3CS0A

Crystal structure of degp24
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
438
structure length
392
Chain Sequence
b'QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title Structural basis for the regulated protease and chaperone function of DegP
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 78
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3cs0A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3cs0A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cs0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cs0A01
2H5DA 3EAJA 4Y0YE 3SQEE 3CYYA 3SNBA 4U01A 1WHAA 2AWWA 1YCPM 3ZVBA 4E34A 2G5VA 3RMMH 1UCYK 1UMAH 1RIWB 2GMTB 1Q7XA 1B0EA 2BQ6B 2I04A 2F83A 2FTLE 1UVOA 2BDYA 1BTXA 3SV9A 3A88A 2ZGHA 2EA3A 3CS0A 1TE0A 1WU1A 2NU4E 1MD8A 1SGQE 1WTGH 1OYTH 5C5NA 4ABAA 2ZDNA 2AMDA 5JYIA 4KTCA 2O8UA 1GHBF 1YGCH 1C5XB 3AW0A 3ITIA 3DUXH 2H2CA 1G9OA 4X8VH 5E11A 1ZOMA 3GY5A 4HOPA 3M5LA 3UWIA 1MQ5A 4BXWA 2O2TA 1BHXF 1AE5A 4BAKB 4CHAC 2EI7A 2PA1A 1P02A 2A7JA 4Q80A 4XBDA 4Y79A 1FN8A 4NMVA 3RXVA 2VWLA 5EU8A 2VWNA 1H9IE 1W2KH 3PV2A 3MFJA 3MNSA 5FBEA 2BTCE 4Q6HA 4A6LA 1VITF 1WI4A 2BLQA 1C1MA 1DT2A 1C4Y2 1TNIA 1KXCA 2SGEE 3FAOA 3PDVA 1GJDB 1FY4A 3SOSA 1UTKA 2FLBH 1VITG 3BTWE 3PROA 3RDZA 1UITA 1W0YH 4X1SU 1WUNH 3QGLA 5LPRA 4IW4E 4X1NU 1GG6C 2P94A 4D8NA 2FIRH 1ZOKA 5BRRE 1FPHH 2DB5A 1ANBA 2HVXA 1EX3A 3M7UA 2KA9A 1BBRK 2VB0A 1FY5A 1RTFB 1YPLH 3A89A 2FM2A 5C1YA 2ZFPH 2BDAA 4X6OA 4Y8XA 5JB8S 1A1RA 1LPKB 3S9BA 1CE5A 5EXLA 2KJPA 5JDUB 1GBIA 2RG3A 1NC6A 2M3MA 4Q2NA 5GXPA 2QG1A 4GVDA 2AINA 7KMEH 1OBYA 4I32A 1FY3A 4ZROA 1Q2WA 1YPHC 3BF6H 2B0FA 5F8TA 5DG6A 2VINA 1RGQA 1THSH 2WUBA 1OXGA 1SPJA 3KNXA 1C5ZB 5K7RA 2QCYA 2QV1A 4RSPA 6ESTA 5HFDA 3M61U 4UFDH 4YOJA 3R69A 3UWJH 3R68A 1TX8A 1P2KA 5G1DA 1GBMA 1X5QA 1S85A 5HM2A 3ZZDA 2FMJA 1C1UH 1GBCA 4X8TH 1YLDA 1INCA 2BZAA 3P8NA 3VXEH 3TH4H 1GBBA 2FOFA 2JOAA 4OGYA 2BD7A 3VEQB 4WYUA 1LVMA 1BTHH 1BJVA 4AMHA 3HPKA 4CRBA 3QWCH 4O03A 1V2VT 1Z8JB 2FLRH 1D5GA 1AZ8A 3VQGA 1PYTC 4X8UH 3SUDA 1I16A 1FV9A 4ISLA 2EDPA 2YT8A 1VGCB 2XXLA 2FO9A 1QJ6B 4HFPB 1UVPA 3KEEA 5FPYA 3VB3A 2BD2A 1OP0A 2GCTB 1O2IA 1F0SA 1GI9B 1N6DA 1A3BH 3ATKA 1UJ1A 2EGKA 5B6OA 2AWXA 4KFVA 2BLWA 2UUJB 2BX3A 1FCFA 5JBBS 1NS3A 2G4UA 5C1UA 1C5PA 2CSSA 2OC7A 3TK9A 3GISB 4BTIB 1N6XA 1TOMH 1W7XH 1C2GA 1RJXB 1TONA 1YPHE 4X8SH 1ACBE 3UUZA 1Z8GA 2R9PA 5K0HA 1BTZA 1EATA 1QA0A 1P2OA 3PMBB 1P12E 2ZU1A 4PROA 2PNTA 1SGFA 1F0UA 1IQJA 1V2TT 3FP7E 4Z6AH 1C5NH 2DKRA 1GI2A 1ZJDA 1O2WA 1C2JA 1V6DA 3TNTA 1LKBA 1P2IA 3QGJA 1B7XB 1SHYA 3TSWA 1WI2A 2SNVA 2YUBA 4IN1A 3RXIA 1O35A 1KDQB 1HBTH 1HAIH 3MHWU 5GNDA 1O3PB 3IG6B 3DJ3A 1LQDB 3NPSA 2PTNA 4X1PU 5E2PA 3Q00A 1RFNA 2F0AA 2JETB 4XBCA 2SGFE 4GUXA 3SV8A 3URCA 1XVMA 1FMGA 2TIOA 4EDJA 2I0IA 1LHGH 2THFB 3RU4E 5CE1A 2V35A 2WPMS 4D76A 3UNQA 3SNCA 1HAZB 3MNCA 4JK5A 3SNDA 2KG2A 4NZLA 2PUQH 1V62A 2Z7FE 1O3DA 4JK6A 3SJ8A 3ZV8A 2FS8A 4A7IB 1O2UA 1G36A 1KEFA 5HFEA 1F0RA 1C5QA 1P3EA 2AEIH 2PUXB 1FNIA 1PPGE 2I6QA 2EXGA 1L2EA 2FOAA 1Z71A 2ODPA 2OTVA 3MMGA 2VPHA 4O06A 4K60A 1TNLA 3RXLA 1D3DB 1ZRBA 3VB6A 5TCAA 4D9RA 3BG4B 4BNRA 4Q7XA 2QIQA 2TGAA 3V12A 3Q76A 2EJYA 5DP8A 4ZKOU 2Z9JA 3SJIA 2D92A 3GDUA 4ISNA 4LOYH 1Z8IB 1AN1E 3GICB 2OQ5A 2W7UA 3A8CA 3HGPA 3M3VA 4IMQA 2FYRA 2KOHA 1GBLA 2BQWB 2ZZUH 5E2OA 3MI4A 3UNSA 3R0FA 1KLIH 1SLWB 3TGIE 1TQ3A 2B7DH 1MTVA 5FCKA 1OPHB 3ZZ3A 1C1WH 1Y59T 2GX4A 1Z1JA 1LMWB 2VIWA 1K1JA 3KIDU 1UEWA 1O31A 1OOKB 4H6SB 2EV8A 1H9LB 3ID3A 1A4WH 1NT1A 4K3JA 2ZHFH 1BRAA 1HAGE 4GCHF 1UHPA 1AUTC 2XRCA 1GJ6A 1QB9A 2CHAC 3M7TA 1W9QA 1KDQA 5A2MH 1NO9H 2I6SA 5E22A 1EAWA 3KN2A 1X45A 1DLEA 4GCHG 1ZJKA 1BHXB 1GGDC 3NXPA 1UTPA 1AWFH 1HJ8A 2DC2A 4JMYA 1EAUA 1UVTH 1TNGA 2ZDLA 2ZHEH 2OQUA 4JZ1A 4IGDA 1A3EH 3I78A 1C1TA 1A5HA 3CBXA 5HJ1A 2ZWLH 1FY1A 4K8BA 3RXMA 2BD8A 1C5OH 2MX6A 3S9AA 1O5CB 1C5YB 1OYQA 3TGKE 4A1TA 3LNYA 3MO6A 2W4FA 1TA6A 1QQ4A 4PQWA 2A4QA 1W0ZU 2VIVA 1GHWH 1XVOA 3OY6U 2F9UA 2C93B 1V2OT 4GSOA 2Q6GA 2ALPA 1SOZA 3HPMA 5HETA 2M0TA 4H6TA 2A4OA 2Z6BD 1IHSH 4AZ2B 1MCVA 2EGOA 1O2HA 5GCHF 2ZQ2A 1FUJA 5EZ0A 4Y11E 1AKSB 3A7TA 5FX6A 2EEJA 1XUJA 4NCYA 4ZH8A 3RXEA 3D23A 3GCHB 5GCHG 2FN5A 1MTNB 4BAHB 4D7GA 1GVKB 1EZXC 3NCLA 2G51A 1V2NT 1O30A 2VU8E 2V1WA 1Y7NA 3M3TA 2KAWA 6LPRA 2WPHS 3VB7A 1NU7B 1O2NA 1YPJH 4YYXA 5LH8A 2CV3A 1C2MA 1O2SA 1O2KA 4JL7A 1LDTT 2QY0B 1HLTH 1N7EA 1RXPA 1SC8U 1ELDE 2B8OH 2ZHDA 3A7WA 2ZG0H 3E91A 2IWQA 2D90A 4TY7A 2VWRA 3TU7H 1LHFH 1PQ8A 1S6FA 4XFQA 1ZUBA 1TBZH 4CRDA 3P8FA 4FUBA 3RXAA 5I25A 1LHEH 1X8SA 2WYGA 1RRKA 3ID2A 1A0LA 3RM2H 2BX4A 5L6NH 5HEYA 2ZTZA 2WV5A 3ENSB 2OGPA 3QIKA 4GHNA 1YPMH 2B9LA 1KTTB 4YZUA 1SLXB 1K28D 4NIVA 1MBMA 2K20A 3OYPA 1QQUA 3BG8A 3ODDA 1PYTD 1JBUH 1TPPA 1TB6H 4Y71A 5AHGH 1C5WB 1YCPH 2R4HA 1JOUB 1YPKH 2D1JA 2XC0A 2IJOB 1AVXA 2IWOA 2OXSA 4CRAA 5C67A 1GJ8B 1GBTA 1NRPH 3RU4D 1V3XA 3SU2A 1ZZZA 5HGGA 1ETTH 2KPKA 4NMTA 1T32A 2BXTH 1O5DH 5JBTA 2ZFTA 3QDOA 1LHCH 8LPRA 2TGTA 1OS8A 2PKSB 2VGCB 3PO1C 1K21H 1JIRA 4JZIA 2ZU2A 3GY3A 4BANB 4O3TA 1EB2A 4B1TA 1ZMNA 1BMMH 1GMCF 3EYDA 3IITA 