K8O A;  1WTQ A;  3KUP A;  3CRK C;  5ISR A;  5LHY 1;  1SNP A;  1KLG D;  1FYC A;  4K5W A;  4KJO A;  4U67 3;  4OO1 G;  1EEF D;  3VR6 A;  4A3D B;  4U68 A;  4V19 0;  4PV1 C;  4CKC A;  2MJ8 A;  1JOO A;  2RDG A;  2PW7 A;  4KY7 A;  1PRT B;  1I6V C;  5TSS A;  2K05 A;  5CBA E;  3I73 A;  2AUK A;  5D3I B;  1U4P A;  2FHT A;  2WB1 B;  2K03 A;  3U9S A;  5I2X A;  4DAP A;  5E4W C;  4XQN A;  4IUT A;  4RWS C;  1U4M A;  4O42 A;  4X3T A;  2Z4H A;  1I6H B;  1UUP A;  1Z6H A;  5IOD A;  3V05 A;  3MXU A;  1RKN A;  3GTK B;  4ID6 A;  1H9R A;  4QIW B;  1QB5 D;  3MEH A;  5G3L F;  1Q1B A;  1ZYR C;  2K6A A;  4KY6 A;  2CW0 C;  3GV6 A;  2A74 C;  4FXK C;  4O1N A;  4LK1 C;  2VB3 X;  3P7J A;  3K0Y A;  1SYE A;  3LNN A;  4RFB A;  5C0X I;  3BG3 A;  1LTS D;  2F0P A;  3NE5 B;  2BE5 C;  2H1E A;  1D6E C;  3ONA B;  4RA8 A;  2JP1 A;  3RZD B;  2SDF A;  1Y69 U;  3HOV B;  1ILQ A;  4XTC S;  2EYL A;  5K5P A;  1D5X C;  2FFK B;  4XYQ A;  3MXG A;  1CZG A;  4EQN A;  4H7B A;  2K7V A;  2L12 A;  4NDX A;  2X69 A;  4C2M B;  4BBS B;  3PUY A;  3A8I E;  4KV6 A;  4K2L A;  3U9O A;  4KTA A;  2AQ2 B;  5C0X H;  5IGD A;  2JA7 B;  4FF1 A;  1G6Z A;  1EQT A;  4IUU A;  1EFI D;  2HQE A;  4EQO A;  2BDN A;  3D4R A;  1SNC A;  2VUM B;  4A3F B;  1OXU A;  1EOT A;  1TU2 B;  2NVT B;  3NBH A;  3AB9 A;  4M8A A;  3E5S A;  1AP0 A;  3NQT A;  3T56 B;  5FOB B;  5C3W A;  1DYQ A;  5BN4 A;  3C46 A;  2PZU A;  5JAV A;  4CJ1 B;  4PQX A;  1WCM B;  3TP6 A;  3QG1 A;  3PIP 3;  5CBE E;  1MSH A;  2F0M A;  1R4P B;  5EJW A;  3EJI A;  1ICW A;  4XT3 B;  2PPB C;  1ML0 D;  1AZQ A;  1W6J A;  1LTT D;  3HEJ A;  3ZYY X;  4OO1 I;  1X32 A;  1DD2 A;  4Q0F A;  1XYI A;  1KNA A;  4K2K A;  1B2T A;  4ZYS A;  3VYR A;  2G9D A;  3BYY B;  5K36 H;  3T4A C;  2M2L A;  4KKU A;  1VF7 A;  4A3I B;  1QCB D;  2K04 A;  1QWY A;  3MZ5 A;  1RCV D;  3R93 A;  5IGC A;  5J22 A;  1TQO A;  2L5T A;  1NR4 A;  1WD1 A;  4BWG B;  1EY4 A;  5I6Y A;  5KYI A;  3QJY A;  1H9S A;  3GD7 A;  4X3U A;  1T5E A;  4BS9 A;  4OO1 H;  1EY6 A;  2F0D A;  1RTN A;  2NN6 G;  1ILP A;  2E2J B;  1C4Q A;  4FXG C;  5JVH 3;  2F0W A;  1CQF A;  2RSN A;  1G8Z D;  4M1U B;  2YU9 B;  4ZUJ A;  1SBB B;  1II3 A;  3A8J E;  4TQU S;  2WAC A;  1R4Q B;  3JAM E;  1ZYR D;  1EYA A;  2CW0 D;  