3CS0A

Crystal structure of degp24
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title Structural basis for the regulated protease and chaperone function of DegP
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 78
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3cs0A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3cs0A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cs0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cs0A01
1K1NA 1IU2A 2XBXA 3M7UA 4YDPA 1GM1A 2RRMA 4ISLA 4GCHF 5E21A 1GHBF 1C5ZB 5GJ4B 1QB6A 3S0NA 1FLEE 4UFFH 1BA8B 2XWBI 1QQ4A 3PMBB 2FESH 5JYIA 2LPRA 2Y7ZA 4BXWA 3ID3A 1TRMA 1CA0C 2O8LA 1V1TA 5E6PB 4FUFA 3LC3A 3N7OA 1DM4B 5GDSH 3KEEA 2QT5A 3MHWU 2YTWA 1XUHA 1ZHRA 3DJAA 1HV7A 1ABJH 1P05A 2AGIX 2XXLA 1DICA 1KDQA 9ESTA 2QV1A 1BJUA 2FX4A 2XBWA 2B9LA 1FY8E 1C4U2 2Q1JA 4AGJA 2GDDA 1MCTA 2LC6A 1YBOA 2Y6TA 1G2MA 2UUKB 3SU6A 2IN2A 2XRCA 1HB0B 3HGPA 2QG1A 3BIUH 3U8RH 2H2CA 1DXWA 1PQAA 4MTBA 3GDSA 1BDAA 1O3GA 2SGFE 1ESTA 2ZU4A 2C4FH 2PTNA 4K8YA 5LPFA 3VB5A 5DK1A 1QURH 4XFQA 2G5VA 3BG8A 3P8NA 2Y82A 5C5OA 1GGDB 3ZZ4A 2MHOA 1AN1E 1JIRA 1AI8H 2OC7A 4MVNA 3LJOA 3WY8A 2AEIH 4JOGA 1QAVB 1GMDF 2DUCA 1UJ1A 2FN5A 1V2RT 2QXHA 1MQ5A 1KLTA 1LPZB 1ANDA 1AB9C 1O2JA 2F91A 1GHYH 2ZKSA 3P95A 1QQUA 1WBGB 1C9TA 1OWKA 4TWYA 2QY0B 3BTME 3B8JA 2DMZA 1MBMA 1YBWA 2HNTE 2Q9VA 3ZVEA 5A09A 1DY8A 3BEFB 5A0CA 1SPJA 4FU7A 4K2YA 2PFEA 2M0TA 1NFYA 1I92A 4I8LA 3ZVGA 1KXAA 3A7YA 1DUAA 5PTPA 1GVZA 1NZQH 1O34A 4Q7ZA 4MNVA 1GWAA 1N1LA 3SORA 1AVXA 1VJAU 2F3CE 1F2SE 2F9NA 3MU1A 1P2OA 3SQEE 2SGQE 4MPVA 3PROA 1SGNE 1G9OA 2D90A 1GJBB 3PDZA 1C2KA 2DKRA 3FP8E 3QTVH 1ID5H 3CBXA 2ZDVH 3CC0A 2P95A 1SHHB 2J9NA 2LUIA 1GMHG 3ZZ6A 1SGEE 1IQFA 1G3DA 1RTFB 5F8XA 2VSVA 1VGCB 1HXEH 2FI4E 2WYJA 2A5IA 1UJVA 1O2OA 2EA3A 2K1QA 1ETSH 4CBOA 2EEHA 4ZKRU 1D4PB 3A8CA 4HTCH 5E8EH 2PW8H 1S0RA 3EQ0H 3VQGA 3QTOH 5F3XA 2KJPA 3VGCC 1V6BA 1FAKH 3D49H 2QGRA 1RY4A 1PPZA 3RXHA 7GCHF 1GI2A 1O3IA 1N8OB 1QB1A 2ZHDA 1LVYA 3RL8A 1TQ7B 3TH3H 4B75A 5JPMH 1GI7B 1GJ6A 3W95A 5EQRA 1NTEA 1W12U 3SV2H 3M37A 1O2YA 1VZQH 4OGXA 2XCNA 3EAJA 2YUBA 2KA9A 3LGUA 2PWXA 4NA8A 1WOFA 2OQSA 4AFZA 1F0SA 4B71A 2G5NA 2NU3E 3MNBA 4MQAA 2OMJA 4ABDA 1GJ8B 2BD8A 2W3KA 1DITH 1O3MA 1OSSA 2GZ8A 2VWLA 1HAZB 4DURA 1LKAA 2BLOA 4WY3A 1GBKA 1CBWB 4JZEH 2VVVA 4AORA 5HMAA 3ZZ3A 4VGCC 3FZDA 2WUBA 3LH3A 1B5GH 3UY9A 1GJDB 3QK1A 3CBYA 2I0IA 4A92A 2EEGA 3FP7E 1J14A 1INCA 1TNJA 3A7VA 3CBZA 4OGYA 4E7NA 1U38A 1LQDB 5DJ7A 1HAIH 2EDZA 1UK4A 3SU5A 1F5LA 4FUBA 2W7SA 1BTXA 2BZAA 2F83A 1XKBC 2Q6FA 2A2XH 3IG6B 4CH2B 1CQQA 1HXFH 4GHNA 2HE2A 2QIQA 2ZU3A 1JWTA 1UFXA 2C3SA 4Z0KA 1VA8A 1SQTA 4GPGA 3AW0A 5E1YA 2ZPLA 4ISHH 4LMMA 1THPB 1G30B 3FANA 1EX3A 3DA9B 2JWEA 2H5CA 2Z9LA 3E17A 2A32A 2BLVA 4U01A 5IDKA 4CREA 4X0WU 3A88A 5EPNA 1BT7A 2XC5A 2SGEE 1O32A 1ELVA 1DX5M 3O46A 1C5LH 1AFEH 5HDYA 1Z1IA 3BTDE 5F67A 1KWAA 3L3TA 1ZGIA 4DCDA 1LPKB 1CT0E 1IOEA 3V12A 3DORA 1C1MA 5JBBS 4O9VA 5HYOA 2BY9X 3CYYA 5T6FA 1UCYK 1KIGH 4FU8A 1VITG 3U1IB 5ETXA 1TNKA 3OTPA 5A8ZA 3DFJA 1AO5A 3BG4B 2F5YA 1KXDA 2BDGA 2R2MB 2ZF0H 5IYTA 1S6FA 1W2KH 1CA8B 5AFZH 4ISNA 1GMCF 2PSYA 4RI0A 4WXVA 1GBLA 2YUYA 1C1NA 2VVCA 4X8VH 1UJUA 2WPIS 4X1NU 1ELGA 1TONA 1C1TA 3RXTA 1QBVH 1ZSKA 1CO7E 1D3PB 1C5UA 1CGHA 3QJNA 3MO6A 1Q3OA 5HF1A 1SLXB 3SJ8A 3GY4A 5I7ZA 4D7FA 1CGJE 3M5NA 1CHOG 3PTBA 1P03A 1C5NH 1NFWA 1VITH 2P8OB 4XDEA 3HKJB 2HALA 2ZGJA 2GV7A 2VB0A 3A83A 3ZYDA 4K75A 1MAXA 1HFDA 1FPHH 1HCGA 1MZDA 2KPKA 3RLEA 1EXFA 1X6DA 3RXMA 1SGFA 1O2HA 1AZ8A 1G36A 4JOPA 1RGQA 5FAHA 1XVMA 1AQ7A 1G3EA 1GJAB 2G4UA 2ZDKA 1ARCA 1CGIE 3MNCA 2QAAA 4ZHLU 2HGTH 4I8HA 1FDPA 3SNDA 4Z6AH 7KMEH 3BTFE 1RGWA 2YOLA 4NIWA 1ZMNA 2LA8A 1X5RA 3TGKE 3ZRTA 4X6NA 3NZIA 1C5SA 4WH6A 3A7WA 1K1LA 4X2VA 4F49A 4LK4A 1C4V2 1FCFA 1C5VA 1SBWA 2O8MA 3H5CB 2OQUA 3RXOA 1SGRE 2VWNA 3LNYA 3S7HB 2C93B 1T32A 1O2LA 4YOIA 5I46H 2ZC9H 3MO3A 2NU4E 4GVUA 1Q31A 1C2EA 1LVMA 2OD3B 3I29A 1BHXB 4AZ2B 3RXFA 5EW1H 2OPGA 2WPJS 3EA8A 5LH8A 3KZDA 2CV3A 3LONA 2BQWB 2LC7A 1FAXA 2ZFSA 3TK5A 1KDQB 3DUXH 3SNBA 2HLCA 3O8RA 3MO9A 1V2VT 1S81A 4BXSA 2SFAA 2P3FH 4FUHA 1FXYA 3LH1A 3E3TA 3ZVBA 2UWPA 2FLRH 5HFFA 4Q2NA 4OS5A 4YZUA 2ZEBA 1O2GH 4NMOA 2NU0E 4AFSA 5JBAS 3O8CA 1IQEA 1QJ6B 1C5PA 1SI5H 2YNBA 4OS4A 2BY6X 1QBNA 1SG8B 3GCHC 1A7SA 2KAIA 2VIQA 1BBRK 1WV7H 1ANBA 3PMHB 3TH4H 1T8LA 4GAWA 3RLWH 4BAQB 1QIXB 1O3HA 2V35A 1TOMH 4KTUA 1O2XA 5DP9A 1E34B 1O5EH 1S82A 1YLCA 2ODPA 4MPWA 4D7GA 5H3JA 3T25A 3QGNB 2PDZA 5CMXH 1V62A 2M0UA 2Z6BD 2WPMS 4ABBA 4ZUHA 3T2NA 4XE4A 3VB7A 2RG3A 2PKTA 2QN5T 3M3SA 2FS9A 1T4UH 1TX6A 4NMQA 1GMHF 1ELEE 1OP2A 4P2AB 2I6SA 2BX3A 1GI1A 4I32A 2FCFA 3PO1C 4AOQA 5A0BA 1EB1H 3TSVA 1DSUA 2ZZUH 2V3OH 5E11A 1MTSA 3GY3A 1CSOE 1U39A 1UEPA 1OX1A 2W5EA 4JL7A 1A4WH 2BD9A 3P92A 5EXMA 3DJ3A 2P16A 1SOTA 1GI6A 4HOPA 3K2UA 3LGWA 5FX6A 1W8BH 3E6PH 4X8TH 3M5LA 3ZZ8A 1EJMA 4YM9A 3MU8A 3KL6A 1C2IA 1KLIH 1WF8A 3DHKH 3MH7A 3SHUA 3VB3A 3M7TA 3V3MA 2ILNA 1UJDA 1AUTC 2R0LA 1JRSA 1Z1JA 1L4ZA 1V2NT 1Y8TA 3TJNA 3BTKE 3M5MA 4CRAA 1N6YA 3HK6B 3LDXH 1HNEE 