3FANA 1AKSA 1AIXH 2OLGA 1P03A 1QRXA 1O3HA 2R2WU 1TRYA 1GMCG 2ZF0H 3Q3XA 1C9TA 2AS9A 1TX7A 2HNTC 5A09A 1NF3C 2VVUA 1NM6A 3VB4A 1EJAA 4DCDA 2BVXH 4JOJA 1LVBA 3LJOA 3FZZA 4Y8YA 3KGPA 3EQ0H 3V0XA 2W5EA 1RD3B 1O2JA 2CXVA 3CH8A 5EOKA 1VCPA 2OCVB 2H9EH 2ZPQA 3L33A 3GY7A 3UOPA 1EP5A 4YO9A 1L0ZA 3SNAA 1SGTA 5T6FA 8KME2 3NFKA 5T6GA 1EZSC 1HNEE 2H9TH 5A8XA 1ARBA 1PQ7A 2DM8A 5J4SA 5HF4A 4WMFA 1GHYH 1MKXH 2SFAA 4X1QU 4B76A 3RXUA 1C5MD 3MH5A 4D9QA 1TALA 5FB8C 4WVPE 1XXDA 1G3EA 1GBEA 2RA3A 4Y0ZE 3SHAH 1YYY1 2KYLA 3A85A 1PDRA 2YTWA 4G69A 1TMTH 1NZQH 1R6JA 5JBAS 2FS9A 1TBRH 4ABIA 1UTJA 1C4V2 3AAUA 3CENA 3A81A 4AYVB 3LT3A 3T2NA 3EGHC 3F1SB 1B8QA 2Y7ZA 1D3QB 1ANDA 2ZGXH 3STJA 4NIYA 3RL8A 4B2CA 3FVFB 1X6DA 4NMPA 2ZCHP 4DW2U 1RIWC 2GMTC 2ZGJA 4BXSA 2J94A 1BIOA 1GQ5A 5SGAE 2HNTE 1MAXA 3PMJA 3PMHB 1D6WA 2CS5A 2ZPSA 3I18A 4IBLH 5CHAB 4Q6SA 2BOKA 4KELA 3BTKE 4ASHA 3HVQC 4MVNA 4I8JA 3TVJB 1O3GA 5L2YH 1O2XA 3PV5A 4E35A 1HAPH 1HJAB 2I6VA 1V5LA 2CF8H 1C1SA 1YF4A 1XMNB 2G5NA 3T28A 5HFFA 2K1ZA 1FC9A 1AE8H 2R2MB 4ABDA 2PKAB 4CR9A 4JOFA 2F9BH 3E8LA 2NU1E 1L6OA 3ESTA 5F03A 2HLCA 1FY8E 2Y5GA 1AFQB 2W26A 3GCTG 1DITH 2BVSH 3SFJA 1J17T 2O9QA 2STAE 1NRQH 1TGCA 1MZAA 5A2PA 2A32A 2OPGA 2ZTXA 4Y76A 2KQFA 4JZFH 4WYTA 1GCDA 8GCHG 4K2YA 4YLQH 1E38B 5EPYA 3R0HA 4ZAEA 3HGNA 2QBWA 1TFXA 1ABIH 5ESBA 5DP9A 2ZTYA 4TPYA 2FESH 4FVBA 1LQEA 2XYAA 5ETXA 4K1TA 4AFUA 4H42U 3UR9A 5F8ZA 1QY6A 3U98H 1BZXE 3DT0H 2P93A 3GSLA 5DP7A 3T26A 3F9EA 1BOQA 4FXGH 3MTYA 2BDGA 1C5LH 1P8VC 4A1XA 1A5GH 2QYIA 2C8ZB 3RXRA 2EDVA 1ORFA 1JMOH 1O37A 4HI3A 2ZA5A 1DDJA 1P09A 1KXBA 4UDWH 2XBYA 2OP9A 1CHGA 5GPIB 5L2ZH 2OSGA 1QB1A 3D62A 1G3DA 2GZ8A 1IAUA 2DLUA 1LHDH 1ELGA 2GZVA 1L4ZA 1SR5C 2GDDA 3HPTB 2AERH 1EB1H 2JH6D 2VWOA 4MQAA 4FUEA 1FPCH 1GJ5H 2Z9LA 1DWCH 1O3FA 2A2XH 2BDCA 4ABGA 2VIPA 4GPGA 3DJAA 1UTQA 1UTOA 4CREA 3MU8A 1WAYB 2QA9E 1YLCA 2R3UA 4INHA 5E1YA 2GT8A 2D8WA 3RC4A 4ABBA 2LUIA 1KLTA 2OQSA 1NFWA 2GT7A 1DWDH 3RXPA 2I0LA 1IQIA 4FU9A 4MPUA 1CT0E 1SQTA 1ZRKA 4LZ4B 4AX9H 2QF3A 5E6PB 2J4IA 1VZQH 2PKAA 1Y3XA 1BTYA 1O2OA 4CR5A 1WQSA 2W3KA 1DM4B 4DIHH 4TYDA 3RC6A 1FAXA 1KWAA 4X6MA 2HGAA 3KQEA 2FZZA 4FUFA 3U1IB 1MFLA 4WY3A 1O3CA 1DXPA 3RUOA 3QTOH 3OTJE 3UR6A 1DFPA 1VGCC 2BY9X 5AFYH 4AG1A 4OS4A 1P1EA 1FQ3A 1T4UH 3QDZB 1EASA 2PZDA 1J14A 2TBSA 4REYA 2Y82A 3H5CB 4JZEH 2GCTC 1JRTA 2BZ6H 1OWDA 2ZO3H 5IYTA 3SJ9A 3U8RH 2M0VA 3S7HB 3BTTE 2P95A 1HFDA 2AMQA 2W7RA 5EQSA 4Q2KA 1HGTH 3S9CA 4H11A 3SHWA 2XWBI 4NMQA 3H7TA 1V2RT 3UNRA 4E7RG 3LPRA 2IPHA 2AMPA 3SU6A 1S84A 2UUFB 2ODQA 3K65B 4HZHA 4WWYA 5ABWA 3OX7U 1UVUH 2C90B 2M10A 2ZDMA 3BEIB 3KQBA 4WJG2 5G4BA 3TPIZ 3TJNA 2ZEBA 1BA8B 1XKBC 1Q3OA 2FE5A 1KIGH 3AAVA 1T31A 4BAMB 1SHHB 3TIUA 4MDSA 4UFGH 5HMAA 3QTVH 1BTWA 1WH1A 3O5NA 4FUDA 5DPAA 4ZMAH 1DVAH 2H2BA 2TGPZ 2Y6TA 1GDNA 1S5SA 5LPFA 1K32A 2C4FH 4U32A 2HPPH 1T8OA 1HJ9A 2BY6X 3KQDA 3TGJE 3HK3B 3RXOA 4DIIH 3HATH 1N1LA 5EXMA 1P05A 2FTMA 4UU6A 3A8DA 1VCQA 1SOTA 1RTLA 3SNEA 2RA0A 1ESTA 1QBOA 2JETC 3SUEA 1WQVH 1UM7A 2BD5A 4NNLA 3A87A 2L4TA 2BDHA 4I33A 3ZZ9A 4XDEA 1OWIA 1UTLM 4ISOA 3RXBA 3ZRTA 4Q3HA 4X6NA 2OC0A 4DJZB 3M5MA 2SGPE 1C2IA 3TK5A 3B9FH 1HDTH 1V6BA 3KF2A 4GHQA 5C5OA 3MU4A 1P2NA 3TH3H 2J2UA 1WFGA 4DT7B 4MNWA 1G3BA 3EA9A 4TPIZ 1P01A 3M7QA 4FVDA 2WV4A 3RXDA 3URDA 1AFEH 4CRFA 1QAVB 1TRNA 2BD3A 3E1XB 4XSKU 3RXTA 1Z6EA 2A0QB 1AD8H 3NGHA 2PGQB 1C2DA 4F4OC 1Z87A 1BT7A 5HEBA 4AB8A 1DXWA 1WCZA 3VFEA 4NWKA 1F2SE 1BRUP 2ANMH 2GP9B 2Z9IA 1HYLA 3RL7A 3BG4C 1V2KT 4B73A 2QC2A 1ZSKA 1ESAA 1ABJH 1TQ0B 3O8RA 3G01A 2Z3DA 3RXGA 2AWUA 2G5MB 3AW1A 2DAZA 1QL9A 8ESTE 4AOQA 4K78A 2PSXA 1GBFA 1TNKA 1PPZA 5EW2H 4BAQB 2VSVA 2AFQB 4Z0KA 2P8OB 3U1JB 1PQ5A 3GY6A 2DE8A 2PW8H 3P8GA 3SHCH 1W14U 1GJ4H 5HYOA 4DY7B 2C3SA 3PYHA 1E37B 1O34A 4FGMA 2A1DB 4KKDA 2STBE 1F5RA 3MOCA 2M0UA 1WHDA 1B5GH 1THRH 3A7VA 1ZR0A 4L8NA 4O97A 1Z6JH 3JXTA 1O2YA 3ZZ7A 1TPSA 5HDYA 2HWLB 3HK6B 3WKMA 4AN7A 1MTSA 1ELTA 1O5BB 4ISHH 4ABFA 3LGYA 1O36A 5GIBA 2QT5A 1K1OA 1O3BA 1ZLRA 2R0LA 3KHVA 1F5KU 4ZKSU 3QO6A 3PTBA 2NU2E 1EKBB 2PLXA 1BFEA 2FOGA 1GHXH 2W3IA 4RKOB 2PR3A 1L4DA 1UJDA 3SBKA 2PKUA 1Y5UT 3LGTA 4X2YA 1WOFA 2YUYA 1OP8A 2F9NA 2AYWA 3ZZ8A 1G2MA 4B74A 3B23B 1YCPK 4UONA 1ZTJA 1ZHRA 4WH8A 1DOJA 1MCTA 3LONA 2K1QA 3SJKA 1LVOA 1VR1H 1LO6A 4MPXA 1BMLA 3RMOH 3BIVH 1FXYA 1G37A 2BY8X 4D7FA 4BOHA 3M3SA 3O46A 3VQFA 3BTHE 5AVDA 1GJBB 2XBVA 2LNCA 3TJVA 1WTHD 1TLDA 1QR3E 5DKMA 1LPGB 1Q31A 1F7ZA 2G4TA 1ELCA 3H7OA 3LDXH 1UF1A 5HFCA 1W13U 1QAVA 5BPEA 1PPEE 1A0HB 1BTPA 3F9FA 2PV9B 1EPTB 1GI6A 3A7YA 1BUIA 2REYA 4NSYA 1VB7A 1H8IH 3GCHC 3O8BA 4QT8C 4GAWA 1MTNC 1GM1A 1F92A 1PPCE 2JWEA 1FDPA 4X6PA 2H3MA 5DP4A 3KZEA 1GBHA 4N6XA 1K1NA 1MU8B 2CGAA 3PLKA 3NZIA 1WF7A 1PPBH 2J38A 2OUAA 1C5TA 1D4PB 3PV4A 3SOEA 1N6YA 2GDEH 3CC0A 1IQEA 1HUTH 3TJOA 1QTFA 3TH2H 2HPQH 5DP5A 4BAOB 2EDZA 1G30B 1QLCA 2FWWA 1ZPBA 4E06H 2A4RA 2ASUB 3GY2A 2KPLA 4CH2B 1SGIB 1ELEE 1MKXK 1NRRH 2GCHF 2LOBA 3M35A 2EI6A 4WF8A 2Z17A 5JBCS 3TNSA 1TGBA 1DLKB 1T7CA 3K50A 2GZ9A 1K1IA 2GCHG 4K72A 2A5AA 2BYAX 3QLPH 1TWXB 4OS6A 3U9AH 3RU4T 3PB1E 7ESTE 1NN6A 