3O13 A;  3GTP B;  2J4X A;  2SNM A;  3GO5 A;  4XT1 B;  5I9O A;  2TMP A;  5DNF A;  4IUQ A;  1E2V A;  3X3N A;  2A6E D;  4C3H G;  2BE5 D;  4ILW A;  2XN9 C;  1B4O A;  1PXU A;  2SEB D;  2RSO A;  4F87 A;  4WFN 3;  3M4Y A;  3TP8 A;  3MWY W;  1CK1 A;  2F03 A;  2Z1C A;  2C5C A;  2NTS A;  1F9R A;  3K6O A;  3M85 A;  3VR4 A;  3A54 A;  3HGB A;  4PMW A;  1F9P A;  4K5V A;  1BBX C;  5T1G A;  5EPK A;  3T51 B;  3GTJ B;  3QWN A;  3SK5 A;  3C1F A;  2N55 A;  2QF7 A;  4EGV A;  5FKA C;  1EWC A;  1EU4 A;  3MHB A;  1K8M A;  2A69 D;  3HOY B;  1A15 A;  4IN3 A;  5JVG 3;  4J6H A;  1KDC A;  1S5C D;  3P20 A;  2JXM B;  2K5D A;  2OEO A;  2F0V A;  1ENC A;  3EFX D;  5M3F B;  3M3Y B;  3I3C A;  3SK8 A;  2LFN A;  3HOX B;  3IFD A;  1NAP A;  1O7Z A;  3FDT A;  2NWG A;  3I90 A;  1IKM A;  2NBF A;  3PV0 A;  2NYZ D;  1PZK D;  2NVX B;  2EJG C;  3H6M A;  3K5O A;  5KNB A;  1ESR A;  3I91 A;  5I6W A;  1TY0 A;  4XDX A;  1H9S B;  3SE0 A;  4OIK A;  5CGK A;  4FNF A;  2F0T A;  2Q8T A;  1LTB D;  4LMQ D;  3A7A B;  1D1I A;  4TSS A;  5FLX E;  1E2W A;  4QUF A;  2PCF B;  3BZD B;  1QJO A;  2IW3 A;  4WJW A;  1GHJ A;  1D1K A;  2KEE A;  1MBY A;  2DN8 A;  4IUN A;  3HP3 A;  3BDL A;  4HED A;  1V8Q A;  3A55 A;  5M5X B;  1GHK A;  2A6H D;  2DNC A;  4PMC A;  4RHS A;  1H9K A;  4ODG A;  3GTL B;  2IWH A;  3KF8 A;  1JIC A;  3DEP A;  3QOJ A;  2KA7 A;  4C1N K;  2A68 C;  2KVM A;  2NN6 I;  2AQ3 B;  4Z9C B;  5KRU A;  2E2D C;  4RCO A;  3DEO A;  1LO5 D;  5FO8 B;  3R8B A;  4H0L C;  2CQA A;  4A3G B;  1TS2 A;  1TR5 A;  1XXG A;  1PRT F;  4KKS A;  1G2S A;  4AYB B;  1YNN C;  3GTM B;  3SR1 A;  3TZD A;  1AZP A;  3NUC A;  2K5Q A;  3CRL C;  2NN6 H;  3D31 A;  4C3H B;  1BNZ A;  5DEH A;  3LWU A;  3KLS A;  1X3Q A;  2R61 A;  4PMB A;  2MUY A;  3P1H A;  1WTP A;  4NW2 A;  2HCC A;  5C4Z A;  1IKL A;  3OOC A;  5FO7 B;  1JWM D;  5EKI A;  3I70 A;  4RAU C;  2MPM A;  3ERO A;  2Y0S B;  5FLX L;  1HPC A;  2PYK A;  1SDF A;  2RDF A;  2D62 A;  4DF7 A;  2HDM A;  2KUM A;  2QDB A;  1CQV A;  1JWS D;  2B2W A;  1K83 B;  2B2U A;  5E3F A;  5AFW A;  4HAE A;  3I72 A;  5CMD A;  1B44 D;  2FMM A;  5M5Y B;  1NSN S;  5C0X J;  3QIA A;  1PZJ D;  4YIJ A;  3BS1 A;  3VR3 A;  3J80 E;  4K5X A;  1D5Z C;  2ZXP A;  4JK1 C;  3SK6 A;  1B3A