3CTDA

Crystal structure of a putative aaa family atpase from prochlorococcus marinus subsp. pastoris
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
150
Chain Sequence
NHFDVISAFIKSIRGSDPDATLYWLANMVEAGEDPNFIFRRLLISACEDIGLADPNAIVVVQSCCDAFDRVGFPEGLFFLSQASLYLAISPKSNSTKSIFKAMEAIKLVPNHLKNNASNYLNPHNYLQQEYLPTDLIKFWKPKGWEKNKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a putative AAA family ATPase from Prochlorococcus marinus subsp. pastoris.
rcsb
source organism Prochlorococcus marinus subsp. pastoris str. ccmp1986
molecule tags Structural genomics, unknown function
molecule keywords Putative ATPase, AAA family
total genus 51
structure length 150
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12002 MgsA_C MgsA AAA+ ATPase C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3710.10 Mainly Alpha Orthogonal Bundle post-AAA+ oligomerization domain-like DNA polymerase III clamp loader subunits, C-terminal domain 3ctdA02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3ctdA01
1SXJB 3CTDA 3GLGA 3GLHE 3BGEA 1IQPA 2CHVA 1A5TA 1SXJE 3GLGE 3GLHB 1JQJC 2R9GA 1JR3D 3GLFE 3U5ZB 3GLIB 1SXJC 1XXHA 3U61B 1SXJD 3GLHA 1JR3E 1XXHE 3GLIA 1XXHB 3U60B 2GNOA 3PVSA 2CHQA 3GLFB 1JR3A 1SXJA 2QW6A 3ZH9B 3GLGB 3GLIE 3GLFA
chains in the Genus database with same CATH superfamily
1SXJB 3CTDA 3GLGA 3GLHE 3BGEA 1IQPA 2CHVA 1A5TA 1SXJE 3GLGE 3GLHB 1JQJC 2R9GA 1JR3D 3GLFE 3U5ZB 3RC3A 3GLIB 1SXJC 1XXHA 3U61B 3ES5A 1SXJD 3GLHA 3U5ZA 1JR3E 4CHDA 1XXHE 3GLIA 1XXHB 3U61A 3U60B 3PVSA 2GNOA 2CHQA 3GLFB 3RC8A 1JR3A 3U60A 1SXJA 2QW6A 1MW5A 3ZH9B 3GLGB 3GLIE 3GLFA
chains in the Genus database with same CATH topology
1SXJB 3CTDA 3GLGA 3GLHE 3BGEA 1IQPA 2CHVA 1A5TA 1SXJE 3GLGE 3GLHB 1JQJC 2R9GA 1JR3D 3GLFE 3U5ZB 3RC3A 3GLIB 1SXJC 1XXHA 3U61B 3ES5A 1SXJD 3GLHA 3U5ZA 1JR3E 4CHDA 1XXHE 3GLIA 1XXHB 3U61A 3U60B 3PVSA 2GNOA 2CHQA 3GLFB 3RC8A 1JR3A 3U60A 1SXJA 2QW6A 1MW5A 3ZH9B 3GLGB 3GLIE 3GLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXJ B;  3CTD A;  3GLG A;  3GLH E;  3BGE A;  1IQP A;  2CHV A;  1A5T A;  1SXJ E;  3GLG E;  3GLH B;  1JQJ C;  2R9G A;  1JR3 D;  3GLF E;  3U5Z B;  3GLI B;  1SXJ C;  1XXH A;  3U61 B;  1SXJ D;  3GLH A;  1JR3 E;  1XXH E;  3GLI A;  1XXH B;  3U60 B;  2GNO A;  3PVS A;  2CHQ A;  3GLF B;  1JR3 A;  1SXJ A;  2QW6 A;  3ZH9 B;  3GLG B;  3GLI E;  3GLF A; 
#chains in the Genus database with same CATH topology
 1SXJ B;  3CTD A;  3GLG A;  3GLH E;  3BGE A;  1IQP A;  2CHV A;  1A5T A;  1SXJ E;  3GLG E;  3GLH B;  1JQJ C;  2R9G A;  1JR3 D;  3GLF E;  3U5Z B;  3RC3 A;  3GLI B;  1SXJ C;  1XXH A;  3U61 B;  3ES5 A;  1SXJ D;  3GLH A;  3U5Z A;  1JR3 E;  4CHD A;  1XXH E;  3GLI A;  1XXH B;  3U61 A;  3U60 B;  3PVS A;  2GNO A;  2CHQ A;  3GLF B;  3RC8 A;  1JR3 A;  3U60 A;  1SXJ A;  2QW6 A;  1MW5 A;  3ZH9 B;  3GLG B;  3GLI E;  3GLF A; 
#chains in the Genus database with same CATH homology
 1SXJ B;  3CTD A;  3GLG A;  3GLH E;  3BGE A;  1IQP A;  2CHV A;  1A5T A;  1SXJ E;  3GLG E;  3GLH B;  1JQJ C;  2R9G A;  1JR3 D;  3GLF E;  3U5Z B;  3RC3 A;  3GLI B;  1SXJ C;  1XXH A;  3U61 B;  3ES5 A;  1SXJ D;  3GLH A;  3U5Z A;  1JR3 E;  4CHD A;  1XXH E;  3GLI A;  1XXH B;  3U61 A;  3U60 B;  3PVS A;  2GNO A;  2CHQ A;  3GLF B;  3RC8 A;  1JR3 A;  3U60 A;  1SXJ A;  2QW6 A;  1MW5 A;  3ZH9 B;  3GLG B;  3GLI E;  3GLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...