5FHTA 3MO9A 1CVWH 1NFYA 4Y8ZA 2F5YA 3TK6A 5I7ZA 1O2MA 4Q2OA 1FIWA 2KJDA 4WMEA 1HB0B 4NXQA 4Y6DA 1ZHPA 5E0HA 1GI1A 2ZGCA 4FUIA 4X1RU 1QL8A 3V13A 3ZZCA 4AB9A 3RXHA 5E21A 2TRMA 1W12U 2D2DA 1MKWH 1GWAA 3P70B 2A5IA 1CGHA 1GDUA 4I8LA 3RXKA 1UK2A 2WPLS 3FZDA 4XBBA 5HF1A 1IOEA 1O3LA 3SI3H 4AG2A 2AIPA 2O8LA 3VGCB 5G1EA 1TMUH 3LIWA 1N6EA 1UK3A 2PKSC 3BEFB 2VGCC 3GGEA 1P3CA 2KAIB 2Y81A 1DICA 1O2TA 1QB6A 4NXRA 1OZIA 2E7KA 1KXDA 2JXOA 4OS1A 1KTSB 2DE9A 1EPTA 1V2WT 2QN5T 2O8MA 6CHAB 1B0FA 3QJNA 1OKXA 2DLSA 1G9IE 2H6MA 1CA0B 1HAVB 1TP5A 1ETSH 1TRMA 1C1PA 3GYLB 1ANEA 1GJCB 1QJ7B 2ZECA 2BD4A 3UIRA 5AF9H 4Y7BA 2YOLA 3ID1A 1AY6H 3E6PH 3K6YA 5FX5A 1SGCA 3QJMA 4U30A 2ZDVH 2Z9GA 4CBNA 3ZYEA 2P3TB 1KYNA 3UY9A 2EAQA 4JOHA 1U6QA 3U69H 5GWZA 1WJLA 1QAUA 3EDXB 3JZ1B 4JOEA 1V2UT 2BDIA 1P9UA 3SI4H 4H4FA 1MUEB 1TPOA 3DHKH 1K1MA 2XCFA 1RZXA 1OBXA 1T8NA 1QHRB 1DWBH 3E16B 5DO4H 3MWIU 1Y3UA 1XXFA 2ILNA 1NFUA 5FPSA 4KP0A 4JOGA 1TPAE 2FOEA 2VIQA 2Y5HA 1T8MA 5HEDA 2ZFRH 3MNXA 1BMNH 2ZPRA 4YOGA 3KHFA 2ZI2H 4OEOA 1ELAA 2BB4A 2WPJS 1TIOA 3K6ZA 4I8KA 3A7XA 1XUGA 4JOPA 3HKIB 2WINI 1CBWB 1ELVA 3FY5A 1UCYE 2ANYA 2V3OH 3BTDE 3KCGH 4RN6A 2G52A 1SQOA 4U2WA 4YESB 1THPB 1Z86A 2I1NA 3F6UH 3BIUH 2ZHQH 1AWHB 1P04A 2B5TB 2V3HH 3EGKH 2IOTA 2EC9H 5EPNA 1GJAB 4F8KA 2ZDAH 1S6HA 1NRSH 3MH6A 1VJ6A 2H2ZA 4MNYA 1ARCA 1BMAA 5JB9S 3LC5A 1GCTB 3W94A 1FI8A 1AB9B 1SGFG 1NFXA 3MH4A 2KAIA 4YT6H 1TX6A 5FPTA 3A7ZA 5EXNA 3CBZA 1WIFA 5CHAC 1V2QT 3NKKA 3P6ZB 4IMZA 3LGVA 3MU5A 2P59A 1C5SA 4UEHH 4Z8JA 4VGCB 3VPKA 1HJAC 3C27B 3RP2A 4ISIH 3K82A 2XC4A 1HAVA 3BTGE 3MO3A 2FDAA 1DUAA 1ZTKA 2F91A 2OC1A 1KSNA 1GHAF 3S7KB 4AFZA 1IQHA 1CU1A 4DURA 4OS7A 1BE9A 1MFGA 1Z1IA 1V2JT 2SGAA 4K5ZA 2PSYA 1VCWA 3FP6E 2AGGX 3M5NA 5HM9A 4ABHA 2ENOA 1GHAG 1AFQC 2JINA 2Y5FA 4AGJA 5E0GA 3L4FD 2ZCLP 2GZ7A 2A4GA 4X2WA 2C8WB 3P8OA 1Q3XA 1XKAC 5C20A 1DS2E 1S81A 3UREA 2VWMA 1LPZB 5JXBA 3I29A 4NIXA 1E35B 1LCYA 1DPOA 3C1KA 5EW1H 1T4VH 2BY5X 3ZVCA 1O2GH 1N7TA 1BBRE 3A8BA 2ALVA 4JYUH 1QIXB 1IQGA 2AH4X 4NA7A 3CBYA 5F67A 1JIMA 3QZRA 1D3PB 5A0AE 4K6YA 1UFXA 3RXQA 1IQNA 2A7CA 1HRTH 2F9OA 1UTMA 1TGSZ 3DIWA 3L6PA 3RMNH 1MTWA 4ZHLU 5GDSH 4Y10E 5PTPA 1OWEA 4OS2A 3T25A 2D8IA 3GCNA 2I4SA 1FJSA 5T3HA 2BM2A 1W8BH 1SGDE 1H9HE 2P3WA 3UOUA 1FAKH 1YPGH 3W95A 1QURH 2OZFA 5DK1A 2H5CA 5EYZA 3GDVA 3ZV9A 3SUGA 3QN7A 2P16A 4ZUHA 5C3NA 3UTUH 3I77A 4XE4A 4FUGA 1XM1A 3GCTF 2EEKA 2GVFA 2XW9A 2ZCKP 2Y80A 4GLYA 4SGAE 3GYMA 1HCGA 2MHOA 1LTOA 1SI5H 2F9VA 1FN6A 2VVVA 2Q6DA 3TMHA 2CF9H 1MAYA 1GHZA 2JILA 2FPZA 5CMXH 4BTUB 8GCHF 1QFKH 4OEPA 5A0CA 1EZUC 1GHVH 3E17A 1N8OB 1OWJA 4E05H 3A80A 5L30H 3A8AA 3CS7A 2AGIX 4R0IA 2CN0H 2XBXA 2YNBA 4UD9H 1X5RA 1UJVA 2J9NA 2OINA 3MYWA 3GJ9A 1P2MA 1CT4E 3ZZ6A 2QF0A 2L97A 4IS5A 3DD2H 4DOQA 4ABJA 1SFIA 2O8TA 2FNEA 1K2I1 2QXHA 3E0NB 1O5FH 2QXJA 2ZP0H 1WSSH 1YC0A 2HOBA 1SGEE 5EQQA 2BVRH 1EAIA 2QXGA 3RXSA 2PHBA 2Z94A 2VRFA 1TYNA 1SMFE 5EODA 1ZGVA 1O3KA 1N99A 1ZTLA 1ELBA 4MG3A 2FI5E 2BOHB 1K22H 2GD4B 2NWNA 3KZDA 3MNBA 3QZQA 1TAWA 4I31A 1ZMJA 3UQOA 2VNTA 1UEPA 2LC7A 1IU2A 3RMLH 2Z9KA 1CT2E 2UWOA 4WXVA 1ZGIA 2ZFQH 2XNIA 3BPUA 1OWKA 4Y7AA 2G8TA 1BITA 2GGVB 1P2QA 1PJPA 2QKUA 5ESTE 2ZKSA 2Q9VA 3AVZA 1HAYB 2RDLA 2ZPMA 5GJ4B 3TSZA 4YTAA 1GDQA 2QGRA 3UFAA 3ID4A 3LOXA 3A86A 3ELAH 4NFFA 4B2AA 1P06A 2BYGA 1J8AA 4J1YA 2Z3CA 2L4SA 1O32A 3SZNA 4FU7A 4MNXA 1V5QA 1VA8A 1GHBG 1GBKA 1IQLA 3HKJB 1HIAB 3GOVB 4OGXA 3RXCA 4AFSA 1DSTA 1ZPCA 4JYTA 4MTBA 1LKAA 1VJ9U 5D13A 2FX6A 4LMMA 4MPVA 5FAHA 3L3TA 1SLVB 2PWXA 1QBVH 5LPEA 3BTEE 2KBSA 2QKVA 2H3LA 5DP3A 1MBQA 3PWCA 5A8ZA 1C5UA 1XUFA 2ZHWH 2FEQH 1TNHA 3E0PB 2HGTH 3T62A 2W7SA 3SV7A 3S0NA 1GBAA 1C2FA 1W11U 2KOMA 1HXEH 2EEIA 1AQ7A 1DX5M 1AGJA 1MTUA 1QL7A 1S83A 3ZVFA 1G32B 1FIZA 2OMJA 3SHUA 1RGRA 3VB5A 1XZ9A 1DY8A 4ABEA 1TABE 1AUJA 1SGYE 2CSJA 2WUCA 2VIOA 1BJUA 5F8XA 1QRZA 3LKWA 1O2QA 1VITH 2DMZA 1F5LA 2VIDA 3PS4A 1U39A 3LJJA 1V2LT 2VH0A 1P57B 1CO7E 1AVGH 1K9OE 2EI8A 2H1UA 4DVAU 3IWMA 3AXAA 1SGPE 1O5AB 2HE2A 3SUZA 5A8YA 4I8HA 2A5KA 2JREA 1C1QA 2NU0E 2P8OC 1P1DA 1P9SA 2P3UB 1SQAA 5DTHA 1CA8B 4HGCA 4NA9H 2IWNA 3ZVAA 3P17H 5DGJA 1OX1A 3PDZA 1GJ7B 2VSPA 5HFBA 1DWEH 1SL3A 2XCNA 4CHAB 1GVLA 4MPWA 4UFEH 1EOLA 1WYKA 1EP6A 1O3IA 2Q6FA 4CBOA 4KFWA 3SN8A 1CGJE 2G55A 2BQ7B 3A83A 1I92A 1HIAA 4K75A 3QE1A 2ANKH 3QK1A 1SSXA 1AZZA 2ZPLA 2D26C 3ATIA 4LXBH 1U3BA 2FYQA 5DJ7A 1EAXA 4K8YA 3E3TA 4FUCA 1ZPZA 3LGWA 5EG4A 3I1EA 1SFQB 1AMHA 3DJ1A 4K1EA 2V0BA 3LH3A 2ZU4A 2FXRA 2YT7A 2BD9A 1MKWK 3PMAB 2G2LA 4ZHAA 1L1JA 3SW2B 2AGEX 3ZVEA 1O3EA 2ZC9H 1A61H 1GG6B 1Z7KA 2RRMA 1PPHE 3NK8A 1U37A 1IHJA 4K1SA 1C9PA 1W7GH 4NNMA 3LC3A 2PTCE 1MD7A 1KLJH 1C1NA 1J9CH 3RLYH 3SORA 1NESE 4TWWA 4FUHA 5E8EH 1EPTC 2ZFFH 2UUKB 1FONA 3ZZ5A 1Q3PA 2PFEA 1X5NA 4X2VA 3RXFA 1BCUH 4AYYB 4ZXXH 1D3TB 1O5EH 2XC5A 3B8JA 4IC5A 1SLUB 1UCYH 4WMDA 2KJKA 4NIWA 1BTUA 1H8DH 3SQHE 1SVPA 4A5TS 1IHTH 2J34A 1UEZA 4B2BA 2C8YB 3KQCA 1DE7H 3K9XB 3K2UA 4LZ1H 4DGJA 1VAEA 1PFXC 1FZZA 1G3CA 1TGTA 3OY5U 2SNWA 3SU4A 4J2YB 1MZDA 2OD3B 4ZKNU 2RCZA 3S69A 1T2MA 1EXFA 1OSSA 1AHTH 1JRSA 1UHBB 1Y3VA 4NSVA 