A;  3SDZ A;  3PO3 B;  4IUR A;  2FMC A;  2D5D A;  3MFG A;  3K58 A;  5FO9 B;  1Q12 A;  1VCI A;  1JOQ A;  4KD3 A;  2VXW A;  4FYD A;  1SYB A;  2WV6 D;  5DM7 3;  3D6C A;  1EQV A;  2F3V A;  2JSO A;  1PTO F;  1NUC A;  1TS3 A;  4B08 A;  4A3K B;  3CKI B;  2NZ1 D;  4F88 A;  3Q23 A;  2PO4 A;  1DZ1 A;  1EZ8 A;  3OSO A;  1PYW D;  1SNQ A;  4K8J A;  1D2B A;  1FNU A;  1F2Z A;  4TRD A;  3TDQ A;  3URY A;  2ICI A;  1F9Q A;  1LT5 D;  1MI2 A;  4OIJ A;  1BF4 A;  3TSS A;  3RUZ A;  4K6D A;  4EVO A;  1TWC B;  3KBG A;  1V1O A;  3N6R A;  2EYH A;  2B2W C;  2A68 D;  5HUR A;  2B2U C;  1WTR A;  1A6X A;  2E76 C;  2A73 B;  2QCP X;  3GTG B;  1TS4 A;  5C4X B;  1TII D;  4HSV A;  4CJ2 C;  2OXP A;  3SK4 A;  3D4D A;  3Q24 A;  3J80 L;  4BBR B;  3MVV A;  2F4I A;  4LJZ C;  1HA5 A;  3D8G A;  2EPB A;  1QNK A;  1PTO C;  3RZO B;  1YNN D;  1S5D D;  1I4X A;  1JC7 A;  4FVM A;  4KHV A;  4BY7 B;  3Q0A A;  1LTI D;  3DXJ C;  1Q8I A;  1FNV A;  1RDP D;  4C56 C;  1A2T A;  3DWA A;  3HOZ B;  1UAP A;  1F2M A;  1STY A;  1F2Y A;  3BYT B;  4A3B B;  5JEA G;  2VB2 X;  4P2C B;  3KLR A;  4XYO A;  2B8G A;  1PTO B;  4RHR A;  1STE A;  2L55 A;  1BOS A;  3OW7 A;  1EY5 A;  4QB4 A;  4IUP A;  4RGT A;  1TWG B;  5D14 A;  4NP5 A;  3CHB D;  1VMC A;  1ZXT A;  5KNC A;  3NPP A;  3K5L A;  4ABN A;  2V4D A;  1ESF A;  4ME5 A;  2EVB A;  1XTC D;  1PTO H;  3PUX A;  2K33 A;  2CHB D;  1LTG D;  5DM6 3;  1PRT D;  3I4M B;  3L9A X;  4RGM A;  4Y7N B;  2F0G A;  2NTT A;  4L63 B;  4XQJ A;  1O78 A;  4HSP A;  1HUN A;  4DAV A;  4DA2 A;  3DWQ A;  3BVZ A;  4DK0 A;  1RTO A;  3HS0 C;  4KJN A;  2F0K A;  1GUW A;  3H94 A;  2E74 C;  2E75 C;  4KMU C;  2KQ3 A;  2XWJ B;  5CV9 A;  3MFY A;  5JEA J;  3K5M A;  1A2U A;  4FF3 A;  1QG7 A;  4BA1 I;  1B53 A;  3VYS A;  2CVR A;  3WOF A;  1OXS C;  3VA7 A;  2LS0 1;  3W3A A;  2JA6 B;  3HKZ B;  1LT4 D;  4H13 C;  5LL6 S;  2F0H A;  2BOS A;  4HTH A;  3I8Z A;  3R2T A;  2Q8R E;  5I4D A;  2MP1 A;  2QEJ C;  5COY A;  2IL8 A;  4QMG A;  3IAY A;  4OHJ A;  2X6L A;  1G29 1;  4BY1 B;  2R7Z B;  4XIG S;  4EQP A;  2XRQ D;  1LAC A;  1J9O A;  2EE1 A;  2IT1 A;  1VDZ A;  3H0G B;  1RJT A;  3H91 A;  2O4X A;  1EY8 A;  5I9P A;  4PNY A;  5CV7 A;  3NBI A;  2SNS A;  5BN5 A;  4J1M A;  3A56 A;  1PTO D;  2F0Q