1E0FD 1BUIA 2VH0A 5I25A 3VXFH 2ZP0H 1P2MA 3CS0A 6GCHF 4JOKA 4H11A 4CR9A 1XVOA 4ZAEA 3GDVA 3KQCA 1S85A 3GYLB 3RC6A 4KKDA 1NC6A 4FVDA 3SV8A 2OBOA 1X8SA 2ZDMA 3TPIZ 1MTNB 2SGPE 3ATMA 4NGAH 1ORFA 3GCOA 1EAXA 1L1GA 4OAJA 4Q7XA 1SSXA 5HXFA 1IQHA 1GHVH 1MKWH 2EGKA 5AVDA 1QJ7B 3L33A 2DM8A 1EJAA 3Q3XA 1DWDH 1AZZA 1WYKA 1VJ9U 3LNXA 1UEWA 4XHVA 1Y3VA 4RN6A 3ID1A 4LOYH 3MNXA 3TITA 3AAVA 4JMYA 5HFEA 3SUEA 1DT2A 3U8TH 3UOUA 4KTSA 3A80A 1RIWB 5FCRA 2M10A 3P8GA 4UDWH 1AU8A 5JB9S 1QRXA 1TP5A 2B8OH 2PUQH 5GXPA 5EQQA 1QTFA 4ZXYH 2J95A 2BLWA 3RXQA 1D6WA 4NIVA 4UU6A 1P8VC 1ZTKA 3ESTA 4H42U 1O3DA 1W13U 1OWEA 1I16A 5EOKA 2ASUB 1SQAA 1LTOA 4QT8C 2GMTB 1QRWA 3GCTF 1ELCA 2RA3A 3RLYH 1MBQA 3P6ZB 3VFEA 2QCYA 1TFXA 2HOBA 4UFEH 5FXLA 1UTNA 5C1XA 3V13A 2F9UA 2ANMH 3SHCH 4Y8ZA 4WF8A 1TX8A 2BQ6B 3AW1A 4RKOB 1QB9A 4H4FA 3RXEA 2Y5HA 1M9UA 3F6UH 2PUXB 2BD7A 1UK2A 1TWXB 2D8WA 1SMFE 3Q76A 1EZQA 2ANYA 1Z86A 2EJYA 1OS8A 1MFLA 4Q6HA 3SOEA 1FIZA 5EXLA 1N6DA 1A0LA 5G1EA 5L2YH 2VWRA 1C1UH 4A7IB 2I6QA 2XYAA 3BTGE 1L6OA 1LKBA 2ZGHA 4YOGA 1BITA 2CHAC 2D1JA 2EAQA 1GBAA 3SHAH 1V2KT 2ZCLP 4Q2QA 5A8XA 1XUIA 4NMRA 2J92A 1OPHB 2GZ9A 2JH6D 1ZSJA 2MX6A 2FLBH 2HPPH 4DT7B 4AG1A 4BTTB 1OBXA 1V5LA 8KME2 1GQ5A 4X1RU 3BTWE 2A5AA 1IQNA 2ZFPH 2H9HA 1XXDA 3M5OA 2XNIA 3T26A 3ZZ5A 5JBTA 1O2TA 1A1RA 3VPKA 2PKAA 1AWHB 3KZEA 3KGPA 2W7UA 4MPXA 3TGIE 4ZHAA 2XWAA 1UM7A 1C5YB 1TA2A 2OLGA 2OC8A 3GY5A 5C1YA 5FPSA 1SVPA 3TVJB 1L2EA 3NXPA 1GBHA 2QA9E 3SJKA 3RXRA 1GI4A 4Y76A 2JETC 3K82A 2CGAA 2J38A 2SGDE 4XBBA 4AN7A 2TPIZ 1AGJA 2ALVA 1WIFA 1S84A 3M3TA 3AXAA 1MQ6A 3BSQA 3D65E 1S6HA 1MKXK 2AMPA 1TOCB 3AAUA 2HPQH 4NCYA 1C4Y2 1RXPA 1C1OA 3RDZA 1GQ4A 8GCHF 4YLQH 1E37B 1UCYE 4AYVB 1SGDE 5E0HA 4EDJA 4FUEA 1AKSA 1DANH 1NFUA 1F92A 1KXCA 4G69A 3MH5A 4INKA 1W9OA 2AMDA 4K1EA 4E05H 3GSLA 5D13A 3KF2A 1RZXA 2ZHEH 1NU7B 2VGCB 3B76A 1HUTH 3BTHE 4Q80A 1TYNA 3HKIB 3RM0H 1K1MA 1ESAA 1THRH 1ZRKA 2GX4A 5GPIB 5J4QA 2ESTE 1O5CB 2BMGB 1UVSH 1AY6H 2D8IA 3ZV9A 1GHAG 1NRPH 1BCUH 2KBSA 3V7TA 1P1DA 3UQVA 3ZZAA 1Y3XA 1X7AC 6CHAC 4L8NA 1B7XB 4F4OC 2KV8A 1UTLM 2BOKA 1E36B 3KN2A 2VZ5A 7ESTE 1UHPA 1K1OA 2Z3CA 2EHRA 4ABHA 1C1WH 1BTUA 2ZA5A 3P8FA 3MH4A 2NU1E 4RSPA 3R69A 1MD7A 2PKSB 2ZHFH 4WWYA 5E2OA 3S9BA 1W7GH 4ABFA 1GBTA 1G32B 1Y3YA 1GVKB 1EPTC 1YPHC 3PB1E 1LHDH 3SO3A 3SU4A 4ISOA 1HJ9A 2KAIB 1YP9A 3PYHA 2R4HA 1AFQB 2W3IA 3ZZBA 4Q6SA 1QL7A 1P2JA 2J34A 1C5RA 1P57B 3HPTB 1GCTB 3GGEA 4O06A 2BDHA 3GJ9A 1G37A 3M3VA 1NRRH 3QGLA 2OZFA 2BD4A 1BOQA 1QL8A 3GYMA 2FOMB 1WHAA 2CN0H 3MI4A 3PLKA 1NROH 4Q2PA 2L4SA 5F03A 3O8DA 1V2QT 4FXGH 1K1IA 4GUXA 3F68H 3S9CA 3PLBA 3FZZA 2KG2A 1DDJA 4IC5A 1O5FH 1K9OE 3SUDA 1HJAB 1DY9A 1PYTD 2FTLE 3UOPA 1GL0E 3T29A 3A8DA 1AIXH 1TP3A 1X5NA 1BMMH 3K65B 1WH1A 4HOPB 4Y8XA 1RTLA 1NPMA 2ZHWH 2VWMA 4JZ1A 1QFKH 4X8UH 1GI0A 3H7TA 2BDCA 1FY1A 1BBRE 3RU4E 4DY7B 3RXUA 1BMLA 2KOMA 3Q3YA 2AINA 4JK6A 3E0PB 4O97A 1L4DA 1V5QA 1P9UA 3B9FH 1YLDA 2BVSH 2P3WA 4GHTA 5EXNA 1P12E 1MZAA 2XC0A 4D8NA 5C67A 2G52A 2A45B 4IGDA 4D9RA 2H9TH 1EKBB 2P93A 1OBZA 1O3CA 5HEDA 1Z71A 1GI5A 1C5WB 3OY6U 1Z8RA 2EDPA 1O2KA 2Z9GA 7LPRA 2M0VA 4UEHH 1GJ4H 1RFNA 1OYQA 5DTHA 1C5QA 2JOAA 4Q2OA 1DLEA 3M35A 2VNTA 1OWDA 1EZUC 1UEQA 1HDTH 1O2ZA 2Q6DA 4X1QU 1D9IA 3C27B 4CHAB 4ZH8A 8LPRA 3ATKA 4Z33A 3O8BA 4D9QA 3ZVFA 3L4FD 4A1VA 1LDTT 2VINA 3HPMA 2GZ7A 2OBQA 2BXTH 4H6TA 1XZ9A 2GKVE 2H2ZA 2ZG0H 2EEJA 2V1WA 1SGPE 3GY8A 4THNH 1Q2WA 3RXJA 1SFQB 1J16A 1TX7A 2XBYA 1PPBH 1GG6C 2C8XB 3MH6A 1H9IE 1O3PB 1PQ7A 1UTJA 4ZKOU 1ANEA 4YLUA 3EGHC 3BF6H 2PR3A 3MYWA 4ZKSU 1C1SA 1XUFA 4R2ZA 1SLUB 2DLUA 4NG9H 1UCYH 4PROA 6LPRA 1V2WT 2CSSA 2FM2A 2HRVA 2CF9H 2GCHG 4WH8A 2UUFB 3LU9B 2BY7X 4A1TA 3QDOA 1S0QA 1ZMJA 2ZFRH 4BAOB 3VB6A 1DWBH 1XXFA 1O2VA 1OYTH 1GBBA 1O2WA 3VXEH 4K76A 1AUJA 1QLCA 1O3EA 2BB4A 1BB0B 1GJ7B 1GI9B 1TNLA 1ZZZA 3SU0A 5GCHG 1RRKA 3SU3A 1Y3WA 2ZFFH 2EI8A 2ZDNA 5HFCA 1OP8A 1ZPCA 3LOXA 1IAUA 1G2LA 2Z17A 1BRUP 3QUMP 3MU5A 3RXVA 2P59A 4CBNA 4KFVA 4KP0A 1O3OA 3CH8A 4A5TS 2ZPMA 1O5GH 4B74A 1WCZA 3D62A 1UVPA 1IQJA 1GBJA 2G5MB 5EPYA 4NMSA 2ANKH 3Q77A 1MTVA 3SI4H 1Y59T 2GTBA 1C5XB 4X1SU 3UNRA 4GSOA 3NGHA 3WKMA 2FYQA 2P3UB 4Z8JA 2YT8A 1CA0B 3ZVCA 4WMDA 4B73A 4NWKA 4NMTA 3A81A 2TRMA 2ZTYA 1EJNA 1FPCH 4WYUA 5C3NA 3E91A 1FC9A 4INHA 2A5KA 2GCTC 5TCAA 1TGCA 2WPLS 4R8TB 1OKXA 2FP7B 5HGGA 1WQSA 4KFWA 1D5GA 1Z6JH 3EYDA 3WKLA 1QJ1B 5B6LA 1P01A 1Z87A 2BXUH 1TPAE 2ZPSA 1FN8A 2G8TA 2G51A 1N6XA 4O3TA 5DP8A 1O2SA 1Z8IB 2OQ5A 1CU1A 1DPOA 1O2IA 1EOLA 2PKAB 2ZTXA 3SJ9A 4CRGA 1H4WA 1P2NA 3GISB 1TALA 1LHGH 1GPZA 1O5BB 1UTKA 4B2BA 4X6MA 3ELAH 2ZO3H 1MUEB 4K60A 3A82A 1P11E 3EGKH 4E35A 4CH8B 1B0FA 1X45A 1LHFH 3U98H 4GLYA 1W0ZU 1AB9B 3NCLA 4DIHH 3SJIA 3G01A 1A0HB 3TK9A 4IW4E 1SC8U 4CRDA 1XUKA 1H1BA 5FBEA 3RU4T 1F5RA 1DE7H 3PV5A 1ZHPA 1AKSB 1YPKH 3AVZA 4ESTE 2WL7A 3V0XA 1ZRBA 3E1XB 3QGJA 4ABIA 3KQDA 1T4VH 2DAZA 4JCNA 2C90B 5HEBA 1T7CA 1TNGA 1BMNH 1SGFG 2H9EH 2IPHA 4K69A 1VB7A 3SV6A 4U2WA 4A1XA 1CVWH 5B6OA 3SGAE 4B1TA 1TBZH 1TMUH 1VAEA 3OTJE 1L1NA 1K2I1 2EI7A 2KQFA 1K21H 2BX4A 4NSYA 5DPAA 3TNSA 2QF0A 4NA9H 