4K76A 2BHGA 3FP8E 2VJ1A 4K69A 1ANCA 1C4U2 1L1NA 3MU0A 1IU0A 1TGNA 2M0ZA 3MH7A 1ELFA 2ZFSA 2V6NA 2JH0D 1QJ1B 2CMYA 5EGMA 3RC5A 1P0SH 3BTME 1XUHA 2QXIA 1WG6A 2WYJA 3LH1A 3NUMA 1MMJN 4B71A 1TMBH 1NPMA 2KRGA 4AGKA 3ZZAA 3M36A 3QX5H 3TJUA 2UWLA 2ZGBH 3T29A 1EZQA 2WL7A 5HXFA 1M9UA 1TOCB 1GMHF 2IN2A 2GV7A 1ZSJA 1HV7A 1KY9A 1LVYA 1O0DH 2ZU3A 3VGCC 1NTPA 3STIA 1GMHG 1NU9A 2R0KA 1QNJA 2ZQ1A 3BV9B 3KL6A 2YNAA 2HNTF 1BBRH 2ZIQH 3ATWA 1ETRH 4OS5A 1GI8B 5EQRA 5TJXA 1JXPA 3SJOA 3UQVA 3ATMA 1UVSH 1K1PA 6CHAC 3B76A 3E90B 4THNH 1IQFA 4ZXYH 3BTQE 1WFVA 1CGIE 4NXPA 1SG8B 4NWLA 3ZYDA 5B6LA 1CA0C 1GI3A 4R8TB 1Y5BT 1GVZA 4DG4A 1O39A 2XBWA 2HE4A 5H3JA 4NMOA 4X2XA 1D9IA 2H9HA 3I4WA 3T27A 3DA9B 1P2JA 4UFFH 2CJIA 2UUYA 5FXLA 3SV2H 1ZMLA 1P10A 3TSVA 4YDPA 3OSYA 1C2LA 2JKHA 3Q77A 3PM3A 3NFLA 2XWAA 1M5ZA 4E3BA 1EOJA 2BLOA 3A82A 4A1VA 2OCSA 7GCHF 4INLA 3K1RA 4WXIA 1C5RA 1UM1A 2AIQA 3Q3YA 1C5VA 1BQYA 3M5OA 2BDBA 1UHBA 1OBZA 4B75A 7GCHG 4NGAH 2PKTA 1QRWA 3ZVGA 1GQ4A 1O3AA 2GTBA 1BB0B 1V2PT 1AO5A 1WV7H 3SGBE 1GL0E 3EGGC 1Y8TA 1HXFH 1CBWC 1W3CA 4CRCA 3NWUA 4RKJB 1SBWA 2ULLA 4O3UA 2FP7B 3GY8A 2FOBA 1BRCE 1S82A 3CP7A 3DFJA 1FC6A 1N7FA 3QUMP 2UZCA 1O2VA 1CQQA 4F49A 1UJUA 1XUKA 2NU3E 1S0QA 4HTCH 2EEHA 4BTTB 2TPIZ 1PQAA 1EUFA 4P0CA 1SB1H 1RGWA 1GI5A 1GMDF 2VZ5A 4I7YH 5F6MA 1KXFA 1GCTC 1OP2A 1AB9C 4M7GA 2BLVA 4KGAA 1H1BA 1MH0A 2FOMB 1GMDG 1SGNE 3SV6A 2G00A 2G81E 4IC6A 1IQMA 2RCEA 3ODFA 4JORA 2M5TA 3SO3A 1EJMA 3U8TH 3QGNB 2QKTA 3EA7A 4WH6A 1GI7B 4NG9H 5FBIA 2VVCA 2GV6A 4VGCC 4KTUA 2FCFA 2GKVE 1P11E 3FFGA 3DFLA 4MNVA 5J4QA 4UE7H 3V7TA 1ESBA 2A2QH 2HALA 3F9GA 1RTKA 4UU5A 1YBOA 1MQ6A 3O8DA 4ESTE 1Y3WA 2BXUH 9LPRA 3PWBA 1O2RA 1Y5AT 2DJTA 2FI4E 2CHAB 1W9EA 3F68H 4JYVH 1MC7A 1O3MA 1Z8RA 4Q7ZA 1HAOH 4OAJA 4FU8A 2Q1JA 3LGIA 2FOCA 1GGDB 5DP6A 1YP9A 2OBOA 1QBNA 2LC6A 1E0FD 1KXEA 2LPRA 2OC8A 1C1RA 2ZDKA 3BN9A 4A92A 1VJAU 2J95A 1BRBE 4MLFB 1PPFE 3V3MA 1O3JA 1GI4A 3LGUA 2FOHA 1FC7A 9ESTA 1T8LA 1K1LA 2TGDA 1YPEH 3BEUA 4YT7H 1DUEA 1FLEE 3RLWH 3RM0H 1BDAA 3VXFH 4NA8A 1GPZA 3MU1A 2JH5D 1AI8H 1HPGA 1UTNA 3ATLA 3BSQA 4AORA 4INKA 5TCCA 4E7NA 2LA8A 1XX9A 2C8XB 4AFQA 4RI0A 3SU1A 4KTSA 1NRNH 2ZNKH 4FUJA 2ODYB 3D65E 3OTPA 1O38A 4YM9A 1O3OA 4O9VA 2ESTE 1AU8A 1F0TA 1C1OA 2WPKS 1C2EA 1O33A 2KV8A 4Q2QA 1RY4A 4JOKA 4TWYA 3SGQE 3U8OH 2BY7X 2V90A 1V2MT 2Y7XA 2X7ZA 3SU3A 3M37A 3R3GB 3D49H 4LK4A 2OS6A 3SU5A 2F3CE 1A46H 2Z3EA 1A0JA 5JPMH 1A2CH 1WBGB 3PLPA 1Y3YA 1NROH 3N7OA 1OWHA 2EGNA 4GHTA 4CH8B 1TNJA 1ZYOA 2QAAA 2ZU5A 1KXAA 1EQ9A 1ZHMA 1O2LA 3EA8A 4JCNA 1DY9A 1V1TA 2PDZA 4Z33A 1N8OC 1YBWA 2J92A 2FODA 4Q7YA 1C2HA 3OU0A 3ZZ4A 1C2KA 1CHOF 2A31A 2DUCA 1MU6B 4NFEA 4X0WU 1A7SA 1TP3A 5E0JA 1CHOG 5AFZH 4R2ZA 1O3NA 4GVUA 2JIKA 3AASA 5C1XA 1XUIA 4TY6A 1W9OA 2OBQA 1UK4A 2P3FH 1TBQH 3ZZBA 4SGBE 1A5IA 1EJNA 1NY22 1QCPA 5H4IB 3RLEA 2KL1A 3F9HA 4YOIA 5LGOA 3WKLA 2VH6A 1GI0A 1GL1A 1O5GH 4I8GA 1HAXB 1SGRE 1IQKA 1ZSLA 2HRVA 1E34B 4ZKRU 1G2LA 2SGDE 3PO1B 4XHVA 3ZVDA 1CSOE 3GY4A 4CRGA 1AVWA 3SGAE 3TITA 1E36B 1H4WA 1QA7A 1RS0A 5A0BA 5F3XA 2KOJA 4HOPB 1J15A 1TA2A 1NTEA 3Q3KA 2UWPA 4IN2A 1GBDA 1WF8A 5C2ZA 1TQ7B 3UPEA 1YM0A 3BTFE 1JWTA 4ZHMU 3GDSA 4GVCA 3T5FH 1N6FA 2Q3GA 3SU0A 3GCOA 1D6RA 3P95A 2R3YA 3SUFA 2O8WA 4JZDH 3RXJA 4XOJA 2EHRA 3LU9B 1U38A 4NZQA 1HAHH 1L1GA 2F9PA 5IDKA 3PLBA 3JZ2B 5GLJA 2WPIS 2ANWA 4P2AB 5FCRA 2EEGA 1V2ST 2A7HA 6GCHF 2SGQE 3A84A 7LPRA 1C1VH 1DSUA 4YLUA 2FX4A 1GBJA 1S0RA 5T6DA 1UO6A 4MPAA 1UEQA 6GCHG 1O2PA 2A45B 4NMRA 3P92A 3EE0B 3WY8A 1O2ZA 2BMGB 3DORA 1GJ9B 2IWPA 3PTNA 4NMSA 1J16A 1W10U 3TLOA 3O8CA 2PGBB 1ID5H 4Q2PA 5I46H 1X7AC 1QGFA 2FI3E 1YKTA 2XTTB 1DANH 3LNXA
chains in the Genus database with same CATH superfamily
2H5DA 3EAJA 4Y0YE 3SQEE 3CYYA 3SNBA 4U01A 1WHAA 2AWWA 1YCPM 3ZVBA 4E34A 2G5VA 3RMMH 1UCYK 1UMAH 1RIWB 2GMTB 2XOKD 1Q7XA 1B0EA 2BQ6B 2I04A 2F83A 2FTLE 1UVOA 2BDYA 1BTXA 3SV9A 3A88A 2ZGHA 2EA3A 3CS0A 1TE0A 1WU1A 2NU4E 1MD8A 1SGQE 1WTGH 1OYTH 5C5NA 4ABAA 2ZDNA 2AMDA 5JYIA 4KTCA 2O8UA 1GHBF 1H8ED 1YGCH 2KCAA 1C5XB 3AW0A 3ITIA 3DUXH 2H2CA 1G9OA 4X8VH 3N7DA 5E11A 1ZOMA 3GY5A 4HOPA 3M5LA 3UWIA 1MQ5A 4BXWA 2O2TA 1BHXF 1AE5A 4BAKB 4CHAC 2EI7A 2PA1A 1P02A 2A7JA 4Q80A 4XBDA 4Y79A 1FN8A 4NMVA 3RXVA 2VWLA 5EU8A 2VWNA 1H9IE 1W2KH 3PV2A 3MFJA 3MNSA 5FBEA 2BTCE 4Q6HA 4A6LA 4OM9A 1VITF 1WI4A 2BLQA 1C1MA 1DT2A 1C4Y2 1TNIA 1KXCA 2SGEE 3FAOA 3PDVA 1GJDB 1FY4A 3SOSA 1UTKA 2FLBH 1VITG 3MQKC 3BTWE 3PROA 1X9ZA 3RDZA 1UITA 1W0YH 2YMSC 2M2AA 4X1SU 1WUNH 3QGLA 5LPRA 4IW4E 4X1NU 1GG6C 2P94A 4D8NA 2FIRH 1ZOKA 5BRRE 1FPHH 2DB5A 1NBME 1ANBA 2HVXA 1EX3A 3FOAA 3M7UA 2KA9A 1BBRK 2VB0A 1FY5A 1RTFB 1YPLH 3A89A 2FM2A 2F4LA 5C1YA 2ZFPH 2BDAA 4X6OA 4Y8XA 5JB8S 1A1RA 3W1EA 1LPKB 3S9BA 1CE5A 5EXLA 2KJPA 5JDUB 1GBIA 2RG3A 1NC6A 2M3MA 4Q2NA 5GXPA 2QG1A 4GVDA 1SQRA 2AINA 7KMEH 1OBYA 4I32A 1FY3A 4ZROA 5C94A 1Q2WA 1YPHC 3BF6H 2B0FA 5F8TA 5DG6A 2VINA 1RGQA 1THSH 2WUBA 1OXGA 1SPJA 3KNXA 1C5ZB 5K7RA 1W0KD 2QCYA 2QV1A 4RSPA 6ESTA 5HFDA 3M61U 4UFDH 4YOJA 3R69A 3UWJH 3R68A 1TX8A 1P2KA 5G1DA 1GBMA 1X5QA 1S85A 5HM2A 3ZZDA 2FMJA 1C1UH 