A;  3J7A F;  1RF2 D;  1EU3 A;  2MGS A;  3NTK A;  2EYJ A;  3G6J B;  1EYC A;  2N88 A;  1X3P A;  2JA8 B;  1T5X D;  2TSS A;  1QE6 A;  2RA4 A;  3M4O B;  2O2L D;  1DXM A;  3FVQ A;  1DON A;  1SYG A;  2PQE A;  4QF4 A;  4QUC A;  3ND8 A;  4ZKC B;  2D2C C;  3KK7 A;  1H9J A;  4L6T B;  1PLF A;  2QIL A;  2RBM A;  2E2H B;  2F3W A;  3BDC A;  4DU9 A;  4KI0 A;  5M9O A;  3RMH A;  3FEW X;  3T13 A;  4KN7 C;  5EBC A;  4OL7 A;  1WD0 A;  3VYU A;  2RDH A;  1HTL D;  4F8M A;  5D65 A;  1SND A;  2BCO A;  1BCP C;  4ZKB B;  4K14 A;  3WOE A;  1MGS A;  1JCK B;  2BDO A;  1TKW B;  1NR2 A;  4UAI A;  3SEB A;  4DXF A;  2F0E A;  1CHP D;  2C9O A;  2AUJ D;  1RHP A;  4G7Z C;  1I50 B;  4CJ0 B;  5CR3 A;  3HG9 A;  1EIG A;  5C5L A;  4A3E B;  3NQI A;  5JEA H;  3CQZ B;  2RKS A;  2J0T D;  5KYL A;  2DY8 A;  3S17 B;  5J39 A;  1BCP B;  4FO2 A;  3HOW B;  2R92 B;  4FF2 A;  2AWO A;  1IW7 C;  4CKB A;  1STB A;  1STG A;  3IL8 A;  1ROD A;  4WOR A;  4DNT B;  1FGB D;  1F2L A;  2WII B;  4C3J G;  3J7Y W;  3A7L A;  1LT6 D;  1HFN A;  1Q3L A;  5EPJ A;  1HCZ A;  2B8F A;  2K32 A;  1HRJ A;  2K01 A;  1A3V A;  2KHS A;  1I3Q B;  4ZAI A;  2PZT A;  2G9H D;  2R93 B;  1LT3 D;  1TY2 A;  1GXD C;  1A3U A;  1H9M A;  2ZXO A;  4S3S A;  4FF4 A;  3OWE B;  3V96 A;  2AWN A;  2B2Y A;  2LY7 A;  3T53 B;  3N52 A;  3I4N B;  1TVX A;  3D6W A;  1C8C A;  5C6A A;  1QNU A;  1B50 A;  1AFP A;  2IX3 A;  1A3T A;  1G91 A;  4UDU C;  1O80 A;  4KHZ A;  1Z47 A;  2IJ0 A;  5EKL A;  2M00 A;  1KLU D;  3QB3 A;  4G7O C;  1CHQ D;  1XWE A;  2JYO A;  3NTI A;  4F7X A;  4IFD G;  1EY7 A;  2H4O A;  3FRP B;  3PUV A;  3QO2 A;  3C3L A;  2WAQ B;  4KN4 C;  3PIO 3;  3S9W A;  2PMZ B;  3T16 A;  3D3R A;  4N9T A;  3ITP A;  4N9P A;  2XVS A;  1SNO A;  2O5I C;  5E4X A;  1SJH D;  2RQX A;  3KLS X;  1KAB A;  2FJ2 A;  3TBI B;  2IX1 A;  2J7Z A;  2F0U A;  2PW5 A;  3ERQ A;  1GJX A;  1D5M C;  3GTQ B;  5EGT A;  1G2T A;  3S2D B;  3FPU B;  5IGB A;  3WDN A;  3NSW A;  3MXP A;  2RVL A;  3GP7 A;  1CA6 A;  2PZW A;  1DOM A;  2ENB A;  5A2Q L;  1SSO A;  5HGT A;  1BCP D;  2ZXR A;  5IGG A;  3A8K E;  3OPO A;  5C3X A;  5C44 B;  1SAP A;  3Q22 A;  2XSC A;  5ELE A;  5IIF A;  5CC4 A;  1ONL A;  1O7Y A;  1OO9 B;  4IZ8 A;  1TT2 A;  3L3O C;  1FNW A;  3QOL A;  