1HIAA 1AD8H 1BRBE 3SGQE 5G1DA 3ATIA 1O39A 1MH0A 4HZHA 1YPJH 1GBMA 3GDUA 2BD5A 2WUCA 5HFBA 2FMJA 1MTUA 3E16B 3LIWA 2C8WB 1PDRA 4X1PU 3HPKA 3QE1A 5DP7A 1PPGE 3RXKA 1BE9A 5DP5A 1PPFE 5F6MA 3VGCB 3I4WA 1O2UA 1T8NA 1F0UA 1ZLRA 5TCCA 5FPTA 1MCVA 4GCHG 2LNCA 3A87A 1UITA 1GHBG 4Y71A 3RXBA 4AG2A 3NWUA 4Q7YA 5DGJA 1DS2E 3NKKA 1ZJDA 2FI3E 2J94A 1N7EA 1KXEA 1AMHA 3F9GA 4OS1A 1NRQH 1N7FA 1C1VH 1DFPA 1GBIA 4I7YH 1IHSH 1LVBA 1ESBA 1TGNA 3FP6E 1VCPA 1QRZA 2QBWA 4ZROA 2VU8E 2A4QA 3HATH 4I31A 4FUJA 3TNTA 4I8JA 1C5TA 1ZJKA 2DLSA 3TU7H 2K20A 2KYLA 1TNIA 1ELBA 1MFGA 2ZGCA 1D3TB 2FOAA 2Y7XA 1A5GH 1Q3XA 3FFGA 2I6VA 1C2LA 3I1EA 2KPLA 4UD9H 4YT7H 1GDUA 2P3TB 1YCPH 5CHAC 3MNSA 3FVFB 4BNRA 1SLWB 3SW2B 1QCPA 4VGCB 1Y5AT 2THFB 1XKAC 4HGCA 3M7QA 3LGTA 1LHEH 2XTTB 4KTCA 4XOJA 2J2UA 1EASA 5L6NH 1R6JA 1T8OA 2RCZA 1QA7A 4I8GA 2ZQ1A 4GVCA 3PDVA 3A8BA 3DFLA 4IS5A 2ZI2H 2Y5FA 2Z3EA 4DGJA 2FODA 1DWCH 4JOEA 3UUZA 5AF9H 1C2MA 4YOJA 3BTEE 1P1EA 1XX9A 3RXAA 2KJDA 3MOCA 3QO6A 1TRNA 3P70B 4AYYB 1DLKB 2SNVA 2Z9JA 2FS8A 1TAWA 2R9PA 1BFEA 1JRTA 1BIOA 3ID2A 1WAYB 1E38B 3U8OH 1ZYOA 2AERH 2ZGXH 3KQBA 2FOBA 4B76A 1YPHE 4Y7AA 1OXGA 4ABEA 4ZHMU 2WPHS 1O33A 1ELFA 1CT2E 3UQOA 1FONA 2CJIA 3KQEA 4BAMB 1P06A 1H8DH 1WFGA 4MNXA 2G81E 3HGNA 2FZZA 3ZZ7A 4LZ4B 4WMEA 2YNAA 1NT1A 3TJUA 3GCNA 3T62A 2D26C 1UO6A 3S69A 3M61U 1NS3A 5E2PA 1GGDC 4AB9A 3IWMA 2M0ZA 1TB6H 3RXLA 2O8TA 1O30A 3ITIA 1HGTH 1KEFA 1KTSB 5CE1A 1VCQA 1FC7A 2TIOA 5C1UA 2FEQH 3VB4A 4K8BA 3ODFA 3NFLA 1GL1A 5E0GA 4JZFH 3SFJA 1O2MA 2XCFA 2GP9B 1PYTC 4UE7H 3PMJA 1UVOA 3SQHE 5GIBA 2VIOA 1GHXH 2NU2E 1YKTA 3BTQE 2C8YB 5HM2A 3D23A 3LGIA 2QKVA 2KJKA 3QJMA 1FY4A 3RMMH 1NRSH 3BPUA 1P02A 2SGAA 2ZTZA 1YPEH 5G4BA 1BTHH 1EAUA 3T5FH 3F9FA 3EA9A 4OEPA 3DT0H 2KOHA 2R3UA 4N6XA 3R3GB 3MTYA 3U1JB 1BTWA 3Q3KA 1YPGH 3RMOH 2H1UA 1FZZA 3ZVAA 2B0FA 3FY5A 1VITF 1W0YH 2IOTA 1VGCC 4WJG2 3UIRA 4OEOA 1WG6A 2DB5A 1V2MT 3TH2H 3MU0A 4X2XA 3E8LA 3SI3H 1GBCA 2YT7A 1G3BA 1OZIA 5K0HA 1MKXH 1MU8B 1U6QA 2BVRH 2FIRH 2Y5GA 1KY9A 1NM6A 1FNIA 1KSNA 1YF4A 5C2ZA 3GY2A 2EDVA 1N8OC 1WI2A 2A4GA 2Z7FE 1A2CH 4E7RG 2ODQA 5FX5A 2EXGA 3R0FA 2CS5A 2D2DA 1WFVA 3KIDU 2ANWA 3TSWA 1CHOF 1O5DH 1UTQA 1O3AA 2PKUA 1G3CA 1Y3UA 2QKTA 1QAUA 4JYTA 4XBDA 4DJZB 4BANB 1H8IH 1OOKB 2O8UA 2ZPQA 2R2WU 1WJLA 4OS6A 1UHBA 4H6SB 1ELAA 1TMBH 1F5KU 1EPTA 1W11U 1FUJA 1HPGA 4TY6A 4SGBE 3GCHB 3STJA 1CBWC 4IMQA 1LCYA 1FV9A 2F9VA 4X8SH 5ABWA 4I33A 1XUGA 5JXBA 1A3BH 3UFAA 1JBUH 5LPRA 1UVUH 2OCSA 3LT3A 3PWCA 1GMCG 4BOHA 1W3CA 1FC6A 1Z8GA 5EGMA 5JDUB 1LO6A 4NXPA 2IWPA 1O36A 1BRAA 5L2ZH 3U69H 3UTUH 5BRRE 5HM9A 1C5MD 3SZNA 3O5NA 1SGCA 1H9LB 3LGYA 3SNAA 3ZV8A 1ZGVA 3PM3A 4FUDA 3RXIA 1O2NA 2VSPA 1PPEE 3PO1B 4IN2A 1P0SH 4LZ1H 1HJ8A 1L1JA 2IJOB 2TBSA 1YPMH 4K5ZA 3UREA 1GBDA 1WU1A 4Y11E 2BY8X 2RA0A 2O2TA 1FJSA 2EEKA 1HIAB 3RXDA 1Y5BT 3K50A 2Z3DA 1F0RA 1SGTA 1TIOA 1FIWA 1HAVA 5HJ1A 1N99A 1MC7A 1SLVB 4IMZA 1TQ3A 1FY3A 1UTPA 1A5IA 1GHZA 1ANCA 4XSKU 3TLOA 2FI5E 1BRCE 5ESBA 2L97A 3FAOA 3QDZB 1QGFA 5EODA 1WUNH 1RJXB 4JORA 2W7RA 3SBKA 2IWQA 4K1SA 4DOQA 2BVXH 2BYGA 3RL7A 1HAHH 2XBVA 3LPRA 1ZUBA 3BG4C 1TLDA 1P10A 3TGJE 3QWCH 1J9CH 1EOJA 2B7DH 1B8QA 1NN6A 2AIQA 3OYPA 4WMFA 3EGGC 4K6YA 2STAE 3DD2H 5A8YA 2ZDLA 1FQ3A 1N6EA 1P2QA 4GVDA 2WYGA 3BEUA 2VVUA 4M7GA 1TE0A 1C1RA 3LC5A 1WF7A 3CS7A 4BAHB 1UEZA 3A84A 1MMJN 1TRYA 1N7TA 5EZ0A 1D3QB 2JIKA 3ID4A 3KHVA 2P8OC 3M36A 3LGVA 2FXRA 4MDSA 4NSVA 3A8AA 4X6PA 1O2RA 5FHTA 1BQYA 3NK8A 1A3EH 1IQMA 2XW9A 1S83A 4R0IA 4AFQA 4TPYA 5JB8S 2SNWA 3NUMA 4NXQA 1ARBA 1P09A 2JILA 2W26A 4NZQA 1IQKA 1C2GA 3L6PA 4FVBA 3LJJA 2WV4A 1QL9A 2GGVB 2ZU5A 3TJVA 5FBIA 3W94A 1AWFH 1HLTH 1O2QA 3SUZA 3ZVDA 1PFXC 1EP6A 1YGCH 1EZXC 1BZXE 2Q3GA 3QLPH 5HEYA 1X5QA 2HE4A 3PLPA 1GVLA 1JIMA 3UPEA 4J1YA 2W4FA 2QYIA 4OS2A 3T28A 1J8AA 4IBLH 1KLJH 3SGBE 3MFJA 4HI3A 2I4SA 2ZCHP 2WPKS 3SV9A 3EE0B 1W9QA 3H7OA 2KRGA 1YC0A 3C1KA 2VIVA 1NFXA 1V2ST 4J2YB 3B23B 1SB1H 3A7XA 1K22H 3CENA 2F9OA 1O3LA 2BQ7B 1FY5A 4I8KA 2DC2A 1TNHA 4NNMA 3PWBA 3A85A 1D6RA 1A61H 3BTTE 4ZKNU 5EYZA 2BY5X 4WVPE 5EG4A 1P2KA 1V2PT 2B5TB 3OY5U 3ODDA 2BD2A 1C1PA 2Y80A 4ISIH 2KOJA 4X2YA 5DP6A 2I1NA 1ZTJA 3BEIB 5SGAE 1GJ9B 2BHGA 1TPPA 3RXSA 3ZZDA 1O0DH 2CHAB 2ZPRA 2EEIA 2Z9KA 3K6ZA 3ZYEA 1MAYA 3UR9A 2ENOA 1M5ZA 1NU9A 3SNEA 1QNJA 5E22A 3UR6A 1Z8JB 3GY6A 2GDEH 2I04A 2RDLA 2OSGA 1YM0A 1O35A 3R68A 1E35B 2V6NA 4MNWA 4ABJA 2DE9A 6GCHG 3U9AH 1T8MA 1FI8A 3SUGA 3CP7A 1O2PA 1UM1A 1K28D 2OTVA 3MWIU 2JETB 2JH5D 4KGAA 1K1JA 1THSH 3ZZCA 4FUCA 4NFFA 2G4TA 3T27A 4Y0YE 4BTIB 4E34A 3PV4A 2BDYA 2HGAA 1HAOH 2A2QH 1U3BA 1EUFA 1ZPBA 3PV2A 4GHQA 1W9EA 3QZRA 2VIDA 1HAYB 3UWJH 4YTAA 5GLJA 1O31A 1WQVH 1AVWA 2Z9IA 1B0EA 2PGQB 2E7KA 2H3MA 1T31A 2FOGA 2OCVB 2UUJB 1KYNA 4JOFA 2O9QA 3RXPA 2ZFQH 1K32A 3HK3B 5E0JA 1P3CA 1SGYE 2FDAA 5AHGH 3BIVH 2VH6A 4RKJB 1UMAH 5T6DA 1BTZA 4K3JA 2I0LA 3EA7A 1KXFA 4Q3HA 2G55A 1PJPA 3SHWA 1TMTH 4K78A 3GCTG 2V0BA 4MNYA 4AMHA 2A1DB 2VIWA 2OP9A 1ZMLA 4FGMA 1MU6B 1AHTH 1H9HE 1V2JT 6CHAB 4UU5A 1F0TA 1GBFA 1V3XA 3E90B 4LXBH 2AFQB 4O03A 1EATA 1DWEH 5C5NA 1AE8H 1IQLA 1FMGA 