1GBCA 4X8TH 1YLDA 1INCA 2BZAA 3P8NA 3VXEH 3TH4H 1GBBA 2FOFA 2JOAA 3OAAD 2BD7A 4OGYA 3VEQB 4WYUA 1LVMA 1BTHH 1BJVA 1EFRD 4AMHA 3HPKA 4CRBA 3QWCH 4O03A 1V2VT 1Z8JB 2FLRH 1D5GA 1AZ8A 3VQGA 1PYTC 4X8UH 3SUDA 1I16A 1FV9A 4ISLA 2EDPA 2YT8A 1VGCB 2XXLA 2FO9A 1QJ6B 4HFPB 2RFKC 1UVPA 3KEEA 5FPYA 3VB3A 2BD2A 1OP0A 2GCTB 1O2IA 1F0SA 1GI9B 3F2FA 2XNDD 1N6DA 1A3BH 3ATKA 1UJ1A 2EGKA 5B6OA 2AWXA 4KFVA 2BLWA 2UUJB 2BX3A 1FCFA 5JBBS 1NS3A 2G4UA 5C1UA 1C5PA 2CSSA 2OC7A 3TK9A 3GISB 4BTIB 1N6XA 1TOMH 1W7XH 5EJLA 1C2GA 5EIYA 1RJXB 1TONA 1YPHE 4X8SH 1ACBE 1E1RD 1Z8GA 3UUZA 2R9PA 5K0HA 1BTZA 1EATA 1QA0A 1P2OA 3PMBB 1P12E 2ZU1A 4PROA 2PNTA 1SGFA 1F0UA 1IQJA 1V2TT 3FP7E 4Z6AH 1C5NH 2DKRA 1GI2A 1ZJDA 1O2WA 1C2JA 1V6DA 3TNTA 1LKBA 1P2IA 3QGJA 1B7XB 1SHYA 3TSWA 1WI2A 2SNVA 2YUBA 4IN1A 3RXIA 1O35A 1KDQB 1HBTH 1HAIH 3MHWU 1YLNA 5GNDA 1O3PB 3IG6B 3DJ3A 1LQDB 3NPSA 2PTNA 4X1PU 5E2PA 3Q00A 1RFNA 2F0AA 2JETB 4XBCA 2SGFE 4GUXA 3SV8A 3URCA 1XVMA 1FMGA 2TIOA 4EDJA 2I0IA 1LHGH 2THFB 3RU4E 5CE1A 2V35A 2WPMS 4D76A 3UNQA 3SNCA 1HAZB 3MNCA 4JK5A 3SNDA 2KG2A 4NZLA 2PUQH 1V62A 2Z7FE 1O3DA 4JK6A 3SJ8A 3ZV8A 2FS8A 4A7IB 1O2UA 1G36A 1KEFA 5HFEA 1F0RA 1C5QA 1P3EA 2AEIH 2PUXB 1FNIA 1PPGE 2I6QA 1OHHD 2EXGA 1L2EA 2FOAA 1Z71A 5HIZA 2ODPA 2OTVA 3MMGA 3OE7D 2VPHA 4O06A 4K60A 1TNLA 3SYJA 3RXLA 1D3DB 1ZRBA 3VB6A 5TCAA 4D9RA 3BG4B 2GEFA 4BNRA 4Q7XA 2QIQA 2TGAA 3V12A 3Q76A 2EJYA 5DP8A 4ZKOU 2Z9JA 3SJIA 2D92A 3GDUA 4ISNA 4LOYH 1Z8IB 1AN1E 3GICB 3F2HA 2OQ5A 2W7UA 3A8CA 3HGPA 3M3VA 4IMQA 2FYRA 2KOHA 1GBLA 2BQWB 2ZZUH 5E2OA 3MI4A 3UNSA 3R0FA 1KLIH 1SLWB 3TGIE 1TQ3A 2B7DH 1MTVA 5FCKA 1OPHB 1NBMD 3ZZ3A 3N99A 1C1WH 1Y59T 2GX4A 1Z1JA 1LMWB 2VIWA 1K1JA 3KIDU 1UEWA 1O31A 1OOKB 4H6SB 2EV8A 1H9LB 3ID3A 1A4WH 1NT1A 4K3JA 2ZHFH 1BRAA 1HAGE 4GCHF 1UHPA 1AUTC 2XRCA 1GJ6A 1QB9A 5T1VA 2CHAC 3M7TA 1W9QA 1KDQA 5A2MH 1NO9H 2I6SA 5E22A 1EAWA 3KN2A 1X45A 1DLEA 4GCHG 1ZJKA 1BHXB 1GGDC 3NXPA 1UTPA 1AWFH 1HJ8A 2DC2A 4JMYA 1EAUA 2L6OA 1UVTH 1TNGA 2ZDLA 2ZHEH 2OQUA 4JZ1A 4IGDA 1A3EH 3I78A 1C1TA 1A5HA 3CBXA 5HJ1A 2ZWLH 4ZCNA 1FY1A 4K8BA 3RXMA 2BD8A 1C5OH 2MX6A 3UAIC 3S9AA 1O5CB 1C5YB 1OYQA 3TGKE 4A1TA 3LNYA 4TT3D 3MO6A 2W4FA 1TA6A 1QQ4A 4PQWA 2A4QA 1W0ZU 2VIVA 1GHWH 1XVOA 3OY6U 2F9UA 2C93B 1V2OT 2YMSD 4GSOA 2Q6GA 2ALPA 1SOZA 3HPMA 5HETA 2M0TA 4H6TA 2A4OA 2Z6BD 1IHSH 4AZ2B 1MCVA 2EGOA 1O2HA 5GCHF 2ZQ2A 1FUJA 5EZ0A 4Y11E 1AKSB 3A7TA 5FX6A 2EEJA 1XUJA 4NCYA 4ZH8A 3RXEA 3D23A 3GCHB 5GCHG 2FN5A 1MTNB 4BAHB 4D7GA 1GVKB 1EZXC 3NCLA 2G51A 1V2NT 1O30A 2VU8E 1E79D 2V1WA 3AK5A 1Y7NA 3M3TA 2KAWA 5HKKD 6LPRA 2WPHS 3VB7A 1NU7B 1O2NA 1YPJH 5DN6D 4YYXA 5LH8A 2CV3A 1C2MA 1O2SA 1O2KA 4JL7A 3U28C 1LDTT 2QY0B 2WHXA 1HLTH 1N7EA 1RXPA 1SC8U 2W6ID 1ELDE 2B8OH 2ZHDA 3A7WA 2ZG0H 3E91A 2IWQA 2D90A 4TY7A 2VWRA 3TU7H 1LHFH 1PQ8A 1S6FA 4XFQA 1ZUBA 1TBZH 4CRDA 3P8FA 4FUBA 3RXAA 5I25A 1LHEH 1X8SA 2WYGA 1RRKA 3ID2A 1A0LA 3RM2H 2BX4A 5L6NH 5HEYA 2K8IA 2ZTZA 1YY3A 2WV5A 3ENSB 2OGPA 3QIKA 4GHNA 1YPMH 2B9LA 1KTTB 4YZUA 1SLXB 1K28D 4NIVA 1MBMA 2K20A 3OYPA 1QQUA 3BG8A 3ODDA 1PYTD 1JBUH 1TPPA 1TB6H 4Y71A 5AHGH 1C5WB 1YCPH 2R4HA 1JOUB 1YPKH 2D1JA 2XC0A 2IJOB 1AVXA 2IWOA 2OXSA 4CRAA 5C67A 1GJ8B 1GBTA 1NRPH 2JJ1D 3RU4D 1V3XA 3SU2A 1ZZZA 5HGGA 1ETTH 2KPKA 4NMTA 1T32A 2BXTH 1O5DH 5JBTA 2ZFTA 3QDOA 1LHCH 8LPRA 2TGTA 1OS8A 2PKSB 2WSSD 2VGCB 3PO1C 1K21H 1JIRA 4JZIA 2ZU2A 3GY3A 4BANB 4O3TA 1EB2A 4B1TA 1ZMNA 1BMMH 1GMCF 3EYDA 3IITA 3FANA 1AKSA 1AIXH 2OLGA 1P03A 1QRXA 1O3HA 2R2WU 1TRYA 1GMCG 2ZF0H 3Q3XA 1C9TA 2AS9A 1TX7A 2HNTC 5A09A 1NF3C 2VVUA 1NM6A 3VB4A 1EJAA 4DCDA 2BVXH 4JOJA 1LVBA 3LJOA 3FZZA 4Y8YA 3KGPA 3EQ0H 3V0XA 2W5EA 1RD3B 1O2JA 2CXVA 3CH8A 5EOKA 1VCPA 2OCVB 2H9EH 2ZPQA 3L33A 3GY7A 3UOPA 1EP5A 4YO9A 1L0ZA 3SNAA 1SGTA 5T6FA 8KME2 3NFKA 4HG6A 5T6GA 1EZSC 1HNEE 2H9TH 5A8XA 1ARBA 1PQ7A 2DM8A 5J4SA 5HF4A 4WMFA 1GHYH 1MKXH 2SFAA 4X1QU 4B76A 3RXUA 1C5MD 3MH5A 4D9QA 1TALA 5FB8C 4WVPE 1XXDA 1G3EA 1GBEA 2RA3A 4Y0ZE 3SHAH 1YYY1 2KYLA 3A85A 1PDRA 2YTWA 4G69A 1TMTH 1NZQH 1R6JA 5JBAS 2FS9A 1TBRH 4ABIA 1UTJA 1C4V2 3AAUA 3CENA 3A81A 4AYVB 3LT3A 3T2NA 3EGHC 3F1SB 1B8QA 2Y7ZA 1D3QB 1ANDA 2ZGXH 3STJA 4NIYA 3RL8A 4B2CA 3FVFB 1X6DA 3KDGA 4NMPA 2ZCHP 4DW2U 1RIWC 2GMTC 5C0UA 2ZGJA 4BXSA 2J94A 1BIOA 1GQ5A 4TSFD 2HNTE 5SGAE 1MAXA 3PMJA 3VG8A 3PMHB 1D6WA 2CS5A 2ZPSA 3I18A 4IBLH 4F55A 5CHAB 4Q6SA 2BOKA 4KELA 3BTKE 4ASHA 3HVQC 4MVNA 4I8JA 3TVJB 1O3GA 5L2YH 1O2XA 3PV5A 4E35A 1HAPH 1HJAB 2I6VA 1V5LA 2CF8H 1C1SA 1VKYA 1XMNB 1YF4A 2G5NA 3T28A 5HFFA 2K1ZA 2JDID 1FC9A 3GABA 1AE8H 2R2MB 4ABDA 2PKAB 4CR9A 4JOFA 2F9BH 3E8LA 2NU1E 1L6OA 3ESTA 5F03A 2HLCA 1FY8E 2Y5GA 1AFQB 2W26A 3GCTG 1DITH 2BVSH 3SFJA 1J17T 2O9QA 2STAE 1NRQH 1TGCA 1MZAA 5A2PA 3ZIAD 2A32A 2OPGA 2ZTXA 4Y76A 2KQFA 4JZFH 4WYTA 1GCDA 8GCHG 4K2YA 4YLQH 1E38B 5EPYA 3R0HA 4ZAEA 3HGNA 2QBWA 1TFXA 1ABIH 5ESBA 5DP9A 2ZTYA 4TPYA 2FESH 4FVBA 1LQEA 2XYAA 5ETXA 5HIYA 4K1TA 4AFUA 4H42U 3UR9A 5F8ZA 1QY6A 4DT4A 3U98H 1BZXE 3DT0H 2P93A 3GSLA 5DP7A 3T26A 3F9EA 1BOQA 4FXGH 3MTYA 2BDGA 1C5LH 1P8VC 4A1XA 1A5GH 2QYIA 2C8ZB 3RXRA 2EDVA 1ORFA 1JMOH 