3CTFA

Crystal structure of oxidized grx2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
VSQETVAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILKPVFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Structural basis for the different activities of yeast Grx1 and Grx2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 36
structure length 108
sequence length 108
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ctfA00
3CSHA 2H6ZA 3GTUA 2R37A 4ZBAA 2REMA 5FT3A 3TGZA 5IOXA 4HOJA 4DEJA 2H72A 3LYKA 4HJMA 2OBKA 2H1BA 5D9WA 2LQQA 3VLNA 2LNSA 4N0VA 4KSMA 2DJ3A 2H0HA 1KBNA 2XBIA 2O7KA 4V2NA 2IMKA 2FCHA 1WP0A 5J4UA 2YWNA 2YP6A 4G2EA 2TRCP 1Z7RA 3FZ9A 3PH9A 3JCML 3KZQA 3WGXA 4NMUA 1PKWA 3LWAA 1C72A 4KGIA 3QAGA 1PMTA 1V58A 1WRYA 2GVPA 3J7Yb 2LNTA 2H0GA 3DMLA 4G9HA 4WBRD 3GURA 3EWLA 2YPMA 5H5SA 1ERWA 2L5OA 1B4PA 3ZMKA 3HA9A 4TXVA 3F63A 2CQ9A 1F37A 3ME8A 2FWHA 5HR3A 3VWXA 4Q5RA 5HFIA 5EY6A 1TJDA 1XPVA 1XOBA 1M2DA 4ISDA 2VLUA 2RM5A 4BL7A 1G6YA 3UMAA 1TRSA 4MZWA 1NM3A 1TDIA 2TRXA 3CRUA 5LD0A 2PPTA 1K0DA 3KMNA 1A2LA 4MLYA 1JHBA 2FHEA 4IJIA 4YQMA 1T3BA 4TXOB 4AGSA 4GXZA 4PUAA 3UARA 1A0RP 1J0FA 3QD9A 3RAZA 4WR4A 3Q19A 4RQRA 2OE3A 1U3AA 2CVBA 5KN1A 1EZKA 4I2UA 1GSFA 1GLQA 1PL2A 1F2EA 1B9XC 1Z6NA 4PURA 1QK8A 2H6YA 3E3EA 4HDEA 3KIJA 5IO2A 2NDOA 4TR3A 5DDLA 2TIRA 4DSSA 4POKA 1SKRB 2XC2A 4MZBA 3UEMA 4EVMA 2I4AA 1Z3EA 4HI7A 1USBA 4WXTA 4NAXA 1H4OA 4GQFA 1WJKA 2OA7A 4L5OA 2K8VA 2DJJA 4EXJA 5CYYA 3A5WA 1XVWA 1A2JA 2M46A 1V98A 3FZ4A 4G19A 2LKUA 1OAZA 3MNGA 4ZXGA 4EF0A 2ON7A 1XBSA 1AQWA 5INYA 2B3SA 4AJ8A 1X0RA 3P2AA 2OE0A 2C0FA 4XRAA 2LRNA 5F8BA 4E8EA 4K1FA 6GSTA 3TKQA 1ST9A 3CSJA 2YZHA 3IDVA 2VOCA 3NIVA 4NV2A 1XOAA 3ZYWA 4PUFC 1SD8A 2I81A 2DBCA 3HVVA 3F6FA 2OE1A 4PX1A 1A23A 3D0ZA 3CRTA 1ZMAA 1EV4A 3KMOA 1BG5A 3L9SA 3HKRA 2IFQB 1R5AA 5LCZA 5H5RA 2P0GA 3IXRA 2L57A 3LG6A 4IP6A 2HNLA 2YZUA 18GSA 1SL0B 5ID2A 4RI6A 4FIWA 2O87A 4L5LA 2KP2A 4KSOA 3HJMA 1O7UA 4F0BA 2H1GA 2DC5A 2CAQA 2IMEA 2WJUA 4HU9A 2K9FA 3DRNA 5CRWA 2DJ1A 1FVKA 1FVJA 3Q18A 5CRGA 2L4QA 2K6VA 1TXXA 1Y25A 4HEA2 2GSTA 4PNGA 4KCEA 2AV4A 4IN0A 3ERFA 5B8BA 2GLRA 1S3AA 1I5GA 2GSQA 1O8WA 2WFCA 2GZPA 3GL3A 1A8LA 4DVCA 3CTGA 3HZ4A 5CRDA 2N5FA 1ZZYA 5D93A 4BA7A 1FO5A 4CW9A 3A2WA 4ULXA 3U6VA 3IAS2 1KEBA 1V2AA 4EL1A 3VK9A 1QMVA 3HZ8A 1SK0A 1EWXA 1XIYA 1K0OA 1SL1B 5HR1A 3FZAA 2HT9A 5FHIA 1X5EA 2AJQB 2O8VB 5HFGA 3UJ1A 1T00A 4FYCA 4GCIA 5CO3A 5HFKA 1VF2A 1EEJA 3HD5A 5D73A 3GNJA 2MBSA 1K0NA 5DAKA 2VD1A 5ECLB 4XTSA 3GSTA 3M9KA 2LQOA 1K0MA 3E9JB 3EURA 4IP1A 1ZL9A 2NVLA 3EVIA 5AIVA 5HR0A 5F05A 2F9SA 1XWCA 4MF6A 1ILOA 2WRTA 6GSYA 4HQZA 2LRTA 1F3AA 5ENUA 3HDCA 4BWQA 3K8NA 3WGEA 2LUSA 1HYUA 2LS5A 2VAFA 1TW9A 4ZBBA 3MDKA 1E6BA 1FG4A 1M9BA 1Y6EA 4PQHA 20GSA 2JSYA 2K8SA 4WF4A 1MEKA 4Q5NA 4V1Ap 3ZFLA 3H79A 2H76A 3W6GA 4XS4A 3TKSE 2MMNA 5ECMB 1H75A 3FR6A 4OWYA 2VL2A 1JZOA 3DGQA 3EMXA 4IHUA 5IIZA 3W8SA 1NHOA 1X5CA 1GNWA 1K0AA 1EV9A 2MMAA 2QSIA 1OKDA 2E7PA 2KLXA 4N30A 3EINA 2MMZA 5IMZA 1ON4A 4K6XA 2J9HA 1OE7A 3F4TA 1SJ6A 3FY7A 5ECHB 1A0FA 3TJBA 3APQA 3D6IA 2I3YA 3G7YA 1UN2A 4Z7XA 4XS6A 3F3RA 2CZ2A 2PMTA 2PGTA 4ZL9A 2WCIA 3A3TA 3NZNA 2PUKC 3H4KA 3IK7A 4EC0A 5C00A 3EC3A 4BVYA 1UC7A 1OYJA 1NHYA 4IBPA 4K9ZA 1YF0A 2J23A 1GULA 4TR4A 3IAM2 2XPDA 3VPQA 4XRDA 3G7JA 1F9MA 2IN3A 5B6NA 4FH8A 1OC9B 2G2QA 3SBCA 1JZWA 5CNWA 4WKWA 3F6DA 3FEUA 4ECIA 4J57E 3RBTA 3GHAA 3LEFA 3D4MA 4ID0A 2HSHA 2JACA 2DIYA 2H70A 6GSWA 5DQSA 1RK4A 3IRAA 4KW6A 5ECRB 3N9JA 4TR0A 3D4TA 2HSYA 2FUG2 1YDKA 3HJOA 1SJZA 1GH2A 3F4RA 2ALBA 1B9YC 3BJ5A 1B8XA 1S3DA 4TW5A 3L0HA 2VL3A 3DXBA 1LBKA 1AIUA 1B48A 2A2RA 4LMVA 3O6TA 3F9UA 2VCQA 4I6XA 3ZITA 5KEJA 2P31A 1XFLA 4V2MA 2JZSA 4V1Ag 2I1UA 3I6AA 1SKWB 4KCAA 1PA3A 4TR1B 4TRXA 5COHA 3GSSA 4ML6A 2YJHA 2NBSA 1R4WA 2YV9A 1T4ZA 1XWKA 3ZREA 1PX6A 2C3NA 1J9BA 2O85A 1O6JA 2VCWA 3M1GA 2WS2A 1TRVA 4G10A 2K18A 4MH2A 10GSA 2HI7A 2CT6A 5AGYA 2DJ0A 4WBJA 2V2GA 4L0WA 5J41A 1W4VA 2C80A 3C7MA 5KN2A 3TKSA 1YQ1A 3TJGA 3QAWA 2VCTA 1BQ7A 3ERGA 3MWHA 1GL8A 2PBJA 1TU7A 2FA8A 1ZYEA 1VF4A 3O76A 2MBTA 3WYWA 2YWMA 2FA4A 16GSA 3C1RA 4YH2A 3KH7A 1MDIA 4I97A 1CQGA 3HY2A 4NWYA 3GRXA 3L9VA 1GP1A 5CAXA 4MDCA 1OC8A 5GAPD 1V9WA 5DJLA 1HNAA 3MSZA 5DJMA 2WULA 2WZ9A 3BCKA 1W89A 5GAND 4ML1A 1XZOA 4AJ6A 2N5BA 1YEXA 4MCUA 3US3A 2GZZA 2C1YA 1SKSB 4BPYA 4JEDA 5F07A 2HZFA 1EGOA 2IPAA 3FW2A 3EU4A 1K3LA 2VM1A 3DKSA 4JE1A 3HJPA 1XWBA 3LFLA 1X9SB 5GSSA 4PQIA 3H8QA 2MZCA 1TKDB 2HZEA 2GT6A 3GX8A 3Q6OA 2VCZA 2VCVA 2QGVA 2FNOA 2H74A 2V41A 5G1LA 3TDGA 1GUHA 2C3TA 4POLA 4RI7A 5AISA 4RQXA 22GSA 1G0TA 3KP8A 4LL4B 4X43A 2HFDA 2R3XA 1SJIA 3QFAC 2H71A 3HVSA 3KD0A 2YV7A 3S9FA 2H6XA 1WIKA 2H66A 4N0ZA 3FZ5A 2AB6A 1N2AA 2AUVA 3IOSA 1YZXA 2FWEA 4AF2A 1X9MB 3KCMA 2ES7A 3BCIA 5CP1A 3R2QA 2KHPA 2P5QA 2H1AA 1CQHA 2E0QA 3ME7A 2JSZA 3O3TA 3C73A 2DMLA 2FWGA 1DBYA 3APOA 3NOFA 3GMFA 2GGTA 4N10A 1VGLA 1GSQA 5D9VA 2V6KA 3ZL5A 4D73B 4HQSA 1OVNA 4F9ZA 2VLVA 1GUKA 1T7PB 3DWVA 4IGJA 1AW9A 2EIRA 1TRWA 3ERWA 4KDXA 1PN9A 4KH7A 5J5NA 2VL9A 3QOUA 1QFNA 2WB9A 1SK1A 2EIOA 4OMVA 3I43A 5B6MA 2FLSA 3GH6A 4ZBDA 5G30A 1WWJA 3HXSA 2Z9SA 1Z9HA 5AIXA 3UOMA 5A4WA 2IMIA 1GNEA 1GLPA 4MPFA 5DALB 4YQUA 5HQPA 4O32A 13GSA 5G1KA 3HHVA 5GSTA 4GTUA 1M2AA 3FR3A 4J56E 1JLWA 1XW9A 4TN8A 4MF7A 1OC3A 4HUAA 3KTLA 5J3RA 1PRXA 3UVHA 2DMMA 1XW5A 4TXOA 1AUCA 2B5XA 5DVBA 3PR8A 5J9BA 3TRQA 5IMFA 12GSA 2B7KA 4POMA 3F0IA 1ERTA 3IA1A 4Q5QA 3M9JA 3TRPA 3IBHA 4LL1B 2MMOA 5C04A 1ZOFA 3TKRA 2DIZA 1ERUA 4KDYA 5JCGA 1TU8A 3EE2A 2EIQA 3UBLA 2H19A 1KNGA 1GRXA 3EMPA 1G7OA 4FYBA 3GKXA 4JZQA 4GQCA 1NW2A 3H1NA 4GF0A 4WF5A 3ZRDA 3KEBA 2H73A 2VCXA 4MJCA 2X64A 2GQMA 4EUYA 4MABA 3EU3A 1T4YA 1MDKA 2DLXA 2I9HA 3LORA 2FY6A 3UL3A 3G7IA 4TVEA 2CV4A 4JU5A 1XXUA 1TK8B 5GZZB 2JZTA 1EOHA 4ECBA 5ELAA 3ZIVA 3TOTA 3GIXA 4FYUA 2H01A 3KM6A 4HZ4A 2CVKA 5ECIB 1V57A 3ZZXA 2IWTA 4K7NA 3M3MA 4IKHA 4PXOA 3GTUB 1R26A 1O8XA 3BBYA 1V40A 1K3YA 4MJEA 2HXKA 3D22A 4YQVA 3GN3A 2HRNA 5G2ZA 3CBUA 1TP9A 1G7EA 1PSQA 1THOA 8GSSA 2WDUA 1EOGA 5A4VA 1BAYA 4AJ7A 1EEMA 2AYTA 3P7XA 4WETA 3IHQA 3J7Yk 3KTBA 1PL1A 1O81A 3GH9A 4HS1A 6GSVA 4GSNA 1M99A 5H5QA 1VRSD 2XBQA 1U87A 5G5FA 3AY8A 2NTOA 2V1MA 3BOAA 4CHSA 3TJJA 1EP7A 2X8HA 1GUMA 2IFQA 5D9TA 1FHEA 2YWOA 3ED3A 1OE8A 5B8AA 4MH3A 3RHBA 4IW9A 4K0GA 2C4JA 2CX3A 2ON5A 1GSUA 2H75A 1YKCA 2YCDA 3DD3A 2BTOT 5D96A 1AC1A 4POBA 3FYGA 4EE0A 1BYEA 1MD4A 3ZVJD 4LLRA 5EPFA 1TRUA 4MP4A 4KX4A 3FRCA 1TK5B 2PVQA 3TKPA 5ABRA 1GWCA 2BMXA 3GKNA 3GA4A 2R4VA 4F0CA 4OFTA 2E2MA 4KA0A 1PD21 1THXA 2DSAA 3WGDA 1K0BA 5JWQB 3VPTA 3W8JA 1JZRA 5D8IA 1NSWA 3U5RE 1KTEA 4IS0A 4XIHA 5IMAA 