3CSHA

Crystal structure of glutathione transferase pi in complex with the chlorambucil-glutathione conjugate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title The anti-cancer drug chlorambucil as a substrate for the human polymorphic enzyme glutathione transferase P1-1: kinetic properties and crystallographic characterisation of allelic variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3cshA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cshA01
3P8WA 5GAPD 2VLTA 3KCMA 3QD9A 4ECCA 3H4KA 5ID2A 5CREA 2YNXA 5B6NA 5CRWA 3IOSA 1PGTA 3QAGA 2CX3A 3GUSA 5IMCA 3WGXA 4NHWA 1H75A 5H5RA 2JL4A 4ZBBA 2VOCA 3IXRA 2IFQB 4I2TA 2V6KA 2F3MA 3EC3A 3GYKA 1GSYA 3TJBA 2C0DA 4HQZA 2DJ0A 3A3TA 2O85A 2VO4A 5CRDA 4JR4A 1JHBA 2AJQB 1Z9HA 2OKAA 2PVQA 5ABRA 2CZ2A 1KNGA 2K8SA 4EDYA 2GSQA 2V6OA 4E8HA 2B5EA 3TJKA 2GS3A 2M72A 4AJ8A 3H1NA 3PINA 2KHPA 3MNGA 4L0WA 3FR3A 1TI3A 4BWQA 3TDGA 2HSYA 4V1Ap 2PGTA 4GCIA 3TKQA 5ECNB 3TKSA 2VLUA 3DD3A 4D73A 5GZZB 4POBA 3QR6A 5JCWA 1H4OA 3QFAC 4DSSB 1U6TA 2WCIA 3ZTLA 1RK4A 3GA4A 1WOUA 3VWWA 2FCHA 4KSOA 2PPTA 1BG5A 4FYCA 4O32A 5IMVA 1XCCA 1MTCA 2H0HA 4GQFA 4FIWA 4NWYA 1AUCA 4EC0A 1TJDA 2WGRA 2A2SA 1N8JA 2H1GA 1X9SB 4QL7A 2R6KA 1O6JA 1VF1A 4DEJA 1SKSB 4MZWA 4ZB6A 18GSA 2TRXA 5C04A 2RLIA 1B4PA 1GUKA 2VCZA 1B9YC 2HRNA 1VF2A 1B8XA 4GLTA 4CHSA 3I6AA 2F51A 3KGKA 1ZOFA 1Y25A 2H74A 1F6MC 3QAVA 3VI5A 1GSDA 2X99A 3F4TA 4FYBA 3P2AA 5KN3A 1Z3EA 2PWJA 4IGJA 4F03A 1A23A 2C1YA 5DQSA 1FVJA 3C1RA 4Q5FA 3TB2A 1OE7A 4RQRA 4WF4A 2ON5A 1XOAA 3APQA 1X0RA 2YANA 1JZWA 1OKTA 3UAPA 1WE0A 1ST9A 3ZIJA 3LG6A 5DALA 4MPGA 5IMZA 1QK8A 3BOAA 4G2EA 1GLQA 1MDKA 2GVPA 5DAKA 2O89A 1KBNA 2YWMA 2CAIA 1T3BA 4WR5A 1JFUA 1XXUA 2MMNA 4OCFA 4IQ1A 2HZEB 4ZXGA 2O7KA 4ZBDA 2CVDA 2M80A 4MCUA 3APSA 3CXGA 4OO5A 2I4AA 1ILOA 2B7KA 1WWJA 3GMFA 3DWVA 1UN2A 5ECSA 4WEYA 1OYJA 3WT2A 2CA8A 2HRKA 3IK7A 1G7EA 1IYIA 1K0MA 4GSSA 1A2MA 1PQNA 2H1BA 4XCSA 2V1MA 3C1SA 1BYEA 4IS0A 2MMZA 4BA7A 4HU9A 5H5SA 2C3QA 2B5YA 4PNFA 2HXKA 2TRCP 3HA9A 1G6WA 5DCGA 2HLSA 2VAFA 1O73A 2V2GA 2FA8A 4TR1B 2VM1A 5E59A 2C0GA 4G9HA 5IMFA 3VWUA 3HVSA 3BCIA 5D8IA 3FHKA 3IR4A 3ZMLA 3EINA 1TK8B 4DVCA 3US3A 6GSXA 2JSYA 2R4VA 4MPFA 3IA1A 3G7JA 3U5RE 4KA0A 3ZYWA 2WZ9A 4XS4A 5ECOB 4F0BA 3IRAA 1M7TA 1ZZYA 4OWYA 3IPZA 1XVWA 4P3YB 4DSRA 2LUSA 1LU4A 2HT9A 1TRVA 4ZL7A 2RM6A 4OD7A 1DBYA 4PQIA 2B1KA 2JU5A 1EV4A 1R7HA 4FYUA 4G0LA 4EL1A 4L8EA 2C4JA 5KN1A 2H72A 1ZCPA 2WFCA 2LQOA 3O6TA 1X9WB 4Q5QA 5G5FA 4POKA 4WBJA 2GSSA 1NHYA 4TRXA 5FWGA 3DVWA 4LL1B 3CRUA 1TW9A 4GF0A 2IMDA 2DJKA 3GURA 1NW2A 1KEBA 3TKSC 3VURA 1OC3A 2C0EA 2KUCA 1S3CA 2VL2C 4OO4A 4OMVA 1PD21 5F07A 3APOA 1QMVA 3I9V2 1SKRB 3E0UA 1HNCA 1AQVA 2GZYA 4ML6A 5HR3A 1GTAA 1B9XC 4F0CA 5G2ZA 3PGTA 2LRCA 4HZ2A 4HZ4A 1XWAA 3VFIA 1QUWA 4BVYB 5KEJA 1A8LA 2WDUA 1JZRA 2ZUPA 5IPGA 1VF3A 3UVHA 3KZQA 5BMUA 2HRFA 1XVQA 3TKSE 1UC7A 3Q6OA 4IQAA 1BAYA 6GSYA 4TKYA 3QPMA 1WRYA 4MABA 5IMAA 1RQMA 2IMFA 4ECBA 2WJUA 1FB6A 2PUKC 3QMXA 1TRWA 1M2BA 1SD9A 2MMOA 1HNAA 3C7MA 2PVOC 1Z6MA 1GULA 1EP8A 2ES7A 5B8BA 3PR8A 3CTGA 1T1VA 1K0OA 2EIRA 3L9UA 2N5BA 2LTKA 4MH3A 1YDKA 1EV9A 4NAXA 1I5GA 3GKNA 4GQCA 5IMDA 4MF6A 2H66A 1GSSA 1THXA 2QKEA 3IE3A 4KH7A 1YF1A 2FY6A 2IMEA 2DJ2A 4XS1A 3W8JA 2XPEA 3IC8A 1Q4JA 4IVFA 2E0QA 2A4VA 5F8BA 2CAQA 3UL3A 1K3LA 1QQ2A 7GSSA 5B6MA 1PX7A 1GP1A 1QXHA 3WGEA 3DIEA 1OKDA 4KDUA 4MDCA 4WKWA 1WMJA 1YY7A 3TCOA 2KLXA 3A2VA 3TKPA 4V2LA 1K3YA 4TOPA 3UMAA 5J41A 1VRSD 1FO5A 3EVIA 2I3YA 4KUNA 1X9MB 4BL7B 3N9JA 1BEDA 3R3EA 1U87A 4K2DA 3GKXA 1O8WA 1DSBA 3D22A 2G2QA 3EYTA 3HZ8A 1A2JA 1TKDB 3P7XA 5GAND 3H8QA 4K7OA 5ELAA 5ECMB 3EU3A 2LKUA 1M0UA 1J08A 1F3BA 2MZCA 4LLRA 3RBTA 4BVXA 2CQ9A 1WIKA 2AAWA 2FWGA 4TXOB 3WD6A 4X1UA 1X5CA 4MJAA 2IWTA 2X8HA 3M8NA 2HRAA 5D9TA 1PKWA 3BD2A 5ECPB 1TXXA 1EEMA 2C80A 3I69A 4MA9A 1XWBA 2KOKA 5DALB 1SKWB 2PU9C 5AIXA 2BTOT 2LNTA 2DC5A 5IO0A 4HJ2A 2K18A 1XWKA 3EU4A 2GGTA 3UJ1A 4V1Ag 3KMNA 2OJLA 3QAWA 5AISA 4AF2A 3RAZA 4N30A 4PNGA 2YCDA 1K0DA 4WF5A 3H79A 2K8VA 2CV4A 4ML1A 1O8XA 3GL5A 2YP6A 1XZOA 1RW1A 1PMTA 8GSSA 3G7IA 5IOXA 2WULA 3VLNA 2N5FA 2N5AA 2YWNA 1SL0B 5C00A 2XPDA 3BBYA 3FYGA 1U3IA 1EWXA 5KN2A 1DUGA 2ZCTA 2GQMA 5HFGA 1QFNA 3NZNA 2PBJA 1TDIA 4XIHA 3IK9A 2C8UA 1A24A 1PL2A 3GTUB 2LJKA 4PQ1A 2ALBA 2L57A 2UZ8A 2FWHA 5D9XA 2KP1A 2REMA 5G1KA 2WRTA 6GSSA 4MJBA 5JWRB 3D21A 2CT6A 1X5DA 1BJXA 3HKRA 4V2MA 2FNOA 2P5QA 2C3TA 2F8AA 4N11A 2VL3A 2VLVA 2JSZA 1GTIA 3NOFA 5F06A 2H0GA 2YWOA 1V40A 4MH2A 1OE8A 4MZBA 4ACSA 3FY7A 3EURA 4JBBA 4TVEA 4TR0A 3BJ5A 4MP4A 2L4QA 4EUYA 2H0IA 1R4WA 1HD2A 4JR6A 2LNSA 1JZDA 2GLRA 14GSA 5LNKe 1TI1A 5ENUA 2E2MA 4PX1A 1AXDA 1GTUA 4I97A 3IAS2 2CZ3A 3CSIA 2B6MA 4TR3A 5J3RA 2K9FA 4PXOA 4MJCA 5INYA 2H73A 2X8CA 4CW9A 1V57A 1TRUA 2EC4A 6GSUA 3N5OA 3F3QA 2E7PA 2AYTA 2JADA 3ERFA 4FO5A 3ERWA 11GSA 1V2AA 5ECHB 1G0TA 1YZXA 3ZMKA 4YH2A 1Z7PA 5A4UA 2RM5A 1TOFA 3L9SA 4IP1A 4YQUA 1WJKA 4MLYA 4TW5A 2IFQA 4RQXA 2NDOA 2MYGA 2AB6A 4JE1A 2OBKA 4E8EA 4JEDA 4I5QA 2I81A 5J9BA 5A4VA 2VCXA 3ISOA 1A0RP 5A5KA 10GSA 1EGOA 1NHOA 3O3TA 1XW6A 3DXBA 4K0GA 1AQXA 5GSSA 1CQHA 3L9VA 1AC1A 1FB0A 3TKRA 3LXTA 3MSZA 1GWCA 2X64A 3F0IA 1LJRA 1PSQA 1YEXA 3LORA 3KXOA 3WGDA 3R2QA 1HQOA 5ECQB 3F9UA 3HCZA 1FW1A 1AW9A 4MF7A 1G6YA 1EOGA 5AIVA 2PERA 5G5EA 2MBTA 2GT6A 1GNWA 3KM6A 3TRQA 19GSA 1O85A 3HJPA 5ECKB 1M2AA 1SJ6A 4HS1A 2YPMA 4H86A 1MEKA 2HSMB 2J23A 4CDOA 1VF4A 3GKMA 3ED3A 2V41A 1PKZA 1T00A 2VCQA 5D9VA 5COHA 3WYWA 1SYRA 2L59A 3TJFA 4KAEA 1SJIA 3LSZA 3GL3A 4O5RA 2PMTA 3A2WA 5HR0A 3FK8A 3UBKA 1EZKA 3DYRA 1NSWA 5EL8A 5DCHA 1YKCA 4K7IA 16GSA 4IN0A 2DIYA 1T8EB 3GFKA 5D9WA 3UARA 2V32A 1K3OA 1XWCA 1ON4A 3GV1A 4XHMA 2DMMA 3ZFLA 1GSEA 2YJHA 2GQLA 1OC9B 2L6CA 2YV9A 4ZB8A 4J2FA 3LYKA 5IO2A 1JLWA 2IMIA 1GL8A 3CSJA 4RI7A 3FRCA 5IOWA 2K6VA 2NPBA 2R37A 1K0NA 1C72A 5DQYA 1FOVA 2HSHA 2HZEA 3HVXA 4GWRA 5ID2B 3CSHA 1F37A 4I2UA 2G0FA 3H93A 2I9HA 4JU5A 1Z7RA 5JWQB 1A8YA 1XW5A 3GH6A 2OA7A 2DSAA 1HYUA 3MWHA 5EY6A 3UBLA 4K1FA 4K7NA 3DEXA 4NV5A 2HQTA 4USSA 1SENA 1X5EA 4WXTA 3C8EA 2DIZA 2WS2A 2OE1A 2VUPA 4GXZA 4G0IA 4ISDA 3FZAA 5B7CA 3FR9A 4TR1A 3HXSA 4HI7A 4YAVA 4IHUA 3W6GA 3PH9A 3GX0A 5CRGA 2LJAA 3L0HA 5G30A 2MMAA 3GKKA 1EGRA 1TU8A 4ZL9A 1SK0A 5IQYA 4D73B 5IIZA 3ZVJA 3D0ZA 1J0FA 3MAKA 1UA5A 3D5JA 4NXIA 3KP8A 4LMWA 1GUMA 2HNLA 5IPHA 3S9FA 4NHZA 2B3SA 3CMIA 3LQ7A 4ID0A 1O81A 1MDIA 1U88A 2YZUA 1GNEA 1ERTA 2GT5A 2FUG2 4F2IA 5CAXA 3ME8A 1YF0A 4TXVA 3ZLPA 9GSSA 2M46A 5CRHA 2R3XA 3F3RA 2C3NA 2C0FA 5A4WA 2DLXA 3Q18A 2CX4A 2QGVA 4KDXA 4KF9A 1DE1A 1E6BA 4Q5RA 2LSTA 5HQPA 5G31A 3JCML 3V1WA 1K0CA 2FD3A 5J9CA 4BPYA 2EIQA 3F6FA 2HE3A 2H76A 4NV2A 5LCZA 3KJYA 4F82A 3KEBA 3RHBA 1FVKA 2DBCA 4XTSA 5J4UA 4K9ZA 4IP6A 3KH9A 3A2XA 3CTFA 22GSA 5E4WA 2VCVA 1ZL9A 4WBRD 1PA3A 4ZIJA 1PN9A 1Y6EA 3FEUA 4MF5A 3TJGA 2FWFA 4O92A 4JZQA 3ERGA 1VGLA 13GSA 1YQ1A 5EVOA 2YOIA 3ZVJD 1HNBA 1BQ7A 1XIYA 1FHEA 3VI7A 4BVYA 5CO3A 2F9SA 2L4CA 2DJ3A 1AIUA 5FHIA 4BWSA 5DAKB 4YQVA 4YQMA 3SWLA 3VWVA 1Q98A 2P0GA 2RIIA 2H75A 5HR2A 2GZZA 3DKSA 2DJJA 3HJMA 1W89A 3IHQA 3LFLA 4IBPA 3FZ4A 3M0FA 3ZIVA 3HYPA 1LBKA 2F8FA 2I1UA 1NM3A 2XHFA 4ECJA 1XPVA 3QDNA 4NPBA 3ZRDA 1V58A 2VD1A 1PRXA 1MD4A 1OVNA 2ZNMA 2VL9A 1SYXA 1YKAA 3DRNA 4GSNA 2HRKB 2JZSA 1M9BA 1SD8A 4LL4B 3TUEA 2IIYA 1WP0A 5GSTA 3P90A 5CNWA 1R5PA 3OR5A 3F6DA 4KE3A 5JCGA 2X8GA 2H30A 3EMPA 4FH8A 2IL3A 2ON7A 3TGZA 3E3EA 5LD0A 1F9MA 3HY2A 5ECRB 4TR4A 3KTBA 1R5AA 4ECIA 5JCUA 3J7Yb 1MD3A 1K0BA 3HJOA 5ECLB 1XBSA 2HFDA 2YV7A 1XWGA 2VL2A 1TP9A 2LS5A 1KTEA 2FHEA 3IDVA 1DE2A 3RPPA 2D2ZA 2NBSA 1USBA 4XS4B 6GSVA 3L78A 2TIRA 4KSMA 3D4TA 1BX9A 1EOHA 4KX4A 3HDCA 4MK3A 1XW9A 4QQ7A 2QSIA 4LA1A 2FGXA 3Q74A 4G19A 4MJEA 5KN0A 5HFKA 4AJ6A 3LEFA 2OBIA 4MMMA 3ZZXA 3HHVA 3RDWA 2LEGA 4ILFA 3FZ5A 2NVLA 4X0XA 4EXJA 4NMUA 2RUEA 1WPIA 4BL7A 1A0FA 3EE2A 4PGTA 2HSNB 2R2JA 1T4YA 2GQKA 2YJ7A 3BCKA 1AQWA 6GSTA 2JACA 2IJYA 5HR1A 3G9BA 2IMKA 3NIVA 5H5QA 3UOMA 3UVTA 1B48A 3M3MA 1R26A 3GSTA 4KCAA 4RUVA 2OADA 2BMXA 4OCEA 4ULXA 4OFTA 1ABAA 2DMLA 4KNDA 1SK2A 4TXOA 5DBQA 4PURA 5D93A 3DMLA 5AGYA 3RHCA 3IAM2 3RPNA 2GTUA 1THOA 4L0UA 4LMVA 3U6VA 1ZGNA 2H01A 3IC4A 4FQUA 3HVVA 2LJRA 1K0AA 4HOJA 4IJIA 2H8LA 1M99A 3QFBC 3Q19A 1PX6A 3LYPA 5DDLA 3KP9A 1ERWA 1E2YA 4HJMA 2H6XA 4HQSA 3ZREA 3KD0A 3LJRA 4GTUA 1GH2A 4XRAA 3LXZA 2P5RA 3D4MA 1B4QA 2EIOA 4HDEA 20GSA 1IYHA 4EVMA 4HEA2 4N0ZA 3ZL5A 2GDRA 2YWIA 5IM9A 1V98A 1Z5YE 5DVBA 2L5OA 5G1LA 4I8BA 3A5WA 2P31A 3CBUA 2LV3A 1FAAA 3ZFBA 1GSQA 2FWEA 4KW6A 2MBSA 3C71A 4EE0A 3I43A 3TRXA 3VWXA 1MDJA 3GRXA 2H6ZA 3ME7A 3M1GA 4K8MA 4YAPA 3TOUA 3DGQA 4N0VA 1FG4A 1A2LA 2L6DA 3G7YA 5ECIB 4J57E 4EDZA 4DSSA 5J5NA 3F4RA 1GSFA 4ZB9A 1G7OA 2H70A 2LQQA 2VIMA 5EPFA 3GTUA 1SJZA 2PN8A 3TJJA 2H19A 5DJMA 1W4VA 3UIWA 1GRXA 3KMOA 4G10A 1SL1B 3MDKA 1ML6A 2H1AA 3TRPA 1EP7A 1I9DA 3E9JB 2OACA 4POLA 3M9KA 1F3AA 12GSA 4WR4A 4F9ZA 2CVBA 5D73A 3SBCA 3J7Yk 2O8VB 3C73A 5CP1A 2RUFA 2LRTA 3KIJA 4MZCA 3CYNA 2VD0A 3FZ9A 2JZRA 1QGVA 4L5OA 3GH9A 2VCTA 1U3AA 1OC8A 4XS6A 3GX8A 3TOTA 3KH7A 3F4SA 2B1LA 4POMA 4RI6A 4K6XA 6GSWA 2JZTA 1ERVA 5F05A 2CVKA 2QC7A 1TK0B 1T4ZA 3O76A 2E2GA 2FLSA 4HUAA 2GSRA 1TRSA 4Q5NA 5L71A 4V2NA 4BVXB 17GSA 2AV4A 1GTBA 1XOBA 1ZYEA 3K8NA 4AJ7A 3PPUA 4IKHA 2IN3A 1GSUA 1T7PB 4XRDA 2GZPA 3WT1A 3DVXA 3GN3A 2LRNA 4TN8A 1YJ6A 1UVZA 1EEJA 4PUAA 3CRTA 2YZHA 4EO3A 3D6IA 4IJ3A 1CQGA 5F0GA 1ACVA 2OE0A 4OFMA 3IBHA 3LWAA 3L4NA 2L5LA 1SL2B 2B5XA 1AAZA 1TTZA 1ZYQB 2HYXA 4PTSA 1PL1A 2GSTA 1TU7A 1OAZA 5HFIA 4KGIA 1GUHA 5JWOB 1SU9A 4KB3A 1SK1A 4G0KA 4IELA 5FT3A 5DJLA 4HU7A 3EMXA 1J9BA 2OE3A 3HD5A 1Z6NA 4I6XA 3GIXA 1XFLA 3GNJA 3W8SA 5CYYA 2XBQA 1M9AA 3QOUA 4EKZA 1YEPA 5AN1A 3HZ4A 2HI7A 2H6YA 3GHAA 1M2DA 2A2RA 4PUFC 4QL9A 2J9HA 4GRFA 4PQHA 2Z9SA 4IW9A 3FR6A 3EWLA 4OFNA 2O87A 2FA4A 1O7UA 3ZITA 2HSMA 3LGCA 2R5GA 2BJXA 4KCEA 2H71A 3UEMA 1URMA 2H1DA 2AUVA 2WB9A 3FW2A 3F8UA 4ZILA 2VCWA 4L5LA 4JRRA 4DSQA 2YN1A 1S3AA 2XC2A 5D96A 2VM2A 4AGSA 4KDYA 1TK5B 1N2AA 1ZMAA 2NTOA 4O7HA 2IPAA 1JZOA 4N10A 4ZBAA 3FKFA 5ELGA 4Z7XA 1GLPA 3VPTA 1F2EA 4K0NA 5B8AA 3M9JA 3AY8A 3IV4A 1V9WA 4J56E 2KP2A 3GSSA 3KTLA 2DJ1A 1ERUA 1OC9A 3F63A 2AHEA 3VPQA 4GSTA 3VK9A 4EF0A 2B7JA 2HZFA 1S3DA 3QCPA 4X43A 2XBIA 4WETA 4ZL8A 1JLVA