4PQWA 1MTNC 2IWNA 1O3NA 2OGPA 3TMHA 2QC2A 1CE5A 4X2WA 2ZU1A 5A2PA 1UHBB 2AMQA 1Q7XA 8ESTE 2FPZA 4P0CA 2BTCE 1EPTB 2EI6A 2CSJA 5ESTE 5HF4A 3QX5H 3URDA 2QF3A 6ESTA 1IQGA 1ZPZA 2O8WA 2J4IA 3VEQB 1DVAH 1MD8A 2PLXA 1EB2A 2CMYA 1QHRB 1W7XH 2OC0A 3QZQA 1QR3E 1D3DB 5T3HA 3F9EA 1HYLA 1PPHE 5JBCS 3DIWA 3OU0A 2TGAA 1MTWA 1NESE 1RIWC 1XUJA 4JZIA 1V2UT 2ZHQH 1UF1A 1ELTA 2G2LA 5HFDA 2PNTA 2A7HA 2AIPA 4X6OA 1YYY1 4B2AA 2QXGA 1BBRH 3I78A 4ABGA 1GHAF 2GMTC 3ZZ9A 4YYXA 3GY7A 1DUEA 4Y8YA 3ATLA 3JZ2B 1HAXB 2OUAA 3NFKA 2TGTA 2KL1A 2Y81A 2BZ6H 2WV5A 4F8KA 1NTPA 1SL3A 1TPSA 1W14U 2A0QB 1JXPA 2OC1A 4FUGA 5FPYA 2HNTC 4JZDH 5A0AE 3HVQC 4JOJA 5LGOA 4YO9A 1UK3A 4NWLA 4IN1A 1VCWA 1VJ6A 2BOHB 2JINA 4IC6A 2RCEA 2REYA 2HVXA 1HAVB 2Z94A 8GCHG 1BHXF 1HAPH 1ETTH 4HFPB 3P17H 2AYWA 3SOSA 3RMLH 3SU2A 1WTGH 1OP0A 5DP4A 2XC4A 1Z7KA 4Y10E 5LPEA 3SNCA 1U37A 2FYRA 5FCKA 4MPUA 4NIXA 4A6LA 1BMAA 1J15A 3VQFA 4Y6DA 1GDQA 4K1TA 2A7CA 3PS4A 3OX7U 3PTNA 3RC5A 4E3BA 2ZWLH 4KELA 3A7TA 2BDAA 1PQ8A 4ZMAH 4ZXXH 1EAWA 2GV6A 2VRFA 1BTPA 4NXRA 1C2JA 2VJ1A 3K1RA 1P04A 3TSZA 2KAWA 4BAKB 2A4OA 1V2OT 1QA0A 4TYDA 1A46H 2D92A 1C2HA 2PHBA 2M5TA 3RXGA 1WI4A 2OINA 2CF8H 1OWJA 1IU0A 5F8ZA 4INLA 1L0ZA 4DW2U 1EQ9A 4UONA 2JREA 4O3UA 1ACBE 1EZSC 3P8OA 1GG6B 2FWWA 3MMGA 4Q2KA 1QAVA 4JOHA 1N6FA 4E06H 1NRNH 2L4TA 2OS6A 5L30H 2EC9H 2QKUA 1K1PA 4B2CA 1DXPA 2H5DA 4K72A 2IWOA 1A0JA 3BN9A 1XMNB 1O3FA 2GVFA 4CRFA 5J4SA 3E0NB 1LPGB 2FOFA 1GMDG 2VWOA 1C1QA 2VPHA 4CRCA 2STBE 3JXTA 1JMOH 2VGCC 4U32A 3KNXA 2PA1A 1TGTA 2AS9A 2BDBA 1OWIA 4FU9A 1PPCE 2BM2A 2JXOA 2FX6A 1LQEA 1V2TT 4NZLA 4WYTA 2GD4B 1TABE 2FOHA 1HRTH 3ATWA 3TK6A 1V2LT 3KCGH 2H6MA 3SN8A 3KHFA 4NNLA 1S5SA 3TIUA 2P94A 3LKWA 1DOJA 1GHWH 1O3JA 1P2IA 3MU4A 2A31A 5H4IB 4ABAA 2ZQ2A 3GOVB 2QXIA 2ZFTA 1O37A 1Y7NA 5GWZA 1ZSLA 2F9BH 4XBCA 3QIKA 2ZGBH 3QN7A 4AB8A 1RD3B 5A2MH 1GI8B 1ZR0A 1TPOA 2PKSC 2UZCA 1P9SA 2ZECA 2FNEA 3EDXB 3I77A 1P3EA 4U30A 1SOZA 4NIYA 1FN6A 4AFUA 2GCTB 2CXVA 2DE8A 1YCPK 1XM1A 5FB8C 1V6DA 2GZVA 2GCHF 3BV9B 1SQOA 3UNQA 4REYA 4NFEA 1AFQC 1JOUB 2ALPA 7GCHG 3R0HA 4D76A 1RTKA 3A7ZA 1GCTC 3STIA 2ODYB 1EAIA 4TPIZ 4ASHA 2BD3A 2BYAX 2H3LA 5GCHF 3RM2H 2JKHA 3OSYA 2AWWA 5EQSA 1C5OH 3RXCA 2JH0D 3RC4A 3S7KB 1C2FA 2F9PA 1W10U 1KXBA 1C9PA 3URCA 4BTUB 1ZOMA 2PZDA 3I18A 2ZCKP 4NMVA 1O3BA 4OS7A 3S9AA 2ZDAH 1HJAC 4Y0ZE 1ELDE 3SV7A 3SUFA 2FOEA 5TJXA 1UVTH 2FOCA 1J17T 4WXIA 4SGAE 1OWHA 5GNDA 1TGBA 2HNTF 3F9HA 3RUOA 1UTMA 3SU1A 1EP5A 1ABIH 1TBRH 2VIPA 2EGOA 2A4RA 1A5HA 2DJTA 4JYUH 4Y79A 1RGRA 2K1ZA 1O3KA 2F0AA 1LVOA 4MLFB 1GDNA 1SR5C 2AGEX 2R3YA 2V3HH 2ZU2A 1MKWK 3Q00A 4DIIH 1BTYA 3TJOA 1QBOA 3NPSA 2TGPZ 2ZIQH 4JK5A 4NA7A 2LOBA 2UWLA 1T2MA 2GT8A 2EGNA 1HBTH 1CHGA 1RS0A 4CHAC 1F7ZA 5K7RA 1AVGH 1YCPM 1CT4E 4CRBA 4FUIA 3RP2A 5EW2H 9LPRA 4TY7A 4TWWA 3RU4D 1ETRH 1SGIB 2FO9A 3A86A 1TBQH 3RMNH 2PV9B 1NO9H 5F8TA 3PMAB 4JYVH 2G00A 1DSTA 5C20A 3AASA 1IQIA 1KTTB 1TGSZ 1VR1H 2OXSA 2Q6GA 2AWXA 4AGKA 4CR5A 1BJVA 4YESB 1GBEA 4MG3A 4MPAA 1ZOKA 1WTHD 3DJ1A 1GJ5H 1YPLH 1SGQE 1ZHMA 5DO4H 2AH4X 2BDIA 1Q3PA 4Y7BA 2X7ZA 2BLQA 5DKMA 1WSSH 2AGGX 2NWNA 4DG4A 1GCDA 1LHCH 2PGBB 2GT7A 3IITA 5DP3A 4DVAU 4AX9H 1TA6A 2FE5A 2UUYA 1Y5UT 1G9IE 4UFGH 2UWOA 2TGDA 1PQ5A 2ZNKH 3F1SB 2QXJA 3JZ1B 3UWIA 1QY6A 2WINI 4UFDH 1SHYA 2PSXA 5HETA 1TQ0B 4YT6H 1C2DA 2FTMA 5DG6A 2HWLB 5CHAB 3GICB 5BPEA 1OBYA 2AWUA 1SFIA 2H2BA 4NMPA 5EU8A 1IHTH 2ULLA 2R0KA 1GJCB 3K6YA 3UNSA 1ZTLA 2C8ZB 2A7JA 1O5AB 1AE5A 1O38A 2EV8A 3ENSB 3K9XB 1WHDA 5AFYH 2PTCE 1IHJA 1Z6EA 1UTOA 2M3MA 1NY22 1GI3A 5T6GA 3SJOA 1HAGE 3A89A 1NF3C 2V90A 1LMWB
chains in the Genus database with same CATH superfamily
1K1NA 1IU2A 2XBXA 3M7UA 4YDPA 1GM1A 2RRMA 4ISLA 4GCHF 5E21A 1GHBF 1C5ZB 5GJ4B 1QB6A 3S0NA 1FLEE 5C17A 4UFFH 1BA8B 5IK2D 2XWBI 1QQ4A 3PMBB 2FESH 5JYIA 2LPRA 2Y7ZA 4BXWA 3ID3A 1TRMA 1CA0C 2O8LA 1V1TA 5E6PB 4FUFA 3LC3A 3N7OA 1DM4B 4TSFD 1E1QD 5GDSH 3KEEA 2QT5A 3MHWU 2YTWA 1XUHA 1ZHRA 3DJAA 2L6OA 4TT3D 1HV7A 1ABJH 1P05A 2AGIX 4AC9A 2XXLA 1DICA 1KDQA 9ESTA 2QV1A 1BJUA 2FX4A 2XBWA 2B9LA 1FY8E 1C4U2 2Q1JA 4AGJA 2GDDA 1MCTA 2LC6A 1YBOA 2Y6TA 1G2MA 2UUKB 3SU6A 2IN2A 2XRCA 1HB0B 3HGPA 2QG1A 3BIUH 3U8RH 2H2CA 1DXWA 1PQAA 4MTBA 3GDSA 1BDAA 1O3GA 2SGFE 1ESTA 2ZU4A 2C4FH 2PTNA 4K8YA 5LPFA 3VB5A 5DK1A 3NCVA 1QURH 4XFQA 2G5VA 3BG8A 3P8NA 1WXRA 2Y82A 5C5OA 1GGDB 2YMSC 2MHOA 1AN1E 1JIRA 1AI8H 2OC7A 3NRLA 4MVNA 3ZZ4A 3LJOA 3WY8A 2AEIH 4JOGA 1QAVB 1GMDF 2DUCA 1UJ1A 2FN5A 1V2RT 2QXHA 1MQ5A 1KLTA 1LPZB 1ANDA 1AB9C 1O2JA 2F91A 1GHYH 2ZKSA 3P95A 1QQUA 1WBGB 1C9TA 1OWKA 4TWYA 2QY0B 3BTME 3B8JA 2DMZA 1MBMA 1YBWA 2HNTE 2Q9VA 3ZVEA 5A09A 1DY8A 3BEFB 5A0CA 1SPJA 4FU7A 4K2YA 2PFEA 2M0TA 1NFYA 1I92A 2LELA 4I8LA 3ZVGA 1KXAA 3A7YA 1DUAA 5PTPA 1GVZA 1NZQH 1O34A 4Q7ZA 4MNVA 1GWAA 1N1LA 3SORA 5HIYA 1AVXA 1VJAU 2F3CE 1F2SE 1SKYE 2F9NA 1P2OA 3MU1A 3SQEE 2SGQE 4MPVA 3PROA 1SGNE 3KDKA 1G9OA 2D90A 1GJBB 3PDZA 5KECA 1C2KA 2DKRA 3FP8E 3QTVH 1ID5H 3CBXA 2ZDVH 3CC0A 2KZ4A 2P95A 1SHHB 2J9NA 2LUIA 1GMHG 3ZZ6A 1SGEE 1IQFA 1G3DA 1RTFB 5F8XA 2VSVA 1VGCB 1HXEH 2FI4E 2KX4A 2A5IA 