1XWGA 4V2LA 9GSSA 1ZYQB 4BVXA 2LJKA 4WEYA 5ECNB 1FW1A 1SU9A 3A2XA 1U3IA 2OJLA 2D2ZA 3M8NA 2B1KA 4FO5A 1HNCA 1TTZA 1T1VA 2HYXA 2OKAA 4N11A 3TJFA 4DSSB 4QL9A 1URMA 3L9UA 5FWGA 1TK0B 5DCHA 1M2BA 2EC4A 3F8UA 4NPBA 2B6MA 4NXIA 4O92A 3FKFA 5E4WA 4OD7A 1FB6A 1QQ2A 2C0DA 3L4NA 3EYTA 2F51A 2IL3A 5IMDA 1PKZA 3IC4A 1U88A 2M72A 2YJ7A 1J08A 2DJ2A 1PX7A 5IOWA 1K0CA 3CXGA 5D9XA 2L6CA 3I69A 5JWOB 1HD2A 2L59A 5EL8A 1Z5YE 3C8EA 5LNKe 2PVOC 5DBQA 2VLTA 2R2JA 3LXZA 3GYKA 2F3MA 3V1WA 3VWVA 1AQVA 2GSRA 2IMFA 3HCZA 2L6DA 3FHKA 4QL7A 1R7HA 7GSSA 2YOIA 3KH9A 2LV3A 1ML6A 1AXDA 2H0IA 2M80A 1TI1A 5HR2A 2WGRA 1ERVA 2RLIA 2RUFA 3N5OA 3DYRA 1YEPA 2HE3A 2PWJA 2JU5A 2ZCTA 3QAVA 4IQ1A 1AQXA 1ACVA 4X0XA 4OO5A 4EDYA 4GWRA 3FR9A 2HLSA 3RHCA 4ACSA 2LRCA 4XCSA 4EO3A 5ECKB 3DVXA 2GDRA 5ID2B 1IYIA 2VO4A 3VI7A 3OR5A 5J9CA 3F4SA 5CREA 1SYRA 1GSEA 2GQLA 3E0UA 1A24A 2GSSA 2RM6A 2IIYA 5G31A 1EP8A 2ZNMA 1XWAA 2X8CA 2QC7A 3F3QA 1QGVA 1S3CA 1OC9A 1SYXA 4O7HA 1SD9A 3DIEA 3DVWA 3TOUA 5IPGA 3GX0A 4F82A 4K0NA 3GKKA 2MYGA 2FD3A 5IO0A 4OCFA 4JR4A 2A4VA 1SENA 2VL2C 2IMDA 3GL5A 4KE3A 4IVFA 2C0EA 3I9V2 2LJAA 4ILFA 1GSDA 1HNBA 3PGTA 4L8EA 1U6TA 5L71A 2YWIA 4X1UA 3IR4A 1N8JA 4I8BA 3LJRA 6GSXA 4LA1A 4J2FA 1YY7A 4GSTA 2L4CA 2FGXA 3HVXA 5AN1A 1DSBA 3UBKA 3ZIJA 4IJ3A 1SL2B 1WPIA 1JFUA 5DAKB 4YAPA 5DQYA 1K3OA 3ISOA 3D21A 1MD3A 2YNXA 1LU4A 3M0FA 1F3BA 1WOUA 3KXOA 4K2DA 2N5AA 4PGTA 3RPPA 2HRFA 4DSQA 3H93A 3QMXA 4TR1A 2ZUPA 1YJ6A 2PERA 3L78A 4YAVA 1ZGNA 2NPBA 3TB2A 5JWRB 3RDWA 3MAKA 2VD0A 1E2YA 1TI3A 4DSRA 1GSYA 2KP1A 2LEGA 2PN8A 3UIWA 3IPZA 2H1DA 1JZDA 4TOPA 2X99A 3VI5A 1WE0A 5ECSA 2LSTA 4OFMA 3WT1A 5JCUA 1Q98A 4JBBA 2F8FA 1ABAA 1BX9A 4MA9A 2C3QA 2JL4A 4P3YB 1F6MC 4QQ7A 17GSA 5KN0A 5IQYA 4XS4B 3CYNA 4ZB6A 1MTCA 1A8YA 3CTFA 2C8UA 1FB0A 3GUSA 4OCEA 2YN1A 2P5RA 3CMIA 1JLVA 14GSA 1M7TA 3BD2A 1PQNA 2AAWA 1I9DA 2B5YA 1B4QA 4RUVA 1SK2A 2CX4A 4I2TA 3UVTA 3QFBC 4ZL7A 2VUPA 3RPNA 1A2MA 11GSA 3QDNA 1GTBA 2GZYA 4K7IA 2V32A 2H8LA 2PU9C 4O5RA 3P90A 4GSSA 1XW6A 1HQOA 1GSSA 5IPHA 1VF1A 2GQKA 4E8HA 5ECOB 1UA5A 2OADA 1Z6MA 2G0FA 4KUNA 1X9WB 2R5GA 3SWLA 1EGRA 4I5QA 3KJYA 1M9AA 5ELGA 2F8AA 2VIMA 1LJRA 4H86A 1YF1A 1RQMA 4GLTA 1T8EB 4K8MA 3A2VA 4F2IA 4EKZA 4JRRA 3VWUA 4OO4A 2RUEA 1MDJA 4NHZA 1AAZA 1OKTA 4LMWA 3ZFBA 5E59A 1M0UA 3IE3A 3C71A 5KN3A 4GRFA 3KGKA 5CRHA 3TKSC 5IM9A 2LJRA 3ZVJA 5A4UA 3LXTA 1DE2A 1GTAA 3LQ7A 1TOFA 4XHMA 3FK8A 3QCPA 1VF3A 6GSSA 3D5JA 2CVDA 3TCOA 3Q74A 5B7CA 1RW1A 2B7JA 4ZL8A 2R6KA 1XVQA 2OBIA 1FAAA 1G6WA 4KNDA 4OFNA 5EVOA 3TUEA 2GTUA 3WT2A 5IMCA 3HYPA 2DJKA 4D73A 3LYPA 2OACA 5ECPB 1XCCA 3TRXA 1IYHA 4MJBA 4HJ2A 19GSA 1Q4JA 3IK9A 2IJYA 2X8GA 3ZMLA 5A5KA 4IQAA 1R5PA 1DE1A 1BJXA 2LTKA 2VM2A 3G9BA 2CZ3A 2O89A 2AHEA 4XS1A 4HZ2A 4HU7A 4MF5A 3VURA 4MZCA 4CDOA 4EDZA 2XHFA 1ZCPA 5DALA 4KDUA 4L0UA 3ZTLA 3ZLPA 2B5EA 5ECQB 4F03A 3QR6A 4ZIJA 5DCGA 4ZB8A 1BEDA 4MPGA 4BWSA 3QPMA 3PINA 4MK3A 4MMMA 4K7OA 2CAIA 4KAEA 2CA8A 4ZILA 3LSZA 6GSUA 3GV1A 3CSIA 2QKEA 3P8WA 4IELA 1PGTA 1Z7PA 4NV5A 4ECCA 4Q5FA 3DEXA 4KB3A 3KP9A 2A2SA 2L5LA 4WR5A 2FWFA 2GS3A 3IV4A 1GTIA 2KOKA 3UAPA 3APSA 3GFKA 2B1LA 2KUCA 2JZRA 2H30A 5F0GA 1GTUA 4JR6A 2C0GA 1YKAA 1O73A 3C1SA 4NHWA 1O85A 4PNFA 2XPEA 2V6OA 5IMVA 4ZB9A 2E2GA 5JCWA 4ECJA 3VFIA 2GT5A 3GKMA 2JADA 3WD6A 2BJXA 1X5DA 1QXHA 3VWWA 1QUWA 5G5EA 3LGCA 4TKYA 1WMJA 1FOVA 5F06A 3TJKA 2YANA 4MJAA 2HZEB 2RIIA 4PQ1A 1UVZA 1DUGA
chains in the Genus database with same CATH superfamily
3CSHA 2H6ZA 3GTUA 2R37A 4ZBAA 2REMA 1S3RA 5FT3A 3TGZA 5IOXA 4HOJA 4DEJA 2H72A 3LYKA 4HJMA 2OBKA 2H1BA 5D9WA 2LQQA 3VLNA 2LNSA 4N0VA 4KSMA 2DJ3A 2H0HA 1KBNA 2XBIA 2O7KA 4V2NA 2IMKA 2FCHA 1WP0A 5J4UA 2YWNA 4O5QA 2YP6A 2R0PA 4G2EA 2TRCP 1Z7RA 3FZ9A 3PH9A 3JCML 3KZQA 3WGXA 4NMUA 1PKWA 3LWAA 1C72A 4KGIA 3QAGA 1PMTA 1V58A 1WRYA 2GVPA 3J7Yb 2LNTA 2H0GA 3DMLA 4G9HA 4WBRD 3GURA 3EWLA 2YPMA 5H5SA 1ERWA 2L5OA 1B4PA 3ZMKA 3HA9A 4TXVA 3F63A 2CQ9A 1F37A 3ME8A 4K5RA 2FWHA 5HR3A 3VWXA 4Q5RA 5HFIA 5EY6A 4USSA 1TJDA 1XPVA 1XOBA 1M2DA 4ISDA 3PPUA 2VLUA 2RM5A 4BL7A 1G6YA 3UMAA 1TRSA 4MZWA 1NM3A 1TDIA 2TRXA 3CRUA 5LD0A 2PPTA 1K0DA 3KMNA 1A2LA 4MLYA 1JHBA 4ICYA 2FHEA 4IJIA 4YQMA 1T3BA 4TXOB 4BIKA 4AGSA 4GXZA 4PUAA 3UARA 1A0RP 1J0FA 3QD9A 3RAZA 4WR4A 2HRAA 3Q19A 4RQRA 2OE3A 1U3AA 2CVBA 5KN1A 1EZKA 4I2UA 1GSFA 1GLQA 1PL2A 1F2EA 1B9XC 1Z6NA 4PURA 1QK8A 2H6YA 3E3EA 4HDEA 3KIJA 5IO2A 2NDOA 4TR3A 5DDLA 2TIRA 4DSSA 4POKA 1SKRB 2XC2A 4MZBA 3UEMA 4EVMA 2I4AA 1Z3EA 4HI7A 1USBA 4WXTA 4NAXA 1H4OA 4GQFA 1WJKA 2OA7A 4L5OA 2K8VA 2DJJA 4EXJA 5CYYA 3A5WA 1XVWA 1A2JA 2M46A 1V98A 3FZ4A 4MNNA 4G19A 2LKUA 1OAZA 3MNGA 4ZXGA 4EF0A 2ON7A 1XBSA 1AQWA 5INYA 2B3SA 4AJ8A 1X0RA 3P2AA 2OE0A 2C0FA 4XRAA 2LRNA 5F8BA 4E8EA 4K1FA 6GSTA 3TKQA 1ST9A 3CSJA 2YZHA 3IDVA 2VOCA 3NIVA 4NV2A 1XOAA 3ZYWA 4PUFC 1SD8A 2I81A 2DBCA 3HVVA 3F6FA 2OE1A 4PX1A 1A23A 3D0ZA 3CRTA 1ZMAA 1EV4A 3KMOA 1BG5A 3L9SA 3HKRA 2IFQB 1R5AA 5LCZA 5H5RA 2P0GA 4HSCX 3EPTA 3IXRA 2L57A 3LG6A 4IP6A 2HNLA 2YZUA 18GSA 1SL0B 5ID2A 4RI6A 4FIWA 2O87A 4L5LA 2KP2A 4KSOA 3A5IA 3HJMA 1O7UA 4F0BA 2H1GA 2DC5A 2CAQA 2IMEA 2WJUA 4HU9A 2K9FA 3DRNA 5CRWA 2DJ1A 1FVKA 1FVJA 3Q18A 5CRGA 2L4QA 2K6VA 1TXXA 1Y25A 4HEA2 2GSTA 4PNGA 4KCEA 2AV4A 4IN0A 3ERFA 5B8BA 2GLRA 4G0LA 1S3AA 1I5GA 2GSQA 1O8WA 2WFCA 2GZPA 3GL3A 1A8LA 4DVCA 3CTGA 3HZ4A 5CRDA 2N5FA 1ZZYA 5D93A 4BA7A 1FO5A 4CW9A 3A2WA 4ULXA 4FQUA 3U6VA 3IAS2 1KEBA 1V2AA 4EL1A 3VK9A 1QMVA 3HZ8A 1SK0A 1EWXA 4BVXB 1XIYA 1K0OA 1SL1B 5HR1A 3FZAA 2HT9A 5FHIA 2R0CA 1X5EA 4CY6A 2AJQB 2O8VB 5HFGA 3UJ1A 1T00A 4FYCA 4GCIA 5CO3A 5HFKA 1VF2A 1EEJA 3HD5A 5D73A 3GNJA 2MBSA 1K0NA 5DAKA 2VD1A 5ECLB 4XTSA 3GSTA 3M9KA 2LQOA 1K0MA 3E9JB 3EURA 4IP1A 1ZL9A 2NVLA 3EVIA 5AIVA 5HR0A 5F05A 2HSMA 2F9SA 1XWCA 4MF6A 1ILOA 2WRTA 6GSYA 4HQZA 2LRTA 1F3AA 5ENUA 3HDCA 5KOXA 4BWQA 3K8NA 3WGEA 2LUSA 1HYUA 2LS5A 2VAFA 1TW9A 4ZBBA 3MDKA 1E6BA 1FG4A 1M9BA 1Y6EA 4PQHA 20GSA 2JSYA 2K8SA 4WF4A 1MEKA 1PFOA 4Q5NA 4V1Ap 3ZFLA 3H79A 2H76A 3W6GA 4XS4A 3TKSE 2MMNA 5ECMB 1H75A 3FR6A 4OWYA 2VL2A 1JZOA 3DGQA 3EMXA 4IHUA 5IIZA 3W8SA 1NHOA 1X5CA 1GNWA 1K0AA 1EV9A 2MMAA 2QSIA 1OKDA 2E7PA 2KLXA 4N30A 3EINA 2MMZA 5IMZA 1ON4A 4K6XA 2J9HA 1OE7A 3F4TA 1SJ6A 3FY7A 5ECHB 1A0FA 3TJBA 3APQA 3D6IA 2I3YA 3G7YA 1UN2A 4Z7XA 4XS6A 3F3RA 2CZ2A 4K2XA 2PMTA 2PGTA 4ZL9A 2WCIA 3A3TA 3NZNA 2PUKC 3H4KA 3IK7A 4EC0A 5C00A 3EC3A 4BVYA 1UC7A 1OYJA 1NHYA 4IBPA 4K9ZA 1YF0A 2J23A 1GULA 4TR4A 3IAM2 2XPDA 3VPQA 4XRDA 3G7JA 1F9MA 2IN3A 5B6NA 4FH8A 1OC9B 2G2QA 3SBCA 1JZWA 5CNWA 4WKWA 3F6DA 3FEUA 4ECIA 4J57E 3RBTA 3GHAA 3LEFA 3D4MA 4ID0A 2HSHA 2JACA 2DIYA 2H70A 4YKGA 6GSWA 5DQSA 3CQFA 1RK4A 