chains in the Genus database with same CATH superfamily
3P8WA 2R0GA 5GAPD 2VLTA 3KCMA 3QD9A 4ECCA 3H4KA 5ID2A 5CREA 2YNXA 5B6NA 5CRWA 3IOSA 1PGTA 3QAGA 2CX3A 3GUSA 5IMCA 3WGXA 4NHWA 1H75A 5H5RA 2JL4A 4ZBBA 2VOCA 3IXRA 2IFQB 4I2TA 2V6KA 2F3MA 3EC3A 3GYKA 1GSYA 3TJBA 2C0DA 4HQZA 2DJ0A 3A3TA 2O85A 2VO4A 5CRDA 4JR4A 1JHBA 2AJQB 1Z9HA 2OKAA 2PVQA 5ABRA 2CZ2A 1KNGA 2K8SA 4EDYA 2GSQA 2V6OA 4E8HA 2B5EA 3TJKA 2GS3A 2M72A 4AJ8A 3H1NA 3PINA 2KHPA 3MNGA 4L0WA 3FR3A 1TI3A 4BWQA 3TDGA 2HSYA 4V1Ap 2PGTA 4GCIA 3TKQA 3MYDA 5ECNB 4E68A 3TKSA 2VLUA 3DD3A 4D73A 5GZZB 4POBA 3QR6A 5JCWA 1H4OA 3QFAC 4DSSB 1U6TA 2WCIA 3ZTLA 1RK4A 4N3ZA 3GA4A 1WOUA 3VWWA 2FCHA 4KSOA 2PPTA 1BG5A 4FYCA 4O5QA 4O32A 5IMVA 1XCCA 2O3EA 1MTCA 2H0HA 4GQFA 4FIWA 4NWYA 1AUCA 4EC0A 1TJDA 2WGRA 2A2SA 1N8JA 2H1GA 1X9SB 4QL7A 2R6KA 1O6JA 1VF1A 4DEJA 1SKSB 4MZWA 4ZB6A 2WW3A 18GSA 2TRXA 5C04A 2RLIA 1B4PA 1GUKA 2VCZA 1B9YC 2HRNA 1M3JA 1VF2A 1B8XA 4GLTA 5J4YA 4CHSA 3I6AA 2F51A 3KGKA 1ZOFA 1Y25A 2H74A 1F6MC 3QAVA 3VI5A 1GSDA 2X99A 3F4TA 4CY8A 4FYBA 3P2AA 2WVZA 5KN3A 1SVOA 1Z3EA 2PWJA 4IGJA 4F03A 1A23A 2C1YA 5DQSA 1FVJA 3C1RA 2WW2A 4Q5FA 3TB2A 1OE7A 4RQRA 3LW9A 4WF4A 2ON5A 1XOAA 3APQA 1X0RA 2YANA 1JZWA 1OKTA 3UAPA 1WE0A 1ST9A 3ZIJA 3LG6A 4YKGA 5DALA 4MPGA 5IMZA 1QK8A 3CWGA 3BOAA 4G2EA 1GLQA 1MDKA 2GVPA 5DAKA 2O89A 1KBNA 2YWMA 2CAIA 1T3BA 4WR5A 1JFUA 1XXUA 2MMNA 4OCFA 4IQ1A 2HZEB 4ZXGA 2O7KA 4ZBDA 2CVDA 2M80A 4MCUA 3APSA 5KOWA 3CXGA 4OO5A 2I4AA 1ILOA 2B7KA 1WWJA 3GMFA 3DWVA 1UN2A 5ECSA 4WEYA 1OYJA 3WT2A 2CA8A 2HRKA 3IK7A 1G7EA 3EPTA 1IYIA 1K0MA 4GSSA 1A2MA 1PQNA 2H1BA 4XCSA 2V1MA 3C1SA 3HVNA 1BYEA 4IS0A 2MMZA 4BA7A 4HU9A 5H5SA 2C3QA 2B5YA 4PNFA 2HXKA 2TRCP 3HA9A 1G6WA 5DCGA 2HLSA 2VAFA 1O73A 2V2GA 2FA8A 4TR1B 2VM1A 5E59A 2C0GA 4G9HA 5IMFA 3VWUA 1SVMA 3HVSA 3BCIA 5D8IA 3FHKA 1S3RA 3IR4A 3ZMLA 3EINA 1TK8B 4DVCA 3US3A 6GSXA 2JSYA 2R4VA 4MPFA 3IA1A 3G7JA 3U5RE 4KA0A 3ZYWA 2WZ9A 4XS4A 5ECOB 4F0BA 3IRAA 1M7TA 1ZZYA 4OWYA 3IPZA 1XVWA 4P3YB 4DSRA 2LUSA 1LU4A 2HT9A 1TRVA 4ZL7A 2RM6A 4OD7A 1DBYA 4PQIA 2B1KA 2JU5A 1EV4A 1R7HA 4FYUA 4G0LA 4EL1A 4L8EA 2C4JA 4PI2C 5KN1A 2H72A 1ZCPA 2WFCA 2LQOA 3O6TA 1X9WB 4Q5QA 5G5FA 2EFDA 4POKA 4WBJA 2GSSA 1NHYA 4TRXA 5FWGA 3DVWA 4LL1B 3CRUA 1TW9A 4GF0A 2IMDA 2DJKA 3GURA 1NW2A 4PHZC 1KEBA 3TKSC 3VURA 1OC3A 2C0EA 2KUCA 1S3CA 2VL2C 4OO4A 4OMVA 1PD21 5F07A 3APOA 1QMVA 3I9V2 1SKRB 3E0UA 1HNCA 1AQVA 2GZYA 4ML6A 5HR3A 1GTAA 1B9XC 4F0CA 1Y1UA 5G2ZA 3PGTA 2LRCA 4HZ2A 4HZ4A 1XWAA 3VFIA 1QUWA 4BVYB 5KEJA 1A8LA 2WDUA 1JZRA 2ZUPA 5IPGA 1VF3A 3UVHA 3KZQA 5BMUA 2HRFA 1XVQA 3TKSE 1UC7A 3Q6OA 4IQAA 1BAYA 6GSYA 4TKYA 5A34A 3QPMA 1WRYA 3IHGA 4MABA 5IMAA 1RQMA 2IMFA 4ECBA 5KOXA 2WJUA 1FB6A 2PUKC 3QMXA 1TRWA 1M2BA 1SD9A 4Z2RA 2MMOA 1HNAA 3C7MA 2PVOC 1Z6MA 1GULA 1EP8A 2ES7A 5B8BA 3PR8A 3CTGA 2WW1A 1T1VA 1K0OA 5A1NA 2EIRA 3L9UA 2N5BA 2LTKA 4MH3A 1YDKA 1EV9A 4NAXA 1I5GA 3GKNA 4GQCA 5IMDA 4MF6A 2H66A 1GSSA 1THXA 2QKEA 3IE3A 2DKIA 4KH7A 1YF1A 2FY6A 2IMEA 2DJ2A 4XS1A 3W8JA 2XPEA 3IC8A 4CY6A 1Q4JA 4IVFA 2E0QA 2A4VA 5F8BA 2CAQA 3UL3A 1K3LA 1QQ2A 7GSSA 5B6MA 1PX7A 1GP1A 1QXHA 3WGEA 3DIEA 1OKDA 4KDUA 4MDCA 4WKWA 1WMJA 1YY7A 3TCOA 2KLXA 3A2VA 3TKPA 4V2LA 1K3YA 4TOPA 3UMAA 5J41A 1VRSD 1FO5A 3EVIA 2I3YA 4KUNA 1X9MB 4BL7B 3N9JA 1BEDA 3R3EA 1U87A 4K2DA 3GKXA 1O8WA 1DSBA 3D22A 2G2QA 3EYTA 3HZ8A 1A2JA 1TKDB 3P7XA 5GAND 3H8QA 4K7OA 5ELAA 5ECMB 3EU3A 2LKUA 1M0UA 1J08A 1F3BA 2MZCA 4LLRA 3RBTA 4BVXA 2CQ9A 1WIKA 2AAWA 2FWGA 4TXOB 3WD6A 4X1UA 1X5CA 3A5IA 4MJAA 2IWTA 2X8HA 3M8NA 2HRAA 5D9TA 1PKWA 3BD2A 5A5HA 5ECPB 1TXXA 1EEMA 2C80A 3I69A 4Z2UA 4MA9A 1XWBA 2KOKA 5DALB 1SKWB 2PU9C 5AIXA 2BTOT 2LNTA 2DC5A 5IO0A 4HJ2A 2K18A 1XWKA 3EU4A 2GGTA 3UJ1A 4V1Ag 3KMNA 2OJLA 3QAWA 5AISA 4AF2A 3RAZA 4N30A 1N25A 4PNGA 2YCDA 1K0DA 4WF5A 3H79A 2K8VA 2CV4A 4ML1A 2WW0A 1O8XA 3GL5A 2YP6A 1XZOA 4ZB7A 1RW1A 1PMTA 8GSSA 3G7IA 5IOXA 2WULA 3VLNA 2N5FA 2N5AA 2YWNA 1SL0B 2QA2A 5C00A 2XPDA 3BBYA 3FYGA 1U3IA 1EWXA 5KN2A 1DUGA 2ZCTA 2GQMA 4FXYP 5HFGA 1QFNA 3NZNA 2PBJA 1TDIA 4XIHA 3FMWA 3IK9A 2C8UA 1A24A 2O36A 1PL2A 3GTUB 2LJKA 4PQ1A 2ALBA 2L57A 2UZ8A 2FWHA 5D9XA 2DKHA 2KP1A 2REMA 5G1KA 2WRTA 6GSSA 4MJBA 5JWRB 3D21A 2CT6A 1X5DA 1BJXA 3HKRA 4V2MA 2FNOA 2P5QA 2C3TA 2F8AA 4N11A 2VL3A 2VLVA 2JSZA 1GTIA 3NOFA 5F06A 2H0GA 2YWOA 1V40A 4MH2A 1OE8A 4MZBA 4ACSA 3FY7A 3EURA 4HSCX 4JBBA 4TVEA 4TR0A 3BJ5A 4MP4A 2L4QA 4EUYA 2H0IA 1R4WA 1HD2A 4JR6A 2LNSA 1JZDA 5J47A 2GLRA 14GSA 5LNKe 3CHXC 1TI1A 5ENUA 2E2MA 4PX1A 1AXDA 1GTUA 4EIQA 4I97A 3IAS2 2WZSA 2CZ3A 3CSIA 2B6MA 4TR3A 5J3RA 2K9FA 4PXOA 4MJCA 5INYA 2H73A 1BG1A 2X8CA 4CW9A 1V57A 1TRUA 2EC4A 4BIKA 4QMKA 6GSUA 3N5OA 3F3QA 2E7PA 2AYTA 2JADA 3ERFA 4FO5A 3ERWA 11GSA 1V2AA 1PN0A 5ECHB 1G0TA 1YZXA 3ZMKA 4YH2A 1Z7PA 5A4UA 2RM5A 1TOFA 3L9SA 4IP1A 4YQUA 1WJKA 4MLYA 4TW5A 2IFQA 4RQXA 5J40A 2NDOA 2MYGA 2AB6A 4JE1A 5A34B 2OBKA 4E8EA 4JEDA 4I5QA 2I81A 5J9BA 5A4VA 2VCXA 3ISOA 1A0RP 5A5KA 10GSA 1EGOA 1NHOA 3O3TA 1XW6A 3DXBA 4K0GA 3RGBC 1AQXA 5GSSA 1CQHA 3L9VA 1AC1A 1FB0A 3TKRA 3LXTA 3MSZA 3CQFA 1GWCA 2X64A 3F0IA 1LJRA 1PSQA 1YEXA 3LORA 3KXOA 3WGDA 3R2QA 5A1NB 1HQOA 5ECQB 3F9UA 3HCZA 1FW1A 1AW9A 4MF7A 1G6YA 1EOGA 5AIVA 2PERA 5G5EA 2MBTA 2GT6A 1GNWA 3KM6A 3TRQA 19GSA 1O85A 3HJPA 5ECKB 1M2AA 1SJ6A 4HS1A 2YPMA 4H86A 1MEKA 2HSMB 2J23A 4CDOA 1VF4A 3GKMA 1PFOA 4PI0C 3ED3A 2V41A 1PKZA 1T00A 2VCQA 5D9VA 5COHA 4Z2TA 3WYWA 1SYRA 2WVXA 2L59A 3TJFA 4KAEA 1SJIA 3LSZA 3GL3A 4O5RA 2PMTA 3A2WA 5HR0A 3FK8A 4AKIA 4G01A 2HSNA 3UBKA 1EZKA 3DYRA 1NSWA 5EL8A 5DCHA 1YKCA 4K7IA 3TU3B 16GSA 4IN0A 1XG8A 2DIYA 5J4VA 1T8EB 3GFKA 5D9WA 3UARA 2V32A 1K3OA 1XWCA 1ON4A 3GV1A 4XHMA 2DMMA 3ZFLA 1GSEA 2YJHA 2GQLA 1OC9B 2L6CA 2YV9A 4ZB8A 2OT3A 4J2FA 3LYKA 5IO2A 1JLWA 2IMIA 1GL8A 3CSJA 4RI7A 3FRCA 5IOWA 2K6VA 2NPBA 2R37A 1K0NA 1C72A 5DQYA 1FOVA 2HSHA 2HZEA 3HVXA 4GWRA 5ID2B 3CSHA 1F37A 4I2UA 2G0FA 3H93A 2I9HA 4JU5A 1Z7RA 5JWQB 1A8YA 1XW5A 3GH6A 2OA7A 2DSAA 1HYUA 3MWHA 5EY6A 3UBLA 4K1FA 4K7NA 3DEXA 4NV5A 2HQTA 4USSA 1SENA 1X5EA 4WXTA 3C8EA 2DIZA 2WS2A 1SVLA 2OE1A 2VUPA 4GXZA 4G0IA 4ISDA 3FZAA 5B7CA 3FR9A 4TR1A 3HXSA 4HI7A 4YAVA 4IHUA 3W6GA 3PH9A 3GX0A 5CRGA 2LJAA 3L0HA 5G30A 3HMJG 2MMAA 3GKKA 1EGRA 1TU8A 4ZL9A 1SK0A 5IQYA 2X49A 4D73B 5IIZA 4EIPA 3ZVJA 3D0ZA 1J0FA 3MAKA 1UA5A 3D5JA 4NXIA 2EFCA 3KP8A 4LMWA 1GUMA 2HNLA 5IPHA 3S9FA 4NHZA 2B3SA 3CMIA 3LQ7A 4ID0A 1O81A 1MDIA 1U88A 2YZUA 1GNEA 1ERTA 2GT5A 2VKZG 2FUG2 4F2IA 5CAXA 3ME8A 1YF0A 4TXVA 3ZLPA 9GSSA 2M46A 5CRHA 2R3XA 3F3RA 2C3NA 2C0FA 5A4WA 2DLXA 3Q18A 2CX4A 2QGVA 4KDXA 4KF9A 1DE1A 1E6BA 4Q5RA 2LSTA 5HQPA 5G31A 3RFRC 3JCML 3V1WA 1K0CA 2FD3A 4X4JA 5J9CA 4AKHA 4BPYA 2EIQA 3F6FA 2HE3A 2H76A 4NV2A 5LCZA 3KJYA 4F82A 3KEBA 3RHBA 1FVKA 2DBCA 4XTSA 5J4UA 4K9ZA 4IP6A 3KH9A 3A2XA 2O5VA 3CTFA 22GSA 5E4WA 2VCVA 1ZL9A 4WBRD 1PA3A 4ZIJA 1PN9A 1Y6EA 3FEUA 4MF5A 3TJGA 2FWFA 4O92A 4JZQA 3ERGA 4AKXB 1VGLA 13GSA 1YQ1A 5EVOA 2YOIA 3ZVJD 1HNBA 1BQ7A 1XIYA 1FHEA 2EFEA 3VI7A 4BVYA 5CO3A 2F9SA 2A2PA 2L4CA 2DJ3A 1AIUA 5FHIA 4BWSA 5DAKB 4YQVA 4YQMA 3SWLA 3VWVA 1Q98A 2P0GA 2RIIA 2H75A 5HR2A 2GZZA 3DKSA 2DJJA 3HJMA 1W89A 3IHQA 3LFLA 4IBPA 3FZ4A 3M0FA 3ZIVA 2EFHA 3HYPA 1LBKA 2F8FA 2I1UA 1NM3A 2XHFA 4ECJA 1XPVA 3QDNA 4NPBA 3ZRDA 1V58A 2VD1A 1PRXA 1MD4A 1OVNA 4W66A 4K5SA 2ZNMA 2VL9A 1SYXA 1YKAA 3DRNA 4GSNA 2HRKB 2JZSA 1M9BA 1SD8A 4LL4B 3TUEA 1M3IA 2IIYA 1WP0A 5GSTA 3P90A 5CNWA 1R5PA 3OR5A 3F6DA 4KE3A 5JCGA 2X8GA 2H30A 3EMPA 4FH8A 2IL3A 2ON7A 3TGZA 3E3EA 5LD0A 1F9MA 3HY2A 5ECRB 1TXUA 4TR4A 1ZYNA 3KTBA 1R5AA 4ECIA 5JCUA 3J7Yb 1MD3A 1K0BA 3HJOA 5ECLB 5BRTA 4K2XA 1XBSA 2HFDA 2YV7A 1XWGA 2VL2A 4AI6A 1TP9A 2LS5A 1KTEA 2FHEA 3IDVA 1DE2A 3RPPA 2D2ZA 2NBSA 1USBA 4XS4B 6GSVA 3L78A 2TIRA 4KSMA 3D4TA 1BX9A 1EOHA 4KX4A 3HDCA 2WVYA 4MK3A 1XW9A 4QQ7A 2QSIA 4LA1A 2FGXA 3Q74A 4G19A 4MJEA 5KN0A 5HFKA 4AJ6A 3LEFA 2OBIA 4MMMA 3ZZXA 3HHVA 3RDWA 2LEGA 4ILFA 3FZ5A 2NVLA 2WVXB 4X0XA 4EXJA 4NMUA 2RUEA 1WPIA 4BL7A 1A0FA 3EE2A 4PGTA 2HSNB 2R2JA 1T4YA 2GQKA 2YJ7A 3BCKA 1AQWA 6GSTA 2JACA 2IJYA 5HR1A 3G9BA 2IMKA 3NIVA 5H5QA 1ZYPA 3UOMA 3UVTA 1B48A 2QA1A 3M3MA 1R26A 3GSTA 4KCAA 4RUVA 2OADA 2BMXA 4OCEA 4ULXA 4OFTA 1ABAA 2DMLA 4KNDA 1SK2A 4TXOA 5DBQA 4PURA 5D93A 3DMLA 5AGYA 4ICYA 3RHCA 3IAM2 3RPNA 2GTUA 1THOA 4L0UA 4A5PA 4LMVA 3U6VA 1ZGNA 2H01A 3IC4A 4FQUA 1YVLA 3HVVA 2LJRA 2H1LA 1K0AA 4MNNA 4HOJA 4IJIA 2H8LA 1M99A 3QFBC 3Q19A 1PX6A 3LYPA 5DDLA 3KP9A 1ERWA 1E2YA 4HJMA 2H6XA 4HQSA 3ZREA 3KD0A 3LJRA 4GTUA 1GH2A 4XRAA 5BMUB 3LXZA 2P5RA 3D4MA 1B4QA 2EIOA 4HDEA 20GSA 1IYHA 4EVMA 4HEA2 4N0ZA 4GDFA 3ZL5A 2GDRA 2YWIA 5IM9A 1V98A 1BF5A 1Z5YE 5DVBA 2L5OA 5G1LA 4I8BA 3A5WA 2P31A 3CBUA 2LV3A 1FAAA 3ZFBA 1GSQA 2FWEA 4KW6A 2MBSA 3C71A 4EE0A 3I43A 3TRXA 1YEWC 3VWXA 2UV8G 1MDJA 3GRXA 2H6ZA 3ME7A 3M1GA 4K8MA 4YAPA 3TOUA 3DGQA 4N0VA 1FG4A 1A2LA 2L6DA 3G7YA 5ECIB 4J57E 4EDZA 4DSSA 5J5NA 3F4RA 1GSFA 4ZB9A 1G7OA 2H70A 2LQQA 2VIMA 5EPFA 3GTUA 1SJZA 2PN8A 2R0PA 3TJJA 2H19A 5DJMA 1W4VA 3UIWA 1GRXA 3KMOA 4G10A 1SL1B 3MDKA 1ML6A 2H1AA 3TRPA 