4MHE A;  4CGY B;  4ZUI A;  2EYO A;  2Z8L A;  3GV3 A;  2B2Y C;  3VR5 A;  1LLR D;  4I7Z C;  2EJM A;  2IX0 A;  1I4Q A;  4IFD J;  3MAQ A;  1PZI D;  1SYC A;  1BXT A;  2BA1 A;  1EWH A;  1ET9 A;  1MD2 D;  4A3M B;  3LX0 A;  4IAL A;  5IOC A;  2B39 A;  1UNS A;  4KY5 A;  2O5J C;  1STN A;  3OMG A;  2R6G A;  3RLF A;  5M3M B;  2QKI C;  1L0X B;  2NUC A;  5CYU A;  3K5N A;  1S5B D;  3M7N A;  1KDB A;  5IGE A;  2OF1 A;  3DMU A;  3BDO A;  4IQZ A;  3EA6 A;  2JEA I;  1UEA B;  3OWF A;  1AEX A;  4H44 C;  1M4V A;  1ET6 A;  3TP5 A;  2K28 A;  5NUC A;  1S4Z A;  4C3J B;  1DM0 B;  1EIH A;  2KJX A;  2PNR C;  3R3O A;  1U4L A;  4FXD A;  1FR3 A;  2EY1 A;  4G4K A;  1I4P A;  1FD7 D;  1TWF B;  1BR9 A;  1W6K A;  1SE3 A;  1JE4 A;  2WKC A;  4DXG A;  3PO2 B;  1GUN A;  1HHV A;  1SE4 A;  1HFG A;  1TWH B;  1HTP A;  4FP5 D;  1IHZ A;  1ZKO A;  3BVM A;  4K8I A;  2WIN B;  4R8N A;  1HXY D;  3KBX A;  1DCZ A;  2Z4I A;  4NKL A;  1HA6 A;  4CHT B;  3RD4 A;  2EYF A;  4G7H C;  4DN4 M;  2A6E C;  1I4G A;  5JPM C;  1Y8O B;  2JA5 B;  5EPL A;  4IFD I;  3MXN A;  5D3D A;  1QOH A;  2OT2 A;  3TME A;  2L4N A;  2I07 B;  4DGZ A;  5CV5 A;  3VYT A;  1SYD A;  4BA2 I;  1GUO A;  2L9H A;  1SMY C;  4B9X A;  1CTM A;  3NXW A;  3D4W A;  1JB3 A;  1IL8 A;  4G57 A;  3TZU A;  1Z7T A;  2EY6 A;  1S5F D;  4L8J A;  4IFD H;  2JE6 I;  1VF5 C;  2A69 C;  2AQ1 B;  4ZLT F;  2HCI A;  1HUM A;  1SEB D;  3MC0 B;  2FIN B;  1S5E D;  2ZT9 C;  2ICE C;  5KIX A;  4HN7 A;  4GZY C;  2GA4 B;  1VMP A;  4MIU A;  3PUW A;  1GUS A;  5LL6 X;  1WTX A;  4IUV A;  2HDL A;  1B9N A;  3GQB A;  2NB0 A;  1IYU A;  1EL0 A;  3DM1 A;  2EYP A;  1LTA D;  4ULL A;  3G7L A;  1JQY D;  3NWT A;  3FMC A;  2F0I A;  3K57 A;  4OGQ C;  5KND A;  5ELD A;  5F2D A;  4HMI A;  5BN3 A;  3NP8 A;  4RCN A;  3J7A V;  5COR A;  5J1Z A;  1F77 A;  3TN2 A;  5ELF A;  3J81 E;  4QCL A;  5DAU A;  2B2V A;  3SHL A;  1PDQ A;  2K1B A;  3S1M B;  5M5W B;  3W2D A;  1LV9 A;  3R2I A;  3DUZ A;  1NCV A;  2EYM A;  1DJR D;  5FK9 C;  4XQQ A;  5EQ0 A;  1J8I A;  2F0O A;  2A6H C;  1V43 A;  3HOU B;  1M8A A;  1SJE D;  2YYZ A;  1BCP F;  2F0N A;  1EZ6 A;  3NHH A;  2LKV A;  4HCS A;  1SXT A;  5C4H A;  1V1P A;  4K6L A;  1JOR A;  3C1E A;  3TP7 A;  2X6G A;  5KEE A;  3S15 B;  1STH A;  