3IRAA 4KW6A 5ECRB 3N9JA 4TR0A 3IHGA 3D4TA 2HSYA 2FUG2 1YDKA 3HJOA 1SJZA 1GH2A 3F4RA 2ALBA 1B9YC 3BJ5A 1B8XA 1S3DA 4TW5A 3L0HA 1ZYNA 2VL3A 3DXBA 1LBKA 1AIUA 1B48A 2A2RA 4LMVA 3O6TA 3F9UA 2VCQA 4I6XA 4PTSA 3ZITA 5KEJA 2P31A 1XFLA 4V2MA 2JZSA 4V1Ag 2I1UA 3I6AA 1SKWB 4KCAA 1PA3A 4TR1B 4TRXA 5COHA 3GSSA 4ML6A 2YJHA 2NBSA 1R4WA 2YV9A 1T4ZA 1XWKA 3ZREA 1PX6A 2C3NA 1J9BA 2O85A 1O6JA 2VCWA 3M1GA 2WS2A 1TRVA 4G10A 2K18A 4MH2A 10GSA 2HI7A 2A4HA 2CT6A 5AGYA 2DJ0A 4KF9A 4WBJA 2V2GA 4L0WA 5J41A 1W4VA 2C80A 3C7MA 5KN2A 3TKSA 1YQ1A 3TJGA 3QAWA 2VCTA 1BQ7A 3ERGA 3MWHA 1GL8A 2PBJA 1TU7A 2FA8A 1ZYEA 1VF4A 3O76A 2MBTA 3WYWA 2YWMA 2FA4A 16GSA 3C1RA 4YH2A 3KH7A 1MDIA 4I97A 1CQGA 3HY2A 4NWYA 3GRXA 3L9VA 1GP1A 5CAXA 4MDCA 1OC8A 5GAPD 1V9WA 5DJLA 1HNAA 3MSZA 5DJMA 2WULA 2WZ9A 3BCKA 1W89A 5GAND 4ML1A 1XZOA 4AJ6A 2N5BA 1YEXA 4MCUA 1FOHA 3US3A 2GZZA 2C1YA 1SKSB 4BPYA 4JEDA 5F07A 2HZFA 1EGOA 2IPAA 3FW2A 3EU4A 1K3LA 2VM1A 3DKSA 4JE1A 3HJPA 1XWBA 3LFLA 1X9SB 5GSSA 4PQIA 3H8QA 2MZCA 1TKDB 2HZEA 2GT6A 3GX8A 3Q6OA 2VCZA 3MIXA 2VCVA 2QGVA 2FNOA 2H74A 2V41A 5G1LA 3TDGA 1GUHA 2C3TA 4POLA 4RI7A 5AISA 4RQXA 22GSA 1G0TA 3KP8A 4LL4B 4X43A 2HFDA 2R3XA 1SJIA 3QFAC 2H71A 3HVSA 3KD0A 2YV7A 3S9FA 2H6XA 1WIKA 2H66A 4N0ZA 3FZ5A 2AB6A 1N2AA 2AUVA 3IOSA 1YZXA 2FWEA 4AF2A 1X9MB 3KCMA 2ES7A 3BCIA 5BRTA 5CP1A 3R2QA 2KHPA 2P5QA 2H1AA 1CQHA 2E0QA 3ME7A 2JSZA 3O3TA 3C73A 2DMLA 2FWGA 1DBYA 3APOA 3NOFA 3GMFA 2GGTA 4N10A 1VGLA 1GSQA 5D9VA 2V6KA 3ZL5A 4D73B 4HQSA 1OVNA 4F9ZA 2VLVA 1GUKA 1T7PB 3DWVA 4IGJA 1AW9A 2EIRA 1TRWA 3ERWA 4KDXA 1PN9A 4KH7A 5J5NA 2VL9A 3QOUA 1QFNA 2WB9A 1SK1A 2EIOA 4OMVA 3I43A 5B6MA 2FLSA 3GH6A 4ZBDA 5G30A 1WWJA 3HXSA 2Z9SA 1Z9HA 5AIXA 3UOMA 5A4WA 2IMIA 1GNEA 1GLPA 4MPFA 5DALB 4YQUA 5HQPA 4O32A 13GSA 5G1KA 3HHVA 5GSTA 4GTUA 1M2AA 3FR3A 4J56E 1JLWA 1XW9A 4EIQA 4TN8A 4MF7A 1OC3A 4HUAA 3KTLA 5J3RA 1PRXA 3UVHA 2DMMA 1XW5A 4TXOA 1AUCA 2B5XA 5DVBA 3PR8A 5J9BA 4EIPA 3TRQA 5IMFA 12GSA 2B7KA 4POMA 3F0IA 1ERTA 3IA1A 4Q5QA 5BMUA 3M9JA 3TRPA 3IBHA 4LL1B 2MMOA 5C04A 1ZOFA 3TKRA 2DIZA 1ERUA 4KDYA 5JCGA 1TU8A 3EE2A 2EIQA 3UBLA 2H19A 1KNGA 1GRXA 3EMPA 1G7OA 4FYBA 3GKXA 4JZQA 4GQCA 1NW2A 3H1NA 4GF0A 4WF5A 3ZRDA 3KEBA 2H73A 2VCXA 4MJCA 2X64A 2GQMA 4EUYA 4MABA 3EU3A 1T4YA 1MDKA 2DLXA 2I9HA 3LORA 2FY6A 3UL3A 3G7IA 4TVEA 2CV4A 4JU5A 1XXUA 1TK8B 5GZZB 2JZTA 1EOHA 4ECBA 3R3EA 5ELAA 3ZIVA 3TOTA 3GIXA 3MYDA 4FYUA 2H01A 3KM6A 4HZ4A 2CVKA 5ECIB 1V57A 3ZZXA 2IWTA 4K7NA 3M3MA 4IKHA 4PXOA 3GTUB 1R26A 1O8XA 3BBYA 1V40A 1K3YA 4MJEA 2HXKA 3D22A 4YQVA 3GN3A 2HRNA 5G2ZA 3CBUA 1TP9A 1G7EA 1PSQA 1THOA 1PN0A 8GSSA 2WDUA 1EOGA 5A4VA 1BAYA 4AJ7A 1EEMA 2AYTA 3P7XA 4WETA 3IHQA 3J7Yk 3KTBA 1PL1A 1O81A 3GH9A 4HS1A 6GSVA 4GSNA 1M99A 5H5QA 1VRSD 2XBQA 1U87A 5G5FA 3AY8A 2NTOA 2V1MA 3BOAA 4CHSA 3TJJA 1EP7A 2X8HA 1GUMA 2IFQA 5D9TA 1FHEA 2YWOA 3ED3A 1OE8A 5B8AA 4CY8A 4MH3A 3RHBA 4IW9A 4K0GA 2C4JA 2CX3A 2ON5A 1GSUA 2H75A 1YKCA 2YCDA 3DD3A 2BTOT 5D96A 1AC1A 4POBA 3FYGA 4EE0A 1BYEA 1MD4A 3ZVJD 4LLRA 5EPFA 1TRUA 4MP4A 4KX4A 3FRCA 1TK5B 4BL7B 2PVQA 3TKPA 5ABRA 1GWCA 2BMXA 3GKNA 3GA4A 2R4VA 4F0CA 4OFTA 2E2MA 4KA0A 1PD21 1THXA 2DSAA 3WGDA 1K0BA 5JWQB 3VPTA 3W8JA 1JZRA 5D8IA 1NSWA 3U5RE 1KTEA 4IS0A 4XIHA 5IMAA 1XWGA 4V2LA 9GSSA 3IC8A 1ZYQB 4BVXA 2LJKA 4WEYA 5ECNB 1FW1A 1SU9A 3A2XA 1U3IA 2OJLA 2D2ZA 2DKHA 3M8NA 2B1KA 4FO5A 2HRKA 1HNCA 1TTZA 1T1VA 2HYXA 2OKAA 4N11A 3TJFA 4DSSB 4QL9A 1URMA 3L9UA 5FWGA 1TK0B 5DCHA 1M2BA 2EC4A 3F8UA 4NPBA 2B6MA 4NXIA 4O92A 3FKFA 2QA2A 5E4WA 4OD7A 1FB6A 1QQ2A 2C0DA 3L4NA 3EYTA 2F51A 2IL3A 5IMDA 1PKZA 3IC4A 1U88A 2M72A 1XG8A 2YJ7A 1J08A 2DJ2A 1PX7A 5IOWA 4G0IA 1K0CA 3CXGA 5D9XA 2L6CA 3I69A 5JWOB 1HD2A 2L59A 5EL8A 1Z5YE 3C8EA 5LNKe 2PVOC 5DBQA 2VLTA 2R2JA 3LXZA 3GYKA 2F3MA 3V1WA 3VWVA 1AQVA 2GSRA 2IMFA 3HCZA 4Z2TA 2L6DA 2X49A 3FHKA 4QL7A 1R7HA 7GSSA 2YOIA 3KH9A 2LV3A 1ML6A 1AXDA 2H0IA 2M80A 1TI1A 5HR2A 2WGRA 1ERVA 2RLIA 2RUFA 3N5OA 3DYRA 1YEPA 2HE3A 2PWJA 2JU5A 2ZCTA 3QAVA 4IQ1A 1AQXA 1ACVA 4X0XA 4OO5A 5KOWA 4EDYA 4GWRA 3FR9A 2DKIA 2HLSA 3RHCA 4ACSA 2LRCA 4XCSA 4EO3A 5ECKB 3DVXA 2GDRA 5ID2B 1IYIA 2VO4A 3VI7A 3OR5A 5J9CA 3F4SA 5CREA 1SYRA 1GSEA 2GQLA 3E0UA 1A24A 2GSSA 2RM6A 2IIYA 5G31A 1EP8A 2ZNMA 1XWAA 2X8CA 2QC7A 3F3QA 1QGVA 1S3CA 1OC9A 1SYXA 4O7HA 1SD9A 3DIEA 3DVWA 3TOUA 4YKFA 5IPGA 3GX0A 4F82A 4K0NA 3GKKA 2MYGA 2FD3A 5IO0A 4OCFA 4JR4A 2A4VA 1SENA 2VL2C 2IMDA 3GL5A 4Z2RA 4KE3A 4IVFA 2C0EA 2X4AA 3I9V2 2LJAA 4ILFA 1GSDA 1HNBA 3PGTA 4L8EA 1U6TA 5L71A 2YWIA 4X1UA 3IR4A 1N8JA 4I8BA 3LJRA 6GSXA 4LA1A 4J2FA 3FMWA 2QA1A 1YY7A 4GSTA 2L4CA 2FGXA 3HVXA 5AN1A 1DSBA 3UBKA 3ZIJA 4IJ3A 1SL2B 1WPIA 1JFUA 5DAKB 4YAPA 5DQYA 3HVNA 1K3OA 3ISOA 3D21A 1MD3A 2YNXA 1LU4A 3M0FA 1F3BA 1WOUA 3KXOA 4K2DA 2N5AA 4PGTA 3RPPA 2HRFA 4DSQA 3H93A 3QMXA 4TR1A 2ZUPA 1YJ6A 2PERA 3L78A 4YAVA 1ZGNA 2NPBA 3TB2A 5JWRB 3RDWA 3MAKA 2VD0A 1E2YA 1TI3A 4DSRA 1GSYA 2KP1A 2LEGA 2PN8A 3UIWA 3IPZA 2H1DA 1JZDA 4TOPA 2X99A 3VI5A 1WE0A 5ECSA 2LSTA 4OFMA 3WT1A 5JCUA 4G0KA 1Q98A 4JBBA 2F8FA 1ABAA 1BX9A 4MA9A 2C3QA 2JL4A 4P3YB 1F6MC 4QQ7A 17GSA 5KN0A 5IQYA 4XS4B 1M3JA 3CYNA 4ZB6A 1MTCA 1A8YA 3CTFA 2C8UA 1FB0A 3GUSA 4OCEA 2YN1A 1ZYPA 2P5RA 3CMIA 1JLVA 14GSA 1M7TA 3BD2A 1PQNA 2AAWA 1I9DA 2B5YA 1B4QA 4RUVA 1SK2A 2CX4A 4I2TA 3UVTA 3QFBC 4ZL7A 2VUPA 3RPNA 1A2MA 11GSA 3QDNA 1GTBA 2GZYA 4K7IA 2V32A 2H8LA 2PU9C 4O5RA 3P90A 4GSSA 1XW6A 1HQOA 1GSSA 5IPHA 1VF1A 2GQKA 4E8HA 5ECOB 2R0GA 1UA5A 2OADA 1Z6MA 2G0FA 4KUNA 1X9WB 2UZ8A 2R5GA 3SWLA 1EGRA 4I5QA 3KJYA 1M9AA 5ELGA 2F8AA 4BVYB 2VIMA 1LJRA 4H86A 1YF1A 1RQMA 4GLTA 1T8EB 4K8MA 3A2VA 4F2IA 4EKZA 4JRRA 3VWUA 4OO4A 2RUEA 1MDJA 4NHZA 1AAZA 1OKTA 4LMWA 3ZFBA 5E59A 1M0UA 3IE3A 3C71A 5KN3A 4GRFA 3KGKA 5CRHA 3TKSC 5IM9A 2LJRA 3ZVJA 5A4UA 3LXTA 4X4JA 1DE2A 1GTAA 3LQ7A 1TOFA 4XHMA 3FK8A 3QCPA 1VF3A 6GSSA 3D5JA 2CVDA 3TCOA 3Q74A 5B7CA 1RW1A 3LW9A 2B7JA 4ZL8A 2R6KA 1XVQA 2OBIA 1FAAA 1G6WA 4KNDA 4OFNA 5EVOA 3TUEA 2GTUA 3WT2A 5IMCA 3HYPA 1M3IA 2DJKA 4D73A 3LYPA 2OACA 5ECPB 1XCCA 3TRXA 1IYHA 4MJBA 4HJ2A 19GSA 1Q4JA 3IK9A 2IJYA 2X8GA 3ZMLA 5A5KA 4IQAA 1R5PA 1DE1A 1BJXA 2LTKA 2VM2A 3G9BA 2CZ3A 2O89A 2AHEA 4XS1A 4HZ2A 4HU7A 4MF5A 3VURA 4MZCA 4CDOA 4EDZA 2XHFA 1ZCPA 5DALA 4KDUA 4L0UA 3ZTLA 3ZLPA 2B5EA 5ECQB 4F03A 3QR6A 4ZIJA 5DCGA 4ZB8A 1BEDA 4MPGA 4BWSA 3QPMA 3PINA 4MK3A 4MMMA 4O5UA 4K7OA 2CAIA 4KAEA 2CA8A 4ZILA 3LSZA 6GSUA 3GV1A 3CSIA 4K5SA 2QKEA 3P8WA 4IELA 1PGTA 1Z7PA 4NV5A 4ECCA 4Q5FA 3DEXA 4KB3A 3KP9A 2A2SA 2L5LA 4WR5A 2A2PA 2FWFA 2GS3A 3IV4A 4A5PA 1GTIA 2KOKA 3UAPA 3APSA 3GFKA 2B1LA 2KUCA 2JZRA 2H30A 5F0GA 1GTUA 4JR6A 2C0GA 1YKAA 1O73A 3C1SA 4NHWA 1O85A 4PNFA 2XPEA 2V6OA 5IMVA 4ZB9A 2E2GA 5JCWA 4Z2UA 4ECJA 3VFIA 2GT5A 3GKMA 2JADA 3WD6A 2BJXA 1X5DA 1QXHA 3VWWA 1QUWA 5G5EA 3LGCA 4TKYA 1WMJA 1FOVA 5F06A 3TJKA 2YANA 4MJAA 2HZEB 2RIIA 4PQ1A 1UVZA 1DUGA