1EP7A 1I9DA 3E9JB 2OACA 4POLA 3M9KA 1F3AA 12GSA 4WR4A 4F9ZA 2CVBA 5D73A 3SBCA 3J7Yk 2O8VB 3C73A 5CP1A 2RUFA 2LRTA 3KIJA 4MZCA 3CYNA 2VD0A 3FZ9A 2JZRA 1QGVA 4L5OA 3GH9A 2VCTA 1U3AA 2A4HA 1OC8A 4XS6A 3GX8A 3TOTA 3KH7A 3F4SA 2B1LA 4POMA 4RI6A 4AKGA 4K6XA 6GSWA 2JZTA 1ERVA 5F05A 2CVKA 2QC7A 1TK0B 1T4ZA 3O76A 2E2GA 2FLSA 1S4BP 4HUAA 2GSRA 1TRSA 4Q5NA 5L71A 4V2NA 4BVXB 17GSA 2AV4A 1GTBA 1XOBA 1ZYEA 3K8NA 4AJ7A 2X4AA 3PPUA 4IKHA 2IN3A 1GSUA 1T7PB 5A5HB 4XRDA 2GZPA 3WT1A 3DVXA 3GN3A 2LRNA 4TN8A 1YJ6A 1UVZA 1EEJA 2YZHA 4PUAA 3CRTA 4EO3A 3D6IA 4IJ3A 1CQGA 5F0GA 1ACVA 2OE0A 4OFMA 3IBHA 3LWAA 3L4NA 2L5LA 1SL2B 1FOHA 2B5XA 1AAZA 1TTZA 1ZYQB 2HYXA 4PTSA 1PL1A 2GSTA 1TU7A 1OAZA 5HFIA 4KGIA 1GUHA 5JWOB 1SU9A 4KB3A 1SK1A 4G0KA 4IELA 5FT3A 5DJLA 4HU7A 3EMXA 1J9BA 2OE3A 3HD5A 1Z6NA 3GIXA 1XFLA 4I6XA 3GNJA 3W8SA 5CYYA 2XBQA 1M9AA 3QOUA 4YKFA 4EKZA 1YEPA 5AN1A 3HZ4A 2HI7A 2H6YA 3GHAA 1M2DA 2A2RA 4PUFC 4QL9A 2J9HA 4GRFA 2R0CA 4PQHA 2Z9SA 4IW9A 3FR6A 3EWLA 4OFNA 2O87A 2FA4A 1O7UA 3ZITA 2HSMA 3LGCA 2R5GA 2BJXA 4KCEA 1I1IP 2H71A 3UEMA 1URMA 2H1DA 2AUVA 2WB9A 3FW2A 3F8UA 4ZILA 4K5RA 2VCWA 4L5LA 4JRRA 4DSQA 2YN1A 1S3AA 2XC2A 5D96A 2VM2A 4O5UA 4AGSA 4KDYA 1TK5B 1N2AA 1ZMAA 2NTOA 4O7HA 2IPAA 1JZOA 4N10A 4ZBAA 3FKFA 5ELGA 4Z7XA 1GLPA 3VPTA 1F2EA 4K0NA 5B8AA 3M9JA 3AY8A 3IV4A 1V9WA 4J56E 2KP2A 3GSSA 3KTLA 2DJ1A 1ERUA 1OC9A 3F63A 2AHEA 3VPQA 4GSTA 3VK9A 4EF0A 2B7JA 2HZFA 1S3DA 3QCPA 4X43A 2XBIA 4WETA 4ZL8A 3MIXA 1JLVA
chains in the Genus database with same CATH topology
3P8WA 2R0GA 5GAPD 2VLTA 3KCMA 3QD9A 4ECCA 3H4KA 5ID2A 5CREA 2YNXA 5B6NA 5CRWA 3IOSA 1PGTA 3QAGA 2CX3A 3GUSA 5IMCA 3WGXA 4NHWA 1H75A 5H5RA 2JL4A 4ZBBA 2VOCA 3IXRA 2IFQB 4I2TA 2V6KA 2F3MA 3EC3A 3GYKA 1GSYA 3TJBA 2C0DA 4HQZA 2DJ0A 3A3TA 2O85A 2VO4A 5CRDA 4JR4A 1JHBA 2AJQB 1Z9HA 2OKAA 2PVQA 5ABRA 2CZ2A 1KNGA 2K8SA 4EDYA 2GSQA 2V6OA 4E8HA 2B5EA 3TJKA 2GS3A 2M72A 4AJ8A 3H1NA 3PINA 2KHPA 3MNGA 4L0WA 3FR3A 1TI3A 4BWQA 3TDGA 2HSYA 4V1Ap 2PGTA 4GCIA 3TKQA 3MYDA 5ECNB 4E68A 3TKSA 2VLUA 3DD3A 4D73A 5GZZB 4POBA 3QR6A 5JCWA 1H4OA 3QFAC 4DSSB 1U6TA 2WCIA 3ZTLA 1RK4A 4N3ZA 3GA4A 1WOUA 3VWWA 2FCHA 4KSOA 2PPTA 1BG5A 4FYCA 4O5QA 4O32A 5IMVA 1XCCA 1MTCA 2H0HA 4GQFA 4FIWA 4NWYA 1AUCA 4EC0A 1TJDA 2WGRA 2A2SA 1N8JA 2H1GA 1X9SB 4QL7A 2R6KA 1O6JA 1VF1A 4DEJA 1SKSB 4MZWA 4ZB6A 18GSA 2TRXA 5C04A 2RLIA 1B4PA 1GUKA 2VCZA 1B9YC 2HRNA 1VF2A 1B8XA 4GLTA 5J4YA 4CHSA 3I6AA 2F51A 3KGKA 1ZOFA 1Y25A 2H74A 1F6MC 3QAVA 3VI5A 1GSDA 2X99A 3F4TA 4CY8A 4FYBA 3P2AA 5KN3A 1SVOA 1Z3EA 2PWJA 4IGJA 4F03A 1A23A 2C1YA 5DQSA 1FVJA 3C1RA 4Q5FA 3TB2A 1OE7A 4RQRA 3LW9A 4WF4A 2ON5A 1XOAA 3APQA 1X0RA 2YANA 1JZWA 1OKTA 3UAPA 1WE0A 1ST9A 3ZIJA 3LG6A 4YKGA 5DALA 4MPGA 5IMZA 1QK8A 3CWGA 3BOAA 4G2EA 1GLQA 1MDKA 2GVPA 5DAKA 2O89A 1KBNA 2YWMA 2CAIA 1T3BA 4WR5A 1JFUA 1XXUA 2MMNA 4OCFA 4IQ1A 2HZEB 4ZXGA 2O7KA 4ZBDA 2CVDA 2M80A 4MCUA 3APSA 5KOWA 3CXGA 4OO5A 2I4AA 1ILOA 2B7KA 1WWJA 3GMFA 3DWVA 1UN2A 5ECSA 4WEYA 1OYJA 3WT2A 2CA8A 2HRKA 3IK7A 1G7EA 3EPTA 1IYIA 1K0MA 4GSSA 1A2MA 1PQNA 2H1BA 4XCSA 2V1MA 3C1SA 1BYEA 4IS0A 2MMZA 4BA7A 4HU9A 5H5SA 2C3QA 2B5YA 4PNFA 2HXKA 2TRCP 3HA9A 1G6WA 5DCGA 2HLSA 2VAFA 1O73A 2V2GA 2FA8A 4TR1B 2VM1A 5E59A 2C0GA 4G9HA 5IMFA 3VWUA 1SVMA 3HVSA 3BCIA 5D8IA 3FHKA 3IR4A 3ZMLA 3EINA 1TK8B 4DVCA 3US3A 6GSXA 2JSYA 2R4VA 4MPFA 3IA1A 3G7JA 3U5RE 4KA0A 3ZYWA 2WZ9A 4XS4A 5ECOB 4F0BA 3IRAA 1M7TA 1ZZYA 4OWYA 3IPZA 1XVWA 4P3YB 4DSRA 2LUSA 1LU4A 2HT9A 1TRVA 4ZL7A 2RM6A 4OD7A 1DBYA 4PQIA 2B1KA 2JU5A 1EV4A 1R7HA 4FYUA 4G0LA 4EL1A 4L8EA 2C4JA 5KN1A 2H72A 1ZCPA 2WFCA 2LQOA 3O6TA 1X9WB 4Q5QA 5G5FA 2EFDA 4POKA 4WBJA 2GSSA 1NHYA 4TRXA 5FWGA 3DVWA 4LL1B 3CRUA 1TW9A 4GF0A 2IMDA 2DJKA 3GURA 1NW2A 1KEBA 3TKSC 3VURA 1OC3A 2C0EA 2KUCA 1S3CA 2VL2C 4OO4A 4OMVA 1PD21 5F07A 3APOA 1QMVA 3I9V2 1SKRB 3E0UA 1HNCA 1AQVA 2GZYA 4ML6A 5HR3A 1GTAA 1B9XC 4F0CA 1Y1UA 5G2ZA 3PGTA 2LRCA 4HZ2A 4HZ4A 1XWAA 3VFIA 1QUWA 4BVYB 5KEJA 1A8LA 2WDUA 1JZRA 2ZUPA 5IPGA 1VF3A 3UVHA 3KZQA 5BMUA 2HRFA 1XVQA 3TKSE 1UC7A 3Q6OA 4IQAA 1BAYA 6GSYA 4TKYA 5A34A 3QPMA 1WRYA 3IHGA 4MABA 5IMAA 1RQMA 2IMFA 4ECBA 5KOXA 2WJUA 1FB6A 2PUKC 3QMXA 1TRWA 1M2BA 1SD9A 4Z2RA 2MMOA 1HNAA 3C7MA 2PVOC 1Z6MA 1GULA 1EP8A 2ES7A 5B8BA 3PR8A 3CTGA 1T1VA 1K0OA 5A1NA 2EIRA 3L9UA 2N5BA 2LTKA 4MH3A 1YDKA 1EV9A 4NAXA 1I5GA 3GKNA 4GQCA 5IMDA 4MF6A 2H66A 1GSSA 1THXA 2QKEA 3IE3A 2DKIA 4KH7A 1YF1A 2FY6A 2IMEA 2DJ2A 4XS1A 3W8JA 2XPEA 3IC8A 4CY6A 1Q4JA 4IVFA 2E0QA 2A4VA 5F8BA 2CAQA 3UL3A 1K3LA 1QQ2A 7GSSA 5B6MA 1PX7A 1GP1A 1QXHA 3WGEA 3DIEA 1OKDA 4KDUA 4MDCA 4WKWA 1WMJA 1YY7A 3TCOA 2KLXA 3A2VA 3TKPA 4V2LA 1K3YA 4TOPA 3UMAA 5J41A 1VRSD 1FO5A 3EVIA 2I3YA 4KUNA 1X9MB 4BL7B 3N9JA 1BEDA 3R3EA 1U87A 4K2DA 3GKXA 1O8WA 1DSBA 3D22A 2G2QA 3EYTA 3HZ8A 1A2JA 1TKDB 3P7XA 5GAND 3H8QA 4K7OA 5ELAA 5ECMB 3EU3A 2LKUA 1M0UA 1J08A 1F3BA 2MZCA 4LLRA 3RBTA 4BVXA 2CQ9A 1WIKA 2AAWA 2FWGA 4TXOB 3WD6A 4X1UA 1X5CA 3A5IA 4MJAA 2IWTA 2X8HA 3M8NA 2HRAA 5D9TA 1PKWA 3BD2A 5A5HA 5ECPB 1TXXA 1EEMA 2C80A 3I69A 4Z2UA 4MA9A 1XWBA 2KOKA 5DALB 1SKWB 2PU9C 5AIXA 2BTOT 2LNTA 2DC5A 5IO0A 4HJ2A 2K18A 1XWKA 3EU4A 2GGTA 3UJ1A 4V1Ag 3KMNA 2OJLA 3QAWA 5AISA 4AF2A 3RAZA 4N30A 1N25A 4PNGA 2YCDA 1K0DA 4WF5A 3H79A 2K8VA 2CV4A 4ML1A 1O8XA 3GL5A 2YP6A 1XZOA 4ZB7A 1RW1A 1PMTA 8GSSA 3G7IA 5IOXA 2WULA 3VLNA 2N5FA 2N5AA 2YWNA 1SL0B 2QA2A 5C00A 2XPDA 3BBYA 3FYGA 1U3IA 1EWXA 5KN2A 1DUGA 2ZCTA 2GQMA 5HFGA 1QFNA 3NZNA 2PBJA 1TDIA 4XIHA 3FMWA 3IK9A 2C8UA 1A24A 1PL2A 3GTUB 2LJKA 4PQ1A 2ALBA 2L57A 2UZ8A 2FWHA 5D9XA 2DKHA 2KP1A 2REMA 5G1KA 2WRTA 6GSSA 4MJBA 5JWRB 3D21A 2CT6A 1X5DA 1BJXA 3HKRA 4V2MA 2FNOA 2P5QA 2C3TA 2F8AA 4N11A 2VL3A 2VLVA 2JSZA 1GTIA 3NOFA 5F06A 2H0GA 2YWOA 1V40A 4MH2A 1OE8A 4MZBA 4ACSA 3FY7A 3EURA 4JBBA 4TVEA 4TR0A 3BJ5A 4MP4A 2L4QA 4EUYA 2H0IA 1R4WA 1HD2A 4JR6A 2LNSA 1JZDA 5J47A 2GLRA 14GSA 5LNKe 1TI1A 5ENUA 2E2MA 4PX1A 1AXDA 1GTUA 4EIQA 4I97A 3IAS2 2CZ3A 3CSIA 2B6MA 4TR3A 5J3RA 2K9FA 4PXOA 4MJCA 5INYA 2H73A 1BG1A 2X8CA 4CW9A 1V57A 1TRUA 2EC4A 4QMKA 6GSUA 3N5OA 3F3QA 2E7PA 2AYTA 2JADA 3ERFA 4FO5A 3ERWA 11GSA 1V2AA 1PN0A 5ECHB 1G0TA 1YZXA 3ZMKA 4YH2A 1Z7PA 5A4UA 2RM5A 1TOFA 3L9SA 4IP1A 4YQUA 1WJKA 4MLYA 4TW5A 2IFQA 4RQXA 5J40A 2NDOA 2MYGA 2AB6A 4JE1A 5A34B 2OBKA 4E8EA 4JEDA 4I5QA 2I81A 5J9BA 5A4VA 2VCXA 3ISOA 1A0RP 5A5KA 10GSA 1EGOA 1NHOA 3O3TA 1XW6A 3DXBA 4K0GA 1AQXA 5GSSA 1CQHA 3L9VA 1AC1A 1FB0A 3TKRA 3LXTA 3MSZA 1GWCA 2X64A 3F0IA 1LJRA 1PSQA 1YEXA 3LORA 3KXOA 3WGDA 3R2QA 5A1NB 1HQOA 5ECQB 3F9UA 3HCZA 1FW1A 1AW9A 4MF7A 1G6YA 1EOGA 5AIVA 2PERA 5G5EA 2MBTA 2GT6A 1GNWA 3KM6A 3TRQA 19GSA 1O85A 3HJPA 5ECKB 1M2AA 1SJ6A 4HS1A 2YPMA 4H86A 1MEKA 2HSMB 2J23A 4CDOA 1VF4A 3GKMA 3ED3A 2V41A 1PKZA 1T00A 2VCQA 5D9VA 5COHA 4Z2TA 3WYWA 1SYRA 2L59A 3TJFA 4KAEA 1SJIA 3LSZA 3GL3A 4O5RA 2PMTA 3A2WA 5HR0A 3FK8A 4AKIA 4G01A 2HSNA 3UBKA 1EZKA 3DYRA 1NSWA 5EL8A 5DCHA 1YKCA 4K7IA 3TU3B 16GSA 4IN0A 2DIYA 5J4VA 1T8EB 3GFKA 5D9WA 3UARA 2V32A 1K3OA 1XWCA 1ON4A 3GV1A 4XHMA 2DMMA 3ZFLA 1GSEA 2YJHA 2GQLA 1OC9B 2L6CA 2YV9A 4ZB8A 2OT3A 4J2FA 3LYKA 5IO2A 1JLWA 2IMIA 1GL8A 3CSJA 4RI7A 3FRCA 5IOWA 2K6VA 2NPBA 2R37A 1K0NA 1C72A 5DQYA 1FOVA 2HSHA 2HZEA 3HVXA 4GWRA 5ID2B 3CSHA 1F37A 4I2UA 2G0FA 3H93A 2I9HA 4JU5A 1Z7RA 5JWQB 1A8YA 1XW5A 3GH6A 2OA7A 2DSAA 1HYUA 3MWHA 5EY6A 3UBLA 4K1FA 4K7NA 3DEXA 4NV5A 2HQTA 4USSA 1SENA 1X5EA 4WXTA 3C8EA 2DIZA 2WS2A 1SVLA 2OE1A 2VUPA 4GXZA 4G0IA 4ISDA 3FZAA 5B7CA 3FR9A 4TR1A 3HXSA 4HI7A 4YAVA 4IHUA 3W6GA 3PH9A 3GX0A 5CRGA 2LJAA 3L0HA 5G30A 3HMJG 2MMAA 3GKKA 1EGRA 1TU8A 4ZL9A 1SK0A 5IQYA 2X49A 4D73B 5IIZA 4EIPA 3ZVJA 3D0ZA 1J0FA 3MAKA 1UA5A 3D5JA 4NXIA 2EFCA 3KP8A 4LMWA 1GUMA 2HNLA 5IPHA 3S9FA 4NHZA 2B3SA 3CMIA 3LQ7A 4ID0A 1O81A 1MDIA 1U88A 2YZUA 1GNEA 1ERTA 2GT5A 2VKZG 2FUG2 4F2IA 5CAXA 3ME8A 1YF0A 4TXVA 3ZLPA 9GSSA 2M46A 5CRHA 2R3XA 3F3RA 2C3NA 2C0FA 5A4WA 2DLXA 3Q18A 2CX4A 2QGVA 4KDXA 4KF9A 1DE1A 1E6BA 4Q5RA 2LSTA 5HQPA 5G31A 3JCML 3V1WA 1K0CA 2FD3A 4X4JA 5J9CA 4AKHA 4BPYA 2EIQA 3F6FA 2HE3A 2H76A 4NV2A 5LCZA 3KJYA 4F82A 3KEBA 3RHBA 1FVKA 2DBCA 4XTSA 5J4UA 4K9ZA 4IP6A 3KH9A 3A2XA 2O5VA 3CTFA 22GSA 5E4WA 2VCVA 1ZL9A 4WBRD 1PA3A 4ZIJA 1PN9A 1Y6EA 3FEUA 4MF5A 3TJGA 2FWFA 4O92A 4JZQA 3ERGA 4AKXB 1VGLA 13GSA 1YQ1A 5EVOA 2YOIA 3ZVJD 1HNBA 1BQ7A 1XIYA 1FHEA 2EFEA 3VI7A 4BVYA 5CO3A 2F9SA 2A2PA 2L4CA 2DJ3A 1AIUA 5FHIA 4BWSA 5DAKB 4YQVA 4YQMA 3SWLA 3VWVA 1Q98A 2P0GA 2RIIA 2H75A 5HR2A 2GZZA 3DKSA 2DJJA 3HJMA 1W89A 3IHQA 3LFLA 4IBPA 3FZ4A 3M0FA 3ZIVA 2EFHA 3HYPA 1LBKA 2F8FA 2I1UA 1NM3A 2XHFA 4ECJA 1XPVA 3QDNA 4NPBA 3ZRDA 1V58A 2VD1A 1PRXA 1MD4A 1OVNA 4W66A 4K5SA 2ZNMA 2VL9A 1SYXA 1YKAA 3DRNA 4GSNA 2HRKB 2JZSA 1M9BA 1SD8A 4LL4B 3TUEA 2IIYA 1WP0A 5GSTA 3P90A 5CNWA 1R5PA 3OR5A 3F6DA 4KE3A 5JCGA 2X8GA 2H30A 3EMPA 4FH8A 2IL3A 2ON7A 3TGZA 3E3EA 5LD0A 1F9MA 3HY2A 5ECRB 1TXUA 4TR4A 1ZYNA 3KTBA 1R5AA 4ECIA 5JCUA 3J7Yb 1MD3A 1K0BA 3HJOA 5ECLB 5BRTA 4K2XA 1XBSA 2HFDA 2YV7A 1XWGA 2VL2A 4AI6A 1TP9A 2LS5A 1KTEA 2FHEA 3IDVA 1DE2A 3RPPA 2D2ZA 2NBSA 1USBA 4XS4B 6GSVA 3L78A 2TIRA 4KSMA 3D4TA 1BX9A 1EOHA 4KX4A 3HDCA 4MK3A 1XW9A 4QQ7A 2QSIA 4LA1A 2FGXA 3Q74A 4G19A 4MJEA 5KN0A 5HFKA 4AJ6A 3LEFA 2OBIA 4MMMA 3ZZXA 3HHVA 3RDWA 2LEGA 4ILFA 3FZ5A 2NVLA 4X0XA 4EXJA 4NMUA 2RUEA 1WPIA 4BL7A 1A0FA 3EE2A 4PGTA 2HSNB 2R2JA 1T4YA 2GQKA 2YJ7A 3BCKA 1AQWA 6GSTA 2JACA 2IJYA 5HR1A 3G9BA 2IMKA 3NIVA 5H5QA 1ZYPA 3UOMA 3UVTA 1B48A 2QA1A 3M3MA 1R26A 3GSTA 4KCAA 4RUVA 2OADA 2BMXA 4OCEA 4ULXA 4OFTA 1ABAA 2DMLA 4KNDA 1SK2A 4TXOA 5DBQA 4PURA 5D93A 3DMLA 5AGYA 4ICYA 3RHCA 3IAM2 3RPNA 2GTUA 1THOA 4L0UA 4A5PA 4LMVA 3U6VA 1ZGNA 