1O37A 2KM0A 4HI3A 2ZA5A 1DDJA 1P09A 1KXBA 4UDWH 2XBYA 2OP9A 1CHGA 5GPIB 5L2ZH 2OSGA 1QB1A 3D62A 1G3DA 3OEHD 2GZ8A 1IAUA 2HVYB 2DLUA 1LHDH 1ELGA 2EQNA 2GZVA 1L4ZA 1SR5C 2GDDA 3HPTB 2AERH 1EB1H 2JH6D 2VWOA 4MQAA 2GJGA 2LP6A 4FUEA 1FPCH 1GJ5H 2Z9LA 1DWCH 1O3FA 2A2XH 2BDCA 4ABGA 2VIPA 4GPGA 3DJAA 1UTQA 5C17A 1UTOA 4CREA 3MU8A 1WAYB 2QA9E 1YLCA 2R3UA 4INHA 5E1YA 2GT8A 2D8WA 3RC4A 4ABBA 2LUIA 1KLTA 2OQSA 1NFWA 2GT7A 1DWDH 3RXPA 2I0LA 1IQIA 4FU9A 4MPUA 1CT0E 1SQTA 1ZRKA 4LZ4B 4AX9H 2QF3A 5E6PB 2J4IA 1VZQH 2PKAA 1Y3XA 1BTYA 1O2OA 4CR5A 1WQSA 2W3KA 1DM4B 4DIHH 4TYDA 3RC6A 1FAXA 1KWAA 4X6MA 2HGAA 3KQEA 2FZZA 4FUFA 3U1IB 1MFLA 4WY3A 1O3CA 1DXPA 3RUOA 3QTOH 3OTJE 3UR6A 1DFPA 1VGCC 2BY9X 5AFYH 4AG1A 2WPDD 1P1EA 4OS4A 1FQ3A 1T4UH 3QDZB 1EASA 2PZDA 1J14A 2TBSA 4REYA 2Y82A 3H5CB 4JZEH 2GCTC 1JRTA 2BZ6H 1OWDA 2ZO3H 5IYTA 3SJ9A 3U8RH 2M0VA 3S7HB 3BTTE 2P95A 1HFDA 2AMQA 2W7RA 5EQSA 4Q2KA 1HGTH 3S9CA 4H11A 3SHWA 2XWBI 4NMQA 3DSGA 3H7TA 1V2RT 3UNRA 4E7RG 3LPRA 2IPHA 2AMPA 3SU6A 1S84A 2UUFB 2ODQA 3K65B 4HZHA 4WWYA 5ABWA 3OX7U 1UVUH 2C90B 2M10A 2ZDMA 3BEIB 3F2GA 3F3BA 3KQBA 4WJG2 5G4BA 3TPIZ 3TJNA 2ZEBA 1BA8B 1XKBC 1Q3OA 2FE5A 1KIGH 3WWFA 3AAVA 1QZ8A 1T31A 4BAMB 1SHHB 3TIUA 4MDSA 4UFGH 5HMAA 3QTVH 1BTWA 1WH1A 3O5NA 4FUDA 5DPAA 4ZMAH 1DVAH 2H2BA 2TGPZ 3NRLA 2Y6TA 1GDNA 1S5SA 5LPFA 1K32A 2C4FH 3WW7A 4Q63A 4U32A 2HPPH 1T8OA 1HJ9A 2BY6X 3KQDA 3TGJE 2KX4A 3HK3B 3RXOA 4DIIH 3HATH 1N1LA 5EXMA 1P05A 2FTMA 4UU6A 3A8DA 1VCQA 1SOTA 1RTLA 3SNEA 2RA0A 1ESTA 1QBOA 2JETC 3SUEA 1WQVH 1UM7A 2BD5A 4NNLA 3A87A 2L4TA 2BDHA 4I33A 5KEDA 3ZZ9A 4XDEA 1OWIA 1UTLM 4ISOA 3RXBA 3ZRTA 4Q3HA 4X6NA 2OC0A 4DJZB 3M5MA 2JIZD 1C2IA 2SGPE 3TK5A 3B9FH 1HDTH 1V6BA 3KF2A 4GHQA 5C5OA 3MU4A 1P2NA 3OFND 3TH3H 2J2UA 1WFGA 4DT7B 4MNWA 1G3BA 3EA9A 4TPIZ 1P01A 3M7QA 4FVDA 2WV4A 3RXDA 3URDA 1AFEH 4CRFA 1QAVB 1TRNA 2BD3A 3E1XB 4XSKU 3RXTA 1Z6EA 2A0QB 1AD8H 3NGHA 2PGQB 1C2DA 4F4OC 1Z87A 1BT7A 5HEBA 4AB8A 1DXWA 1WCZA 3VFEA 4NWKA 1F2SE 1BRUP 2ANMH 2GP9B 2Z9IA 1HYLA 3RL7A 3BG4C 1V2KT 1H8HD 4B73A 2QC2A 1ZSKA 1ESAA 1ABJH 1TQ0B 3O8RA 3G01A 2Z3DA 3RXGA 2AWUA 2G5MB 3AW1A 2DAZA 1QL9A 8ESTE 4AOQA 4K78A 2PSXA 5FL7D 1GBFA 1TNKA 1PPZA 5EW2H 4BAQB 2VSVA 2AFQB 4Z0KA 2P8OB 3U1JB 1PQ5A 3GY6A 2DE8A 2PW8H 3P8GA 4RT1A 3SHCH 1W14U 1GJ4H 5HYOA 4DY7B 2C3SA 3PYHA 1E37B 1O34A 4FGMA 2A1DB 4KKDA 2STBE 1F5RA 3MOCA 2M0UA 1WHDA 1B5GH 1THRH 3A7VA 1ZR0A 4L8NA 4O97A 1Z6JH 5KECA 3JXTA 1O2YA 3ZZ7A 1TPSA 5HDYA 2HWLB 3HK6B 3WKMA 4AN7A 1MTSA 1ELTA 1O5BB 4ISHH 4ABFA 3LGYA 1O36A 5GIBA 2QT5A 1K1OA 1O3BA 1ZLRA 2R0LA 3KHVA 1F5KU 4ZKSU 3QO6A 3PTBA 2NU2E 1EKBB 2PLXA 1BFEA 2FOGA 1GHXH 2W3IA 4RKOB 2PR3A 1L4DA 1UJDA 3SBKA 2PKUA 1Y5UT 3LGTA 4X2YA 1WOFA 2YUYA 1OP8A 2F9NA 2AYWA 3ZZ8A 1G2MA 4B74A 3B23B 1YCPK 4UONA 1ZTJA 1ZHRA 4WH8A 1DOJA 1MCTA 3WWBA 3LONA 2K1QA 3SJKA 1LVOA 1VR1H 1LO6A 4MPXA 1BMLA 3RMOH 3BIVH 1FXYA 1G37A 2BY8X 4D7FA 4BOHA 3M3SA 3O46A 3VQFA 3BTHE 5AVDA 1GJBB 2XBVA 2LNCA 3TJVA 1WTHD 1QR3E 1TLDA 5DKMA 1LPGB 1Q31A 1F7ZA 2G4TA 1ELCA 3H7OA 3LDXH 1UF1A 5HFCA 1W13U 1QAVA 5BPEA 1PPEE 1A0HB 1BTPA 3F9FA 2PV9B 1EPTB 1GI6A 3A7YA 1BUIA 2REYA 1W0JD 4NSYA 1VB7A 1H8IH 3GCHC 3O8BA 4QT8C 4GAWA 1MTNC 1GM1A 1F92A 1PPCE 2JWEA 2QF5A 1FDPA 4X6PA 2H3MA 5DP4A 3KZEA 1GBHA 4N6XA 1K1NA 1MU8B 2CGAA 3PLKA 3NZIA 1WF7A 1PPBH 2J38A 2OUAA 1C5TA 1D4PB 3PV4A 3SOEA 1N6YA 2GDEH 3CC0A 1IQEA 1HUTH 3TJOA 1QTFA 3TH2H 2HPQH 5DP5A 4BAOB 2EDZA 1G30B 1QLCA 2FWWA 1ZPBA 4E06H 2A4RA 2ASUB 3GY2A 2KPLA 4CH2B 1SGIB 1ELEE 1MKXK 1NRRH 1YWUA 2GCHF 5C0TA 2LOBA 3M35A 2EI6A 4WF8A 2Z17A 5JBCS 3TNSA 1TGBA 1DLKB 1T7CA 3K50A 2GZ9A 3NCVA 1K1IA 2GCHG 4K72A 2A5AA 2BYAX 3QLPH 1TWXB 4OS6A 3U9AH 3RU4T 3PB1E 7ESTE 1NN6A 5FHTA 3MO9A 1CVWH 1NFYA 4Y8ZA 2F5YA 3TK6A 5I7ZA 1O2MA 4Q2OA 1FIWA 2KJDA 4WMEA 1HB0B 4NXQA 4Y6DA 1ZHPA 5E0HA 1GI1A 2ZGCA 4FUIA 4F48B 4X1RU 1QL8A 2RDEA 3V13A 3ZZCA 4AB9A 3RXHA 5E21A 2TRMA 1W12U 2D2DA 1MKWH 1GWAA 3P70B 2A5IA 1CGHA 1GDUA 4I8LA 3RXKA 4ASUD 1UK2A 2WPLS 3FZDA 4XBBA 5HF1A 1IOEA 1O3LA 3SI3H 4AG2A 2AIPA 2O8LA 3VGCB 5G1EA 1TMUH 3LIWA 1N6EA 1UK3A 2PKSC 3BEFB 2VGCC 3GGEA 1P3CA 2KAIB 2Y81A 3GS9A 1DICA 1O2TA 1QB6A 4NXRA 1OZIA 2E7KA 1KXDA 2JXOA 4OS1A 4ACBA 1KTSB 2DE9A 1EPTA 1V2WT 2QN5T 2O8MA 6CHAB 1B0FA 3QJNA 1OKXA 2DLSA 1G9IE 2H6MA 1CA0B 1HAVB 1TP5A 1ETSH 1TRMA 1C1PA 3GYLB 1ANEA 1GJCB 1QJ7B 2ZECA 2BD4A 3UIRA 5AF9H 4Y7BA 2YOLA 3ID1A 1AY6H 3E6PH 3K6YA 5FX5A 1SGCA 3QJMA 4U30A 2ZDVH 2Z9GA 4CBNA 3ZYEA 2P3TB 1KYNA 3UY9A 2EAQA 4JOHA 1U6QA 3U69H 5GWZA 1WJLA 1QAUA 3EDXB 3JZ1B 4JOEA 2L74A 1V2UT 2BDIA 1P9UA 3SI4H 4H4FA 1MUEB 1TPOA 3DHKH 1K1MA 4XD7D 2XCFA 1RZXA 1OBXA 1T8NA 1QHRB 1DWBH 3E16B 5DO4H 3MWIU 2QF4A 1Y3UA 1XXFA 2ILNA 1NFUA 5FPSA 4KP0A 4JOGA 1TPAE 2FOEA 2VIQA 2Y5HA 1T8MA 5HEDA 2ZFRH 3MNXA 1BMNH 2ZPRA 4YOGA 3KHFA 2ZI2H 4OEOA 1ELAA 2BB4A 2WPJS 1TIOA 5ILBA 3K6ZA 4FETA 4I8KA 3A7XA 1XUGA 2PP6A 4FOUC 4JOPA 3HKIB 2WINI 1CBWB 1ELVA 3FY5A 1UCYE 2ANYA 2V3OH 3BTDE 3KCGH 4RN6A 2G52A 1SQOA 4U2WA 4YESB 1THPB 1Z86A 2I1NA 3F6UH 3BIUH 2ZHQH 1AWHB 1P04A 2B5TB 2V3HH 3EGKH 2IOTA 2EC9H 5EPNA 1GJAB 4F8KA 