chains in the Genus database with same CATH topology
3CSHA 2H6ZA 3GTUA 2R37A 4ZBAA 2REMA 5FT3A 3TGZA 5IOXA 4HOJA 4DEJA 2H72A 3LYKA 4HJMA 2OBKA 2H1BA 5D9WA 2LQQA 3VLNA 2LNSA 4N0VA 4KSMA 2DJ3A 2H0HA 1KBNA 2XBIA 2O7KA 4V2NA 2IMKA 2FCHA 1WP0A 5J4UA 2YWNA 4O5QA 2YP6A 2R0PA 4G2EA 2TRCP 1Z7RA 3FZ9A 3PH9A 3JCML 3KZQA 3WGXA 4NMUA 1PKWA 3LWAA 1C72A 4KGIA 3QAGA 1PMTA 1V58A 1WRYA 2GVPA 3J7Yb 2LNTA 2H0GA 3DMLA 4G9HA 4WBRD 3GURA 3EWLA 2YPMA 5H5SA 1ERWA 2L5OA 1B4PA 3ZMKA 3HA9A 4TXVA 3F63A 2CQ9A 1F37A 3ME8A 4K5RA 2FWHA 5HR3A 3VWXA 4Q5RA 5HFIA 5EY6A 4USSA 1TJDA 1XPVA 1XOBA 1M2DA 4ISDA 3PPUA 2VLUA 2RM5A 4BL7A 1G6YA 3UMAA 1TRSA 4MZWA 1NM3A 1TDIA 2TRXA 3CRUA 5LD0A 2PPTA 1K0DA 3KMNA 1A2LA 4MLYA 1JHBA 4ICYA 2FHEA 4IJIA 4YQMA 1T3BA 4TXOB 4AGSA 4GXZA 4PUAA 3UARA 1A0RP 1J0FA 3QD9A 3RAZA 4WR4A 2HRAA 3Q19A 4RQRA 2OE3A 1U3AA 2CVBA 5KN1A 1EZKA 4I2UA 1GSFA 1GLQA 1PL2A 1F2EA 1B9XC 1Z6NA 4PURA 1QK8A 2H6YA 3E3EA 4HDEA 3KIJA 5IO2A 2NDOA 4TR3A 5DDLA 2TIRA 4DSSA 4POKA 1SKRB 2XC2A 4MZBA 3UEMA 4EVMA 2I4AA 1Z3EA 4HI7A 1USBA 4WXTA 4NAXA 1H4OA 4GQFA 1WJKA 2OA7A 4L5OA 2K8VA 2DJJA 4EXJA 5CYYA 3A5WA 1XVWA 1A2JA 2M46A 1V98A 3FZ4A 4MNNA 4G19A 2LKUA 1OAZA 3MNGA 4ZXGA 4EF0A 2ON7A 1XBSA 1AQWA 5INYA 2B3SA 4AJ8A 1X0RA 3P2AA 2OE0A 2C0FA 4XRAA 2LRNA 5F8BA 4E8EA 4K1FA 6GSTA 3TKQA 1ST9A 3CSJA 2YZHA 3IDVA 2VOCA 3NIVA 4NV2A 1XOAA 3ZYWA 4PUFC 1SD8A 2I81A 2DBCA 3HVVA 3F6FA 2OE1A 4PX1A 1A23A 3D0ZA 3CRTA 1ZMAA 1EV4A 3KMOA 1BG5A 3L9SA 3HKRA 2IFQB 1R5AA 5LCZA 5H5RA 2P0GA 3EPTA 3IXRA 2L57A 3LG6A 4IP6A 2HNLA 2YZUA 18GSA 1SL0B 5ID2A 4RI6A 4FIWA 2O87A 4L5LA 2KP2A 4KSOA 3A5IA 3HJMA 1O7UA 4F0BA 2H1GA 2DC5A 2CAQA 2IMEA 2WJUA 4HU9A 2K9FA 3DRNA 5CRWA 2DJ1A 1FVKA 1FVJA 3Q18A 5CRGA 2L4QA 2K6VA 1TXXA 1Y25A 4HEA2 2GSTA 4PNGA 4KCEA 2AV4A 4IN0A 3ERFA 5B8BA 2GLRA 4G0LA 1S3AA 1I5GA 2GSQA 1O8WA 2WFCA 2GZPA 3GL3A 1A8LA 4DVCA 3CTGA 3HZ4A 5CRDA 2N5FA 1ZZYA 5D93A 4BA7A 1FO5A 4CW9A 3A2WA 4ULXA 4FQUA 3U6VA 3IAS2 1KEBA 1V2AA 4EL1A 3VK9A 1QMVA 3HZ8A 1SK0A 1EWXA 4BVXB 1XIYA 1K0OA 1SL1B 5HR1A 3FZAA 2HT9A 5FHIA 2R0CA 1X5EA 4CY6A 2AJQB 2O8VB 5HFGA 3UJ1A 1T00A 4FYCA 4GCIA 5CO3A 5HFKA 1VF2A 1EEJA 3HD5A 5D73A 3GNJA 2MBSA 1K0NA 5DAKA 2VD1A 5ECLB 4XTSA 3GSTA 3M9KA 2LQOA 1K0MA 3E9JB 3EURA 4IP1A 1ZL9A 2NVLA 3EVIA 5AIVA 5HR0A 5F05A 2HSMA 2F9SA 1XWCA 4MF6A 1ILOA 2WRTA 6GSYA 4HQZA 2LRTA 1F3AA 5ENUA 3HDCA 5KOXA 4BWQA 3K8NA 3WGEA 2LUSA 1HYUA 2LS5A 2VAFA 1TW9A 4ZBBA 3MDKA 1E6BA 1FG4A 1M9BA 1Y6EA 4PQHA 20GSA 2JSYA 2K8SA 4WF4A 1MEKA 4Q5NA 4V1Ap 3ZFLA 3H79A 2H76A 3W6GA 4XS4A 3TKSE 2MMNA 5ECMB 1H75A 3FR6A 4OWYA 2VL2A 1JZOA 3DGQA 3EMXA 4IHUA 5IIZA 3W8SA 1NHOA 1X5CA 1GNWA 1K0AA 1EV9A 2MMAA 2QSIA 1OKDA 2E7PA 2KLXA 4N30A 3EINA 2MMZA 5IMZA 1ON4A 4K6XA 2J9HA 1OE7A 3F4TA 1SJ6A 3FY7A 5ECHB 1A0FA 3TJBA 3APQA 3D6IA 2I3YA 3G7YA 1UN2A 4Z7XA 4XS6A 3F3RA 2CZ2A 4K2XA 2PMTA 2PGTA 4ZL9A 2WCIA 3A3TA 3NZNA 2PUKC 3H4KA 3IK7A 4EC0A 5C00A 3EC3A 4BVYA 1UC7A 1OYJA 1NHYA 4IBPA 4K9ZA 1YF0A 2J23A 1GULA 4TR4A 3IAM2 2XPDA 3VPQA 4XRDA 3G7JA 1F9MA 2IN3A 5B6NA 4FH8A 1OC9B 2G2QA 3SBCA 1JZWA 5CNWA 4WKWA 3F6DA 3FEUA 4ECIA 4J57E 3RBTA 3GHAA 3LEFA 3D4MA 4ID0A 2HSHA 2JACA 2DIYA 2H70A 4YKGA 6GSWA 5DQSA 1RK4A 3IRAA 4KW6A 5ECRB 3N9JA 4TR0A 3IHGA 3D4TA 2HSYA 2FUG2 1YDKA 3HJOA 1SJZA 1GH2A 3F4RA 2ALBA 1B9YC 3BJ5A 1B8XA 1S3DA 4TW5A 3L0HA 1ZYNA 2VL3A 3DXBA 1LBKA 1AIUA 1B48A 2A2RA 4LMVA 3O6TA 3F9UA 2VCQA 4I6XA 4PTSA 3ZITA 5KEJA 2P31A 1XFLA 4V2MA 2JZSA 4V1Ag 2I1UA 3I6AA 1SKWB 4KCAA 1PA3A 4TR1B 4TRXA 5COHA 3GSSA 4ML6A 2YJHA 2NBSA 1R4WA 2YV9A 1T4ZA 1XWKA 3ZREA 1PX6A 2C3NA 1J9BA 2O85A 1O6JA 2VCWA 3M1GA 2WS2A 1TRVA 4G10A 2K18A 4MH2A 10GSA 2HI7A 2A4HA 2CT6A 5AGYA 2DJ0A 4KF9A 4WBJA 2V2GA 4L0WA 5J41A 1W4VA 2C80A 3C7MA 5KN2A 3TKSA 1YQ1A 3TJGA 3QAWA 2VCTA 1BQ7A 3ERGA 3MWHA 1GL8A 2PBJA 1TU7A 2FA8A 1ZYEA 1VF4A 3O76A 2MBTA 3WYWA 2YWMA 2FA4A 16GSA 3C1RA 4YH2A 3KH7A 1MDIA 4I97A 1CQGA 3HY2A 4NWYA 3GRXA 3L9VA 1GP1A 5CAXA 4MDCA 1OC8A 5GAPD 1V9WA 5DJLA 1HNAA 3MSZA 5DJMA 2WULA 2WZ9A 3BCKA 1W89A 5GAND 4ML1A 1XZOA 4AJ6A 2N5BA 1YEXA 4MCUA 1FOHA 3US3A 2GZZA 2C1YA 1SKSB 4BPYA 4JEDA 5F07A 2HZFA 1EGOA 2IPAA 3FW2A 3EU4A 1K3LA 2VM1A 3DKSA 4JE1A 3HJPA 1XWBA 3LFLA 1X9SB 5GSSA 4PQIA 3H8QA 2MZCA 1TKDB 2HZEA 2GT6A 3GX8A 3Q6OA 2VCZA 3MIXA 2VCVA 2QGVA 2FNOA 2H74A 2V41A 5G1LA 3TDGA 1GUHA 2C3TA 4POLA 4RI7A 5AISA 4RQXA 22GSA 1G0TA 3KP8A 4LL4B 4X43A 2HFDA 2R3XA 1SJIA 3QFAC 2H71A 3HVSA 3KD0A 2YV7A 3S9FA 2H6XA 1WIKA 2H66A 4N0ZA 3FZ5A 2AB6A 1N2AA 2AUVA 3IOSA 1YZXA 2FWEA 4AF2A 1X9MB 3KCMA 2ES7A 3BCIA 5BRTA 5CP1A 3R2QA 2KHPA 2P5QA 2H1AA 1CQHA 2E0QA 3ME7A 2JSZA 3O3TA 3C73A 2DMLA 2FWGA 1DBYA 3APOA 3NOFA 3GMFA 2GGTA 4N10A 1VGLA 1GSQA 5D9VA 2V6KA 3ZL5A 4D73B 4HQSA 1OVNA 4F9ZA 2VLVA 1GUKA 1T7PB 3DWVA 4IGJA 1AW9A 2EIRA 1TRWA 3ERWA 4KDXA 1PN9A 4KH7A 5J5NA 2VL9A 3QOUA 1QFNA 2WB9A 1SK1A 2EIOA 4OMVA 3I43A 5B6MA 2FLSA 3GH6A 4ZBDA 5G30A 1WWJA 3HXSA 2Z9SA 1Z9HA 5AIXA 3UOMA 5A4WA 2IMIA 1GNEA 1GLPA 4MPFA 5DALB 4YQUA 5HQPA 4O32A 13GSA 5G1KA 3HHVA 5GSTA 4GTUA 1M2AA 3FR3A 4J56E 1JLWA 1XW9A 4EIQA 4TN8A 4MF7A 1OC3A 4HUAA 3KTLA 5J3RA 1PRXA 3UVHA 2DMMA 1XW5A 4TXOA 1AUCA 2B5XA 5DVBA 3PR8A 5J9BA 4EIPA 3TRQA 5IMFA 12GSA 2B7KA 4POMA 3F0IA 1ERTA 3IA1A 4Q5QA 5BMUA 3M9JA 3TRPA 3IBHA 4LL1B 2MMOA 5C04A 1ZOFA 3TKRA 2DIZA 1ERUA 4KDYA 5JCGA 1TU8A 3EE2A 2EIQA 3UBLA 2H19A 1KNGA 1GRXA 3EMPA 1G7OA 4FYBA 3GKXA 4JZQA 4GQCA 1NW2A 3H1NA 4GF0A 4WF5A 3ZRDA 3KEBA 2H73A 2VCXA 4MJCA 2X64A 2GQMA 4EUYA 4MABA 3EU3A 1T4YA 1MDKA 2DLXA 2I9HA 3LORA 2FY6A 3UL3A 3G7IA 4TVEA 2CV4A 4JU5A 1XXUA 1TK8B 5GZZB 2JZTA 1EOHA 4ECBA 3R3EA 5ELAA 3ZIVA 3TOTA 3GIXA 3MYDA 4FYUA 2H01A 3KM6A 4HZ4A 2CVKA 5ECIB 1V57A 3ZZXA 2IWTA 4K7NA 3M3MA 4IKHA 4PXOA 3GTUB 1R26A 1O8XA 3BBYA 1V40A 1K3YA 4MJEA 2HXKA 3D22A 4YQVA 3GN3A 2HRNA 5G2ZA 3CBUA 1TP9A 1G7EA 1PSQA 1THOA 1PN0A 8GSSA 2WDUA 1EOGA 5A4VA 1BAYA 4AJ7A 1EEMA 2AYTA 3P7XA 4WETA 3IHQA 3J7Yk 3KTBA 1PL1A 1O81A 3GH9A 4HS1A 6GSVA 4GSNA 1M99A 5H5QA 1VRSD 2XBQA 1U87A 5G5FA 3AY8A 2NTOA 2V1MA 3BOAA 4CHSA 3TJJA 1EP7A 2X8HA 1GUMA 2IFQA 5D9TA 1FHEA 2YWOA 3ED3A 1OE8A 5B8AA 4CY8A 4MH3A 3RHBA 4IW9A 4K0GA 2C4JA 2CX3A 2ON5A 1GSUA 2H75A 1YKCA 2YCDA 3DD3A 2BTOT 5D96A 1AC1A 4POBA 3FYGA 4EE0A 1BYEA 1MD4A 3ZVJD 4LLRA 5EPFA 1TRUA 4MP4A 4KX4A 3FRCA 1TK5B 4BL7B 2PVQA 3TKPA 5ABRA 1GWCA 2BMXA 3GKNA 3GA4A 2R4VA 4F0CA 4OFTA 2E2MA 4KA0A 1PD21 1THXA 2DSAA 3WGDA 1K0BA 5JWQB 3VPTA 3W8JA 1JZRA 5D8IA 1NSWA 3U5RE 