2H01A 3IC4A 4FQUA 1YVLA 3HVVA 2LJRA 2H1LA 1K0AA 4MNNA 4HOJA 4IJIA 2H8LA 1M99A 3QFBC 3Q19A 1PX6A 3LYPA 5DDLA 3KP9A 1ERWA 1E2YA 4HJMA 2H6XA 4HQSA 3ZREA 3KD0A 3LJRA 4GTUA 1GH2A 4XRAA 5BMUB 3LXZA 2P5RA 3D4MA 1B4QA 2EIOA 4HDEA 20GSA 1IYHA 4EVMA 4HEA2 4N0ZA 4GDFA 3ZL5A 2GDRA 2YWIA 5IM9A 1V98A 1BF5A 1Z5YE 5DVBA 2L5OA 5G1LA 4I8BA 3A5WA 2P31A 3CBUA 2LV3A 1FAAA 3ZFBA 1GSQA 2FWEA 4KW6A 2MBSA 3C71A 4EE0A 3I43A 3TRXA 3VWXA 2UV8G 1MDJA 3GRXA 2H6ZA 3ME7A 3M1GA 4K8MA 4YAPA 3TOUA 3DGQA 4N0VA 1FG4A 1A2LA 2L6DA 3G7YA 5ECIB 4J57E 4EDZA 4DSSA 5J5NA 3F4RA 1GSFA 4ZB9A 1G7OA 2H70A 2LQQA 2VIMA 5EPFA 3GTUA 1SJZA 2PN8A 2R0PA 3TJJA 2H19A 5DJMA 1W4VA 3UIWA 1GRXA 3KMOA 4G10A 1SL1B 3MDKA 1ML6A 2H1AA 3TRPA 1EP7A 1I9DA 3E9JB 2OACA 4POLA 3M9KA 1F3AA 12GSA 4WR4A 4F9ZA 2CVBA 5D73A 3SBCA 3J7Yk 2O8VB 3C73A 5CP1A 2RUFA 2LRTA 3KIJA 4MZCA 3CYNA 2VD0A 3FZ9A 2JZRA 1QGVA 4L5OA 3GH9A 2VCTA 1U3AA 2A4HA 1OC8A 4XS6A 3GX8A 3TOTA 3KH7A 3F4SA 2B1LA 4POMA 4RI6A 4AKGA 4K6XA 6GSWA 2JZTA 1ERVA 5F05A 2CVKA 2QC7A 1TK0B 1T4ZA 3O76A 2E2GA 2FLSA 4HUAA 2GSRA 1TRSA 4Q5NA 5L71A 4V2NA 4BVXB 17GSA 2AV4A 1GTBA 1XOBA 1ZYEA 3K8NA 4AJ7A 2X4AA 3PPUA 4IKHA 2IN3A 1GSUA 1T7PB 5A5HB 4XRDA 2GZPA 3WT1A 3DVXA 3GN3A 2LRNA 4TN8A 1YJ6A 1UVZA 1EEJA 2YZHA 4PUAA 3CRTA 4EO3A 3D6IA 4IJ3A 1CQGA 5F0GA 1ACVA 2OE0A 4OFMA 3IBHA 3LWAA 3L4NA 2L5LA 1SL2B 1FOHA 2B5XA 1AAZA 1TTZA 1ZYQB 2HYXA 4PTSA 1PL1A 2GSTA 1TU7A 1OAZA 5HFIA 4KGIA 1GUHA 5JWOB 1SU9A 4KB3A 1SK1A 4G0KA 4IELA 5FT3A 5DJLA 4HU7A 3EMXA 1J9BA 2OE3A 3HD5A 1Z6NA 3GIXA 1XFLA 4I6XA 3GNJA 3W8SA 5CYYA 2XBQA 1M9AA 3QOUA 4YKFA 4EKZA 1YEPA 5AN1A 3HZ4A 2HI7A 2H6YA 3GHAA 1M2DA 2A2RA 4PUFC 4QL9A 2J9HA 4GRFA 2R0CA 4PQHA 2Z9SA 4IW9A 3FR6A 3EWLA 4OFNA 2O87A 2FA4A 1O7UA 3ZITA 2HSMA 3LGCA 2R5GA 2BJXA 4KCEA 2H71A 3UEMA 1URMA 2H1DA 2AUVA 2WB9A 3FW2A 3F8UA 4ZILA 4K5RA 2VCWA 4L5LA 4JRRA 4DSQA 2YN1A 1S3AA 2XC2A 5D96A 2VM2A 4O5UA 4AGSA 4KDYA 1TK5B 1N2AA 1ZMAA 2NTOA 4O7HA 2IPAA 1JZOA 4N10A 4ZBAA 3FKFA 5ELGA 4Z7XA 1GLPA 3VPTA 1F2EA 4K0NA 5B8AA 3M9JA 3AY8A 3IV4A 1V9WA 4J56E 2KP2A 3GSSA 3KTLA 2DJ1A 1ERUA 1OC9A 3F63A 2AHEA 3VPQA 4GSTA 3VK9A 4EF0A 2B7JA 2HZFA 1S3DA 3QCPA 4X43A 2XBIA 4WETA 4ZL8A 3MIXA 1JLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8W A;  5GAP D;  2VLT A;  3KCM A;  3QD9 A;  4ECC A;  3H4K A;  5ID2 A;  5CRE A;  2YNX A;  5B6N A;  5CRW A;  3IOS A;  1PGT A;  3QAG A;  2CX3 A;  3GUS A;  5IMC A;  3WGX A;  4NHW A;  1H75 A;  5H5R A;  2JL4 A;  4ZBB A;  2VOC A;  3IXR A;  2IFQ B;  4I2T A;  2V6K A;  2F3M A;  3EC3 A;  3GYK A;  1GSY A;  3TJB A;  2C0D A;  4HQZ A;  2DJ0 A;  3A3T A;  2O85 A;  2VO4 A;  5CRD A;  4JR4 A;  1JHB A;  2AJQ B;  1Z9H A;  2OKA A;  2PVQ A;  5ABR A;  2CZ2 A;  1KNG A;  2K8S A;  4EDY A;  2GSQ A;  2V6O A;  4E8H A;  2B5E A;  3TJK A;  2GS3 A;  2M72 A;  4AJ8 A;  3H1N A;  3PIN A;  2KHP A;  3MNG A;  4L0W A;  3FR3 A;  1TI3 A;  4BWQ A;  3TDG A;  2HSY A;  4V1A p;  2PGT A;  4GCI A;  3TKQ A;  5ECN B;  3TKS A;  2VLU A;  3DD3 A;  4D73 A;  5GZZ B;  4POB A;  3QR6 A;  5JCW A;  1H4O A;  3QFA C;  4DSS B;  1U6T A;  2WCI A;  3ZTL A;  1RK4 A;  3GA4 A;  1WOU A;  3VWW A;  2FCH A;  4KSO A;  2PPT A;  1BG5 A;  4FYC A;  4O32 A;  5IMV A;  1XCC A;  1MTC A;  2H0H A;  4GQF A;  4FIW A;  4NWY A;  1AUC A;  4EC0 A;  1TJD A;  2WGR A;  2A2S A;  1N8J A;  2H1G A;  1X9S B;  4QL7 A;  2R6K A;  1O6J A;  1VF1 A;  4DEJ A;  1SKS B;  4MZW A;  4ZB6 A;  18GS A;  2TRX A;  5C04 A;  2RLI A;  1B4P A;  1GUK A;  2VCZ A;  1B9Y C;  2HRN A;  1VF2 A;  1B8X A;  4GLT A;  4CHS A;  3I6A A;  2F51 A;  3KGK A;  1ZOF A;  1Y25 A;  2H74 A;  1F6M C;  3QAV A;  3VI5 A;  1GSD A;  2X99 A;  3F4T A;  4FYB A;  3P2A A;  5KN3 A;  1Z3E A;  2PWJ A;  4IGJ A;  4F03 A;  1A23 A;  2C1Y A;  5DQS A;  1FVJ A;  3C1R A;  4Q5F A;  3TB2 A;  1OE7 A;  4RQR A;  4WF4 A;  2ON5 A;  1XOA A;  3APQ A;  1X0R A;  2YAN A;  1JZW A;  1OKT A;  3UAP A;  1WE0 A;  1ST9 A;  3ZIJ A;  3LG6 A;  5DAL A;  4MPG A;  5IMZ A;  1QK8 A;  3BOA A;  4G2E A;  1GLQ A;  1MDK A;  2GVP A;  5DAK A;  2O89 A;  1KBN A;  2YWM A;  2CAI A;  1T3B A;  4WR5 A;  1JFU A;  1XXU A;  2MMN A;  4OCF A;  4IQ1 A;  2HZE B;  4ZXG A;  2O7K A;  4ZBD A;  2CVD A;  2M80 A;  4MCU A;  3APS A;  3CXG A;  4OO5 A;  2I4A A;  1ILO A;  2B7K A;  1WWJ A;  3GMF A;  3DWV A;  1UN2 A;  5ECS A;  4WEY A;  1OYJ A;  3WT2 A;  2CA8 A;  2HRK A;  3IK7 A;  1G7E A;  1IYI A;  1K0M A;  4GSS A;  1A2M A;  1PQN A;  2H1B A;  4XCS A;  2V1M A;  3C1S A;  1BYE A;  4IS0 A;  2MMZ A;  4BA7 A;  4HU9 A;  5H5S A;  2C3Q A;  2B5Y A;  4PNF A;  2HXK A;  2TRC P;  3HA9 A;  1G6W A;  5DCG A;  2HLS A;  2VAF A;  1O73 A;  2V2G A;  2FA8 A;  4TR1 B;  2VM1 A;  5E59 A;  2C0G A;  4G9H A;  5IMF A;  3VWU A;  3HVS A;  3BCI A;  5D8I A;  3FHK A;  3IR4 A;  3ZML A;  3EIN A;  1TK8 B;  4DVC A;  3US3 A;  6GSX A;  2JSY A;  2R4V A;  4MPF A;  3IA1 A;  3G7J A;  3U5R E;  4KA0 A;  3ZYW A;  2WZ9 A;  4XS4 A;  5ECO B;  4F0B A;  3IRA A;  1M7T A;  1ZZY A;  4OWY A;  3IPZ A;  1XVW A;  4P3Y B;  4DSR A;  2LUS A;  1LU4 A;  2HT9 A;  1TRV A;  4ZL7 A;  2RM6 A;  4OD7 A;  1DBY A;  4PQI A;  2B1K A;  2JU5 A;  1EV4 A;  1R7H A;  4FYU A;  4G0L A;  4EL1 A;  4L8E A;  2C4J A;  5KN1 A;  2H72 A;  1ZCP A;  2WFC A;  2LQO A;  3O6T A;  1X9W B;  4Q5Q A;  5G5F A;  4POK A;  4WBJ A;  2GSS A;  1NHY A;  4TRX A;  5FWG A;  3DVW A;  4LL1 B;  3CRU A;  1TW9 A;  4GF0 A;  2IMD A;  2DJK A;  3GUR A;  1NW2 A;  1KEB A;  3TKS C;  3VUR A;  1OC3 A;  2C0E A;  2KUC A;  1S3C A;  2VL2 C;  4OO4 A;  4OMV A;  1PD2 1;  5F07 A;  3APO A;  1QMV A;  3I9V 2;  1SKR B;  3E0U A;  1HNC A;  1AQV A;  2GZY A;  4ML6 A;  5HR3 A;  1GTA A;  1B9X C;  4F0C A;  5G2Z A;  3PGT A;  2LRC A;  4HZ2 A;  4HZ4 A;  1XWA A;  3VFI A;  1QUW A;  4BVY B;  5KEJ A;  1A8L A;  2WDU A;  1JZR A;  2ZUP A;  5IPG A;  1VF3 A;  3UVH A;  3KZQ A;  5BMU A;  2HRF A;  1XVQ A;  3TKS E;  1UC7 A;  3Q6O A;  4IQA A;  1BAY A;  6GSY A;  4TKY A;  3QPM A;  1WRY A;  4MAB A;  5IMA A;  1RQM A;  2IMF A;  4ECB A;  2WJU A;  1FB6 A;  2PUK C;  3QMX A;  1TRW A;  1M2B A;  1SD9 A;  2MMO A;  1HNA A;  3C7M A;  2PVO C;  1Z6M A;  1GUL A;  1EP8 A;  2ES7 A;  5B8B A;  3PR8 A;  3CTG A;  1T1V A;  1K0O A;  2EIR A;  3L9U A;  2N5B A;  2LTK A;  4MH3 A;  1YDK A;  1EV9 A;  4NAX A;  1I5G A;  3GKN A;  4GQC A;  5IMD A;  4MF6 A;  2H66 A;  1GSS A;  1THX A;  2QKE A;  3IE3 A;  4KH7 A;  1YF1 A;  2FY6 A;  2IME A;  2DJ2 A;  4XS1 A;  3W8J A;  2XPE A;  3IC8 A;  1Q4J A;  4IVF A;  2E0Q A;  2A4V A;  5F8B A;  2CAQ A;  3UL3 A;  1K3L A;  1QQ2 A;  7GSS A;  5B6M A;  1PX7 A;  1GP1 A;  1QXH A;  3WGE A;  3DIE A;  1OKD A;  4KDU A;  4MDC A;  4WKW A;  1WMJ A;  1YY7 A;  3TCO A;  2KLX A;  3A2V A;  3TKP A;  4V2L A;  1K3Y A;  4TOP A;  3UMA A;  5J41 A;  1VRS D;  1FO5 A;  3EVI A;  2I3Y A;  4KUN A;  1X9M B;  4BL7 B;  3N9J A;  1BED A;  3R3E A;  1U87 A;  4K2D A;  3GKX A;  1O8W A;  1DSB A;  3D22 A;  2G2Q A;  3EYT A;  3HZ8 A;  1A2J A;  1TKD B;  3P7X A;  5GAN D;  3H8Q A;  4K7O A;  5ELA A;  5ECM B;  3EU3 A;  2LKU A;  1M0U A;  1J08 A;  1F3B A;  2MZC A;  4LLR A;  3RBT A;  4BVX A;  2CQ9 A;  1WIK A;  2AAW A;  2FWG A;  4TXO B;  3WD6 A;  4X1U A;  1X5C A;  4MJA A;  2IWT A;  2X8H A;  3M8N A;  2HRA A;  5D9T A;  1PKW A;  3BD2 A;  5ECP B;  1TXX A;  1EEM A;  2C80 A;  3I69 A;  4MA9 A;  1XWB A;  2KOK A;  5DAL B;  1SKW B;  2PU9 C;  5AIX A;  2BTO T;  2LNT A;  2DC5 A;  5IO0 A;  4HJ2 A;  2K18 A;  1XWK A;  3EU4 A;  2GGT A;  3UJ1 A;  4V1A g;  3KMN A;  2OJL A;  3QAW A;  5AIS A;  4AF2 A;  3RAZ A;  4N30 A;  4PNG A;  2YCD A;  1K0D A;  4WF5 A;  3H79 A;  2K8V A;  2CV4 A;  4ML1 A;  1O8X A;  3GL5 A;  2YP6 A;  1XZO A;  1RW1 A;  1PMT A;  8GSS A;  3G7I A;  5IOX A;  2WUL A;  3VLN A;  2N5F A;  2N5A A;  2YWN A;  1SL0 B;  5C00 A;  2XPD A;  3BBY A;  3FYG A;  1U3I A;  1EWX A;  5KN2 A;  1DUG A;  2ZCT A;  2GQM A;  5HFG A;  1QFN A;  3NZN A;  2PBJ A;  1TDI A;  4XIH A;  3IK9 A;  2C8U A;  1A24 A;  1PL2 A;  3GTU B;  2LJK A;  4PQ1 A;  2ALB A;  2L57 A;  2UZ8 A;  2FWH A;  5D9X A;  2KP1 A;  2REM A;  5G1K A;  2WRT A;  6GSS A;  4MJB A;  5JWR B;  3D21 A;  2CT6 A;  1X5D A;  1BJX A;  3HKR A;  4V2M A;  2FNO A;  2P5Q A;  2C3T A;  2F8A A;  4N11 A;  2VL3 A;  2VLV A;  2JSZ A;  1GTI A;  3NOF A;  5F06 A;  2H0G A;  2YWO A;  1V40 A;  4MH2 A;  1OE8 A;  4MZB A;  4ACS A;  3FY7 A;  3EUR A;  4JBB A;  4TVE A;  4TR0 A;  3BJ5 A;  4MP4 A;  2L4Q A;  4EUY A;  2H0I A;  1R4W A;  1HD2 A;  4JR6 A;  2LNS A;  1JZD A;  2GLR A;  14GS A;  5LNK e;  1TI1 A;  5ENU A;  2E2M A;  4PX1 A;  1AXD A;  1GTU A;  4I97 A;  3IAS 2;  2CZ3 A;  3CSI A;  2B6M A;  4TR3 A;  5J3R A;  2K9F A;  4PXO A;  4MJC A;  5INY A;  2H73 A;  2X8C A;  4CW9 A;  1V57 A;  1TRU A;  2EC4 A;  6GSU A;  3N5O A;  3F3Q A;  2E7P A;  2AYT A;  2JAD A;  3ERF A;  4FO5 A;  3ERW A;  11GS A;  1V2A A;  5ECH B;  1G0T A;  1YZX A;  3ZMK A;  4YH2 A;  1Z7P A;  5A4U A;  2RM5 A;  1TOF A;  3L9S A;  4IP1 A;  4YQU A;  1WJK A;  4MLY A;  4TW5 A;  2IFQ A;  4RQX A;  2NDO A;  2MYG A;  2AB6 A;  4JE1 A;  2OBK A;  4E8E A;  4JED A;  4I5Q A;  2I81 A;  5J9B A;  5A4V A;  2VCX A;  3ISO A;  1A0R P;  5A5K A;  10GS A;  1EGO A;  1NHO A;  3O3T A;  1XW6 A;  3DXB A;  4K0G A;  1AQX A;  5GSS A;  1CQH A;  3L9V A;  1AC1 A;  1FB0 A;  3TKR A;  3LXT A;  3MSZ A;  1GWC A;  2X64 A;  3F0I A;  1LJR A;  1PSQ A;  1YEX A;  3LOR A;  3KXO A;  3WGD A;  3R2Q A;  1HQO A;  5ECQ B;  3F9U A;  3HCZ A;  1FW1 A;  1AW9 A;  4MF7 A;  1G6Y A;  1EOG A;  5AIV A;  2PER A;  5G5E A;  2MBT A;  2GT6 A;  1GNW A;  3KM6 A;  3TRQ A;  19GS A;  1O85 A;  3HJP A;  5ECK B;  1M2A A;  1SJ6 A;  4HS1 A;  2YPM A;  4H86 A;  1MEK A;  2HSM B;  2J23 A;  4CDO A;  1VF4 A;  3GKM