2ZDAH 1S6HA 1NRSH 3MH6A 1VJ6A 2H2ZA 4MNYA 1ARCA 1BMAA 5JB9S 3LC5A 1GCTB 3W94A 1FI8A 1AB9B 1SGFG 1NFXA 3MH4A 2KAIA 4YT6H 1TX6A 5FPTA 3A7ZA 5EXNA 5KGOA 3CBZA 1WIFA 5CHAC 1V2QT 1WXRA 3NKKA 3P6ZB 4P00A 4IMZA 3LGVA 3MU5A 2P59A 1C5SA 4UEHH 4Z8JA 1SKYE 4VGCB 2KR7A 3VPKA 1HJAC 3C27B 3RP2A 2JSNA 4ISIH 3K82A 2XC4A 1HAVA 3BTGE 3MO3A 2FDAA 1DUAA 1ZTKA 2F91A 2OC1A 1KSNA 1GHAF 3S7KB 4AFZA 1IQHA 1CU1A 4DURA 4OS7A 1BE9A 1MFGA 1Z1IA 1V2JT 2SGAA 4K5ZA 2PSYA 1VCWA 3FP6E 2AGGX 3M5NA 5HM9A 4ABHA 2ENOA 1GHAG 1AFQC 2JINA 2Y5FA 4AGJA 5E0GA 3L4FD 2ZCLP 2GZ7A 2A4GA 4X2WA 2C8WB 3P8OA 1Q3XA 1XKAC 2J98B 5C20A 1DS2E 1S81A 3UREA 2VWMA 1LPZB 5JXBA 3I29A 4NIXA 1E35B 1LCYA 1DPOA 3C1KA 5EW1H 1T4VH 2BY5X 3ZVCA 1O2GH 1N7TA 1BBRE 3A8BA 2ALVA 5CHBA 4JYUH 1QIXB 1IQGA 2AH4X 4NA7A 3CBYA 5F67A 1JIMA 3QZRA 4I86A 1D3PB 5A0AE 4K6YA 1UFXA 3RXQA 1IQNA 2A7CA 1HRTH 2F9OA 1UTMA 1TGSZ 3DIWA 3L6PA 3RMNH 1MTWA 4ZHLU 5GDSH 4Y10E 5PTPA 1OWEA 4OS2A 3T25A 2D8IA 3GCNA 2I4SA 1FJSA 5T3HA 2BM2A 1W8BH 1SGDE 1H9HE 2P3WA 3UOUA 1FAKH 1YPGH 3W95A 1QURH 2OZFA 5DK1A 2H5CA 5EYZA 3GDVA 3ZV9A 3SUGA 3QN7A 2P16A 4ZUHA 5C3NA 3UTUH 3I77A 4XE4A 4FUGA 1XM1A 3GCTF 2EEKA 2GVFA 2XW9A 2ZCKP 2Y80A 4GLYA 4SGAE 3GYMA 1HCGA 2MHOA 4JJ3A 1LTOA 1SI5H 2F9VA 1FN6A 2VVVA 2Q6DA 3TMHA 2CF9H 1MAYA 1GHZA 2JILA 2FPZA 5CMXH 4BTUB 8GCHF 1QFKH 4OEPA 5A0CA 1EZUC 1GHVH 3E17A 1N8OB 1OWJA 4E05H 3A80A 5L30H 3A8AA 3CS7A 2AGIX 4R0IA 2WV9A 2CN0H 2XBXA 3PRDA 2YNBA 4UD9H 1X5RA 1UJVA 2J9NA 2OINA 3MYWA 3GJ9A 1P2MA 2EY4C 1CT4E 3ZZ6A 2QF0A 2L97A 4IS5A 3DD2H 4DOQA 4ABJA 1SFIA 2J98A 2O8TA 2FNEA 1K2I1 2QXHA 3E0NB 1O5FH 2QXJA 2ZP0H 1WSSH 4YXWD 1YC0A 2HOBA 1SGEE 5EQQA 2BVRH 1EAIA 2QXGA 3RXSA 2PHBA 2Z94A 2VRFA 1TYNA 1SMFE 3PRBA 5EODA 1ZGVA 1O3KA 1N99A 1ZTLA 1ELBA 4MG3A 4ACAA 2FI5E 2BOHB 1K22H 2GD4B 2NWNA 3KZDA 3MNBA 3QZQA 1TAWA 4I31A 1ZMJA 3UQOA 2VNTA 1UEPA 2LC7A 1IU2A 3RMLH 2Z9KA 1CT2E 2UWOA 2KFWA 1ZGIA 4WXVA 2ZFQH 2XNIA 3BPUA 1OWKA 4Y7AA 2G8TA 1BITA 2GGVB 1WDIA 1P2QA 1PJPA 2QKUA 5ESTE 2ZKSA 2Q9VA 3AVZA 1HAYB 2RDLA 2ZPMA 5GJ4B 1MABB 3TSZA 4YTAA 1GDQA 2QGRA 3UFAA 3ID4A 3LOXA 3A86A 3ELAH 4NFFA 4B2AA 1P06A 2BYGA 1J8AA 4J1YA 2Z3CA 2L4SA 1O32A 3SZNA 4FU7A 4MNXA 1V5QA 1VA8A 1GHBG 1GBKA 1IQLA 3HKJB 1HIAB 3GOVB 4OGXA 3RXCA 4AFSA 1DSTA 1ZPCA 3OEED 4JYTA 4MTBA 1LKAA 1VJ9U 4Q4LA 5D13A 2FX6A 4LMMA 4MPVA 5FAHA 3F0PA 3L3TA 1SLVB 2PWXA 1QBVH 5LPEA 3BTEE 2KBSA 2QKVA 2H3LA 5DP3A 1MBQA 2HLDD 3PWCA 5A8ZA 1C5UA 1XUFA 2ZHWH 2FEQH 1TNHA 3E0PB 2HGTH 3T62A 2W7SA 3SV7A 3S0NA 1GBAA 1C2FA 1W11U 2KOMA 1HXEH 2EEIA 1AQ7A 1DX5M 1AGJA 1MTUA 1QL7A 1S83A 3ZVFA 1G32B 1FIZA 2OMJA 3SHUA 1RGRA 3VB5A 2J5UA 1XZ9A 1DY8A 3KYGA 4ABEA 1TABE 1AUJA 1SGYE 2CSJA 2WUCA 2VIOA 1BJUA 5F8XA 1QRZA 3LKWA 1O2QA 1VITH 2DMZA 1F5LA 2VIDA 3PS4A 1U39A 3LJJA 4JJ0A 1V2LT 2VH0A 1P57B 1CO7E 1AVGH 1K9OE 2EI8A 2H1UA 4DVAU 3DSOA 3IWMA 3AXAA 1SGPE 1O5AB 4Z1MD 2HE2A 4RT0A 2K0QA 3SUZA 5A8YA 4I8HA 2A5KA 2JREA 1C1QA 2NU0E 2P8OC 1P1DA 1P9SA 2P3UB 1SQAA 5DTHA 1CA8B 2V7QD 4HGCA 4NA9H 2IWNA 3ZVAA 3P17H 5DGJA 1OX1A 3PDZA 1GJ7B 2VSPA 5HFBA 1DWEH 1SL3A 2XCNA 4CHAB 1GVLA 4MPWA 4UFEH 1EOLA 1WYKA 1EP6A 1O3IA 2Q6FA 4CBOA 4KFWA 3SN8A 1CGJE 2G55A 2BQ7B 3A83A 1I92A 1HIAA 4K75A 3QE1A 2ANKH 3QK1A 1SSXA 1AZZA 2ZPLA 2D26C 3ATIA 4LXBH 1U3BA 2FYQA 5DJ7A 1EAXA 4K8YA 3E3TA 4FUCA 1ZPZA 3LGWA 5EG4A 3I1EA 1SFQB 1AMHA 3DJ1A 4K1EA 2V0BA 3LH3A 2ZU4A 2FXRA 2YT7A 2BD9A 1MKWK 3PMAB 2G2LA 4ZHAA 1L1JA 3SW2B 2AGEX 3ZVEA 2YMSB 1O3EA 2ZC9H 1A61H 3N7EA 1GG6B 1Z7KA 2RRMA 1PPHE 3NK8A 5DSFA 1U37A 1IHJA 4K1SA 1C9PA 1W7GH 4NNMA 3LC3A 2VBCA 2PTCE 1MD7A 1KLJH 1C1NA 1J9CH 3RLYH 3SORA 1NESE 4TWWA 4FUHA 5E8EH 1EPTC 2ZFFH 2UUKB 1FONA 3ZZ5A 1Q3PA 2PFEA 1X5NA 4X2VA 3RXFA 1BCUH 2V3MA 4AYYB 4ZXXH 1D3TB 1O5EH 2XC5A 3B8JA 4IC5A 1SLUB 1UCYH 4WMDA 2KJKA 4NIWA 1BTUA 1H8DH 3SQHE 4M9FA 1SVPA 4A5TS 1IHTH 2J34A 1UEZA 4B2BA 2C8YB 3KQCA 4XRNA 1DE7H 3K9XB 3K2UA 1FX0B 4LZ1H 4DGJA 1VAEA 1PFXC 1FZZA 1G3CA 1TGTA 3OY5U 2SNWA 3SU4A 4J2YB 1MZDA 2OD3B 4ZKNU 2RCZA 3S69A 3EE7A 1T2MA 1EXFA 1OSSA 1AHTH 1JRSA 1UHBB 1Y3VA 2KCPA 5F53A 4NSVA 4K76A 2BHGA 3FP8E 2VJ1A 4K69A 1ANCA 1C4U2 1L1NA 3MU0A 1IU0A 1TGNA 2J97A 2M0ZA 3FKSD 3MH7A 1ELFA 2ZFSA 2V6NA 2JH0D 1QJ1B 2CMYA 5EGMA 3RC5A 1P0SH 3BTME 1XUHA 2QXIA 1WG6A 2WYJA 3LH1A 3NUMA 1MMJN 4B71A 1TMBH 1NPMA 2KRGA 4AGKA 3ZZAA 3M36A 3QX5H 3TJUA 2UWLA 2ZGBH 3T29A 1EZQA 2WL7A 5HXFA 1M9UA 1TOCB 1GMHF 2IN2A 2GV7A 1ZSJA 1HV7A 1KY9A 1LVYA 1O0DH 2ZU3A 3VGCC 1NTPA 3STIA 1GMHG 1NU9A 2R0KA 5IK2D 1QNJA 2ZQ1A 3BV9B 3KL6A 2YNAA 2HNTF 1BBRH 2ZIQH 3ATWA 1ETRH 4OS5A 1GI8B 5EQRA 5TJXA 1JXPA 3SJOA 3UQVA 3ATMA 1UVSH 1K1PA 6CHAC 3B76A 3E90B 4THNH 1IQFA 4ZXYH 3BTQE 1WFVA 1CGIE 4NXPA 1SG8B 2KZ4A 4NWLA 3ZYDA 5B6LA 3FN8A 1CA0C 1GI3A 4R8TB 1Y5BT 1GVZA 2OK5A 4DG4A 1O39A 2XBWA 2HE4A 5H3JA 4NMOA 4X2XA 1D9IA 2H9HA 3I4WA 3T27A 3DA9B 3KQ5A 1P2JA 4UFFH 2CJIA 2KCOA 2UUYA 5FXLA 3SV2H 1ZMLA 1P10A 3TSVA 4YDPA 3OSYA 1C2LA 2JKHA 3Q77A 3PM3A 3NFLA 2XWAA 1M5ZA 4E3BA 1EOJA 2BLOA 3A82A 4A1VA 2OCSA 7GCHF 4INLA 3K1RA 4WXIA 1C5RA 1UM1A 2AIQA 3Q3YA 1C5VA 1BQYA 3M5OA 2BDBA 1UHBA 1OBZA 4B6FA 4B75A 7GCHG 