2WYJA 1UJVA 1O2OA 2EA3A 2K1QA 1ETSH 4CBOA 2EEHA 4ZKRU 3MQKC 1D4PB 3A8CA 4HTCH 5E8EH 2PW8H 1S0RA 3EQ0H 3VQGA 3QTOH 5F3XA 2KJPA 3VGCC 1V6BA 1FAKH 3D49H 2QGRA 1RY4A 5KGOA 1PPZA 3OEED 3RXHA 7GCHF 1GI2A 1O3IA 1N8OB 1QB1A 2ZHDA 1LVYA 3RL8A 1TQ7B 3TH3H 4B75A 5JPMH 1GI7B 1GJ6A 3W95A 5EQRA 1NTEA 1W12U 3SV2H 3M37A 1O2YA 1VZQH 4OGXA 2XCNA 3EAJA 2YUBA 2KA9A 3LGUA 2PWXA 4NA8A 3FN8A 1WOFA 2OQSA 4AFZA 1F0SA 4B71A 2G5NA 2NU3E 3MNBA 4MQAA 2OMJA 4ABDA 1GJ8B 2BD8A 2W3KA 1DITH 1O3MA 1OSSA 2GZ8A 2VWLA 1HAZB 4DURA 1LKAA 2BLOA 4WY3A 1GBKA 1CBWB 4JZEH 2VVVA 4AORA 5HMAA 3ZZ3A 4VGCC 3FZDA 2WUBA 3LH3A 1B5GH 3UY9A 5CDFE 1GJDB 3QK1A 3CBYA 2I0IA 4A92A 2EEGA 3FP7E 1J14A 1INCA 1TNJA 3A7VA 3CBZA 4OGYA 4E7NA 1U38A 1LQDB 5DJ7A 1HAIH 2EDZA 1UK4A 3SU5A 1F5LA 4FUBA 2W7SA 1BTXA 2BZAA 2F83A 1XKBC 2Q6FA 2A2XH 3IG6B 4CH2B 1CQQA 1HXFH 4GHNA 2HE2A 2QIQA 2ZU3A 1JWTA 1UFXA 2C3SA 4Z0KA 1VA8A 1SQTA 4GPGA 3AW0A 5E1YA 2ZPLA 4ISHH 4LMMA 1THPB 1G30B 3FANA 1EX3A 3DA9B 2JWEA 2H5CA 2Z9LA 3E17A 2A32A 2BLVA 4U01A 5IDKA 4CREA 4X0WU 3A88A 5EPNA 1BT7A 2XC5A 2SGEE 1O32A 2KCPA 1ELVA 1DX5M 3O46A 1C5LH 1AFEH 5HDYA 1Z1IA 3BTDE 5F67A 1KWAA 3L3TA 1ZGIA 4DCDA 1LPKB 1CT0E 1IOEA 3V12A 3DORA 1C1MA 5JBBS 4O9VA 5HYOA 2BY9X 3CYYA 5T6FA 1UCYK 1KIGH 4FU8A 1VITG 3U1IB 5ETXA 1TNKA 3OTPA 5A8ZA 3DFJA 1AO5A 3BG4B 2F5YA 1KXDA 2BDGA 2R2MB 2ZF0H 5IYTA 1S6FA 1W2KH 1CA8B 5AFZH 4ISNA 1GMCF 2PSYA 4RI0A 4WXVA 1GBLA 2YUYA 1C1NA 2VVCA 4X8VH 2QF5A 1UJUA 2WPIS 4X1NU 1ELGA 1TONA 1C1TA 3RXTA 1QBVH 1ZSKA 4B6EA 1CO7E 1D3PB 1C5UA 1CGHA 3QJNA 3MO6A 1Q3OA 5HF1A 1SLXB 3SJ8A 3GY4A 1YWUA 5I7ZA 4D7FA 1CGJE 3M5NA 1CHOG 1H8HD 3PTBA 2F4LA 1P03A 1C5NH 1NFWA 1VITH 2P8OB 4XDEA 3HKJB 2HALA 2ZGJA 2GV7A 3N7EA 2VB0A 3A83A 3ZYDA 4K75A 1MAXA 1HFDA 1FPHH 1HCGA 1MZDA 2KPKA 2JJ2D 2JSNA 3RLEA 1EXFA 1X6DA 3RXMA 1SGFA 1O2HA 1AZ8A 1G36A 4JOPA 1RGQA 5FAHA 1XVMA 1AQ7A 1G3EA 1GJAB 2G4UA 2ZDKA 1ARCA 1CGIE 3MNCA 2QAAA 4ZHLU 2HGTH 4I8HA 1FDPA 3SNDA 4Z6AH 7KMEH 3BTFE 1RGWA 2YOLA 4NIWA 1ZMNA 2LA8A 2KM0A 1X5RA 3TGKE 3ZRTA 4X6NA 4YXWD 3NZIA 3SZEA 1C5SA 4WH6A 3A7WA 1K1LA 1BMFD 4X2VA 4F49A 4LK4A 1C4V2 1FCFA 1C5VA 1SBWA 2O8MA 3H5CB 2OQUA 3RXOA 1SGRE 2VWNA 3LNYA 3S7HB 2C93B 1T32A 1O2LA 4YOIA 5I46H 2ZC9H 3MO3A 2NU4E 4GVUA 1Q31A 1C2EA 1LVMA 2OD3B 3I29A 1BHXB 4AZ2B 3RXFA 5EW1H 2OPGA 2WPJS 3EA8A 5LH8A 3KZDA 2CV3A 3LONA 2BQWB 2LC7A 1FAXA 2JJ1D 2ZFSA 3TK5A 1KDQB 3DUXH 3SNBA 3AK5A 2HLCA 3O8RA 3MO9A 1V2VT 1S81A 4BXSA 2SFAA 2P3FH 4FUHA 1FXYA 3LH1A 3E3TA 3ZVBA 2UWPA 2FLRH 5HFFA 4Q2NA 4OS5A 4YZUA 2ZEBA 1O2GH 2WZQA 4NMOA 2NU0E 3OEHD 4F55A 4AFSA 5JBAS 3O8CA 1IQEA 1QJ6B 1C5PA 1SI5H 2YNBA 4OS4A 2BY6X 1QBNA 1SG8B 3GCHC 1A7SA 2KAIA 2VIQA 1BBRK 1WV7H 1ANBA 3PMHB 3TH4H 1T8LA 4GAWA 3RLWH 4BAQB 1QIXB 1O3HA 2V35A 1TOMH 4KTUA 4RT0A 1O2XA 5DP9A 1E34B 1O5EH 1S82A 1YLCA 2ODPA 4MPWA 4D7GA 5H3JA 3T25A 3QGNB 2PDZA 5CMXH 1V62A 2M0UA 2Z6BD 2WPMS 4ABBA 4ZUHA 3T2NA 4XE4A 4FETA 3VB7A 2RG3A 2PKTA 2QN5T 3M3SA 2FS9A 1T4UH 1TX6A 4NMQA 1GMHF 1ELEE 1OP2A 4P2AB 2I6SA 2BX3A 1GI1A 4I32A 2FCFA 3PO1C 4AOQA 5A0BA 1EB1H 3TSVA 1DSUA 2ZZUH 2V3OH 5E11A 1MTSA 3GY3A 1CSOE 1U39A 1UEPA 1OX1A 2W5EA 4JL7A 3F0OA 1A4WH 1KMHB 2BD9A 3P92A 5EXMA 3DJ3A 2P16A 1SOTA 1GI6A 4HOPA 3K2UA 3LGWA 5FX6A 1UW7A 1W8BH 3E6PH 4X8TH 3M5LA 3ZZ8A 1EJMA 4YM9A 3MU8A 3KL6A 1C2IA 1KLIH 2JIZD 1WF8A 3DHKH 3MH7A 3SHUA 3VB3A 3M7TA 2M2AA 3V3MA 2ILNA 1UJDA 1AUTC 2R0LA 1JRSA 1Z1JA 1L4ZA 1V2NT 1Y8TA 4ASUD 3TJNA 3BTKE 3M5MA 4CRAA 1N6YA 3HK6B 3LDXH 1HNEE 1E0FD 1BUIA 2VH0A 5I25A 2OK5A 3VXFH 2ZP0H 1P2MA 3CS0A 1WDIA 6GCHF 4JOKA 4H11A 4CR9A 1XVOA 4ZAEA 3GDVA 3KQCA 5DN6D 1S85A 3GYLB 3RC6A 4KKDA 1NC6A 4FVDA 3SV8A 2OBOA 1X8SA 2ZDMA 3TPIZ 1MTNB 2SGPE 3ATMA 4NGAH 1ORFA 3GCOA 1EAXA 1L1GA 5C0TA 4OAJA 4Q7XA 1SSXA 5HXFA 1IQHA 1GHVH 1MKWH 2EGKA 5AVDA 1QJ7B 3L33A 2DM8A 1EJAA 3Q3XA 1DWDH 1AZZA 1WYKA 1VJ9U 3LNXA 1UEWA 4XHVA 1Y3VA 4RN6A 3ID1A 3WWBA 4LOYH 3MNXA 3TITA 3AAVA 4JMYA 5HFEA 3SUEA 1DT2A 3U8TH 3UOUA 4KTSA 3A80A 1RIWB 2PP6A 5FCRA 2M10A 3P8GA 4UDWH 1AU8A 5JB9S 1QRXA 1TP5A 2B8OH 2PUQH 3EE7A 5GXPA 5EQQA 1QTFA 4ZXYH 2J95A 2BLWA 3RXQA 1D6WA 4NIVA 4UU6A 1P8VC 1ZTKA 3ESTA 4H42U 1O3DA 1W13U 1OWEA 1I16A 5EOKA 2ASUB 1SQAA 1LTOA 4QT8C 2GMTB 1QRWA 3GCTF 1ELCA 2RA3A 3RLYH 1MBQA 3P6ZB 3VFEA 2QCYA 1TFXA 2HOBA 4UFEH 5FXLA 1UTNA 5C1XA 5EJLA 3V13A 2F9UA 2W6ID 2ANMH 3SHCH 4Y8ZA 4WF8A 1TX8A 2BQ6B 3AW1A 4ACAA 4RKOB 1QB9A 4H4FA 3RXEA 2Y5HA 1M9UA 3F6UH 2PUXB 2BD7A 1UK2A 1TWXB 2D8WA 1SMFE 3Q76A 1EZQA 2ANYA 1Z86A 2EJYA 1OS8A 1MFLA 4Q6HA 3SOEA 1FIZA 5EXLA 1N6DA 4JJ3A 5G1EA 1A0LA 5L2YH 2VWRA 1C1UH 4A7IB 2I6QA 2XYAA 3BTGE 1L6OA 1LKBA 2ZGHA 4YOGA 1BITA 2CHAC 2D1JA 2EAQA 1GBAA 3SHAH 1V2KT 2ZCLP 4Q2QA 5A8XA 1XUIA 4NMRA 2J92A 1OPHB 2GZ9A 2JH6D 1ZSJA 2MX6A 2FLBH 2HPPH 4DT7B 4AG1A 4BTTB 1OBXA 1V5LA 8KME2 4I86A 1GQ5A 4X1RU 3BTWE 2A5AA 1IQNA 2ZFPH 2H9HA 1XXDA 3M5OA 2XNIA 3T26A 3ZZ5A 5JBTA 1O2TA 1A1RA 3VPKA 2PKAA 1AWHB 3KZEA 3KGPA 2W7UA 4MPXA 3TGIE 4ZHAA 2XWAA 1UM7A 1C5YB 1TA2A 2OLGA 2OC8A 3GY5A 5C1YA 5FPSA 1SVPA 3TVJB 1L2EA 3NXPA 1GBHA 2QA9E 3SJKA 3RXRA 1GI4A 4Y76A 2JETC 3K82A 2CGAA 2J38A 