A;  3ED3 A;  2V41 A;  1PKZ A;  1T00 A;  2VCQ A;  5D9V A;  5COH A;  3WYW A;  1SYR A;  2L59 A;  3TJF A;  4KAE A;  1SJI A;  3LSZ A;  3GL3 A;  4O5R A;  2PMT A;  3A2W A;  5HR0 A;  3FK8 A;  3UBK A;  1EZK A;  3DYR A;  1NSW A;  5EL8 A;  5DCH A;  1YKC A;  4K7I A;  16GS A;  4IN0 A;  2DIY A;  1T8E B;  3GFK A;  5D9W A;  3UAR A;  2V32 A;  1K3O A;  1XWC A;  1ON4 A;  3GV1 A;  4XHM A;  2DMM A;  3ZFL A;  1GSE A;  2YJH A;  2GQL A;  1OC9 B;  2L6C A;  2YV9 A;  4ZB8 A;  4J2F A;  3LYK A;  5IO2 A;  1JLW A;  2IMI A;  1GL8 A;  3CSJ A;  4RI7 A;  3FRC A;  5IOW A;  2K6V A;  2NPB A;  2R37 A;  1K0N A;  1C72 A;  5DQY A;  1FOV A;  2HSH A;  2HZE A;  3HVX A;  4GWR A;  5ID2 B;  3CSH A;  1F37 A;  4I2U A;  2G0F A;  3H93 A;  2I9H A;  4JU5 A;  1Z7R A;  5JWQ B;  1A8Y A;  1XW5 A;  3GH6 A;  2OA7 A;  2DSA A;  1HYU A;  3MWH A;  5EY6 A;  3UBL A;  4K1F A;  4K7N A;  3DEX A;  4NV5 A;  2HQT A;  4USS A;  1SEN A;  1X5E A;  4WXT A;  3C8E A;  2DIZ A;  2WS2 A;  2OE1 A;  2VUP A;  4GXZ A;  4G0I A;  4ISD A;  3FZA A;  5B7C A;  3FR9 A;  4TR1 A;  3HXS A;  4HI7 A;  4YAV A;  4IHU A;  3W6G A;  3PH9 A;  3GX0 A;  5CRG A;  2LJA A;  3L0H A;  5G30 A;  2MMA A;  3GKK A;  1EGR A;  1TU8 A;  4ZL9 A;  1SK0 A;  5IQY A;  4D73 B;  5IIZ A;  3ZVJ A;  3D0Z A;  1J0F A;  3MAK A;  1UA5 A;  3D5J A;  4NXI A;  3KP8 A;  4LMW A;  1GUM A;  2HNL A;  5IPH A;  3S9F A;  4NHZ A;  2B3S A;  3CMI A;  3LQ7 A;  4ID0 A;  1O81 A;  1MDI A;  1U88 A;  2YZU A;  1GNE A;  1ERT A;  2GT5 A;  2FUG 2;  4F2I A;  5CAX A;  3ME8 A;  1YF0 A;  4TXV A;  3ZLP A;  9GSS A;  2M46 A;  5CRH A;  2R3X A;  3F3R A;  2C3N A;  2C0F A;  5A4W A;  2DLX A;  3Q18 A;  2CX4 A;  2QGV A;  4KDX A;  4KF9 A;  1DE1 A;  1E6B A;  4Q5R A;  2LST A;  5HQP A;  5G31 A;  3JCM L;  3V1W A;  1K0C A;  2FD3 A;  5J9C A;  4BPY A;  2EIQ A;  3F6F A;  2HE3 A;  2H76 A;  4NV2 A;  5LCZ A;  3KJY A;  4F82 A;  3KEB A;  3RHB A;  1FVK A;  2DBC A;  4XTS A;  5J4U A;  4K9Z A;  4IP6 A;  3KH9 A;  3A2X A;  3CTF A;  22GS A;  5E4W A;  2VCV A;  1ZL9 A;  4WBR D;  1PA3 A;  4ZIJ A;  1PN9 A;  1Y6E A;  3FEU A;  4MF5 A;  3TJG A;  2FWF A;  4O92 A;  4JZQ A;  3ERG A;  1VGL A;  13GS A;  1YQ1 A;  5EVO A;  2YOI A;  3ZVJ D;  1HNB A;  1BQ7 A;  1XIY A;  1FHE A;  3VI7 A;  4BVY A;  5CO3 A;  2F9S A;  2L4C A;  2DJ3 A;  1AIU A;  5FHI A;  4BWS A;  5DAK B;  4YQV A;  4YQM A;  3SWL A;  3VWV A;  1Q98 A;  2P0G A;  2RII A;  2H75 A;  5HR2 A;  2GZZ A;  3DKS A;  2DJJ A;  3HJM A;  1W89 A;  3IHQ A;  3LFL A;  4IBP A;  3FZ4 A;  3M0F A;  3ZIV A;  3HYP A;  1LBK A;  2F8F A;  2I1U A;  1NM3 A;  2XHF A;  4ECJ A;  1XPV A;  3QDN A;  4NPB A;  3ZRD A;  1V58 A;  2VD1 A;  1PRX A;  1MD4 A;  1OVN A;  2ZNM A;  2VL9 A;  1SYX A;  1YKA A;  3DRN A;  4GSN A;  2HRK B;  2JZS A;  1M9B A;  1SD8 A;  4LL4 B;  3TUE A;  2IIY A;  1WP0 A;  5GST A;  3P90 A;  5CNW A;  1R5P A;  3OR5 A;  3F6D A;  4KE3 A;  5JCG A;  2X8G A;  2H30 A;  3EMP A;  4FH8 A;  2IL3 A;  2ON7 A;  3TGZ A;  3E3E A;  5LD0 A;  1F9M A;  3HY2 A;  5ECR B;  4TR4 A;  3KTB A;  1R5A A;  4ECI A;  5JCU A;  3J7Y b;  1MD3 A;  1K0B A;  3HJO A;  5ECL B;  1XBS A;  2HFD A;  2YV7 A;  1XWG A;  2VL2 A;  1TP9 A;  2LS5 A;  1KTE A;  2FHE A;  3IDV A;  1DE2 A;  3RPP A;  2D2Z A;  2NBS A;  1USB A;  4XS4 B;  6GSV A;  3L78 A;  2TIR A;  4KSM A;  3D4T A;  1BX9 A;  1EOH A;  4KX4 A;  3HDC A;  4MK3 A;  1XW9 A;  4QQ7 A;  2QSI A;  4LA1 A;  2FGX A;  3Q74 A;  4G19 A;  4MJE A;  5KN0 A;  5HFK A;  4AJ6 A;  3LEF A;  2OBI A;  4MMM A;  3ZZX A;  3HHV A;  3RDW A;  2LEG A;  4ILF A;  3FZ5 A;  2NVL A;  4X0X A;  4EXJ A;  4NMU A;  2RUE A;  1WPI A;  4BL7 A;  1A0F A;  3EE2 A;  4PGT A;  2HSN B;  2R2J A;  1T4Y A;  2GQK A;  2YJ7 A;  3BCK A;  1AQW A;  6GST A;  2JAC A;  2IJY A;  5HR1 A;  3G9B A;  2IMK A;  3NIV A;  5H5Q A;  3UOM A;  3UVT A;  1B48 A;  3M3M A;  1R26 A;  3GST A;  4KCA A;  4RUV A;  2OAD A;  2BMX A;  4OCE A;  4ULX A;  4OFT A;  1ABA A;  2DML A;  4KND A;  1SK2 A;  4TXO A;  5DBQ A;  4PUR A;  5D93 A;  3DML A;  5AGY A;  3RHC A;  3IAM 2;  3RPN A;  2GTU A;  1THO A;  4L0U A;  4LMV A;  3U6V A;  1ZGN A;  2H01 A;  3IC4 A;  4FQU A;  3HVV A;  2LJR A;  1K0A A;  4HOJ A;  4IJI A;  2H8L A;  1M99 A;  3QFB C;  3Q19 A;  1PX6 A;  3LYP A;  5DDL A;  3KP9 A;  1ERW A;  1E2Y A;  4HJM A;  2H6X A;  4HQS A;  3ZRE A;  3KD0 A;  3LJR A;  4GTU A;  1GH2 A;  4XRA A;  3LXZ A;  2P5R A;  3D4M A;  1B4Q A;  2EIO A;  4HDE A;  20GS A;  1IYH A;  4EVM A;  4HEA 2;  4N0Z A;  3ZL5 A;  2GDR A;  2YWI A;  5IM9 A;  1V98 A;  1Z5Y E;  5DVB A;  2L5O A;  5G1L A;  4I8B A;  3A5W A;  2P31 A;  3CBU A;  2LV3 A;  1FAA A;  3ZFB A;  1GSQ A;  2FWE A;  4KW6 A;  2MBS A;  3C71 A;  4EE0 A;  3I43 A;  3TRX A;  3VWX A;  1MDJ A;  3GRX A;  2H6Z A;  3ME7 A;  3M1G A;  4K8M A;  4YAP A;  3TOU A;  3DGQ A;  4N0V A;  1FG4 A;  1A2L A;  2L6D A;  3G7Y A;  5ECI B;  4J57 E;  4EDZ A;  4DSS A;  5J5N A;  3F4R A;  1GSF A;  4ZB9 A;  1G7O A;  2H70 A;  2LQQ A;  2VIM A;  5EPF A;  3GTU A;  1SJZ A;  2PN8 A;  3TJJ A;  2H19 A;  5DJM A;  1W4V A;  3UIW A;  1GRX A;  3KMO A;  4G10 A;  1SL1 B;  3MDK A;  1ML6 A;  2H1A A;  3TRP A;  1EP7 A;  1I9D A;  3E9J B;  2OAC A;  4POL A;  3M9K A;  1F3A A;  12GS A;  4WR4 A;  4F9Z A;  2CVB A;  5D73 A;  3SBC A;  3J7Y k;  2O8V B;  3C73 A;  5CP1 A;  2RUF A;  2LRT A;  3KIJ A;  4MZC A;  3CYN A;  2VD0 A;  3FZ9 A;  2JZR A;  1QGV A;  4L5O A;  3GH9 A;  2VCT A;  1U3A A;  1OC8 A;  4XS6 A;  3GX8 A;  3TOT A;  3KH7 A;  3F4S A;  2B1L A;  4POM A;  4RI6 A;  4K6X A;  6GSW A;  2JZT A;  1ERV A;  5F05 A;  2CVK A;  2QC7 A;  1TK0 B;  1T4Z A;  3O76 A;  2E2G A;  2FLS A;  4HUA A;  2GSR A;  1TRS A;  4Q5N A;  5L71 A;  4V2N A;  4BVX B;  17GS A;  2AV4 A;  1GTB A;  1XOB A;  1ZYE A;  3K8N A;  4AJ7 A;  3PPU A;  4IKH A;  2IN3 A;  1GSU A;  1T7P B;  4XRD A;  2GZP A;  3WT1 A;  3DVX A;  3GN3 A;  2LRN A;  4TN8 A;  1YJ6 A;  1UVZ A;  1EEJ A;  4PUA A;  3CRT A;  2YZH A;  4EO3 A;  3D6I A;  4IJ3 A;  1CQG A;  5F0G A;  1ACV A;  2OE0 A;  4OFM A;  3IBH A;  3LWA A;  3L4N A;  2L5L A;  1SL2 B;  2B5X A;  1AAZ A;  1TTZ A;  1ZYQ B;  2HYX A;  4PTS A;  1PL1 A;  2GST A;  1TU7 A;  1OAZ A;  5HFI A;  4KGI A;  1GUH A;  5JWO B;  1SU9 A;  4KB3 A;  1SK1 A;  4G0K A;  4IEL A;  5FT3 A;  5DJL A;  4HU7 A;  3EMX A;  1J9B A;  2OE3 A;  3HD5 A;  1Z6N A;  4I6X A;  3GIX A;  1XFL A;  3GNJ A;  3W8S A;  5CYY A;  2XBQ A;  1M9A A;  3QOU A;  4EKZ A;  1YEP A;  5AN1 A;  3HZ4 A;  2HI7 A;  2H6Y A;  3GHA A;  1M2D A;  2A2R A;  4PUF C;  4QL9 A;  2J9H A;  4GRF A;  4PQH A;  2Z9S A;  4IW9 A;  3FR6 A;  3EWL A;  4OFN A;  2O87 A;  2FA4 A;  1O7U A;  3ZIT A;  2HSM A;  3LGC A;  2R5G A;  2BJX A;  4KCE A;  2H71 A;  3UEM A;  1URM A;  2H1D A;  2AUV A;  2WB9 A;  3FW2 A;  3F8U A;  4ZIL A;  2VCW A;  4L5L A;  4JRR A;  4DSQ A;  2YN1 A;  1S3A A;  2XC2 A;  5D96 A;  2VM2 A;  4AGS A;  4KDY A;  1TK5 B;  1N2A A;  1ZMA A;  2NTO A;  4O7H A;  2IPA A;  1JZO A;  4N10 A;  4ZBA A;  3FKF A;  5ELG A;  4Z7X A;  1GLP A;  3VPT A;  1F2E A;  4K0N A;  5B8A A;  3M9J A;  3AY8 A;  3IV4 A;  1V9W A;  4J56 E;  2KP2 A;  3GSS A;  3KTL A;  2DJ1 A;  1ERU A;  1OC9 A;  3F63 A;  2AHE A;  3VPQ A;  4GST A;  3VK9 A;  4EF0 A;  2B7J A;  2HZF A;  1S3D A;  3QCP A;  4X43 A;  2XBI A;  4WET A;  4ZL8 A;  1JLV A; 
#chains in the Genus database with same CATH topology
 3P8W A;  2R0G A;  5GAP D;  2VLT A;  3KCM A;  3QD9 A;  4ECC A;  3H4K A;  5ID2 A;  5CRE A;  2YNX A;  5B6N A;  5CRW A;  3IOS A;  1PGT A;  3QAG A;  2CX3 A;  3GUS A;  5IMC A;  3WGX A;  4NHW A;  1H75 A;  5H5R A;  2JL4 A;  4ZBB A;  2VOC A;  3IXR A;  2IFQ B;  4I2T A;  2V6K A;  2F3M A;  3EC3 A;  3GYK A;  1GSY A;  3TJB A;  2C0D A;  4HQZ A;  2DJ0 A;  3A3T A;  2O85 A;  2VO4 A;  5CRD A;  4JR4 A;  1JHB A;  2AJQ B;  1Z9H A;  2OKA A;  2PVQ A;  5ABR A;  2CZ2 A;  1KNG A;  2K8S A;  4EDY A;  2GSQ A;  2V6O A;  4E8H A;  2B5E A;  3TJK A;  2GS3 A;  2M72 A;  4AJ8 A;  3H1N A;  3PIN A;  2KHP A;  3MNG A;  4L0W A;  3FR3 A;  1TI3 A;  4BWQ A;  3TDG A;  2HSY A;  4V1A p;  2PGT A;  4GCI A;  3TKQ A;  3MYD A;  5ECN B;  4E68 A;  3TKS A;  2VLU A;  3DD3 A;  4D73 A;  5GZZ B;  4POB A;  3QR6 A;  5JCW A;  1H4O A;  3QFA C;  4DSS B;  1U6T A;  2WCI A;  3ZTL A;  1RK4 A;  4N3Z A;  3GA4 A;  1WOU A;  3VWW A;  2FCH A;  4KSO A;  2PPT A;  1BG5 A;  4FYC A;  4O5Q A;  4O32 A;  5IMV A;  1XCC A;  2O3E A;  1MTC A;  2H0H A;  4GQF A;  4FIW A;  4NWY A;  1AUC A;  4EC0 A;  1TJD A;  2WGR A;  2A2S A;  1N8J A;  2H1G A;  1X9S B;  4QL7 A;  2R6K A;  1O6J A;  1VF1 A;  4DEJ A;  1SKS B;  4MZW A;  4ZB6 A;  2WW3 A;  18GS A;  2TRX A;  5C04 A;  2RLI A;  1B4P A;  1GUK A;  2VCZ A;  1B9Y C;  2HRN A;  1M3J A;  1VF2 A;  1B8X A;  4GLT A;  5J4Y A;  4CHS A;  3I6A A;  2F51 A;  3KGK A;  1ZOF A;  1Y25 A;  2H74 A;  1F6M C;  3QAV A;  3VI5 A;  1GSD A;  2X99 A;  3F4T A;  4CY8 A;  4FYB A;  3P2A A;  2WVZ A;  5KN3 A;  1SVO A;  1Z3E A;  2PWJ A;  4IGJ A;  4F03 A;  1A23 A;  2C1Y A;  5DQS A;  1FVJ A;  3C1R A;  2WW2 A;  4Q5F A;  3TB2 A;  1OE7 A;  4RQR A;  3LW9 A;  4WF4 A;  2ON5 A;  1XOA A;  3APQ A;  1X0R A;  2YAN A;  1JZW A;  1OKT A;  3UAP A;  1WE0 A;  1ST9 A;  3ZIJ A;  3LG6 A;  4YKG A;  5DAL A;  4MPG A;  5IMZ A;  1QK8 A;  3CWG A;  3BOA A;  4G2E A;  1GLQ A;  1MDK A;  2GVP A;  5DAK A;  2O89 A;  1KBN A;  2YWM A;  2CAI A;  1T3B A;  4WR5 A;  1JFU A;  1XXU A;  2MMN A;  4OCF A;  4IQ1 A;  2HZE B;  4ZXG A;  2O7K A;  4ZBD A;  2CVD A;  2M80 A;  4MCU A;  3APS A;  5KOW A;  3CXG A;  4OO5 A;  2I4A A;  1ILO A;  2B7K A;  1WWJ A;  3GMF A;  3DWV A;  1UN2 A;  5ECS A;  4WEY A;  1OYJ A;  3WT2 A;  2CA8 A;  2HRK A;  3IK7 A;  1G7E A;  3EPT A;  1IYI A;  1K0M A;  4GSS A;  1A2M A;  1PQN A;  2H1B A;  4XCS A;  2V1M