2BA0 A;  4HMJ A;  2SOB A;  1TWA B;  3MA2 B;  1OXX K;  1EY9 A;  4C3I G;  3E6Z X;  2Q8I B;  1HQM C;  1SFO B;  2I46 A;  2KOL A;  3NWS A;  2F0L A;  3SVM A;  5IT9 E;  4J8Q A;  1WTO A;  1PFN A;  1BDO A;  2XNA C;  1Y8N B;  2B63 B;  1YNJ C;  4V0B A;  3Q6S A;  3S1Q B;  1EYD A;  2JEB I;  4HCE A;  3V2T A;  4B9W A;  5CV6 A;  1SMY D;  1GOZ A;  3AU7 A;  2WKD A;  3S1N B;  3VA5 A;  3X3M A;  3IKJ A;  4NMZ A;  2MHV A;  3HZX A;  4HR7 B;  2L0C A;  1WTV A;  3EQL C;  3IFT A;  3J81 L;  1XX8 A;  3FKI B;  2B2V C;  3DHQ A;  4ZQ3 A;  3PUZ A;  2VNU D;  4RKB A;  2M9V A;  1JR0 D;  5IGF A;  5G3L D;  2K5W A;  1BUV T;  4DFA A;  1JWU D;  2NVQ B;  1KNE A;  1I4R A;  1SNM A;  3NK9 A;  3EVQ A;  1CA5 A;  2XWB B;  4JBW A;  1B9M A;  3S2H B;  4Q5V A;  1CI3 M;  1I4H A;  1U4R A;  2B2T A;  4DK1 A;  1CFM A;  2F0F A;  3E0J A;  4X3S A;  2EJF C;  2F1M A;  4R8I A;  1KTK A;  1U9R A;  5ELC A;  4RGO S;  2KEC A;  3K7A B;  3JAM L;  2F0J A;  4LAA A;  2WP8 J;  3S16 B;  2R3Z A;  4KKT A;  3DWP A;  5ELB A;  1ENA A;  3H3V C;  4X3K A;  2D9U A;  5EKK A;  4I65 A;  4MN3 A;  4TKO B;  3ND9 A;  5CV4 A;  3VR2 A;  4DNR B;  4A93 B;  2L11 A;  3UI2 A;  1CT1 D;  5A2Q E;  5IT9 L;  1V1P B;  2LMC B;  3FPP A;  5JPN C;  5CV8 A;  1ENF A;  2EXZ A;  3I4L A;  1F9S A;  3F2U A;  3OMC A;  3AMU A;  2A5H A;  3LWE A;  3OIP A;  3M7G A;  1CZW A;  3BVG A;  5E1F A;  5JOB A;  1GUG A;  5JJZ A;  1C48 A;  2DY7 A;  3SXH A;  4DAY A;  3H09 A;  2HUG A;  3GTO B;  1Y1W B;  1L0Y B;  1TS5 A;  1SYF A;  2NVY B;  4KK7 A;  3OHX C;  5C4J B;  5EBD A;  1BQQ T;  5C0X G;  5C5M A;  3CU7 A;  3OIQ A;  5T1I A;  1JOK A;  4XXE A;  1DOK A;  2B2T C;  1SE2 A;  1CM9 A;  1HQR D;  4CKE A;  2XRS D;  1IYV A;  2KCC A;  1E0B A;  3HRZ C;  1O7L A;  4RGN A;  1R9T B;  2F0S A;  1GUT A;  1YNJ D;  4CBV A;  1OXT A;  3L7Z C;  4C3I B;  4RKL A;  4WRD A;  2EY2 A;  3PMF A;  2EZV A;  1RD9 D;  4R9W A;  1Y1V B;  3S14 B;  1EY0 A;  2EY5 A;  2XIW A;  1LTR D;  3S1R B;  1AW7 A;  1E2Z A;  4ZK9 B;  1KAA A;  1LAB A;  1B1Z A;  2L1B A;  1WVL A;  2ID0 A;  1AN8 A;  1PMR A;  1Q1E A;  1MSG A;  3NTH A;  2E2I B;  3C2P A;  1ZEQ X;  4C1N I;  1BO0 A;  1WTW A;  2KCN A;  2IPK D;  2DNE A;  3P75 A;  5I2Y A;  4E6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...