2SGDE 4XBBA 4AN7A 2TPIZ 1AGJA 2ALVA 1WIFA 1S84A 3M3TA 1COWD 3AXAA 1MQ6A 3BSQA 3D65E 1S6HA 1MKXK 2AMPA 1TOCB 3AAUA 2HPQH 4NCYA 1C4Y2 1RXPA 1C1OA 3RDZA 1GQ4A 8GCHF 4YLQH 1E37B 1UCYE 4AYVB 1SGDE 5E0HA 4EDJA 4FUEA 1AKSA 1DANH 1NFUA 1F92A 5EIYA 1KXCA 4G69A 2QF4A 3MH5A 4INKA 3U28C 1W9OA 2AMDA 4K1EA 4E05H 3GSLA 5D13A 3KF2A 1RZXA 2ZHEH 1NU7B 2VGCB 3B76A 1HUTH 3BTHE 4Q80A 1TYNA 3HKIB 3RM0H 1K1MA 1ESAA 1THRH 1ZRKA 2GX4A 5GPIB 5J4QA 2ESTE 1O5CB 2BMGB 1UVSH 1AY6H 2D8IA 3ZV9A 1GHAG 1NRPH 1BCUH 2KBSA 3V7TA 1P1DA 3UQVA 3ZZAA 1Y3XA 1X7AC 6CHAC 1FX0B 4L8NA 1B7XB 4F4OC 2KV8A 1UTLM 2BOKA 1E36B 3KN2A 2VZ5A 7ESTE 1UHPA 1K1OA 2GJGA 2Z3CA 2EHRA 4ABHA 1C1WH 4Z1MD 1BTUA 2ZA5A 3P8FA 3MH4A 2NU1E 4RSPA 3R69A 1MD7A 2PKSB 2ZHFH 4WWYA 5E2OA 3S9BA 1W7GH 4ABFA 1GBTA 1G32B 1Y3YA 1GVKB 1EPTC 1YPHC 3PB1E 1LHDH 3SO3A 3SU4A 4ISOA 1HJ9A 2KAIB 1YP9A 3PYHA 4XRNA 1H8ED 2R4HA 1AFQB 2W3IA 3ZZBA 4Q6SA 1QL7A 1P2JA 2J34A 1C5RA 1P57B 3HPTB 1GCTB 3GGEA 4O06A 2BDHA 3GJ9A 1G37A 3M3VA 1NRRH 3QGLA 2OZFA 2BD4A 1BOQA 1QL8A 3GYMA 2FOMB 1WHAA 2CN0H 3MI4A 3PLKA 1NROH 4Q2PA 2L4SA 5F03A 3O8DA 1V2QT 4FXGH 1K1IA 4GUXA 3F68H 3S9CA 3PLBA 3FZZA 2KG2A 1DDJA 4IC5A 1O5FH 1K9OE 3SUDA 1HJAB 1DY9A 1PYTD 2FTLE 3UOPA 1GL0E 3T29A 3A8DA 1AIXH 1TP3A 1X5NA 1BMMH 3K65B 1WH1A 4HOPB 4Y8XA 1RTLA 1NPMA 2ZHWH 2VWMA 4JZ1A 1QFKH 4X8UH 1GI0A 3H7TA 2BDCA 1FY1A 1BBRE 3RU4E 4DY7B 3RXUA 1BMLA 2KOMA 3Q3YA 2AINA 4JK6A 1YLNA 3E0PB 1L4DA 4O97A 1V5QA 1P9UA 3B9FH 1YLDA 2BVSH 2P3WA 4GHTA 5EXNA 1P12E 1MZAA 2XC0A 4D8NA 5C67A 2G52A 2A45B 4IGDA 4D9RA 2H9TH 1EKBB 2P93A 1OBZA 1O3CA 5HEDA 1Z71A 1GI5A 1C5WB 3OY6U 1Z8RA 2EDPA 1O2KA 2Z9GA 7LPRA 2M0VA 4UEHH 1GJ4H 1RFNA 1OYQA 5DTHA 1C5QA 2JOAA 4Q2OA 1DLEA 3M35A 3N99A 2VNTA 1OWDA 1EZUC 1UEQA 1HDTH 1O2ZA 2Q6DA 4X1QU 1D9IA 3C27B 4CHAB 4ZH8A 8LPRA 3ATKA 4Z33A 3O8BA 4D9QA 3ZVFA 3L4FD 4A1VA 1LDTT 2VINA 3HPMA 2GZ7A 2OBQA 2BXTH 4H6TA 1XZ9A 4ZCNA 2GKVE 2H2ZA 2ZG0H 2EEJA 2V1WA 1SGPE 3GY8A 4THNH 1Q2WA 3RXJA 1SFQB 1J16A 3H09A 5IL9A 1TX7A 2XBYA 1PPBH 1GG6C 2C8XB 3MH6A 1H9IE 1O3PB 1PQ7A 1UTJA 4ZKOU 1ANEA 4YLUA 3EGHC 3BF6H 2PR3A 3MYWA 4ZKSU 3N7DA 1C1SA 1XUFA 4R2ZA 1SLUB 2DLUA 4NG9H 1UCYH 4PROA 6LPRA 2WHXA 1V2WT 2CSSA 2FM2A 2HRVA 2CF9H 2GCHG 4WH8A 2UUFB 3LU9B 2BY7X 4A1TA 3QDOA 1S0QA 1ZMJA 2ZFRH 4BAOB 3VB6A 1DWBH 1XXFA 1O2VA 1OYTH 1GBBA 1O2WA 3VXEH 4K76A 1AUJA 1QLCA 1O3EA 2BB4A 1BB0B 1GJ7B 1GI9B 1TNLA 1ZZZA 3SU0A 5GCHG 1RRKA 3SU3A 1Y3WA 2ZFFH 2EI8A 2ZDNA 5HFCA 1OP8A 1ZPCA 3LOXA 1IAUA 1G2LA 2Z17A 1BRUP 3QUMP 3MU5A 3RXVA 2P59A 4CBNA 4KFVA 4KP0A 1O3OA 3CH8A 4A5TS 2ZPMA 1O5GH 4B74A 1WCZA 3D62A 1UVPA 1IQJA 1GBJA 2G5MB 5EPYA 4NMSA 2ANKH 3Q77A 1MTVA 3SI4H 1Y59T 2GTBA 1C5XB 4X1SU 3UNRA 4GSOA 3NGHA 3WKMA 2FYQA 2P3UB 4Z8JA 2YT8A 1CA0B 3ZVCA 4WMDA 3DSPA 4B73A 5DSFA 4NWKA 4NMTA 3A81A 2TRMA 2ZTYA 1EJNA 1FPCH 4WYUA 5C3NA 3E91A 1FC9A 4INHA 2A5KA 2GCTC 5TCAA 1TGCA 2WPLS 4R8TB 1OKXA 2FP7B 5HGGA 1WQSA 4KFWA 2CK3D 1D5GA 1Z6JH 3EYDA 3WKLA 2KCYA 1QJ1B 5B6LA 1P01A 1Z87A 2BXUH 1TPAE 2ZPSA 1FN8A 2G8TA 2G51A 1N6XA 4O3TA 5DP8A 1O2SA 1Z8IB 2OQ5A 1CU1A 1DPOA 1O2IA 1EOLA 2PKAB 2ZTXA 3SJ9A 4CRGA 1H4WA 1P2NA 3GISB 1TALA 1LHGH 1GPZA 1O5BB 1UTKA 4B2BA 5FL7D 4X6MA 3ELAH 2ZO3H 1MUEB 2YMSB 3A82A 4K60A 1P11E 3EGKH 4E35A 4CH8B 1B0FA 1X45A 1LHFH 3U98H 4GLYA 1W0ZU 1AB9B 3NCLA 4DIHH 3SJIA 5HIZA 3G01A 1A0HB 3TK9A 4IW4E 1SC8U 4CRDA 1XUKA 1H1BA 5FBEA 3RU4T 1F5RA 1DE7H 3PV5A 1ZHPA 1AKSB 1YPKH 3AVZA 4ESTE 2WL7A 3V0XA 1ZRBA 3E1XB 3QGJA 4ABIA 3UAIC 3KQDA 1T4VH 2DAZA 4JCNA 2C90B 4FLNA 5HEBA 1T7CA 1TNGA 1BMNH 1SGFG 2H9EH 2IPHA 4K69A 1VB7A 4P02A 3SV6A 4U2WA 4A1XA 1CVWH 5B6OA 3SGAE 4B1TA 1TBZH 1TMUH 1VAEA 3OTJE 1L1NA 1K2I1 2EI7A 2KQFA 1K21H 2BX4A 4NSYA 5DPAA 3TNSA 2QF0A 4NA9H 1HIAA 1AD8H 1BRBE 3SGQE 5G1DA 3ATIA 1O39A 1MH0A 4HZHA 1YPJH 1GBMA 3GDUA 2BD5A 2WUCA 5HFBA 2FMJA 1MTUA 3E16B 3LIWA 2C8WB 1PDRA 4X1PU 3HPKA 3QE1A 5DP7A 4Q4LA 1PPGE 2J5UA 3RXKA 1BE9A 5DP5A 1PPFE 5F6MA 3VGCB 3I4WA 1O2UA 1T8NA 1F0UA 1ZLRA 5TCCA 5FPTA 1MCVA 4GCHG 2LNCA 3A87A 1UITA 1GHBG 4Y71A 3RXBA 4AG2A 3NWUA 4Q7YA 5DGJA 1DS2E 3NKKA 1ZJDA 2FI3E 2J94A 1N7EA 1KXEA 1AMHA 3F9GA 4OS1A 1NRQH 1N7FA 1C1VH 1DFPA 1GBIA 4I7YH 1IHSH 1LVBA 1ESBA 1TGNA 3FP6E 1VCPA 1QRZA 2QBWA 4ZROA 2VU8E 2A4QA 3HATH 4I31A 4FUJA 1QZ8A 3TNTA 4I8JA 1C5TA 1ZJKA 2DLSA 2AHME 3TU7H 2K20A 2KYLA 1TNIA 1ELBA 1MFGA 2ZGCA 1D3TB 2FOAA 2Y7XA 1A5GH 1NBMD 1Q3XA 3FFGA 2I6VA 1C2LA 3I1EA 2KPLA 2K8IA 3FO8D 4UD9H 4YT7H 1GDUA 2P3TB 1YCPH 5CHAC 3MNSA 3FVFB 4BNRA 1SLWB 3SW2B 1QCPA 4VGCB 1Y5AT 2THFB 1XKAC 4HGCA 3M7QA 3LGTA 1LHEH 2XTTB 4KTCA 4XOJA 2J2UA 1EASA 5L6NH 1R6JA 1T8OA 2RCZA 1QA7A 4I8GA 2V3MA 2ZQ1A 4GVCA 3PDVA 3A8BA 3F2GA 3DFLA 4IS5A 2EY4C 2ZI2H 2Y5FA 2Z3EA 4DGJA 2FODA 1DWCH 4JOEA 3UUZA 5AF9H 1C2MA 2HVYB 4YOJA 3BTEE 1P1EA 1XX9A 3RXAA 2KJDA 3MOCA 3QO6A 1TRNA 3P70B 4AYYB 1DLKB 2SNVA 2Z9JA 2FS8A 1TAWA 2R9PA 3KQ5A 1BFEA 1JRTA 1BIOA 2K0QA 3ID2A 1WAYB 1E38B 3U8OH 1ZYOA 2AERH 2ZGXH 3KQBA 2FOBA 4B76A 1YPHE 4Y7AA 1OXGA 4ABEA 4ZHMU 2WPHS 1O33A 2WSSD 1ELFA 1CT2E 3UQOA 1FONA 2CJIA 3KQEA 4BAMB 1P06A 1H8DH 1WFGA 1VKYA 1S6LA 4MNXA 