A;  3C1S A;  3HVN A;  1BYE A;  4IS0 A;  2MMZ A;  4BA7 A;  4HU9 A;  5H5S A;  2C3Q A;  2B5Y A;  4PNF A;  2HXK A;  2TRC P;  3HA9 A;  1G6W A;  5DCG A;  2HLS A;  2VAF A;  1O73 A;  2V2G A;  2FA8 A;  4TR1 B;  2VM1 A;  5E59 A;  2C0G A;  4G9H A;  5IMF A;  3VWU A;  1SVM A;  3HVS A;  3BCI A;  5D8I A;  3FHK A;  1S3R A;  3IR4 A;  3ZML A;  3EIN A;  1TK8 B;  4DVC A;  3US3 A;  6GSX A;  2JSY A;  2R4V A;  4MPF A;  3IA1 A;  3G7J A;  3U5R E;  4KA0 A;  3ZYW A;  2WZ9 A;  4XS4 A;  5ECO B;  4F0B A;  3IRA A;  1M7T A;  1ZZY A;  4OWY A;  3IPZ A;  1XVW A;  4P3Y B;  4DSR A;  2LUS A;  1LU4 A;  2HT9 A;  1TRV A;  4ZL7 A;  2RM6 A;  4OD7 A;  1DBY A;  4PQI A;  2B1K A;  2JU5 A;  1EV4 A;  1R7H A;  4FYU A;  4G0L A;  4EL1 A;  4L8E A;  2C4J A;  4PI2 C;  5KN1 A;  2H72 A;  1ZCP A;  2WFC A;  2LQO A;  3O6T A;  1X9W B;  4Q5Q A;  5G5F A;  2EFD A;  4POK A;  4WBJ A;  2GSS A;  1NHY A;  4TRX A;  5FWG A;  3DVW A;  4LL1 B;  3CRU A;  1TW9 A;  4GF0 A;  2IMD A;  2DJK A;  3GUR A;  1NW2 A;  4PHZ C;  1KEB A;  3TKS C;  3VUR A;  1OC3 A;  2C0E A;  2KUC A;  1S3C A;  2VL2 C;  4OO4 A;  4OMV A;  1PD2 1;  5F07 A;  3APO A;  1QMV A;  3I9V 2;  1SKR B;  3E0U A;  1HNC A;  1AQV A;  2GZY A;  4ML6 A;  5HR3 A;  1GTA A;  1B9X C;  4F0C A;  1Y1U A;  5G2Z A;  3PGT A;  2LRC A;  4HZ2 A;  4HZ4 A;  1XWA A;  3VFI A;  1QUW A;  4BVY B;  5KEJ A;  1A8L A;  2WDU A;  1JZR A;  2ZUP A;  5IPG A;  1VF3 A;  3UVH A;  3KZQ A;  5BMU A;  2HRF A;  1XVQ A;  3TKS E;  1UC7 A;  3Q6O A;  4IQA A;  1BAY A;  6GSY A;  4TKY A;  5A34 A;  3QPM A;  1WRY A;  3IHG A;  4MAB A;  5IMA A;  1RQM A;  2IMF A;  4ECB A;  5KOX A;  2WJU A;  1FB6 A;  2PUK C;  3QMX A;  1TRW A;  1M2B A;  1SD9 A;  4Z2R A;  2MMO A;  1HNA A;  3C7M A;  2PVO C;  1Z6M A;  1GUL A;  1EP8 A;  2ES7 A;  5B8B A;  3PR8 A;  3CTG A;  2WW1 A;  1T1V A;  1K0O A;  5A1N A;  2EIR A;  3L9U A;  2N5B A;  2LTK A;  4MH3 A;  1YDK A;  1EV9 A;  4NAX A;  1I5G A;  3GKN A;  4GQC A;  5IMD A;  4MF6 A;  2H66 A;  1GSS A;  1THX A;  2QKE A;  3IE3 A;  2DKI A;  4KH7 A;  1YF1 A;  2FY6 A;  2IME A;  2DJ2 A;  4XS1 A;  3W8J A;  2XPE A;  3IC8 A;  4CY6 A;  1Q4J A;  4IVF A;  2E0Q A;  2A4V A;  5F8B A;  2CAQ A;  3UL3 A;  1K3L A;  1QQ2 A;  7GSS A;  5B6M A;  1PX7 A;  1GP1 A;  1QXH A;  3WGE A;  3DIE A;  1OKD A;  4KDU A;  4MDC A;  4WKW A;  1WMJ A;  1YY7 A;  3TCO A;  2KLX A;  3A2V A;  3TKP A;  4V2L A;  1K3Y A;  4TOP A;  3UMA A;  5J41 A;  1VRS D;  1FO5 A;  3EVI A;  2I3Y A;  4KUN A;  1X9M B;  4BL7 B;  3N9J A;  1BED A;  3R3E A;  1U87 A;  4K2D A;  3GKX A;  1O8W A;  1DSB A;  3D22 A;  2G2Q A;  3EYT A;  3HZ8 A;  1A2J A;  1TKD B;  3P7X A;  5GAN D;  3H8Q A;  4K7O A;  5ELA A;  5ECM B;  3EU3 A;  2LKU A;  1M0U A;  1J08 A;  1F3B A;  2MZC A;  4LLR A;  3RBT A;  4BVX A;  2CQ9 A;  1WIK A;  2AAW A;  2FWG A;  4TXO B;  3WD6 A;  4X1U A;  1X5C A;  3A5I A;  4MJA A;  2IWT A;  2X8H A;  3M8N A;  2HRA A;  5D9T A;  1PKW A;  3BD2 A;  5A5H A;  5ECP B;  1TXX A;  1EEM A;  2C80 A;  3I69 A;  4Z2U A;  4MA9 A;  1XWB A;  2KOK A;  5DAL B;  1SKW B;  2PU9 C;  5AIX A;  2BTO T;  2LNT A;  2DC5 A;  5IO0 A;  4HJ2 A;  2K18 A;  1XWK A;  3EU4 A;  2GGT A;  3UJ1 A;  4V1A g;  3KMN A;  2OJL A;  3QAW A;  5AIS A;  4AF2 A;  3RAZ A;  4N30 A;  1N25 A;  4PNG A;  2YCD A;  1K0D A;  4WF5 A;  3H79 A;  2K8V A;  2CV4 A;  4ML1 A;  2WW0 A;  1O8X A;  3GL5 A;  2YP6 A;  1XZO A;  4ZB7 A;  1RW1 A;  1PMT A;  8GSS A;  3G7I A;  5IOX A;  2WUL A;  3VLN A;  2N5F A;  2N5A A;  2YWN A;  1SL0 B;  2QA2 A;  5C00 A;  2XPD A;  3BBY A;  3FYG A;  1U3I A;  1EWX A;  5KN2 A;  1DUG A;  2ZCT A;  2GQM A;  4FXY P;  5HFG A;  1QFN A;  3NZN A;  2PBJ A;  1TDI A;  4XIH A;  3FMW A;  3IK9 A;  2C8U A;  1A24 A;  2O36 A;  1PL2 A;  3GTU B;  2LJK A;  4PQ1 A;  2ALB A;  2L57 A;  2UZ8 A;  2FWH A;  5D9X A;  2DKH A;  2KP1 A;  2REM A;  5G1K A;  2WRT A;  6GSS A;  4MJB A;  5JWR B;  3D21 A;  2CT6 A;  1X5D A;  1BJX A;  3HKR A;  4V2M A;  2FNO A;  2P5Q A;  2C3T A;  2F8A A;  4N11 A;  2VL3 A;  2VLV A;  2JSZ A;  1GTI A;  3NOF A;  5F06 A;  2H0G A;  2YWO A;  1V40 A;  4MH2 A;  1OE8 A;  4MZB A;  4ACS A;  3FY7 A;  3EUR A;  4HSC X;  4JBB A;  4TVE A;  4TR0 A;  3BJ5 A;  4MP4 A;  2L4Q A;  4EUY A;  2H0I A;  1R4W A;  1HD2 A;  4JR6 A;  2LNS A;  1JZD A;  5J47 A;  2GLR A;  14GS A;  5LNK e;  3CHX C;  1TI1 A;  5ENU A;  2E2M A;  4PX1 A;  1AXD A;  1GTU A;  4EIQ A;  4I97 A;  3IAS 2;  2WZS A;  2CZ3 A;  3CSI A;  2B6M A;  4TR3 A;  5J3R A;  2K9F A;  4PXO A;  4MJC A;  5INY A;  2H73 A;  1BG1 A;  2X8C A;  4CW9 A;  1V57 A;  1TRU A;  2EC4 A;  4BIK A;  4QMK A;  6GSU A;  3N5O A;  3F3Q A;  2E7P A;  2AYT A;  2JAD A;  3ERF A;  4FO5 A;  3ERW A;  11GS A;  1V2A A;  1PN0 A;  5ECH B;  1G0T A;  1YZX A;  3ZMK A;  4YH2 A;  1Z7P A;  5A4U A;  2RM5 A;  1TOF A;  3L9S A;  4IP1 A;  4YQU A;  1WJK A;  4MLY A;  4TW5 A;  2IFQ A;  4RQX A;  5J40 A;  2NDO A;  2MYG A;  2AB6 A;  4JE1 A;  5A34 B;  2OBK A;  4E8E A;  4JED A;  4I5Q A;  2I81 A;  5J9B A;  5A4V A;  2VCX A;  3ISO A;  1A0R P;  5A5K A;  10GS A;  1EGO A;  1NHO A;  3O3T A;  1XW6 A;  3DXB A;  4K0G A;  3RGB C;  1AQX A;  5GSS A;  1CQH A;  3L9V A;  1AC1 A;  1FB0 A;  3TKR A;  3LXT A;  3MSZ A;  3CQF A;  1GWC A;  2X64 A;  3F0I A;  1LJR A;  1PSQ A;  1YEX A;  3LOR A;  3KXO A;  3WGD A;  3R2Q A;  5A1N B;  1HQO A;  5ECQ B;  3F9U A;  3HCZ A;  1FW1 A;  1AW9 A;  4MF7 A;  1G6Y A;  1EOG A;  5AIV A;  2PER A;  5G5E A;  2MBT A;  2GT6 A;  1GNW A;  3KM6 A;  3TRQ A;  19GS A;  1O85 A;  3HJP A;  5ECK B;  1M2A A;  1SJ6 A;  4HS1 A;  2YPM A;  4H86 A;  1MEK A;  2HSM B;  2J23 A;  4CDO A;  1VF4 A;  3GKM A;  1PFO A;  4PI0 C;  3ED3 A;  2V41 A;  1PKZ A;  1T00 A;  2VCQ A;  5D9V A;  5COH A;  4Z2T A;  3WYW A;  1SYR A;  2WVX A;  2L59 A;  3TJF A;  4KAE A;  1SJI A;  3LSZ A;  3GL3 A;  4O5R A;  2PMT A;  3A2W A;  5HR0 A;  3FK8 A;  4AKI A;  4G01 A;  2HSN A;  3UBK A;  1EZK A;  3DYR A;  1NSW A;  5EL8 A;  5DCH A;  1YKC A;  4K7I A;  3TU3 B;  16GS A;  4IN0 A;  1XG8 A;  2DIY A;  5J4V A;  1T8E B;  3GFK A;  5D9W A;  3UAR A;  2V32 A;  1K3O A;  1XWC A;  1ON4 A;  3GV1 A;  4XHM A;  2DMM A;  3ZFL A;  1GSE A;  2YJH A;  2GQL A;  1OC9 B;  2L6C A;  2YV9 A;  4ZB8 A;  2OT3 A;  4J2F A;  3LYK A;  5IO2 A;  1JLW A;  2IMI A;  1GL8 A;  3CSJ A;  4RI7 A;  3FRC A;  5IOW A;  2K6V A;  2NPB A;  2R37 A;  1K0N A;  1C72 A;  5DQY A;  1FOV A;  2HSH A;  2HZE A;  3HVX A;  4GWR A;  5ID2 B;  3CSH A;  1F37 A;  4I2U A;  2G0F A;  3H93 A;  2I9H A;  4JU5 A;  1Z7R A;  5JWQ B;  1A8Y A;  1XW5 A;  3GH6 A;  2OA7 A;  2DSA A;  1HYU A;  3MWH A;  5EY6 A;  3UBL A;  4K1F A;  4K7N A;  3DEX A;  4NV5 A;  2HQT A;  4USS A;  1SEN A;  1X5E A;  4WXT A;  3C8E A;  2DIZ A;  2WS2 A;  1SVL A;  2OE1 A;  2VUP A;  4GXZ A;  4G0I A;  4ISD A;  3FZA A;  5B7C A;  3FR9 A;  4TR1 A;  3HXS A;  4HI7 A;  4YAV A;  4IHU A;  3W6G A;  3PH9 A;  3GX0 A;  5CRG A;  2LJA A;  3L0H A;  5G30 A;  3HMJ G;  2MMA A;  3GKK A;  1EGR A;  1TU8 A;  4ZL9 A;  1SK0 A;  5IQY A;  2X49 A;  4D73 B;  5IIZ A;  4EIP A;  3ZVJ A;  3D0Z A;  1J0F A;  3MAK A;  1UA5 A;  3D5J A;  4NXI A;  2EFC A;  3KP8 A;  4LMW A;  1GUM A;  2HNL A;  5IPH A;  3S9F A;  4NHZ A;  2B3S A;  3CMI A;  3LQ7 A;  4ID0 A;  1O81 A;  1MDI A;  1U88 A;  2YZU A;  1GNE A;  1ERT A;  2GT5 A;  2VKZ G;  2FUG 2;  4F2I A;  5CAX A;  3ME8 A;  1YF0 A;  4TXV A;  3ZLP A;  9GSS A;  2M46 A;  5CRH A;  2R3X A;  3F3R A;  2C3N A;  2C0F A;  5A4W A;  2DLX A;  3Q18 A;  2CX4 A;  2QGV A;  4KDX A;  4KF9 A;  1DE1 A;  1E6B A;  4Q5R A;  2LST A;  5HQP A;  5G31 A;  3RFR C;  3JCM L;  3V1W A;  1K0C A;  2FD3 A;  4X4J A;  5J9C A;  4AKH A;  4BPY A;  2EIQ A;  3F6F A;  2HE3 A;  2H76 A;  4NV2 A;  5LCZ A;  3KJY A;  4F82 A;  3KEB A;  3RHB A;  1FVK A;  2DBC A;  4XTS A;  5J4U A;  4K9Z A;  4IP6 A;  3KH9 A;  3A2X A;  2O5V A;  3CTF A;  22GS A;  5E4W A;  2VCV A;  1ZL9 A;  4WBR D;  1PA3 A;  4ZIJ A;  1PN9 A;  1Y6E A;  3FEU A;  4MF5 A;  3TJG A;  2FWF A;  4O92 A;  4JZQ A;  3ERG A;  4AKX B;  1VGL A;  13GS A;  1YQ1 A;  5EVO A;  2YOI A;  3ZVJ D;  1HNB A;  1BQ7 A;  1XIY A;  1FHE A;  2EFE A;  3VI7 A;  4BVY A;  5CO3 A;  2F9S A;  2A2P A;  2L4C A;  2DJ3 A;  1AIU A;  5FHI A;  4BWS A;  5DAK B;  4YQV A;  4YQM A;  3SWL A;  3VWV A;  1Q98 A;  2P0G A;  2RII A;  2H75 A;  5HR2 A;  2GZZ A;  3DKS A;  2DJJ A;  3HJM A;  1W89 A;  3IHQ A;  3LFL A;  4IBP A;  3FZ4 A;  3M0F A;  3ZIV A;  2EFH A;  3HYP A;  1LBK A;  2F8F A;  2I1U A;  1NM3 A;  2XHF A;  4ECJ A;  1XPV A;  3QDN A;  4NPB A;  3ZRD A;  1V58 A;  2VD1 A;  1PRX A;  1MD4 A;  1OVN A;  4W66 A;  4K5S A;  2ZNM A;  2VL9 A;  1SYX A;  1YKA A;  3DRN A;  4GSN A;  2HRK B;  2JZS A;  1M9B A;  1SD8 A;  4LL4 B;  3TUE A;  1M3I A;  2IIY A;  1WP0 A;  5GST A;  3P90 A;  5CNW A;  1R5P A;  3OR5 A;  3F6D A;  4KE3 A;  5JCG A;  2X8G A;  2H30 A;  3EMP A;  4FH8 A;  2IL3 A;  2ON7 A;  3TGZ A;  3E3E A;  5LD0 A;  1F9M A;  3HY2 A;  5ECR B;  1TXU A;  4TR4 A;  1ZYN A;  3KTB A;  1R5A A;  4ECI A;  5JCU A;  3J7Y b;  1MD3 A;  1K0B A;  3HJO A;  5ECL B;  5BRT A;  4K2X A;  1XBS A;  2HFD A;  2YV7 A;  1XWG A;  2VL2 A;  4AI6 A;  1TP9 A;  2LS5 A;  1KTE A;  2FHE A;  3IDV A;  1DE2 A;  3RPP A;  2D2Z A;  2NBS A;  1USB A;  4XS4 B;  6GSV A;  3L78 A;  2TIR A;  4KSM A;  3D4T A;  1BX9 A;  1EOH A;  4KX4 A;  3HDC A;  2WVY A;  4MK3 A;  1XW9 A;  4QQ7 A;  2QSI A;  4LA1 A;  2FGX A;  3Q74 A;  4G19 A;  4MJE A;  5KN0 A;  5HFK A;  4AJ6 A;  3LEF A;  2OBI A;  4MMM A;  3ZZX A;  3HHV A;  3RDW A;  2LEG A;  4ILF A;  3FZ5 A;  2NVL A;  2WVX B;  4X0X A;  4EXJ A;  4NMU A;  2RUE A;  1WPI A;  4BL7 A;  1A0F A;  3EE2 A;  4PGT A;  2HSN B;  2R2J A;  1T4Y A;  2GQK A;  2YJ7 A;  3BCK A;  1AQW A;  6GST A;  2JAC A;  2IJY A;  5HR1 