1KTEA 4IS0A 4XIHA 5IMAA 1XWGA 4V2LA 9GSSA 3IC8A 1ZYQB 4BVXA 2LJKA 4WEYA 5ECNB 1FW1A 1SU9A 3A2XA 1U3IA 2OJLA 2D2ZA 2DKHA 3M8NA 2B1KA 4FO5A 2HRKA 1HNCA 1TTZA 1T1VA 2HYXA 2OKAA 4N11A 3TJFA 4DSSB 4QL9A 1URMA 3L9UA 5FWGA 1TK0B 5DCHA 1M2BA 2EC4A 3F8UA 4NPBA 2B6MA 4NXIA 4O92A 3FKFA 2QA2A 5E4WA 4OD7A 1FB6A 1QQ2A 2C0DA 3L4NA 3EYTA 2F51A 2IL3A 5IMDA 1PKZA 3IC4A 1U88A 2M72A 2YJ7A 1J08A 2DJ2A 1PX7A 5IOWA 4G0IA 1K0CA 3CXGA 5D9XA 2L6CA 3I69A 5JWOB 1HD2A 2L59A 5EL8A 1Z5YE 3C8EA 5LNKe 2PVOC 5DBQA 2VLTA 2R2JA 3LXZA 3GYKA 2F3MA 3V1WA 3VWVA 1AQVA 2GSRA 2IMFA 3HCZA 4Z2TA 2L6DA 2X49A 3FHKA 4QL7A 1R7HA 7GSSA 2YOIA 3KH9A 2LV3A 1ML6A 1AXDA 2H0IA 2M80A 1TI1A 5HR2A 2WGRA 1ERVA 2RLIA 2RUFA 3N5OA 3DYRA 1YEPA 2HE3A 2PWJA 2JU5A 2ZCTA 3QAVA 4IQ1A 1AQXA 1ACVA 4X0XA 4OO5A 5KOWA 4EDYA 4GWRA 3FR9A 2DKIA 2HLSA 3RHCA 4ACSA 2LRCA 4XCSA 4EO3A 5ECKB 3DVXA 2GDRA 5ID2B 1IYIA 2VO4A 3VI7A 3OR5A 5J9CA 3F4SA 5CREA 1SYRA 1GSEA 2GQLA 3E0UA 1A24A 2GSSA 2RM6A 2IIYA 5G31A 1EP8A 2ZNMA 1XWAA 2X8CA 2QC7A 3F3QA 1QGVA 1S3CA 1OC9A 1SYXA 4O7HA 1SD9A 3DIEA 3DVWA 3TOUA 4YKFA 5IPGA 3GX0A 4F82A 4K0NA 3GKKA 2MYGA 2FD3A 5IO0A 4OCFA 4JR4A 2A4VA 1SENA 2VL2C 2IMDA 3GL5A 4Z2RA 4KE3A 4IVFA 2C0EA 2X4AA 3I9V2 2LJAA 4ILFA 1GSDA 1HNBA 3PGTA 4L8EA 1U6TA 5L71A 2YWIA 4X1UA 3IR4A 1N8JA 4I8BA 3LJRA 6GSXA 4LA1A 4J2FA 3FMWA 2QA1A 1YY7A 4GSTA 2L4CA 2FGXA 3HVXA 5AN1A 1DSBA 3UBKA 3ZIJA 4IJ3A 1SL2B 1WPIA 1JFUA 5DAKB 4YAPA 5DQYA 1K3OA 3ISOA 3D21A 1MD3A 2YNXA 1LU4A 3M0FA 1F3BA 1WOUA 3KXOA 4K2DA 2N5AA 4PGTA 3RPPA 2HRFA 4DSQA 3H93A 3QMXA 4TR1A 2ZUPA 1YJ6A 2PERA 3L78A 4YAVA 1ZGNA 2NPBA 3TB2A 5JWRB 3RDWA 3MAKA 2VD0A 1E2YA 1TI3A 4DSRA 1GSYA 2KP1A 2LEGA 2PN8A 3UIWA 3IPZA 2H1DA 1JZDA 4TOPA 2X99A 3VI5A 1WE0A 5ECSA 2LSTA 4OFMA 3WT1A 5JCUA 4G0KA 1Q98A 4JBBA 2F8FA 1ABAA 1BX9A 4MA9A 2C3QA 2JL4A 4P3YB 1F6MC 4QQ7A 17GSA 5KN0A 5IQYA 4XS4B 3CYNA 4ZB6A 1MTCA 1A8YA 3CTFA 2C8UA 1FB0A 3GUSA 4OCEA 2YN1A 1ZYPA 2P5RA 3CMIA 1JLVA 14GSA 1M7TA 3BD2A 1PQNA 2AAWA 1I9DA 2B5YA 1B4QA 4RUVA 1SK2A 2CX4A 4I2TA 3UVTA 3QFBC 4ZL7A 2VUPA 3RPNA 1A2MA 11GSA 3QDNA 1GTBA 2GZYA 4K7IA 2V32A 2H8LA 2PU9C 4O5RA 3P90A 4GSSA 1XW6A 1HQOA 1GSSA 5IPHA 1VF1A 2GQKA 4E8HA 5ECOB 2R0GA 1UA5A 2OADA 1Z6MA 2G0FA 4KUNA 1X9WB 2UZ8A 2R5GA 3SWLA 1EGRA 4I5QA 3KJYA 1M9AA 5ELGA 2F8AA 4BVYB 2VIMA 1LJRA 4H86A 1YF1A 1RQMA 4GLTA 1T8EB 4K8MA 3A2VA 4F2IA 4EKZA 4JRRA 3VWUA 4OO4A 2RUEA 1MDJA 4NHZA 1AAZA 1OKTA 4LMWA 3ZFBA 5E59A 1M0UA 3IE3A 3C71A 5KN3A 4GRFA 3KGKA 5CRHA 3TKSC 5IM9A 2LJRA 3ZVJA 5A4UA 3LXTA 4X4JA 1DE2A 1GTAA 3LQ7A 1TOFA 4XHMA 3FK8A 3QCPA 1VF3A 6GSSA 3D5JA 2CVDA 3TCOA 3Q74A 5B7CA 1RW1A 3LW9A 2B7JA 4ZL8A 2R6KA 1XVQA 2OBIA 1FAAA 1G6WA 4KNDA 4OFNA 5EVOA 3TUEA 2GTUA 3WT2A 5IMCA 3HYPA 2DJKA 4D73A 3LYPA 2OACA 5ECPB 1XCCA 3TRXA 1IYHA 4MJBA 4HJ2A 19GSA 1Q4JA 3IK9A 2IJYA 2X8GA 3ZMLA 5A5KA 4IQAA 1R5PA 1DE1A 1BJXA 2LTKA 2VM2A 3G9BA 2CZ3A 2O89A 2AHEA 4XS1A 4HZ2A 4HU7A 4MF5A 3VURA 4MZCA 4CDOA 4EDZA 2XHFA 1ZCPA 5DALA 4KDUA 4L0UA 3ZTLA 3ZLPA 2B5EA 5ECQB 4F03A 3QR6A 4ZIJA 5DCGA 4ZB8A 1BEDA 4MPGA 4BWSA 3QPMA 3PINA 4MK3A 4MMMA 4O5UA 4K7OA 2CAIA 4KAEA 2CA8A 4ZILA 3LSZA 6GSUA 3GV1A 3CSIA 4K5SA 2QKEA 3P8WA 4IELA 1PGTA 1Z7PA 4NV5A 4ECCA 4Q5FA 3DEXA 4KB3A 3KP9A 2A2SA 2L5LA 4WR5A 2A2PA 2FWFA 2GS3A 3IV4A 4A5PA 1GTIA 2KOKA 3UAPA 3APSA 3GFKA 2B1LA 2KUCA 2JZRA 2H30A 5F0GA 1GTUA 4JR6A 2C0GA 1YKAA 1O73A 3C1SA 4NHWA 1O85A 4PNFA 2XPEA 2V6OA 5IMVA 4ZB9A 2E2GA 5JCWA 4Z2UA 4ECJA 3VFIA 2GT5A 3GKMA 2JADA 3WD6A 2BJXA 1X5DA 1QXHA 3VWWA 1QUWA 5G5EA 3LGCA 4TKYA 1WMJA 1FOVA 5F06A 3TJKA 2YANA 4MJAA 2HZEB 2RIIA 4PQ1A 1UVZA 1DUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSH A;  2H6Z A;  3GTU A;  2R37 A;  4ZBA A;  2REM A;  5FT3 A;  3TGZ A;  5IOX A;  4HOJ A;  4DEJ A;  2H72 A;  3LYK A;  4HJM A;  2OBK A;  2H1B A;  5D9W A;  2LQQ A;  3VLN A;  2LNS A;  4N0V A;  4KSM A;  2DJ3 A;  2H0H A;  1KBN A;  2XBI A;  2O7K A;  4V2N A;  2IMK A;  2FCH A;  1WP0 A;  5J4U A;  2YWN A;  2YP6 A;  4G2E A;  2TRC P;  1Z7R A;  3FZ9 A;  3PH9 A;  3JCM L;  3KZQ A;  3WGX A;  4NMU A;  1PKW A;  3LWA A;  1C72 A;  4KGI A;  3QAG A;  1PMT A;  1V58 A;  1WRY A;  2GVP A;  3J7Y b;  2LNT A;  2H0G A;  3DML A;  4G9H A;  4WBR D;  3GUR A;  3EWL A;  2YPM A;  5H5S A;  1ERW A;  2L5O A;  1B4P A;  3ZMK A;  3HA9 A;  4TXV A;  3F63 A;  2CQ9 A;  1F37 A;  3ME8 A;  2FWH A;  5HR3 A;  3VWX A;  4Q5R A;  5HFI A;  5EY6 A;  1TJD A;  1XPV A;  1XOB A;  1M2D A;  4ISD A;  2VLU A;  2RM5 A;  4BL7 A;  1G6Y A;  3UMA A;  1TRS A;  4MZW A;  1NM3 A;  1TDI A;  2TRX A;  3CRU A;  5LD0 A;  2PPT A;  1K0D A;  3KMN A;  1A2L A;  4MLY A;  1JHB A;  2FHE A;  4IJI A;  4YQM A;  1T3B A;  4TXO B;  4AGS A;  4GXZ A;  4PUA A;  3UAR A;  1A0R P;  1J0F A;  3QD9 A;  3RAZ A;  4WR4 A;  3Q19 A;  4RQR A;  2OE3 A;  1U3A A;  2CVB A;  5KN1 A;  1EZK A;  4I2U A;  1GSF A;  1GLQ A;  1PL2 A;  1F2E A;  1B9X C;  1Z6N A;  4PUR A;  1QK8 A;  2H6Y A;  3E3E A;  4HDE A;  3KIJ A;  5IO2 A;  2NDO A;  4TR3 A;  5DDL A;  2TIR A;  4DSS A;  4POK A;  1SKR B;  2XC2 A;  4MZB A;  3UEM A;  4EVM A;  2I4A A;  1Z3E A;  4HI7 A;  1USB A;  4WXT A;  4NAX A;  1H4O A;  4GQF A;  1WJK A;  2OA7 A;  4L5O A;  2K8V A;  2DJJ A;  4EXJ A;  5CYY A;  3A5W A;  1XVW A;  1A2J A;  2M46 A;  1V98 A;  3FZ4 A;  4G19 A;  2LKU A;  1OAZ A;  3MNG A;  4ZXG A;  4EF0 A;  2ON7 A;  1XBS A;  1AQW A;  5INY A;  2B3S A;  4AJ8 A;  1X0R A;  3P2A A;  2OE0 A;  2C0F A;  4XRA A;  2LRN A;  5F8B A;  4E8E A;  4K1F A;  6GST A;  3TKQ A;  1ST9 A;  3CSJ A;  2YZH A;  3IDV A;  2VOC A;  3NIV A;  4NV2 A;  1XOA A;  3ZYW A;  4PUF C;  1SD8 A;  2I81 A;  2DBC A;  3HVV A;  3F6F A;  2OE1 A;  4PX1 A;  1A23 A;  3D0Z A;  3CRT A;  1ZMA A;  1EV4 A;  3KMO A;  1BG5 A;  3L9S A;  3HKR A;  2IFQ B;  1R5A A;  5LCZ A;  5H5R A;  2P0G A;  3IXR A;  2L57 A;  3LG6 A;  4IP6 A;  2HNL A;  2YZU A;  18GS A;  1SL0 B;  5ID2 A;  4RI6 A;  4FIW A;  2O87 A;  4L5L A;  2KP2 A;  4KSO A;  3HJM A;  1O7U A;  4F0B A;  2H1G A;  2DC5 A;  2CAQ A;  2IME A;  2WJU A;  4HU9 A;  2K9F A;  3DRN A;  5CRW A;  2DJ1 A;  1FVK A;  1FVJ A;  3Q18 A;  5CRG A;  2L4Q A;  2K6V A;  1TXX A;  1Y25 A;  4HEA 2;  2GST A;  4PNG A;  4KCE A;  2AV4 A;  4IN0 A;  3ERF A;  5B8B A;  2GLR A;  1S3A A;  1I5G A;  2GSQ A;  1O8W A;  2WFC A;  2GZP A;  3GL3 A;  1A8L A;  4DVC A;  3CTG A;  3HZ4 A;  5CRD A;  2N5F A;  1ZZY A;  5D93 A;  4BA7 A;  1FO5 A;  4CW9 A;  3A2W A;  4ULX A;  3U6V A;  3IAS 2;  1KEB A;  1V2A A;  4EL1 A;  3VK9 A;  1QMV A;  3HZ8 A;  1SK0 A;  1EWX A;  1XIY A;  1K0O A;  1SL1 B;  5HR1 A;  3FZA A;  2HT9 A;  5FHI A;  1X5E A;  2AJQ B;  2O8V B;  5HFG A;  3UJ1 A;  1T00 A;  4FYC A;  4GCI A;  5CO3 A;  