2G81E 3HGNA 2FZZA 3ZZ7A 4LZ4B 4WMEA 2YNAA 1NT1A 3TJUA 3GCNA 3T62A 2D26C 1UO6A 3S69A 3M61U 1NS3A 5E2PA 1GGDC 4AB9A 3IWMA 2M0ZA 1TB6H 3RXLA 2O8TA 1O30A 3ITIA 1HGTH 1KEFA 1KTSB 3F2FA 5CE1A 1VCQA 1FC7A 2TIOA 5C1UA 2FEQH 3VB4A 4K8BA 3ODFA 3NFLA 1GL1A 5E0GA 4JZFH 3SFJA 1O2MA 2XCFA 2GP9B 1PYTC 4UE7H 3PMJA 1UVOA 3SQHE 5GIBA 2VIOA 1GHXH 2NU2E 1YKTA 3BTQE 2C8YB 1OHHD 5HM2A 3D23A 3LGIA 2QKVA 2KJKA 3QJMA 1FY4A 3RMMH 1NRSH 3BPUA 1P02A 2SGAA 2ZTZA 1YPEH 5G4BA 1BTHH 2KFWA 1EAUA 3T5FH 3F9FA 3EA9A 4OEPA 3DT0H 2KOHA 2R3UA 4N6XA 3R3GB 3MTYA 3U1JB 1BTWA 3Q3KA 1YPGH 2WPDD 3RMOH 2H1UA 1FZZA 3ZVAA 2B0FA 4Q63A 3FY5A 1VITF 1W0YH 2IOTA 1VGCC 4WJG2 3UIRA 4OEOA 1WG6A 3KYFA 2DB5A 1V2MT 3TH2H 3MU0A 4X2XA 2HLDD 3E8LA 1GBCA 3F3BA 3SI3H 2YT7A 1G3BA 1OZIA 5K0HA 4FOUC 1MKXH 1MU8B 1U6QA 2BVRH 2FIRH 2Y5GA 1KY9A 1NM6A 2J97A 3DCLA 1FNIA 1KSNA 1YF4A 5C2ZA 3GY2A 2EDVA 1N8OC 1WI2A 2A4GA 2Z7FE 1A2CH 4E7RG 2ODQA 5FX5A 2EXGA 3R0FA 2CS5A 2D2DA 1WFVA 3KIDU 2ANWA 3TSWA 1MABB 1CHOF 1O5DH 4OM9A 1UTQA 1O3AA 2PKUA 1G3CA 1Y3UA 2QKTA 1QAUA 4JYTA 4XBDA 4DJZB 4BANB 1H8IH 1OOKB 2O8UA 2ZPQA 2R2WU 1WJLA 4OS6A 1UHBA 3F2HA 4H6SB 1ELAA 1TMBH 1F5KU 1EPTA 1W11U 1FUJA 1HPGA 4TY6A 3F0PA 1W0JD 4SGBE 3GCHB 3STJA 1CBWC 4IMQA 1LCYA 2LP6A 1FV9A 2F9VA 4X8SH 5ABWA 4I33A 1XUGA 5JXBA 1A3BH 3UFAA 4B6FA 1JBUH 5LPRA 1UVUH 2OCSA 2JDID 3LT3A 3PWCA 1GMCG 2RFKC 4BOHA 1W3CA 1FC6A 1Z8GA 5EGMA 5JDUB 1E79D 1LO6A 4NXPA 2IWPA 1O36A 1BRAA 3OE7D 5L2ZH 3U69H 3UTUH 5BRRE 5HM9A 1C5MD 3SZNA 3O5NA 1SGCA 1H9LB 3LGYA 3SNAA 3ZV8A 1ZGVA 3PM3A 4FUDA 3WW7A 3RXIA 1O2NA 2VSPA 1PPEE 3PO1B 4IN2A 1P0SH 4LZ1H 1HJ8A 1L1JA 2IJOB 2TBSA 1YPMH 4K5ZA 3UREA 1GBDA 1WU1A 4Y11E 2BY8X 2RA0A 2O2TA 1FJSA 2EEKA 1HIAB 3RXDA 1Y5BT 3K50A 2Z3DA 1F0RA 1SGTA 1TIOA 1FIWA 2RDEA 1HAVA 5HJ1A 1N99A 1MC7A 1SLVB 4IMZA 1TQ3A 1FY3A 1UTPA 1A5IA 1GHZA 1ANCA 4XSKU 3TLOA 4ACBA 2FI5E 1BRCE 5ESBA 2L97A 3FAOA 3QDZB 1QGFA 5EODA 1WUNH 1RJXB 4JORA 2W7RA 3SBKA 2IWQA 4K1SA 4M9FA 4DOQA 2BVXH 2BYGA 3RL7A 1HAHH 2XBVA 3LPRA 1ZUBA 3BG4C 1TLDA 1P10A 3VG8A 3TGJE 3QWCH 1J9CH 1EOJA 2B7DH 1B8QA 1NN6A 2AIQA 3OYPA 4WMFA 3EGGC 4K6YA 2STAE 2WV9A 3DD2H 5A8YA 2ZDLA 1FQ3A 1N6EA 1P2QA 4GVDA 2WYGA 3BEUA 2VVUA 4M7GA 1TE0A 1C1RA 3LC5A 1WF7A 3CS7A 4BAHB 1UEZA 3A84A 1MMJN 1TRYA 1N7TA 5EZ0A 1D3QB 2JIKA 3ID4A 3KHVA 2P8OC 3M36A 3LGVA 2FXRA 4MDSA 4NSVA 3A8AA 4X6PA 1O2RA 5FHTA 1BQYA 3NK8A 1A3EH 1IQMA 2XW9A 1S83A 4R0IA 4AFQA 4TPYA 5JB8S 4DT4A 2SNWA 3NUMA 4NXQA 1ARBA 1P09A 2JILA 2W26A 4NZQA 1IQKA 1C2GA 3L6PA 4FVBA 3LJJA 2WV4A 1QL9A 2GGVB 2ZU5A 3TJVA 5FBIA 3W94A 1AWFH 1HLTH 1O2QA 3SUZA 3ZVDA 1PFXC 1EP6A 1YGCH 1EZXC 1BZXE 2Q3GA 3QLPH 5HEYA 1X5QA 2HE4A 3PLPA 1GVLA 1JIMA 3UPEA 4J1YA 2KCAA 2W4FA 2QYIA 4OS2A 3T28A 1J8AA 4IBLH 1KLJH 3SGBE 3PRBA 3MFJA 4HI3A 2I4SA 2ZCHP 2WPKS 3SV9A 4JJ0A 3EE0B 1W9QA 3H7OA 2KRGA 1YC0A 3C1KA 2VIVA 1NFXA 1V2ST 4J2YB 3B23B 1SB1H 3A7XA 1K22H 3CENA 2F9OA 1O3LA 2BQ7B 1FY5A 2IJD1 4I8KA 2DC2A 1TNHA 4NNMA 3PWBA 3A85A 1D6RA 1A61H 3BTTE 4ZKNU 5EYZA 2BY5X 4WVPE 5EG4A 1P2KA 1V2PT 2B5TB 3OY5U 3ODDA 2BD2A 1C1PA 2Y80A 4ISIH 2KOJA 4X2YA 5DP6A 2I1NA 1ZTJA 3BEIB 5SGAE 1GJ9B 2BHGA 1TPPA 2F43B 3RXSA 3ZZDA 1O0DH 2CHAB 2GEFA 2ZPRA 2EEIA 2Z9KA 3K6ZA 3ZYEA 1MAYA 3UR9A 2ENOA 1M5ZA 1NU9A 3SNEA 1QNJA 5E22A 3UR6A 1Z8JB 3GY6A 2GDEH 2I04A 2RDLA 2OSGA 1YM0A 1O35A 3R68A 1E35B 2V6NA 4MNWA 4ABJA 2DE9A 6GCHG 3FKSD 3U9AH 1T8MA 1FI8A 3SUGA 5KEDA 5ILBA 3CP7A 1O2PA 1UM1A 1K28D 5F53A 2OTVA 3MWIU 2JETB 2JH5D 4KGAA 1K1JA 1THSH 3ZZCA 4FUCA 4NFFA 2G4TA 3T27A 4Y0YE 4BTIB 4E34A 3PV4A 2BDYA 2HGAA 1HAOH 2A2QH 1U3BA 1EUFA 1ZPBA 3PV2A 4GHQA 3W1EA 1W9EA 2J98A 3QZRA 2VIDA 3SYJA 1HAYB 3UWJH 4YTAA 5GLJA 1O31A 1WQVH 1AVWA 2Z9IA 1B0EA 2PGQB 2E7KA 2H3MA 1T31A 2FOGA 2OCVB 2UUJB 1KYNA 4JOFA 3PRDA 2O9QA 3RXPA 2ZFQH 5EJ1A 1K32A 3HK3B 5E0JA 1P3CA 4RT1A 1SGYE 2FDAA 5AHGH 3BIVH 2VH6A 2W6JD 1UMAH 4RKJB 1BTZA 5T6DA 4K3JA 2I0LA 3EA7A 1KXFA 4Q3HA 2G55A 3DSGA 1PJPA 3SHWA 1TMTH 4K78A 3GCTG 2V0BA 4MNYA 4AMHA 2A1DB 2VIWA 2OP9A 1ZMLA 4FGMA 1MU6B 1AHTH 1H9HE 1V2JT 6CHAB 4UU5A 1F0TA 1GBFA 1V3XA 3E90B 4LXBH 2AFQB 4O03A 1EATA 1DWEH 5C5NA 1AE8H 1IQLA 1FMGA 4PQWA 1MTNC 2IWNA 1O3NA 2OGPA 3TMHA 2QC2A 1CE5A 4X2WA 2ZU1A 5A2PA 1UHBB 2AMQA 1Q7XA 8ESTE 2FPZA 4P0CA 2IPQX 2BTCE 1EPTB 2EI6A 5C0UA 2CSJA 5ESTE 5HF4A 3QX5H 3URDA 2QF3A 6ESTA 1IQGA 1ZPZA 2O8WA 2J4IA 3VEQB 1DVAH 1MD8A 2PLXA 1EB2A 2CMYA 1QHRB 1W7XH 2OC0A 3QZQA 1QR3E 1D3DB 5T3HA 3F9EA 1HYLA 1PPHE 5CHBA 5JBCS 3DIWA 3OU0A 2KR7A 2TGAA 4XD7D 1MTWA 1NESE 2YMSD 1RIWC 1XUJA 4JZIA 1V2UT 3DSOA 1EFRD 2ZHQH 1UF1A 1ELTA 2G2LA 5HFDA 2PNTA 2A7HA 2AIPA 4X6OA 2EQNA 1YYY1 4B2AA 2QXGA 1BBRH 3I78A 4ABGA 2VBCA 1GHAF 2GMTC 3ZZ9A 4YYXA 3GY7A 1DUEA 4Y8YA 3ATLA 3JZ2B 1HAXB 2OUAA 3NFKA 2TGTA 2KL1A 2Y81A 2BZ6H 2WV5A 4F8KA 1NTPA 1SL3A 1TPSA 1W14U 2A0QB 1JXPA 2OC1A 4FUGA 5FPYA 5HKKD 2HNTC 4JZDH 5A0AE 3HVQC 4JOJA 5LGOA 4YO9A 1UK3A 4NWLA 4IN1A 1VCWA 1VJ6A 2BOHB 2JINA 4IC6A 2RCEA 2REYA 2HVXA 1HAVB 2Z94A 8GCHG 1BHXF 1HAPH 1ETTH 4HFPB 3P17H 2AYWA 3SOSA 3RMLH 3SU2A 1WTGH 1OP0A 5DP4A 2XC4A 1Z7KA 4Y10E 5LPEA 3SNCA 1U37A 2FYRA 5FCKA 