A;  3G9B A;  2IMK A;  3NIV A;  5H5Q A;  1ZYP A;  3UOM A;  3UVT A;  1B48 A;  2QA1 A;  3M3M A;  1R26 A;  3GST A;  4KCA A;  4RUV A;  2OAD A;  2BMX A;  4OCE A;  4ULX A;  4OFT A;  1ABA A;  2DML A;  4KND A;  1SK2 A;  4TXO A;  5DBQ A;  4PUR A;  5D93 A;  3DML A;  5AGY A;  4ICY A;  3RHC A;  3IAM 2;  3RPN A;  2GTU A;  1THO A;  4L0U A;  4A5P A;  4LMV A;  3U6V A;  1ZGN A;  2H01 A;  3IC4 A;  4FQU A;  1YVL A;  3HVV A;  2LJR A;  2H1L A;  1K0A A;  4MNN A;  4HOJ A;  4IJI A;  2H8L A;  1M99 A;  3QFB C;  3Q19 A;  1PX6 A;  3LYP A;  5DDL A;  3KP9 A;  1ERW A;  1E2Y A;  4HJM A;  2H6X A;  4HQS A;  3ZRE A;  3KD0 A;  3LJR A;  4GTU A;  1GH2 A;  4XRA A;  5BMU B;  3LXZ A;  2P5R A;  3D4M A;  1B4Q A;  2EIO A;  4HDE A;  20GS A;  1IYH A;  4EVM A;  4HEA 2;  4N0Z A;  4GDF A;  3ZL5 A;  2GDR A;  2YWI A;  5IM9 A;  1V98 A;  1BF5 A;  1Z5Y E;  5DVB A;  2L5O A;  5G1L A;  4I8B A;  3A5W A;  2P31 A;  3CBU A;  2LV3 A;  1FAA A;  3ZFB A;  1GSQ A;  2FWE A;  4KW6 A;  2MBS A;  3C71 A;  4EE0 A;  3I43 A;  3TRX A;  1YEW C;  3VWX A;  2UV8 G;  1MDJ A;  3GRX A;  2H6Z A;  3ME7 A;  3M1G A;  4K8M A;  4YAP A;  3TOU A;  3DGQ A;  4N0V A;  1FG4 A;  1A2L A;  2L6D A;  3G7Y A;  5ECI B;  4J57 E;  4EDZ A;  4DSS A;  5J5N A;  3F4R A;  1GSF A;  4ZB9 A;  1G7O A;  2H70 A;  2LQQ A;  2VIM A;  5EPF A;  3GTU A;  1SJZ A;  2PN8 A;  2R0P A;  3TJJ A;  2H19 A;  5DJM A;  1W4V A;  3UIW A;  1GRX A;  3KMO A;  4G10 A;  1SL1 B;  3MDK A;  1ML6 A;  2H1A A;  3TRP A;  1EP7 A;  1I9D A;  3E9J B;  2OAC A;  4POL A;  3M9K A;  1F3A A;  12GS A;  4WR4 A;  4F9Z A;  2CVB A;  5D73 A;  3SBC A;  3J7Y k;  2O8V B;  3C73 A;  5CP1 A;  2RUF A;  2LRT A;  3KIJ A;  4MZC A;  3CYN A;  2VD0 A;  3FZ9 A;  2JZR A;  1QGV A;  4L5O A;  3GH9 A;  2VCT A;  1U3A A;  2A4H A;  1OC8 A;  4XS6 A;  3GX8 A;  3TOT A;  3KH7 A;  3F4S A;  2B1L A;  4POM A;  4RI6 A;  4AKG A;  4K6X A;  6GSW A;  2JZT A;  1ERV A;  5F05 A;  2CVK A;  2QC7 A;  1TK0 B;  1T4Z A;  3O76 A;  2E2G A;  2FLS A;  1S4B P;  4HUA A;  2GSR A;  1TRS A;  4Q5N A;  5L71 A;  4V2N A;  4BVX B;  17GS A;  2AV4 A;  1GTB A;  1XOB A;  1ZYE A;  3K8N A;  4AJ7 A;  2X4A A;  3PPU A;  4IKH A;  2IN3 A;  1GSU A;  1T7P B;  5A5H B;  4XRD A;  2GZP A;  3WT1 A;  3DVX A;  3GN3 A;  2LRN A;  4TN8 A;  1YJ6 A;  1UVZ A;  1EEJ A;  2YZH A;  4PUA A;  3CRT A;  4EO3 A;  3D6I A;  4IJ3 A;  1CQG A;  5F0G A;  1ACV A;  2OE0 A;  4OFM A;  3IBH A;  3LWA A;  3L4N A;  2L5L A;  1SL2 B;  1FOH A;  2B5X A;  1AAZ A;  1TTZ A;  1ZYQ B;  2HYX A;  4PTS A;  1PL1 A;  2GST A;  1TU7 A;  1OAZ A;  5HFI A;  4KGI A;  1GUH A;  5JWO B;  1SU9 A;  4KB3 A;  1SK1 A;  4G0K A;  4IEL A;  5FT3 A;  5DJL A;  4HU7 A;  3EMX A;  1J9B A;  2OE3 A;  3HD5 A;  1Z6N A;  3GIX A;  1XFL A;  4I6X A;  3GNJ A;  3W8S A;  5CYY A;  2XBQ A;  1M9A A;  3QOU A;  4YKF A;  4EKZ A;  1YEP A;  5AN1 A;  3HZ4 A;  2HI7 A;  2H6Y A;  3GHA A;  1M2D A;  2A2R A;  4PUF C;  4QL9 A;  2J9H A;  4GRF A;  2R0C A;  4PQH A;  2Z9S A;  4IW9 A;  3FR6 A;  3EWL A;  4OFN A;  2O87 A;  2FA4 A;  1O7U A;  3ZIT A;  2HSM A;  3LGC A;  2R5G A;  2BJX A;  4KCE A;  1I1I P;  2H71 A;  3UEM A;  1URM A;  2H1D A;  2AUV A;  2WB9 A;  3FW2 A;  3F8U A;  4ZIL A;  4K5R A;  2VCW A;  4L5L A;  4JRR A;  4DSQ A;  2YN1 A;  1S3A A;  2XC2 A;  5D96 A;  2VM2 A;  4O5U A;  4AGS A;  4KDY A;  1TK5 B;  1N2A A;  1ZMA A;  2NTO A;  4O7H A;  2IPA A;  1JZO A;  4N10 A;  4ZBA A;  3FKF A;  5ELG A;  4Z7X A;  1GLP A;  3VPT A;  1F2E A;  4K0N A;  5B8A A;  3M9J A;  3AY8 A;  3IV4 A;  1V9W A;  4J56 E;  2KP2 A;  3GSS A;  3KTL A;  2DJ1 A;  1ERU A;  1OC9 A;  3F63 A;  2AHE A;  3VPQ A;  4GST A;  3VK9 A;  4EF0 A;  2B7J A;  2HZF A;  1S3D A;  3QCP A;  4X43 A;  2XBI A;  4WET A;  4ZL8 A;  3MIX A;  1JLV A; 
#chains in the Genus database with same CATH homology
 3P8W A;  2R0G A;  5GAP D;  2VLT A;  3KCM A;  3QD9 A;  4ECC A;  3H4K A;  5ID2 A;  5CRE A;  2YNX A;  5B6N A;  5CRW A;  3IOS A;  1PGT A;  3QAG A;  2CX3 A;  3GUS A;  5IMC A;  3WGX A;  4NHW A;  1H75 A;  5H5R A;  2JL4 A;  4ZBB A;  2VOC A;  3IXR A;  2IFQ B;  4I2T A;  2V6K A;  2F3M A;  3EC3 A;  3GYK A;  1GSY A;  3TJB A;  2C0D A;  4HQZ A;  2DJ0 A;  3A3T A;  2O85 A;  2VO4 A;  5CRD A;  4JR4 A;  1JHB A;  2AJQ B;  1Z9H A;  2OKA A;  2PVQ A;  5ABR A;  2CZ2 A;  1KNG A;  2K8S A;  4EDY A;  2GSQ A;  2V6O A;  4E8H A;  2B5E A;  3TJK A;  2GS3 A;  2M72 A;  4AJ8 A;  3H1N A;  3PIN A;  2KHP A;  3MNG A;  4L0W A;  3FR3 A;  1TI3 A;  4BWQ A;  3TDG A;  2HSY A;  4V1A p;  2PGT A;  4GCI A;  3TKQ A;  3MYD A;  5ECN B;  4E68 A;  3TKS A;  2VLU A;  3DD3 A;  4D73 A;  5GZZ B;  4POB A;  3QR6 A;  5JCW A;  1H4O A;  3QFA C;  4DSS B;  1U6T A;  2WCI A;  3ZTL A;  1RK4 A;  4N3Z A;  3GA4 A;  1WOU A;  3VWW A;  2FCH A;  4KSO A;  2PPT A;  1BG5 A;  4FYC A;  4O5Q A;  4O32 A;  5IMV A;  1XCC A;  1MTC A;  2H0H A;  4GQF A;  4FIW A;  4NWY A;  1AUC A;  4EC0 A;  1TJD A;  2WGR A;  2A2S A;  1N8J A;  2H1G A;  1X9S B;  4QL7 A;  2R6K A;  1O6J A;  1VF1 A;  4DEJ A;  1SKS B;  4MZW A;  4ZB6 A;  18GS A;  2TRX A;  5C04 A;  2RLI A;  1B4P A;  1GUK A;  2VCZ A;  1B9Y C;  2HRN A;  1VF2 A;  1B8X A;  4GLT A;  5J4Y A;  4CHS A;  3I6A A;  2F51 A;  3KGK A;  1ZOF A;  1Y25 A;  2H74 A;  1F6M C;  3QAV A;  3VI5 A;  1GSD A;  2X99 A;  3F4T A;  4CY8 A;  4FYB A;  3P2A A;  5KN3 A;  1SVO A;  1Z3E A;  2PWJ A;  4IGJ A;  4F03 A;  1A23 A;  2C1Y A;  5DQS A;  1FVJ A;  3C1R A;  4Q5F A;  3TB2 A;  1OE7 A;  4RQR A;  3LW9 A;  4WF4 A;  2ON5 A;  1XOA A;  3APQ A;  1X0R A;  2YAN A;  1JZW A;  1OKT A;  3UAP A;  1WE0 A;  1ST9 A;  3ZIJ A;  3LG6 A;  4YKG A;  5DAL A;  4MPG A;  5IMZ A;  1QK8 A;  3CWG A;  3BOA A;  4G2E A;  1GLQ A;  1MDK A;  2GVP A;  5DAK A;  2O89 A;  1KBN A;  2YWM A;  2CAI A;  1T3B A;  4WR5 A;  1JFU A;  1XXU A;  2MMN A;  4OCF A;  4IQ1 A;  2HZE B;  4ZXG A;  2O7K A;  4ZBD A;  2CVD A;  2M80 A;  4MCU A;  3APS A;  5KOW A;  3CXG A;  4OO5 A;  2I4A A;  1ILO A;  2B7K A;  1WWJ A;  3GMF A;  3DWV A;  1UN2 A;  5ECS A;  4WEY A;  1OYJ A;  3WT2 A;  2CA8 A;  2HRK A;  3IK7 A;  1G7E A;  3EPT A;  1IYI A;  1K0M A;  4GSS A;  1A2M A;  1PQN A;  2H1B A;  4XCS A;  2V1M A;  3C1S A;  1BYE A;  4IS0 A;  2MMZ A;  4BA7 A;  4HU9 A;  5H5S A;  2C3Q A;  2B5Y A;  4PNF A;  2HXK A;  2TRC P;  3HA9 A;  1G6W A;  5DCG A;  2HLS A;  2VAF A;  1O73 A;  2V2G A;  2FA8 A;  4TR1 B;  2VM1 A;  5E59 A;  2C0G A;  4G9H A;  5IMF A;  3VWU A;  1SVM A;  3HVS A;  3BCI A;  5D8I A;  3FHK A;  3IR4 A;  3ZML A;  3EIN A;  1TK8 B;  4DVC A;  3US3 A;  6GSX A;  2JSY A;  2R4V A;  4MPF A;  3IA1 A;  3G7J A;  3U5R E;  4KA0 A;  3ZYW A;  2WZ9 A;  4XS4 A;  5ECO B;  4F0B A;  3IRA A;  1M7T A;  1ZZY A;  4OWY A;  3IPZ A;  1XVW A;  4P3Y B;  4DSR A;  2LUS A;  1LU4 A;  2HT9 A;  1TRV A;  4ZL7 A;  2RM6 A;  4OD7 A;  1DBY A;  4PQI A;  2B1K A;  2JU5 A;  1EV4 A;  1R7H A;  4FYU A;  4G0L A;  4EL1 A;  4L8E A;  2C4J A;  5KN1 A;  2H72 A;  1ZCP A;  2WFC A;  2LQO A;  3O6T A;  1X9W B;  4Q5Q A;  5G5F A;  2EFD A;  4POK A;  4WBJ A;  2GSS A;  1NHY A;  4TRX A;  5FWG A;  3DVW A;  4LL1 B;  3CRU A;  1TW9 A;  4GF0 A;  2IMD A;  2DJK A;  3GUR A;  1NW2 A;  1KEB A;  3TKS C;  3VUR A;  1OC3 A;  2C0E A;  2KUC A;  1S3C A;  2VL2 C;  4OO4 A;  4OMV A;  1PD2 1;  5F07 A;  3APO A;  1QMV A;  3I9V 2;  1SKR B;  3E0U A;  1HNC A;  1AQV A;  2GZY A;  4ML6 A;  5HR3 A;  1GTA A;  1B9X C;  4F0C A;  1Y1U A;  5G2Z A;  3PGT A;  2LRC A;  4HZ2 A;  4HZ4 A;  1XWA A;  3VFI A;  1QUW A;  4BVY B;  5KEJ A;  1A8L A;  2WDU A;  1JZR A;  2ZUP A;  5IPG A;  1VF3 A;  3UVH A;  3KZQ A;  5BMU A;  2HRF A;  1XVQ A;  3TKS E;  1UC7 A;  3Q6O A;  4IQA A;  1BAY A;  6GSY A;  4TKY A;  5A34 A;  3QPM A;  1WRY A;  3IHG A;  4MAB A;  5IMA A;  1RQM A;  2IMF A;  4ECB A;  5KOX A;  2WJU A;  1FB6 A;  2PUK C;  3QMX A;  1TRW A;  1M2B A;  1SD9 A;  4Z2R A;  2MMO A;  1HNA A;  3C7M A;  2PVO C;  1Z6M A;  1GUL A;  1EP8 A;  2ES7 A;  5B8B A;  3PR8 A;  3CTG A;  1T1V A;  1K0O A;  5A1N A;  2EIR A;  3L9U A;  2N5B A;  2LTK A;  4MH3 A;  1YDK A;  1EV9 A;  4NAX A;  1I5G A;  3GKN A;  4GQC A;  5IMD A;  4MF6 A;  2H66 A;  1GSS A;  1THX A;  2QKE A;  3IE3 A;  2DKI A;  4KH7 A;  1YF1 A;  2FY6 A;  2IME A;  2DJ2 A;  4XS1 A;  3W8J A;  2XPE A;  3IC8 A;  4CY6 A;  1Q4J A;  4IVF A;  2E0Q A;  2A4V A;  5F8B A;  2CAQ A;  3UL3 A;  1K3L A;  1QQ2 A;  7GSS A;  5B6M A;  1PX7 A;  1GP1 A;  1QXH A;  3WGE A;  3DIE A;  1OKD A;  4KDU A;  4MDC A;  4WKW A;  1WMJ A;  1YY7 A;  3TCO A;  2KLX A;  3A2V A;  3TKP A;  4V2L A;  1K3Y A;  4TOP A;  3UMA A;  5J41 A;  1VRS D;  1FO5 A;  3EVI A;  2I3Y A;  4KUN A;  1X9M B;  4BL7 B;  3N9J A;  1BED A;  3R3E A;  1U87 A;  4K2D A;  3GKX A;  1O8W A;  1DSB A;  3D22 A;  2G2Q A;  3EYT A;  3HZ8 A;  1A2J A;  1TKD B;  3P7X A;  5GAN D;  3H8Q A;  4K7O A;  5ELA A;  5ECM B;  3EU3 A;  2LKU A;  1M0U A;  1J08 A;  1F3B A;  2MZC A;  4LLR A;  3RBT A;  4BVX A;  2CQ9 A;  1WIK A;  2AAW A;  2FWG A;  4TXO B;  3WD6 A;  4X1U A;  1X5C A;  3A5I A;  4MJA A;  2IWT A;  2X8H A;  3M8N A;  2HRA A;  5D9T A;  1PKW A;  3BD2 A;  5A5H A;  5ECP B;  1TXX A;  1EEM A;  2C80 A;  3I69 A;  4Z2U A;  4MA9 A;  1XWB A;  2KOK A;  5DAL B;  1SKW B;  2PU9 C;  5AIX A;  2BTO T;  2LNT A;  2DC5 A;  5IO0 A;  4HJ2 A;  2K18 A;  1XWK A;  3EU4 A;  2GGT A;  3UJ1 A;  4V1A g;  3KMN A;  2OJL A;  3QAW A;  5AIS A;  4AF2 A;  3RAZ A;  4N30 A;  1N25 A;  4PNG A;  2YCD A;  1K0D A;  4WF5 A;  3H79 A;  2K8V A;  2CV4 A;  4ML1 A;  1O8X A;  3GL5 A;  2YP6 A;  1XZO A;  4ZB7 A;  1RW1 A;  1PMT A;  8GSS A;  3G7I A;  5IOX A;  2WUL A;  3VLN A;  2N5F A;  2N5A A;  2YWN A;  1SL0 B;  2QA2 A;  5C00 A;  2XPD A;  3BBY A;  3FYG A;  1U3I A;  1EWX A;  5KN2 A;  1DUG A;  2ZCT A;  2GQM A;  5HFG A;  1QFN