5HFK A;  1VF2 A;  1EEJ A;  3HD5 A;  5D73 A;  3GNJ A;  2MBS A;  1K0N A;  5DAK A;  2VD1 A;  5ECL B;  4XTS A;  3GST A;  3M9K A;  2LQO A;  1K0M A;  3E9J B;  3EUR A;  4IP1 A;  1ZL9 A;  2NVL A;  3EVI A;  5AIV A;  5HR0 A;  5F05 A;  2F9S A;  1XWC A;  4MF6 A;  1ILO A;  2WRT A;  6GSY A;  4HQZ A;  2LRT A;  1F3A A;  5ENU A;  3HDC A;  4BWQ A;  3K8N A;  3WGE A;  2LUS A;  1HYU A;  2LS5 A;  2VAF A;  1TW9 A;  4ZBB A;  3MDK A;  1E6B A;  1FG4 A;  1M9B A;  1Y6E A;  4PQH A;  20GS A;  2JSY A;  2K8S A;  4WF4 A;  1MEK A;  4Q5N A;  4V1A p;  3ZFL A;  3H79 A;  2H76 A;  3W6G A;  4XS4 A;  3TKS E;  2MMN A;  5ECM B;  1H75 A;  3FR6 A;  4OWY A;  2VL2 A;  1JZO A;  3DGQ A;  3EMX A;  4IHU A;  5IIZ A;  3W8S A;  1NHO A;  1X5C A;  1GNW A;  1K0A A;  1EV9 A;  2MMA A;  2QSI A;  1OKD A;  2E7P A;  2KLX A;  4N30 A;  3EIN A;  2MMZ A;  5IMZ A;  1ON4 A;  4K6X A;  2J9H A;  1OE7 A;  3F4T A;  1SJ6 A;  3FY7 A;  5ECH B;  1A0F A;  3TJB A;  3APQ A;  3D6I A;  2I3Y A;  3G7Y A;  1UN2 A;  4Z7X A;  4XS6 A;  3F3R A;  2CZ2 A;  2PMT A;  2PGT A;  4ZL9 A;  2WCI A;  3A3T A;  3NZN A;  2PUK C;  3H4K A;  3IK7 A;  4EC0 A;  5C00 A;  3EC3 A;  4BVY A;  1UC7 A;  1OYJ A;  1NHY A;  4IBP A;  4K9Z A;  1YF0 A;  2J23 A;  1GUL A;  4TR4 A;  3IAM 2;  2XPD A;  3VPQ A;  4XRD A;  3G7J A;  1F9M A;  2IN3 A;  5B6N A;  4FH8 A;  1OC9 B;  2G2Q A;  3SBC A;  1JZW A;  5CNW A;  4WKW A;  3F6D A;  3FEU A;  4ECI A;  4J57 E;  3RBT A;  3GHA A;  3LEF A;  3D4M A;  4ID0 A;  2HSH A;  2JAC A;  2DIY A;  2H70 A;  6GSW A;  5DQS A;  1RK4 A;  3IRA A;  4KW6 A;  5ECR B;  3N9J A;  4TR0 A;  3D4T A;  2HSY A;  2FUG 2;  1YDK A;  3HJO A;  1SJZ A;  1GH2 A;  3F4R A;  2ALB A;  1B9Y C;  3BJ5 A;  1B8X A;  1S3D A;  4TW5 A;  3L0H A;  2VL3 A;  3DXB A;  1LBK A;  1AIU A;  1B48 A;  2A2R A;  4LMV A;  3O6T A;  3F9U A;  2VCQ A;  4I6X A;  3ZIT A;  5KEJ A;  2P31 A;  1XFL A;  4V2M A;  2JZS A;  4V1A g;  2I1U A;  3I6A A;  1SKW B;  4KCA A;  1PA3 A;  4TR1 B;  4TRX A;  5COH A;  3GSS A;  4ML6 A;  2YJH A;  2NBS A;  1R4W A;  2YV9 A;  1T4Z A;  1XWK A;  3ZRE A;  1PX6 A;  2C3N A;  1J9B A;  2O85 A;  1O6J A;  2VCW A;  3M1G A;  2WS2 A;  1TRV A;  4G10 A;  2K18 A;  4MH2 A;  10GS A;  2HI7 A;  2CT6 A;  5AGY A;  2DJ0 A;  4WBJ A;  2V2G A;  4L0W A;  5J41 A;  1W4V A;  2C80 A;  3C7M A;  5KN2 A;  3TKS A;  1YQ1 A;  3TJG A;  3QAW A;  2VCT A;  1BQ7 A;  3ERG A;  3MWH A;  1GL8 A;  2PBJ A;  1TU7 A;  2FA8 A;  1ZYE A;  1VF4 A;  3O76 A;  2MBT A;  3WYW A;  2YWM A;  2FA4 A;  16GS A;  3C1R A;  4YH2 A;  3KH7 A;  1MDI A;  4I97 A;  1CQG A;  3HY2 A;  4NWY A;  3GRX A;  3L9V A;  1GP1 A;  5CAX A;  4MDC A;  1OC8 A;  5GAP D;  1V9W A;  5DJL A;  1HNA A;  3MSZ A;  5DJM A;  2WUL A;  2WZ9 A;  3BCK A;  1W89 A;  5GAN D;  4ML1 A;  1XZO A;  4AJ6 A;  2N5B A;  1YEX A;  4MCU A;  3US3 A;  2GZZ A;  2C1Y A;  1SKS B;  4BPY A;  4JED A;  5F07 A;  2HZF A;  1EGO A;  2IPA A;  3FW2 A;  3EU4 A;  1K3L A;  2VM1 A;  3DKS A;  4JE1 A;  3HJP A;  1XWB A;  3LFL A;  1X9S B;  5GSS A;  4PQI A;  3H8Q A;  2MZC A;  1TKD B;  2HZE A;  2GT6 A;  3GX8 A;  3Q6O A;  2VCZ A;  2VCV A;  2QGV A;  2FNO A;  2H74 A;  2V41 A;  5G1L A;  3TDG A;  1GUH A;  2C3T A;  4POL A;  4RI7 A;  5AIS A;  4RQX A;  22GS A;  1G0T A;  3KP8 A;  4LL4 B;  4X43 A;  2HFD A;  2R3X A;  1SJI A;  3QFA C;  2H71 A;  3HVS A;  3KD0 A;  2YV7 A;  3S9F A;  2H6X A;  1WIK A;  2H66 A;  4N0Z A;  3FZ5 A;  2AB6 A;  1N2A A;  2AUV A;  3IOS A;  1YZX A;  2FWE A;  4AF2 A;  1X9M B;  3KCM A;  2ES7 A;  3BCI A;  5CP1 A;  3R2Q A;  2KHP A;  2P5Q A;  2H1A A;  1CQH A;  2E0Q A;  3ME7 A;  2JSZ A;  3O3T A;  3C73 A;  2DML A;  2FWG A;  1DBY A;  3APO A;  3NOF A;  3GMF A;  2GGT A;  4N10 A;  1VGL A;  1GSQ A;  5D9V A;  2V6K A;  3ZL5 A;  4D73 B;  4HQS A;  1OVN A;  4F9Z A;  2VLV A;  1GUK A;  1T7P B;  3DWV A;  4IGJ A;  1AW9 A;  2EIR A;  1TRW A;  3ERW A;  4KDX A;  1PN9 A;  4KH7 A;  5J5N A;  2VL9 A;  3QOU A;  1QFN A;  2WB9 A;  1SK1 A;  2EIO A;  4OMV A;  3I43 A;  5B6M A;  2FLS A;  3GH6 A;  4ZBD A;  5G30 A;  1WWJ A;  3HXS A;  2Z9S A;  1Z9H A;  5AIX A;  3UOM A;  5A4W A;  2IMI A;  1GNE A;  1GLP A;  4MPF A;  5DAL B;  4YQU A;  5HQP A;  4O32 A;  13GS A;  5G1K A;  3HHV A;  5GST A;  4GTU A;  1M2A A;  3FR3 A;  4J56 E;  1JLW A;  1XW9 A;  4TN8 A;  4MF7 A;  1OC3 A;  4HUA A;  3KTL A;  5J3R A;  1PRX A;  3UVH A;  2DMM A;  1XW5 A;  4TXO A;  1AUC A;  2B5X A;  5DVB A;  3PR8 A;  5J9B A;  3TRQ A;  5IMF A;  12GS A;  2B7K A;  4POM A;  3F0I A;  1ERT A;  3IA1 A;  4Q5Q A;  3M9J A;  3TRP A;  3IBH A;  4LL1 B;  2MMO A;  5C04 A;  1ZOF A;  3TKR A;  2DIZ A;  1ERU A;  4KDY A;  5JCG A;  1TU8 A;  3EE2 A;  2EIQ A;  3UBL A;  2H19 A;  1KNG A;  1GRX A;  3EMP A;  1G7O A;  4FYB A;  3GKX A;  4JZQ A;  4GQC A;  1NW2 A;  3H1N A;  4GF0 A;  4WF5 A;  3ZRD A;  3KEB A;  2H73 A;  2VCX A;  4MJC A;  2X64 A;  2GQM A;  4EUY A;  4MAB A;  3EU3 A;  1T4Y A;  1MDK A;  2DLX A;  2I9H A;  3LOR A;  2FY6 A;  3UL3 A;  3G7I A;  4TVE A;  2CV4 A;  4JU5 A;  1XXU A;  1TK8 B;  5GZZ B;  2JZT A;  1EOH A;  4ECB A;  5ELA A;  3ZIV A;  3TOT A;  3GIX A;  4FYU A;  2H01 A;  3KM6 A;  4HZ4 A;  2CVK A;  5ECI B;  1V57 A;  3ZZX A;  2IWT A;  4K7N A;  3M3M A;  4IKH A;  4PXO A;  3GTU B;  1R26 A;  1O8X A;  3BBY A;  1V40 A;  1K3Y A;  4MJE A;  2HXK A;  3D22 A;  4YQV A;  3GN3 A;  2HRN A;  5G2Z A;  3CBU A;  1TP9 A;  1G7E A;  1PSQ A;  1THO A;  8GSS A;  2WDU A;  1EOG A;  5A4V A;  1BAY A;  4AJ7 A;  1EEM A;  2AYT A;  3P7X A;  4WET A;  3IHQ A;  3J7Y k;  3KTB A;  1PL1 A;  1O81 A;  3GH9 A;  4HS1 A;  6GSV A;  4GSN A;  1M99 A;  5H5Q A;  1VRS D;  2XBQ A;  1U87 A;  5G5F A;  3AY8 A;  2NTO A;  2V1M A;  3BOA A;  4CHS A;  3TJJ A;  1EP7 A;  2X8H A;  1GUM A;  2IFQ A;  5D9T A;  1FHE A;  2YWO A;  3ED3 A;  1OE8 A;  5B8A A;  4MH3 A;  3RHB A;  4IW9 A;  4K0G A;  2C4J A;  2CX3 A;  2ON5 A;  1GSU A;  2H75 A;  1YKC A;  2YCD A;  3DD3 A;  2BTO T;  5D96 A;  1AC1 A;  4POB A;  3FYG A;  4EE0 A;  1BYE A;  1MD4 A;  3ZVJ D;  4LLR A;  5EPF A;  1TRU A;  4MP4 A;  4KX4 A;  3FRC A;  1TK5 B;  2PVQ A;  3TKP A;  5ABR A;  1GWC A;  2BMX A;  3GKN A;  3GA4 A;  2R4V A;  4F0C A;  4OFT A;  2E2M A;  4KA0 A;  1PD2 1;  1THX A;  2DSA A;  3WGD A;  1K0B A;  5JWQ B;  3VPT A;  3W8J A;  1JZR A;  5D8I A;  1NSW A;  3U5R E;  1KTE A;  4IS0 A;  4XIH A;  5IMA A;  1XWG A;  4V2L A;  9GSS A;  1ZYQ B;  4BVX A;  2LJK A;  4WEY A;  5ECN B;  1FW1 A;  1SU9 A;  3A2X A;  1U3I A;  2OJL A;  2D2Z A;  3M8N A;  2B1K A;  4FO5 A;  1HNC A;  1TTZ A;  1T1V A;  2HYX A;  2OKA A;  4N11 A;  3TJF A;  4DSS B;  4QL9 A;  1URM A;  3L9U A;  5FWG A;  1TK0 B;  5DCH A;  1M2B A;  2EC4 A;  3F8U A;  4NPB A;  2B6M A;  4NXI A;  4O92 A;  3FKF