4NGAH 2PKTA 1QRWA 3ZVGA 3SZEA 1GQ4A 1O3AA 2GTBA 1BB0B 1V2PT 1AO5A 1WV7H 3SGBE 1GL0E 3EGGC 1Y8TA 1HXFH 1CBWC 1W3CA 4CRCA 3NWUA 4RKJB 1SBWA 4B6EA 2ULLA 4O3UA 2FP7B 3GY8A 2FOBA 1BRCE 1S82A 3CP7A 3DFJA 1FC6A 1N7FA 3QUMP 1O2VA 2UZCA 1CQQA 4F49A 1UJUA 1XUKA 2NU3E 1S0QA 4HTCH 2EEHA 4BTTB 2TPIZ 1PQAA 1EUFA 4P0CA 1SB1H 1RGWA 1GI5A 1GMDF 2VZ5A 4I7YH 5F6MA 1KXFA 1GCTC 1OP2A 1AB9C 4M7GA 2BLVA 4KGAA 1H1BA 1MH0A 2FOMB 1GMDG 1SGNE 3SV6A 2G00A 2G81E 4IC6A 1IQMA 2QE7D 2RCEA 3ODFA 4JORA 2M5TA 3SO3A 1EJMA 3U8TH 3QGNB 2QKTA 3EA7A 4WH6A 1GI7B 4NG9H 5FBIA 2VVCA 2GV6A 4VGCC 4KTUA 2FCFA 2GKVE 1P11E 3FFGA 3DFLA 4MNVA 5J4QA 4UE7H 3V7TA 1ESBA 2A2QH 2HALA 3F9GA 1RTKA 4UU5A 1YBOA 1MQ6A 3O8DA 4ESTE 3KYFA 1Y3WA 2BXUH 9LPRA 3PWBA 1O2RA 1Y5AT 2DJTA 2FI4E 2CHAB 1W9EA 3F68H 4JYVH 1MC7A 1O3MA 1Z8RA 4Q7ZA 1HAOH 4OAJA 4FU8A 2Q1JA 3LGIA 2FOCA 1GGDB 5DP6A 1YP9A 2OBOA 1QBNA 2LC6A 1E0FD 1KXEA 2LPRA 2OC8A 1C1RA 2CK3D 2ZDKA 3BN9A 4A92A 1BMFD 1VJAU 2J95A 1BRBE 4MLFB 1PPFE 3V3MA 1O3JA 1GI4A 3LGUA 2FOHA 1FC7A 9ESTA 1T8LA 1K1LA 2TGDA 1YPEH 3BEUA 4YT7H 1DUEA 1K0HA 1FLEE 3RLWH 3RM0H 1BDAA 3VXFH 4NA8A 1GPZA 3MU1A 2JH5D 1AI8H 1HPGA 1UTNA 3ATLA 3BSQA 4AORA 1KMHB 4INKA 5TCCA 4E7NA 4P02A 2LA8A 1XX9A 2C8XB 4AFQA 4RI0A 5IL9A 3SU1A 2W6JD 4KTSA 1NRNH 2ZNKH 4FUJA 2ODYB 3D65E 3OTPA 1O38A 4YM9A 1O3OA 4O9VA 2ESTE 1AU8A 1F0TA 1C1OA 2WPKS 3UB0A 1C2EA 1O33A 2KV8A 4Q2QA 3CNRA 1RY4A 4JOKA 4TWYA 3SGQE 3U8OH 2BY7X 2V90A 1V2MT 2LELA 2Y7XA 2X7ZA 3SU3A 3M37A 3R3GB 3D49H 4LK4A 2OS6A 2AHME 3SU5A 2F3CE 1A46H 2Z3EA 1A0JA 5JPMH 1A2CH 1WBGB 3PLPA 1Y3YA 1NROH 1COWD 3N7OA 1OWHA 2EGNA 4GHTA 4CH8B 1TNJA 1ZYOA 2QAAA 2ZU5A 1KXAA 1EQ9A 3FO8D 1ZHMA 1O2LA 3EA8A 4JCNA 1DY9A 1V1TA 2PDZA 4Z33A 1N8OC 1YBWA 2J92A 2FODA 4Q7YA 1C2HA 3OU0A 3ZZ4A 1C2KA 1CHOF 2A31A 2DUCA 3KDKA 1MU6B 4NFEA 4X0WU 1A7SA 1TP3A 5E0JA 1CHOG 5AFZH 4R2ZA 1O3NA 4GVUA 2JIKA 3AASA 3F0OA 5C1XA 1XUIA 4TY6A 1W9OA 2OBQA 1UK4A 1E1QD 2P3FH 1TBQH 3ZZBA 4SGBE 5CDFE 1A5IA 1EJNA 1NY22 1QCPA 5H4IB 3RLEA 2KL1A 3F9HA 4YOIA 5LGOA 3WKLA 2VH6A 1GI0A 1GL1A 1O5GH 4I8GA 1HAXB 1SGRE 1IQKA 1ZSLA 2HRVA 1E34B 4ZKRU 1G2LA 2SGDE 3PO1B 4XHVA 3ZVDA 1CSOE 2WZQA 3GY4A 4CRGA 1AVWA 3SGAE 3TITA 1E36B 1H4WA 5EJZA 1QA7A 1RS0A 5A0BA 5F3XA 2KOJA 4HOPB 1J15A 1TA2A 1UW7A 1NTEA 3Q3KA 2UWPA 4IN2A 1GBDA 1WF8A 5C2ZA 3DSPA 3H09A 1TQ7B 3UPEA 3DCLA 1YM0A 3BTFE 1JWTA 4ZHMU 3GDSA 4GVCA 3T5FH 2KCYA 1N6FA 2Q3GA 3SU0A 3GCOA 1D6RA 3P95A 2R3YA 3SUFA 2O8WA 4JZDH 1S6LA 3RXJA 4XOJA 2EHRA 3LU9B 1U38A 4NZQA 1HAHH 1L1GA 2F9PA 5IDKA 3PLBA 3JZ2B 5GLJA 2WPIS 2ANWA 4P2AB 5FCRA 2EEGA 1V2ST 2A7HA 6GCHF 2SGQE 3A84A 7LPRA 1C1VH 1DSUA 4YLUA 4AC9A 2FX4A 1GBJA 1S0RA 2IPQX 5T6DA 1UO6A 4MPAA 2IJD1 1UEQA 6GCHG 1O2PA 2A45B 4NMRA 3P92A 3EE0B 3WY8A 1O2ZA 2BMGB 2F43B 3DORA 1GJ9B 5EJ1A 2IWPA 2JJ2D 3PTNA 4NMSA 1J16A 1W10U 3TLOA 3O8CA 4FLNA 2PGBB 1ID5H 4Q2PA 5I46H 1X7AC 1QGFA 2FI3E 1YKTA 2XTTB 1DANH 3LNXA 5B42A
chains in the Genus database with same CATH topology
2H5DA 3EAJA 4Y0YE 3SQEE 3CYYA 3SNBA 4U01A 1WHAA 2AWWA 1YCPM 3ZVBA 4E34A 2G5VA 3RMMH 1UCYK 1UMAH 1RIWB 2GMTB 1Q7XA 1B0EA 2BQ6B 2I04A 2F83A 2FTLE 1UVOA 2BDYA 1BTXA 3SV9A 3A88A 2ZGHA 2EA3A 3CS0A 1TE0A 1WU1A 2NU4E 1MD8A 1SGQE 1WTGH 1OYTH 5C5NA 4ABAA 2ZDNA 2AMDA 5JYIA 4KTCA 2O8UA 1GHBF 1YGCH 1C5XB 3AW0A 3ITIA 3DUXH 2H2CA 1G9OA 4X8VH 5E11A 1ZOMA 3GY5A 4HOPA 3M5LA 3UWIA 1MQ5A 4BXWA 2O2TA 1BHXF 1AE5A 4BAKB 4CHAC 2EI7A 2PA1A 1P02A 2A7JA 4Q80A 4XBDA 4Y79A 1FN8A 4NMVA 3RXVA 2VWLA 5EU8A 2VWNA 1H9IE 1W2KH 3PV2A 3MFJA 3MNSA 5FBEA 2BTCE 4Q6HA 4A6LA 1VITF 1WI4A 2BLQA 1C1MA 1DT2A 1C4Y2 1TNIA 1KXCA 2SGEE 3FAOA 3PDVA 1GJDB 1FY4A 3SOSA 1UTKA 2FLBH 1VITG 3BTWE 3PROA 1X9ZA 3RDZA 1UITA 1W0YH 4X1SU 1WUNH 3QGLA 5LPRA 4IW4E 4X1NU 1GG6C 2P94A 4D8NA 2FIRH 1ZOKA 5BRRE 1FPHH 2DB5A 1ANBA 2HVXA 1EX3A 3M7UA 2KA9A 1BBRK 2VB0A 1FY5A 1RTFB 1YPLH 3A89A 2FM2A 5C1YA 2ZFPH 2BDAA 4X6OA 4Y8XA 5JB8S 1A1RA 1LPKB 3S9BA 1CE5A 5EXLA 2KJPA 5JDUB 1GBIA 2RG3A 1NC6A 2M3MA 4Q2NA 5GXPA 2QG1A 4GVDA 2AINA 7KMEH 1OBYA 4I32A 1FY3A 4ZROA 1Q2WA 1YPHC 3BF6H 2B0FA 5F8TA 5DG6A 2VINA 1RGQA 1THSH 2WUBA 1OXGA 1SPJA 3KNXA 1C5ZB 5K7RA 2QCYA 2QV1A 4RSPA 6ESTA 5HFDA 3M61U 4UFDH 4YOJA 3R69A 3UWJH 3R68A 1TX8A 1P2KA 5G1DA 1GBMA 1X5QA 1S85A 5HM2A 3ZZDA 2FMJA 1C1UH 1GBCA 4X8TH 1YLDA 1INCA 2BZAA 3P8NA 3VXEH 3TH4H 1GBBA 2FOFA 2JOAA 4OGYA 2BD7A 3VEQB 4WYUA 1LVMA 1BTHH 1BJVA 4AMHA 3HPKA 4CRBA 3QWCH 4O03A 1V2VT 1Z8JB 2FLRH 1D5GA 1AZ8A 3VQGA 1PYTC 4X8UH 3SUDA 1I16A 1FV9A 4ISLA 2EDPA 2YT8A 1VGCB 2XXLA 2FO9A 1QJ6B 4HFPB 1UVPA 3KEEA 5FPYA 3VB3A 2BD2A 1OP0A 2GCTB 1O2IA 1F0SA 1GI9B 1N6DA 1A3BH 3ATKA 1UJ1A 2EGKA 5B6OA 2AWXA 4KFVA 2BLWA 2UUJB 2BX3A 1FCFA 5JBBS 1NS3A 2G4UA 5C1UA 1C5PA 2CSSA 2OC7A 3TK9A 3GISB 4BTIB 1N6XA 1TOMH 1W7XH 1C2GA 1RJXB 1TONA 1YPHE 4X8SH 1ACBE 3UUZA 1Z8GA 2R9PA 5K0HA 1BTZA 1EATA 1QA0A 1P2OA 3PMBB 1P12E 2ZU1A 4PROA 2PNTA 1SGFA 1F0UA 1IQJA 1V2TT 3FP7E 4Z6AH 1C5NH 2DKRA 1GI2A 1ZJDA 1O2WA 1C2JA 1V6DA 3TNTA 1LKBA 1P2IA 3QGJA 1B7XB 1SHYA 3TSWA 1WI2A 2SNVA 2YUBA 4IN1A 3RXIA 1O35A 1KDQB 1HBTH 1HAIH 3MHWU 5GNDA 1O3PB 3IG6B 3DJ3A 1LQDB 3NPSA