A;  3NZN A;  2PBJ A;  1TDI A;  4XIH A;  3FMW A;  3IK9 A;  2C8U A;  1A24 A;  1PL2 A;  3GTU B;  2LJK A;  4PQ1 A;  2ALB A;  2L57 A;  2UZ8 A;  2FWH A;  5D9X A;  2DKH A;  2KP1 A;  2REM A;  5G1K A;  2WRT A;  6GSS A;  4MJB A;  5JWR B;  3D21 A;  2CT6 A;  1X5D A;  1BJX A;  3HKR A;  4V2M A;  2FNO A;  2P5Q A;  2C3T A;  2F8A A;  4N11 A;  2VL3 A;  2VLV A;  2JSZ A;  1GTI A;  3NOF A;  5F06 A;  2H0G A;  2YWO A;  1V40 A;  4MH2 A;  1OE8 A;  4MZB A;  4ACS A;  3FY7 A;  3EUR A;  4JBB A;  4TVE A;  4TR0 A;  3BJ5 A;  4MP4 A;  2L4Q A;  4EUY A;  2H0I A;  1R4W A;  1HD2 A;  4JR6 A;  2LNS A;  1JZD A;  5J47 A;  2GLR A;  14GS A;  5LNK e;  1TI1 A;  5ENU A;  2E2M A;  4PX1 A;  1AXD A;  1GTU A;  4EIQ A;  4I97 A;  3IAS 2;  2CZ3 A;  3CSI A;  2B6M A;  4TR3 A;  5J3R A;  2K9F A;  4PXO A;  4MJC A;  5INY A;  2H73 A;  1BG1 A;  2X8C A;  4CW9 A;  1V57 A;  1TRU A;  2EC4 A;  4QMK A;  6GSU A;  3N5O A;  3F3Q A;  2E7P A;  2AYT A;  2JAD A;  3ERF A;  4FO5 A;  3ERW A;  11GS A;  1V2A A;  1PN0 A;  5ECH B;  1G0T A;  1YZX A;  3ZMK A;  4YH2 A;  1Z7P A;  5A4U A;  2RM5 A;  1TOF A;  3L9S A;  4IP1 A;  4YQU A;  1WJK A;  4MLY A;  4TW5 A;  2IFQ A;  4RQX A;  5J40 A;  2NDO A;  2MYG A;  2AB6 A;  4JE1 A;  5A34 B;  2OBK A;  4E8E A;  4JED A;  4I5Q A;  2I81 A;  5J9B A;  5A4V A;  2VCX A;  3ISO A;  1A0R P;  5A5K A;  10GS A;  1EGO A;  1NHO A;  3O3T A;  1XW6 A;  3DXB A;  4K0G A;  1AQX A;  5GSS A;  1CQH A;  3L9V A;  1AC1 A;  1FB0 A;  3TKR A;  3LXT A;  3MSZ A;  1GWC A;  2X64 A;  3F0I A;  1LJR A;  1PSQ A;  1YEX A;  3LOR A;  3KXO A;  3WGD A;  3R2Q A;  5A1N B;  1HQO A;  5ECQ B;  3F9U A;  3HCZ A;  1FW1 A;  1AW9 A;  4MF7 A;  1G6Y A;  1EOG A;  5AIV A;  2PER A;  5G5E A;  2MBT A;  2GT6 A;  1GNW A;  3KM6 A;  3TRQ A;  19GS A;  1O85 A;  3HJP A;  5ECK B;  1M2A A;  1SJ6 A;  4HS1 A;  2YPM A;  4H86 A;  1MEK A;  2HSM B;  2J23 A;  4CDO A;  1VF4 A;  3GKM A;  3ED3 A;  2V41 A;  1PKZ A;  1T00 A;  2VCQ A;  5D9V A;  5COH A;  4Z2T A;  3WYW A;  1SYR A;  2L59 A;  3TJF A;  4KAE A;  1SJI A;  3LSZ A;  3GL3 A;  4O5R A;  2PMT A;  3A2W A;  5HR0 A;  3FK8 A;  4AKI A;  4G01 A;  2HSN A;  3UBK A;  1EZK A;  3DYR A;  1NSW A;  5EL8 A;  5DCH A;  1YKC A;  4K7I A;  3TU3 B;  16GS A;  4IN0 A;  2DIY A;  5J4V A;  1T8E B;  3GFK A;  5D9W A;  3UAR A;  2V32 A;  1K3O A;  1XWC A;  1ON4 A;  3GV1 A;  4XHM A;  2DMM A;  3ZFL A;  1GSE A;  2YJH A;  2GQL A;  1OC9 B;  2L6C A;  2YV9 A;  4ZB8 A;  2OT3 A;  4J2F A;  3LYK A;  5IO2 A;  1JLW A;  2IMI A;  1GL8 A;  3CSJ A;  4RI7 A;  3FRC A;  5IOW A;  2K6V A;  2NPB A;  2R37 A;  1K0N A;  1C72 A;  5DQY A;  1FOV A;  2HSH A;  2HZE A;  3HVX A;  4GWR A;  5ID2 B;  3CSH A;  1F37 A;  4I2U A;  2G0F A;  3H93 A;  2I9H A;  4JU5 A;  1Z7R A;  5JWQ B;  1A8Y A;  1XW5 A;  3GH6 A;  2OA7 A;  2DSA A;  1HYU A;  3MWH A;  5EY6 A;  3UBL A;  4K1F A;  4K7N A;  3DEX A;  4NV5 A;  2HQT A;  4USS A;  1SEN A;  1X5E A;  4WXT A;  3C8E A;  2DIZ A;  2WS2 A;  1SVL A;  2OE1 A;  2VUP A;  4GXZ A;  4G0I A;  4ISD A;  3FZA A;  5B7C A;  3FR9 A;  4TR1 A;  3HXS A;  4HI7 A;  4YAV A;  4IHU A;  3W6G A;  3PH9 A;  3GX0 A;  5CRG A;  2LJA A;  3L0H A;  5G30 A;  3HMJ G;  2MMA A;  3GKK A;  1EGR A;  1TU8 A;  4ZL9 A;  1SK0 A;  5IQY A;  2X49 A;  4D73 B;  5IIZ A;  4EIP A;  3ZVJ A;  3D0Z A;  1J0F A;  3MAK A;  1UA5 A;  3D5J A;  4NXI A;  2EFC A;  3KP8 A;  4LMW A;  1GUM A;  2HNL A;  5IPH A;  3S9F A;  4NHZ A;  2B3S A;  3CMI A;  3LQ7 A;  4ID0 A;  1O81 A;  1MDI A;  1U88 A;  2YZU A;  1GNE A;  1ERT A;  2GT5 A;  2VKZ G;  2FUG 2;  4F2I A;  5CAX A;  3ME8 A;  1YF0 A;  4TXV A;  3ZLP A;  9GSS A;  2M46 A;  5CRH A;  2R3X A;  3F3R A;  2C3N A;  2C0F A;  5A4W A;  2DLX A;  3Q18 A;  2CX4 A;  2QGV A;  4KDX A;  4KF9 A;  1DE1 A;  1E6B A;  4Q5R A;  2LST A;  5HQP A;  5G31 A;  3JCM L;  3V1W A;  1K0C A;  2FD3 A;  4X4J A;  5J9C A;  4AKH A;  4BPY A;  2EIQ A;  3F6F A;  2HE3 A;  2H76 A;  4NV2 A;  5LCZ A;  3KJY A;  4F82 A;  3KEB A;  3RHB A;  1FVK A;  2DBC A;  4XTS A;  5J4U A;  4K9Z A;  4IP6 A;  3KH9 A;  3A2X A;  2O5V A;  3CTF A;  22GS A;  5E4W A;  2VCV A;  1ZL9 A;  4WBR D;  1PA3 A;  4ZIJ A;  1PN9 A;  1Y6E A;  3FEU A;  4MF5 A;  3TJG A;  2FWF A;  4O92 A;  4JZQ A;  3ERG A;  4AKX B;  1VGL A;  13GS A;  1YQ1 A;  5EVO A;  2YOI A;  3ZVJ D;  1HNB A;  1BQ7 A;  1XIY A;  1FHE A;  2EFE A;  3VI7 A;  4BVY A;  5CO3 A;  2F9S A;  2A2P A;  2L4C A;  2DJ3 A;  1AIU A;  5FHI A;  4BWS A;  5DAK B;  4YQV A;  4YQM A;  3SWL A;  3VWV A;  1Q98 A;  2P0G A;  2RII A;  2H75 A;  5HR2 A;  2GZZ A;  3DKS A;  2DJJ A;  3HJM A;  1W89 A;  3IHQ A;  3LFL A;  4IBP A;  3FZ4 A;  3M0F A;  3ZIV A;  2EFH A;  3HYP A;  1LBK A;  2F8F A;  2I1U A;  1NM3 A;  2XHF A;  4ECJ A;  1XPV A;  3QDN A;  4NPB A;  3ZRD A;  1V58 A;  2VD1 A;  1PRX A;  1MD4 A;  1OVN A;  4W66 A;  4K5S A;  2ZNM A;  2VL9 A;  1SYX A;  1YKA A;  3DRN A;  4GSN A;  2HRK B;  2JZS A;  1M9B A;  1SD8 A;  4LL4 B;  3TUE A;  2IIY A;  1WP0 A;  5GST A;  3P90 A;  5CNW A;  1R5P A;  3OR5 A;  3F6D A;  4KE3 A;  5JCG A;  2X8G A;  2H30 A;  3EMP A;  4FH8 A;  2IL3 A;  2ON7 A;  3TGZ A;  3E3E A;  5LD0 A;  1F9M A;  3HY2 A;  5ECR B;  1TXU A;  4TR4 A;  1ZYN A;  3KTB A;  1R5A A;  4ECI A;  5JCU A;  3J7Y b;  1MD3 A;  1K0B A;  3HJO A;  5ECL B;  5BRT A;  4K2X A;  1XBS A;  2HFD A;  2YV7 A;  1XWG A;  2VL2 A;  4AI6 A;  1TP9 A;  2LS5 A;  1KTE A;  2FHE A;  3IDV A;  1DE2 A;  3RPP A;  2D2Z A;  2NBS A;  1USB A;  4XS4 B;  6GSV A;  3L78 A;  2TIR A;  4KSM A;  3D4T A;  1BX9 A;  1EOH A;  4KX4 A;  3HDC A;  4MK3 A;  1XW9 A;  4QQ7 A;  2QSI A;  4LA1 A;  2FGX A;  3Q74 A;  4G19 A;  4MJE A;  5KN0 A;  5HFK A;  4AJ6 A;  3LEF A;  2OBI A;  4MMM A;  3ZZX A;  3HHV A;  3RDW A;  2LEG A;  4ILF A;  3FZ5 A;  2NVL A;  4X0X A;  4EXJ A;  4NMU A;  2RUE A;  1WPI A;  4BL7 A;  1A0F A;  3EE2 A;  4PGT A;  2HSN B;  2R2J A;  1T4Y A;  2GQK A;  2YJ7 A;  3BCK A;  1AQW A;  6GST A;  2JAC A;  2IJY A;  5HR1 A;  3G9B A;  2IMK A;  3NIV A;  5H5Q A;  1ZYP A;  3UOM A;  3UVT A;  1B48 A;  2QA1 A;  3M3M A;  1R26 A;  3GST A;  4KCA A;  4RUV A;  2OAD A;  2BMX A;  4OCE A;  4ULX A;  4OFT A;  1ABA A;  2DML A;  4KND A;  1SK2 A;  4TXO A;  5DBQ A;  4PUR A;  5D93 A;  3DML A;  5AGY A;  4ICY A;  3RHC A;  3IAM 2;  3RPN A;  2GTU A;  1THO A;  4L0U A;  4A5P A;  4LMV A;  3U6V A;  1ZGN A;  2H01 A;  3IC4 A;  4FQU A;  1YVL A;  3HVV A;  2LJR A;  2H1L A;  1K0A A;  4MNN A;  4HOJ A;  4IJI A;  2H8L A;  1M99 A;  3QFB C;  3Q19 A;  1PX6 A;  3LYP A;  5DDL A;  3KP9 A;  1ERW A;  1E2Y A;  4HJM A;  2H6X A;  4HQS A;  3ZRE A;  3KD0 A;  3LJR A;  4GTU A;  1GH2 A;  4XRA A;  5BMU B;  3LXZ A;  2P5R A;  3D4M A;  1B4Q A;  2EIO A;  4HDE A;  20GS A;  1IYH A;  4EVM A;  4HEA 2;  4N0Z A;  4GDF A;  3ZL5 A;  2GDR A;  2YWI A;  5IM9 A;  1V98 A;  1BF5 A;  1Z5Y E;  5DVB A;  2L5O A;  5G1L A;  4I8B A;  3A5W A;  2P31 A;  3CBU A;  2LV3 A;  1FAA A;  3ZFB A;  1GSQ A;  2FWE A;  4KW6 A;  2MBS A;  3C71 A;  4EE0 A;  3I43 A;  3TRX A;  3VWX A;  2UV8 G;  1MDJ A;  3GRX A;  2H6Z A;  3ME7 A;  3M1G A;  4K8M A;  4YAP A;  3TOU A;  3DGQ A;  4N0V A;  1FG4 A;  1A2L A;  2L6D A;  3G7Y A;  5ECI B;  4J57 E;  4EDZ A;  4DSS A;  5J5N A;  3F4R A;  1GSF A;  4ZB9 A;  1G7O A;  2H70 A;  2LQQ A;  2VIM A;  5EPF A;  3GTU A;  1SJZ A;  2PN8 A;  2R0P A;  3TJJ A;  2H19 A;  5DJM A;  1W4V A;  3UIW A;  1GRX A;  3KMO A;  4G10 A;  1SL1 B;  3MDK A;  1ML6 A;  2H1A A;  3TRP A;  1EP7 A;  1I9D A;  3E9J B;  2OAC A;  4POL A;  3M9K A;  1F3A A;  12GS A;  4WR4 A;  4F9Z A;  2CVB A;  5D73 A;  3SBC A;  3J7Y k;  2O8V B;  3C73 A;  5CP1 A;  2RUF A;  2LRT A;  3KIJ A;  4MZC A;  3CYN A;  2VD0 A;  3FZ9 A;  2JZR A;  1QGV A;  4L5O A;  3GH9 A;  2VCT A;  1U3A A;  2A4H A;  1OC8 A;  4XS6 A;  3GX8 A;  3TOT A;  3KH7 A;  3F4S A;  2B1L A;  4POM A;  4RI6 A;  4AKG A;  4K6X A;  6GSW A;  2JZT A;  1ERV A;  5F05 A;  2CVK A;  2QC7 A;  1TK0 B;  1T4Z A;  3O76 A;  2E2G A;  2FLS A;  4HUA A;  2GSR A;  1TRS A;  4Q5N A;  5L71 A;  4V2N A;  4BVX B;  17GS A;  2AV4 A;  1GTB A;  1XOB A;  1ZYE A;  3K8N A;  4AJ7 A;  2X4A A;  3PPU A;  4IKH A;  2IN3 A;  1GSU A;  1T7P B;  5A5H B;  4XRD A;  2GZP A;  3WT1 A;  3DVX A;  3GN3 A;  2LRN A;  4TN8 A;  1YJ6 A;  1UVZ A;  1EEJ A;  2YZH A;  4PUA A;  3CRT A;  4EO3 A;  3D6I A;  4IJ3 A;  1CQG A;  5F0G A;  1ACV A;  2OE0 A;  4OFM A;  3IBH A;  3LWA A;  3L4N A;  2L5L A;  1SL2 B;  1FOH A;  2B5X A;  1AAZ A;  1TTZ A;  1ZYQ B;  2HYX A;  4PTS A;  1PL1 A;  2GST A;  1TU7 A;  1OAZ A;  5HFI A;  4KGI A;  1GUH A;  5JWO B;  1SU9 A;  4KB3 A;  1SK1 A;  4G0K A;  4IEL A;  5FT3 A;  5DJL A;  4HU7 A;  3EMX A;  1J9B A;  2OE3 A;  3HD5 A;  1Z6N A;  3GIX A;  1XFL A;  4I6X A;  3GNJ A;  3W8S A;  5CYY A;  2XBQ A;  1M9A A;  3QOU A;  4YKF A;  4EKZ A;  1YEP A;  5AN1 A;  3HZ4 A;  2HI7 A;  2H6Y A;  3GHA A;  1M2D A;  2A2R A;  4PUF C;  4QL9 A;  2J9H A;  4GRF A;  2R0C A;  4PQH A;  2Z9S A;  4IW9 A;  3FR6 A;  3EWL A;  4OFN A;  2O87 A;  2FA4 A;  1O7U A;  3ZIT A;  2HSM A;  3LGC A;  2R5G A;  2BJX A;  4KCE A;  2H71 A;  3UEM A;  1URM A;  2H1D A;  2AUV A;  2WB9 A;  3FW2 A;  3F8U A;  4ZIL A;  4K5R A;  2VCW A;  4L5L A;  4JRR A;  4DSQ A;  2YN1 A;  1S3A A;  2XC2 A;  5D96 A;  2VM2 A;  4O5U A;  4AGS A;  4KDY A;  1TK5 B;  1N2A A;  1ZMA A;  2NTO A;  4O7H A;  2IPA A;  1JZO A;  4N10 A;  4ZBA A;  3FKF A;  5ELG A;  4Z7X A;  1GLP A;  3VPT A;  1F2E A;  4K0N A;  5B8A A;  3M9J A;  3AY8 A;  3IV4 A;  1V9W A;  4J56 E;  2KP2 A;  3GSS A;  3KTL A;  2DJ1 A;  1ERU A;  1OC9 A;  3F63 A;  2AHE A;  3VPQ A;  4GST A;  3VK9 A;  4EF0 A;  2B7J A;  2HZF A;  1S3D A;  3QCP A;  4X43 A;  2XBI A;  4WET A;  4ZL8 A;  3MIX A;  1JLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...