A;  5E4W A;  4OD7 A;  1FB6 A;  1QQ2 A;  2C0D A;  3L4N A;  3EYT A;  2F51 A;  2IL3 A;  5IMD A;  1PKZ A;  3IC4 A;  1U88 A;  2M72 A;  2YJ7 A;  1J08 A;  2DJ2 A;  1PX7 A;  5IOW A;  1K0C A;  3CXG A;  5D9X A;  2L6C A;  3I69 A;  5JWO B;  1HD2 A;  2L59 A;  5EL8 A;  1Z5Y E;  3C8E A;  5LNK e;  2PVO C;  5DBQ A;  2VLT A;  2R2J A;  3LXZ A;  3GYK A;  2F3M A;  3V1W A;  3VWV A;  1AQV A;  2GSR A;  2IMF A;  3HCZ A;  2L6D A;  3FHK A;  4QL7 A;  1R7H A;  7GSS A;  2YOI A;  3KH9 A;  2LV3 A;  1ML6 A;  1AXD A;  2H0I A;  2M80 A;  1TI1 A;  5HR2 A;  2WGR A;  1ERV A;  2RLI A;  2RUF A;  3N5O A;  3DYR A;  1YEP A;  2HE3 A;  2PWJ A;  2JU5 A;  2ZCT A;  3QAV A;  4IQ1 A;  1AQX A;  1ACV A;  4X0X A;  4OO5 A;  4EDY A;  4GWR A;  3FR9 A;  2HLS A;  3RHC A;  4ACS A;  2LRC A;  4XCS A;  4EO3 A;  5ECK B;  3DVX A;  2GDR A;  5ID2 B;  1IYI A;  2VO4 A;  3VI7 A;  3OR5 A;  5J9C A;  3F4S A;  5CRE A;  1SYR A;  1GSE A;  2GQL A;  3E0U A;  1A24 A;  2GSS A;  2RM6 A;  2IIY A;  5G31 A;  1EP8 A;  2ZNM A;  1XWA A;  2X8C A;  2QC7 A;  3F3Q A;  1QGV A;  1S3C A;  1OC9 A;  1SYX A;  4O7H A;  1SD9 A;  3DIE A;  3DVW A;  3TOU A;  5IPG A;  3GX0 A;  4F82 A;  4K0N A;  3GKK A;  2MYG A;  2FD3 A;  5IO0 A;  4OCF A;  4JR4 A;  2A4V A;  1SEN A;  2VL2 C;  2IMD A;  3GL5 A;  4KE3 A;  4IVF A;  2C0E A;  3I9V 2;  2LJA A;  4ILF A;  1GSD A;  1HNB A;  3PGT A;  4L8E A;  1U6T A;  5L71 A;  2YWI A;  4X1U A;  3IR4 A;  1N8J A;  4I8B A;  3LJR A;  6GSX A;  4LA1 A;  4J2F A;  1YY7 A;  4GST A;  2L4C A;  2FGX A;  3HVX A;  5AN1 A;  1DSB A;  3UBK A;  3ZIJ A;  4IJ3 A;  1SL2 B;  1WPI A;  1JFU A;  5DAK B;  4YAP A;  5DQY A;  1K3O A;  3ISO A;  3D21 A;  1MD3 A;  2YNX A;  1LU4 A;  3M0F A;  1F3B A;  1WOU A;  3KXO A;  4K2D A;  2N5A A;  4PGT A;  3RPP A;  2HRF A;  4DSQ A;  3H93 A;  3QMX A;  4TR1 A;  2ZUP A;  1YJ6 A;  2PER A;  3L78 A;  4YAV A;  1ZGN A;  2NPB A;  3TB2 A;  5JWR B;  3RDW A;  3MAK A;  2VD0 A;  1E2Y A;  1TI3 A;  4DSR A;  1GSY A;  2KP1 A;  2LEG A;  2PN8 A;  3UIW A;  3IPZ A;  2H1D A;  1JZD A;  4TOP A;  2X99 A;  3VI5 A;  1WE0 A;  5ECS A;  2LST A;  4OFM A;  3WT1 A;  5JCU A;  1Q98 A;  4JBB A;  2F8F A;  1ABA A;  1BX9 A;  4MA9 A;  2C3Q A;  2JL4 A;  4P3Y B;  1F6M C;  4QQ7 A;  17GS A;  5KN0 A;  5IQY A;  4XS4 B;  3CYN A;  4ZB6 A;  1MTC A;  1A8Y A;  3CTF A;  2C8U A;  1FB0 A;  3GUS A;  4OCE A;  2YN1 A;  2P5R A;  3CMI A;  1JLV A;  14GS A;  1M7T A;  3BD2 A;  1PQN A;  2AAW A;  1I9D A;  2B5Y A;  1B4Q A;  4RUV A;  1SK2 A;  2CX4 A;  4I2T A;  3UVT A;  3QFB C;  4ZL7 A;  2VUP A;  3RPN A;  1A2M A;  11GS A;  3QDN A;  1GTB A;  2GZY A;  4K7I A;  2V32 A;  2H8L A;  2PU9 C;  4O5R A;  3P90 A;  4GSS A;  1XW6 A;  1HQO A;  1GSS A;  5IPH A;  1VF1 A;  2GQK A;  4E8H A;  5ECO B;  1UA5 A;  2OAD A;  1Z6M A;  2G0F A;  4KUN A;  1X9W B;  2R5G A;  3SWL A;  1EGR A;  4I5Q A;  3KJY A;  1M9A A;  5ELG A;  2F8A A;  2VIM A;  1LJR A;  4H86 A;  1YF1 A;  1RQM A;  4GLT A;  1T8E B;  4K8M A;  3A2V A;  4F2I A;  4EKZ A;  4JRR A;  3VWU A;  4OO4 A;  2RUE A;  1MDJ A;  4NHZ A;  1AAZ A;  1OKT A;  4LMW A;  3ZFB A;  5E59 A;  1M0U A;  3IE3 A;  3C71 A;  5KN3 A;  4GRF A;  3KGK A;  5CRH A;  3TKS C;  5IM9 A;  2LJR A;  3ZVJ A;  5A4U A;  3LXT A;  1DE2 A;  1GTA A;  3LQ7 A;  1TOF A;  4XHM A;  3FK8 A;  3QCP A;  1VF3 A;  6GSS A;  3D5J A;  2CVD A;  3TCO A;  3Q74 A;  5B7C A;  1RW1 A;  2B7J A;  4ZL8 A;  2R6K A;  1XVQ A;  2OBI A;  1FAA A;  1G6W A;  4KND A;  4OFN A;  5EVO A;  3TUE A;  2GTU A;  3WT2 A;  5IMC A;  3HYP A;  2DJK A;  4D73 A;  3LYP A;  2OAC A;  5ECP B;  1XCC A;  3TRX A;  1IYH A;  4MJB A;  4HJ2 A;  19GS A;  1Q4J A;  3IK9 A;  2IJY A;  2X8G A;  3ZML A;  5A5K A;  4IQA A;  1R5P A;  1DE1 A;  1BJX A;  2LTK A;  2VM2 A;  3G9B A;  2CZ3 A;  2O89 A;  2AHE A;  4XS1 A;  4HZ2 A;  4HU7 A;  4MF5 A;  3VUR A;  4MZC A;  4CDO A;  4EDZ A;  2XHF A;  1ZCP A;  5DAL A;  4KDU A;  4L0U A;  3ZTL A;  3ZLP A;  2B5E A;  5ECQ B;  4F03 A;  3QR6 A;  4ZIJ A;  5DCG A;  4ZB8 A;  1BED A;  4MPG A;  4BWS A;  3QPM A;  3PIN A;  4MK3 A;  4MMM A;  4K7O A;  2CAI A;  4KAE A;  2CA8 A;  4ZIL A;  3LSZ A;  6GSU A;  3GV1 A;  3CSI A;  2QKE A;  3P8W A;  4IEL A;  1PGT A;  1Z7P A;  4NV5 A;  4ECC A;  4Q5F A;  3DEX A;  4KB3 A;  3KP9 A;  2A2S A;  2L5L A;  4WR5 A;  2FWF A;  2GS3 A;  3IV4 A;  1GTI A;  2KOK A;  3UAP A;  3APS A;  3GFK A;  2B1L A;  2KUC A;  2JZR A;  2H30 A;  5F0G A;  1GTU A;  4JR6 A;  2C0G A;  1YKA A;  1O73 A;  3C1S A;  4NHW A;  1O85 A;  4PNF A;  2XPE A;  2V6O A;  5IMV A;  4ZB9 A;  2E2G A;  5JCW A;  4ECJ A;  3VFI A;  2GT5 A;  3GKM A;  2JAD A;  3WD6 A;  2BJX A;  1X5D A;  1QXH A;  3VWW A;  1QUW A;  5G5E A;  3LGC A;  4TKY A;  1WMJ A;  1FOV A;  5F06 A;  3TJK A;  2YAN A;  4MJA A;  2HZE B;  2RII A;  4PQ1 A;  1UVZ A;  1DUG A; 
#chains in the Genus database with same CATH topology
 3CSH A;  2H6Z A;  3GTU A;  2R37 A;  4ZBA A;  2REM A;  1S3R A;  5FT3 A;  3TGZ A;  5IOX A;  4HOJ A;  4DEJ A;  2H72 A;  3LYK A;  4HJM A;  2OBK A;  2H1B A;  5D9W A;  2LQQ A;  3VLN A;  2LNS A;  4N0V A;  4KSM A;  2DJ3 A;  2H0H A;  1KBN A;  2XBI A;  2O7K A;  4V2N A;  2IMK A;  2FCH A;  1WP0 A;  5J4U A;  2YWN A;  4O5Q A;  2YP6 A;  2R0P A;  4G2E A;  2TRC P;  1Z7R A;  3FZ9 A;  3PH9 A;  3JCM L;  3KZQ A;  3WGX A;  4NMU A;  1PKW A;  3LWA A;  1C72 A;  4KGI A;  3QAG A;  1PMT A;  1V58 A;  1WRY A;  2GVP A;  3J7Y b;  2LNT A;  2H0G A;  3DML A;  4G9H A;  4WBR D;  3GUR A;  3EWL A;  2YPM A;  5H5S A;  1ERW A;  2L5O A;  1B4P A;  3ZMK A;  3HA9 A;  4TXV A;  3F63 A;  2CQ9 A;  1F37 A;  3ME8 A;  4K5R A;  2FWH A;  5HR3 A;  3VWX A;  4Q5R A;  5HFI A;  5EY6 A;  4USS A;  1TJD A;  1XPV A;  1XOB A;  1M2D A;  4ISD A;  3PPU A;  2VLU A;  2RM5 A;  4BL7 A;  1G6Y A;  3UMA A;  1TRS A;  4MZW A;  1NM3 A;  1TDI A;  2TRX A;  3CRU A;  5LD0 A;  2PPT A;  1K0D A;  3KMN A;  1A2L A;  4MLY A;  1JHB A;  4ICY A;  2FHE A;  4IJI A;  4YQM A;  1T3B A;  4TXO B;  4BIK A;  4AGS A;  4GXZ A;  4PUA A;  3UAR A;  1A0R P;  1J0F A;  3QD9 A;  3RAZ A;  4WR4 A;  2HRA A;  3Q19 A;  4RQR A;  2OE3 A;  1U3A A;  2CVB A;  5KN1 A;  1EZK A;  4I2U A;  1GSF A;  1GLQ A;  1PL2 A;  1F2E A;  1B9X C;  1Z6N A;  4PUR A;  1QK8 A;  2H6Y A;  3E3E A;  4HDE A;  3KIJ A;  5IO2 A;  2NDO A;  4TR3 A;  5DDL A;  2TIR A;  4DSS A;  4POK A;  1SKR B;  2XC2 A;  4MZB A;  3UEM A;  4EVM A;  2I4A A;  1Z3E A;  4HI7 A;  1USB A;  4WXT A;  4NAX A;  1H4O A;  4GQF A;  1WJK A;  2OA7 A;  4L5O A;  2K8V A;  2DJJ A;  4EXJ A;  5CYY A;  3A5W A;  1XVW A;  1A2J A;  2M46 A;  1V98 A;  3FZ4 A;  4MNN A;  4G19 A;  2LKU A;  1OAZ A;  3MNG A;  4ZXG A;  4EF0 A;  2ON7 A;  1XBS A;  1AQW A;  5INY A;  2B3S A;  4AJ8 A;  1X0R A;  3P2A A;  