4MPUA 4NIXA 4A6LA 1BMAA 1J15A 3VQFA 4Y6DA 1GDQA 4K1TA 2A7CA 3PS4A 3OX7U 3PTNA 3RC5A 4E3BA 2ZWLH 4KELA 3A7TA 2BDAA 1PQ8A 4ZMAH 4ZXXH 1EAWA 2GV6A 2VRFA 1BTPA 4NXRA 1C2JA 2VJ1A 5T1VA 3K1RA 1P04A 3TSZA 2KAWA 4BAKB 2A4OA 1V2OT 1QA0A 4TYDA 1A46H 2D92A 1C2HA 3OFND 2PHBA 2M5TA 3RXGA 1WI4A 2L74A 2OINA 2CF8H 1OWJA 1IU0A 3OAAD 5F8ZA 4INLA 1L0ZA 4DW2U 1EQ9A 4UONA 2JREA 4F48B 4O3UA 1ACBE 1EZSC 3P8OA 1GG6B 2FWWA 3MMGA 4Q2KA 1QAVA 4JOHA 1N6FA 4E06H 2KCOA 1NRNH 2L4TA 2OS6A 5L30H 3WWFA 2EC9H 2QKUA 1K1PA 4B2CA 1DXPA 2H5DA 4K72A 2IWOA 1A0JA 3BN9A 1XMNB 1O3FA 2GVFA 4CRFA 5J4SA 3E0NB 1LPGB 2FOFA 1GMDG 2VWOA 1C1QA 2VPHA 4CRCA 2STBE 3JXTA 1JMOH 2VGCC 4U32A 3KNXA 2PA1A 1TGTA 2AS9A 2BDBA 1OWIA 4FU9A 1PPCE 2BM2A 2JXOA 2FX6A 1LQEA 1V2TT 4NZLA 4WYTA 2GD4B 1TABE 3GS9A 2FOHA 1HRTH 3ATWA 3TK6A 1V2LT 3KCGH 2H6MA 3SN8A 3KHFA 4NNLA 1S5SA 3TIUA 2P94A 3LKWA 1DOJA 1GHWH 1O3JA 1P2IA 3MU4A 2A31A 5H4IB 4ABAA 5B42A 2ZQ2A 3GOVB 2QXIA 1W0KD 2ZFTA 1O37A 1Y7NA 5GWZA 1ZSLA 2F9BH 4XBCA 3QIKA 2ZGBH 3QN7A 4AB8A 1RD3B 5A2MH 1GI8B 1ZR0A 1TPOA 2PKSC 2UZCA 1P9SA 2ZECA 2FNEA 3EDXB 3I77A 1P3EA 4U30A 1SOZA 1K0HA 4NIYA 1FN6A 4AFUA 2GCTB 2CXVA 2DE8A 1YCPK 1XM1A 5FB8C 1V6DA 2GZVA 2GCHF 3BV9B 1SQOA 3UNQA 4REYA 4NFEA 1AFQC 3GABA 1JOUB 2ALPA 3ZIAD 3R0HA 7GCHG 4D76A 1RTKA 3A7ZA 1GCTC 3STIA 2ODYB 1EAIA 4TPIZ 4ASHA 5C94A 2BD3A 2BYAX 2H3LA 5GCHF 3RM2H 2JKHA 3OSYA 2AWWA 5EQSA 1C5OH 3RXCA 2JH0D 3RC4A 2XOKD 3S7KB 1C2FA 2F9PA 1W10U 1KXBA 1C9PA 3URCA 4BTUB 1ZOMA 2PZDA 3I18A 2ZCKP 4NMVA 1O3BA 4OS7A 3S9AA 2ZDAH 1HJAC 4Y0ZE 3CNRA 1ELDE 3SV7A 3KDGA 2FOEA 3SUFA 2J98B 5TJXA 1UVTH 2FOCA 1J17T 4WXIA 4SGAE 1OWHA 5GNDA 1TGBA 2HNTF 3F9HA 3RUOA 1UTMA 3SU1A 1EP5A 1ABIH 1TBRH 2VIPA 2EGOA 2A4RA 1A5HA 2DJTA 4JYUH 4Y79A 1X9ZA 4P00A 2QE7D 1RGRA 2K1ZA 1O3KA 2F0AA 4HG6A 1LVOA 4MLFB 1GDNA 1SR5C 2AGEX 2R3YA 2V3HH 2ZU2A 1MKWK 3Q00A 4DIIH 1BTYA 3TJOA 1QBOA 3NPSA 2TGPZ 2ZIQH 2V7QD 1YY3A 4JK5A 4NA7A 2LOBA 2UWLA 1T2MA 2GT8A 2EGNA 1HBTH 1CHGA 1RS0A 4CHAC 1F7ZA 5K7RA 1AVGH 1YCPM 1CT4E 2XNDD 4CRBA 1NBME 4FUIA 3RP2A 5EW2H 9LPRA 4TY7A 4TWWA 3RU4D 1ETRH 1SGIB 2FO9A 3A86A 1TBQH 3RMNH 2PV9B 1NO9H 5F8TA 3PMAB 4JYVH 2G00A 1DSTA 5C20A 3AASA 1IQIA 1KTTB 1TGSZ 1VR1H 2OXSA 3KYGA 2AWXA 2Q6GA 4AGKA 4CR5A 1BJVA 4YESB 1GBEA 4MG3A 4MPAA 1ZOKA 1WTHD 3DJ1A 1SQRA 1GJ5H 1YPLH 1SGQE 1ZHMA 5DO4H 2AH4X 2BDIA 1Q3PA 4Y7BA 2X7ZA 2BLQA 5DKMA 1WSSH 2AGGX 2NWNA 4DG4A 1GCDA 1LHCH 2PGBB 2GT7A 3IITA 5DP3A 4DVAU 4AX9H 1TA6A 2FE5A 2UUYA 1Y5UT 1G9IE 1E1RD 4UFGH 3FOAA 5EJZA 2UWOA 2TGDA 1PQ5A 2ZNKH 3F1SB 2QXJA 3JZ1B 3UWIA 1QY6A 2WINI 4UFDH 1SHYA 2PSXA 5HETA 1TQ0B 4YT6H 1C2DA 2FTMA 5DG6A 2HWLB 5CHAB 3GICB 5BPEA 1OBYA 2AWUA 1SFIA 2H2BA 4NMPA 5EU8A 1IHTH 2ULLA 2R0KA 1GJCB 3K6YA 3UNSA 1ZTLA 2C8ZB 2A7JA 1O5AB 1AE5A 1O38A 2EV8A 3ENSB 3K9XB 1WHDA 5AFYH 2PTCE 1IHJA 1Z6EA 1UTOA 2M3MA 1NY22 1GI3A 5T6GA 3SJOA 1HAGE 3UB0A 3A89A 1NF3C 2V90A 1LMWB
chains in the Genus database with same CATH topology
1K1NA 1IU2A 2XBXA 3M7UA 4YDPA 1GM1A 2RRMA 4ISLA 4GCHF 5E21A 1GHBF 1C5ZB 5GJ4B 1QB6A 3S0NA 1FLEE 4UFFH 1BA8B 2XWBI 1QQ4A 3PMBB 2FESH 5JYIA 2LPRA 2Y7ZA 4BXWA 3ID3A 1TRMA 1CA0C 2O8LA 1V1TA 5E6PB 4FUFA 3LC3A 3N7OA 1DM4B 5GDSH 3KEEA 2QT5A 3MHWU 2YTWA 1XUHA 1ZHRA 3DJAA 1HV7A 1ABJH 1P05A 2AGIX 2XXLA 1DICA 1KDQA 9ESTA 2QV1A 1BJUA 2FX4A 2XBWA 2B9LA 1FY8E 1C4U2 2Q1JA 4AGJA 2GDDA 1MCTA 2LC6A 1YBOA 2Y6TA 1G2MA 2UUKB 3SU6A 2IN2A 2XRCA 1HB0B 3HGPA 2QG1A 3BIUH 3U8RH 2H2CA 1DXWA 1PQAA 4MTBA 3GDSA 1BDAA 1O3GA 2SGFE 1ESTA 2ZU4A 2C4FH 2PTNA 4K8YA 5LPFA 3VB5A 5DK1A 3NCVA 1QURH 4XFQA 2G5VA 3BG8A 3P8NA 2Y82A 5C5OA 1GGDB 3ZZ4A 2MHOA 1AN1E 1JIRA 1AI8H 2OC7A 4MVNA 3LJOA 3WY8A 2AEIH 4JOGA 1QAVB 1GMDF 2DUCA 1UJ1A 2FN5A 1V2RT 2QXHA 1MQ5A 1KLTA 1LPZB 1ANDA 1AB9C 1O2JA 2F91A 1GHYH 2ZKSA 3P95A 1QQUA 1WBGB 1C9TA 1OWKA 4TWYA 2QY0B 3BTME 3B8JA 2DMZA 1MBMA 1YBWA 2HNTE 2Q9VA 3ZVEA 5A09A 1DY8A 3BEFB 5A0CA 1SPJA 4FU7A 4K2YA 2PFEA 2M0TA 1NFYA 1I92A 4I8LA 3ZVGA 1KXAA 3A7YA 1DUAA 5PTPA 1GVZA 1NZQH 1O34A 4Q7ZA 4MNVA 1GWAA 1N1LA 3SORA 1AVXA 1VJAU 2F3CE 1F2SE 2F9NA 3MU1A 1P2OA 3SQEE 2SGQE 4MPVA 3PROA 1SGNE 3KDKA 1G9OA 2D90A 1GJBB 3PDZA 1C2KA 2DKRA 3FP8E 3QTVH 1ID5H 3CBXA 2ZDVH 3CC0A 2P95A 1SHHB 2J9NA 2LUIA 1GMHG 3ZZ6A 1SGEE 1IQFA 1G3DA 1RTFB 5F8XA 2VSVA 1VGCB 1HXEH 2FI4E 2WYJA 2A5IA 1UJVA 1O2OA 2EA3A 2K1QA 1ETSH 4CBOA 2EEHA 4ZKRU 1D4PB 3A8CA 4HTCH 5E8EH 2PW8H 1S0RA 3EQ0H 3VQGA 3QTOH 5F3XA 2KJPA 3VGCC 1V6BA 1FAKH 3D49H 2QGRA 1RY4A 1PPZA 3RXHA 7GCHF 1GI2A 1O3IA 1N8OB 1QB1A 2ZHDA 1LVYA 3RL8A 1TQ7B 3TH3H 4B75A 5JPMH 1GI7B 1GJ6A 3W95A 5EQRA 1NTEA 1W12U 3SV2H 3M37A 1O2YA 1VZQH 4OGXA 2XCNA 3EAJA 2YUBA 2KA9A 3LGUA 2PWXA 4NA8A 1WOFA 2OQSA 4AFZA 1F0SA 4B71A 2G5NA 2NU3E 3MNBA 4MQAA 2OMJA 4ABDA 1GJ8B 2BD8A 2W3KA 1DITH 1O3MA 1OSSA 2GZ8A 2VWLA 1HAZB 4DURA 1LKAA 2BLOA 4WY3A 1GBKA 1CBWB 4JZEH 2VVVA 4AORA 5HMAA 3ZZ3A 4VGCC 3FZDA 2WUBA 3LH3A 1B5GH 3UY9A 1GJDB 3QK1A 3CBYA 2I0IA 4A92A 2EEGA 3FP7E 1J14A 1INCA 1TNJA 3A7VA 3CBZA 4OGYA 4E7NA 1U38A 1LQDB 5DJ7A 1HAIH 2EDZA 1UK4A 3SU5A 1F5LA 4FUBA 2W7SA 1BTXA 2BZAA 2F83A 1XKBC 2Q6FA 2A2XH