2OE0 A;  2C0F A;  4XRA A;  2LRN A;  5F8B A;  4E8E A;  4K1F A;  6GST A;  3TKQ A;  1ST9 A;  3CSJ A;  2YZH A;  3IDV A;  2VOC A;  3NIV A;  4NV2 A;  1XOA A;  3ZYW A;  4PUF C;  1SD8 A;  2I81 A;  2DBC A;  3HVV A;  3F6F A;  2OE1 A;  4PX1 A;  1A23 A;  3D0Z A;  3CRT A;  1ZMA A;  1EV4 A;  3KMO A;  1BG5 A;  3L9S A;  3HKR A;  2IFQ B;  1R5A A;  5LCZ A;  5H5R A;  2P0G A;  4HSC X;  3EPT A;  3IXR A;  2L57 A;  3LG6 A;  4IP6 A;  2HNL A;  2YZU A;  18GS A;  1SL0 B;  5ID2 A;  4RI6 A;  4FIW A;  2O87 A;  4L5L A;  2KP2 A;  4KSO A;  3A5I A;  3HJM A;  1O7U A;  4F0B A;  2H1G A;  2DC5 A;  2CAQ A;  2IME A;  2WJU A;  4HU9 A;  2K9F A;  3DRN A;  5CRW A;  2DJ1 A;  1FVK A;  1FVJ A;  3Q18 A;  5CRG A;  2L4Q A;  2K6V A;  1TXX A;  1Y25 A;  4HEA 2;  2GST A;  4PNG A;  4KCE A;  2AV4 A;  4IN0 A;  3ERF A;  5B8B A;  2GLR A;  4G0L A;  1S3A A;  1I5G A;  2GSQ A;  1O8W A;  2WFC A;  2GZP A;  3GL3 A;  1A8L A;  4DVC A;  3CTG A;  3HZ4 A;  5CRD A;  2N5F A;  1ZZY A;  5D93 A;  4BA7 A;  1FO5 A;  4CW9 A;  3A2W A;  4ULX A;  4FQU A;  3U6V A;  3IAS 2;  1KEB A;  1V2A A;  4EL1 A;  3VK9 A;  1QMV A;  3HZ8 A;  1SK0 A;  1EWX A;  4BVX B;  1XIY A;  1K0O A;  1SL1 B;  5HR1 A;  3FZA A;  2HT9 A;  5FHI A;  2R0C A;  1X5E A;  4CY6 A;  2AJQ B;  2O8V B;  5HFG A;  3UJ1 A;  1T00 A;  4FYC A;  4GCI A;  5CO3 A;  5HFK A;  1VF2 A;  1EEJ A;  3HD5 A;  5D73 A;  3GNJ A;  2MBS A;  1K0N A;  5DAK A;  2VD1 A;  5ECL B;  4XTS A;  3GST A;  3M9K A;  2LQO A;  1K0M A;  3E9J B;  3EUR A;  4IP1 A;  1ZL9 A;  2NVL A;  3EVI A;  5AIV A;  5HR0 A;  5F05 A;  2HSM A;  2F9S A;  1XWC A;  4MF6 A;  1ILO A;  2WRT A;  6GSY A;  4HQZ A;  2LRT A;  1F3A A;  5ENU A;  3HDC A;  5KOX A;  4BWQ A;  3K8N A;  3WGE A;  2LUS A;  1HYU A;  2LS5 A;  2VAF A;  1TW9 A;  4ZBB A;  3MDK A;  1E6B A;  1FG4 A;  1M9B A;  1Y6E A;  4PQH A;  20GS A;  2JSY A;  2K8S A;  4WF4 A;  1MEK A;  1PFO A;  4Q5N A;  4V1A p;  3ZFL A;  3H79 A;  2H76 A;  3W6G A;  4XS4 A;  3TKS E;  2MMN A;  5ECM B;  1H75 A;  3FR6 A;  4OWY A;  2VL2 A;  1JZO A;  3DGQ A;  3EMX A;  4IHU A;  5IIZ A;  3W8S A;  1NHO A;  1X5C A;  1GNW A;  1K0A A;  1EV9 A;  2MMA A;  2QSI A;  1OKD A;  2E7P A;  2KLX A;  4N30 A;  3EIN A;  2MMZ A;  5IMZ A;  1ON4 A;  4K6X A;  2J9H A;  1OE7 A;  3F4T A;  1SJ6 A;  3FY7 A;  5ECH B;  1A0F A;  3TJB A;  3APQ A;  3D6I A;  2I3Y A;  3G7Y A;  1UN2 A;  4Z7X A;  4XS6 A;  3F3R A;  2CZ2 A;  4K2X A;  2PMT A;  2PGT A;  4ZL9 A;  2WCI A;  3A3T A;  3NZN A;  2PUK C;  3H4K A;  3IK7 A;  4EC0 A;  5C00 A;  3EC3 A;  4BVY A;  1UC7 A;  1OYJ A;  1NHY A;  4IBP A;  4K9Z A;  1YF0 A;  2J23 A;  1GUL A;  4TR4 A;  3IAM 2;  2XPD A;  3VPQ A;  4XRD A;  3G7J A;  1F9M A;  2IN3 A;  5B6N A;  4FH8 A;  1OC9 B;  2G2Q A;  3SBC A;  1JZW A;  5CNW A;  4WKW A;  3F6D A;  3FEU A;  4ECI A;  4J57 E;  3RBT A;  3GHA A;  3LEF A;  3D4M A;  4ID0 A;  2HSH A;  2JAC A;  2DIY A;  2H70 A;  4YKG A;  6GSW A;  5DQS A;  3CQF A;  1RK4 A;  3IRA A;  4KW6 A;  5ECR B;  3N9J A;  4TR0 A;  3IHG A;  3D4T A;  2HSY A;  2FUG 2;  1YDK A;  3HJO A;  1SJZ A;  1GH2 A;  3F4R A;  2ALB A;  1B9Y C;  3BJ5 A;  1B8X A;  1S3D A;  4TW5 A;  3L0H A;  1ZYN A;  2VL3 A;  3DXB A;  1LBK A;  1AIU A;  1B48 A;  2A2R A;  4LMV A;  3O6T A;  3F9U A;  2VCQ A;  4I6X A;  4PTS A;  3ZIT A;  5KEJ A;  2P31 A;  1XFL A;  4V2M A;  2JZS A;  4V1A g;  2I1U A;  3I6A A;  1SKW B;  4KCA A;  1PA3 A;  4TR1 B;  4TRX A;  5COH A;  3GSS A;  4ML6 A;  2YJH A;  2NBS A;  1R4W A;  2YV9 A;  1T4Z A;  1XWK A;  3ZRE A;  1PX6 A;  2C3N A;  1J9B A;  2O85 A;  1O6J A;  2VCW A;  3M1G A;  2WS2 A;  1TRV A;  4G10 A;  2K18 A;  4MH2 A;  10GS A;  2HI7 A;  2A4H A;  2CT6 A;  5AGY A;  2DJ0 A;  4KF9 A;  4WBJ A;  2V2G A;  4L0W A;  5J41 A;  1W4V A;  2C80 A;  3C7M A;  5KN2 A;  3TKS A;  1YQ1 A;  3TJG A;  3QAW A;  2VCT A;  1BQ7 A;  3ERG A;  3MWH A;  1GL8 A;  2PBJ A;  1TU7 A;  2FA8 A;  1ZYE A;  1VF4 A;  3O76 A;  2MBT A;  3WYW A;  2YWM A;  2FA4 A;  16GS A;  3C1R A;  4YH2 A;  3KH7 A;  1MDI A;  4I97 A;  1CQG A;  3HY2 A;  4NWY A;  3GRX A;  3L9V A;  1GP1 A;  5CAX A;  4MDC A;  1OC8 A;  5GAP D;  1V9W A;  5DJL A;  1HNA A;  3MSZ A;  5DJM A;  2WUL A;  2WZ9 A;  3BCK A;  1W89 A;  5GAN D;  4ML1 A;  1XZO A;  4AJ6 A;  2N5B A;  1YEX A;  4MCU A;  1FOH A;  3US3 A;  2GZZ A;  2C1Y A;  1SKS B;  4BPY A;  4JED A;  5F07 A;  2HZF A;  1EGO A;  2IPA A;  3FW2 A;  3EU4 A;  1K3L A;  2VM1 A;  3DKS A;  4JE1 A;  3HJP A;  1XWB A;  3LFL A;  1X9S B;  5GSS A;  4PQI A;  3H8Q A;  2MZC A;  1TKD B;  2HZE A;  2GT6 A;  3GX8 A;  3Q6O A;  2VCZ A;  3MIX A;  2VCV A;  2QGV A;  2FNO A;  2H74 A;  2V41 A;  5G1L A;  3TDG A;  1GUH A;  2C3T A;  4POL A;  4RI7 A;  5AIS A;  4RQX A;  22GS A;  1G0T A;  3KP8 A;  4LL4 B;  4X43 A;  2HFD A;  2R3X A;  1SJI A;  3QFA C;  2H71 A;  3HVS A;  3KD0 A;  2YV7 A;  3S9F A;  2H6X A;  1WIK A;  2H66 A;  4N0Z A;  3FZ5 A;  2AB6 A;  1N2A A;  2AUV A;  3IOS A;  1YZX A;  2FWE A;  4AF2 A;  1X9M B;  3KCM A;  2ES7 A;  3BCI A;  5BRT A;  5CP1 A;  3R2Q A;  2KHP A;  2P5Q A;  2H1A A;  1CQH A;  2E0Q A;  3ME7 A;  2JSZ A;  3O3T A;  3C73 A;  2DML A;  2FWG A;  1DBY A;  3APO A;  3NOF A;  3GMF A;  2GGT A;  4N10 A;  1VGL A;  1GSQ A;  5D9V A;  2V6K A;  3ZL5 A;  4D73 B;  4HQS A;  1OVN A;  4F9Z A;  2VLV A;  1GUK A;  1T7P B;  3DWV A;  4IGJ A;  1AW9 A;  2EIR A;  1TRW A;  3ERW A;  4KDX A;  1PN9 A;  4KH7 A;  5J5N A;  2VL9 A;  3QOU A;  1QFN A;  2WB9 A;  1SK1 A;  2EIO A;  4OMV A;  3I43 A;  5B6M A;  2FLS A;  3GH6 A;  4ZBD A;  5G30 A;  1WWJ A;  3HXS A;  2Z9S A;  1Z9H A;  5AIX A;  3UOM A;  5A4W A;  2IMI A;  1GNE A;  1GLP A;  4MPF A;  5DAL B;  4YQU A;  5HQP A;  4O32 A;  13GS A;  5G1K A;  3HHV A;  5GST A;  4GTU A;  1M2A A;  3FR3 A;  4J56 E;  1JLW A;  1XW9 A;  4EIQ A;  4TN8 A;  4MF7 A;  1OC3 A;  4HUA A;  3KTL A;  5J3R A;  1PRX A;  3UVH A;  2DMM A;  1XW5 A;  4TXO A;  1AUC A;  2B5X A;  5DVB A;  3PR8 A;  5J9B A;  4EIP A;  3TRQ A;  5IMF A;  12GS A;  2B7K A;  4POM A;  3F0I A;  1ERT A;  3IA1 A;  4Q5Q A;  5BMU A;  3M9J A;  3TRP A;  3IBH A;  4LL1 B;  2MMO A;  5C04 A;  1ZOF A;  3TKR A;  2DIZ A;  1ERU A;  4KDY A;  5JCG A;  1TU8 A;  3EE2 A;  2EIQ A;  3UBL A;  2H19 A;  1KNG A;  1GRX A;  3EMP A;  1G7O A;  4FYB A;  3GKX A;  4JZQ A;  4GQC A;  1NW2 A;  3H1N A;  4GF0 A;  4WF5 A;  3ZRD A;  3KEB A;  2H73 A;  2VCX A;  4MJC A;  2X64 A;  2GQM A;  4EUY A;  4MAB A;  3EU3 A;  1T4Y A;  1MDK A;  2DLX A;  2I9H A;  3LOR A;  2FY6 A;  3UL3 A;  3G7I A;  4TVE A;  2CV4 A;  4JU5 A;  1XXU A;  1TK8 B;  5GZZ B;  2JZT A;  1EOH A;  4ECB A;  3R3E A;  5ELA A;  3ZIV A;  3TOT A;  3GIX A;  3MYD A;  4FYU A;  2H01 A;  3KM6 A;  4HZ4 A;  2CVK A;  5ECI B;  1V57 A;  3ZZX A;  2IWT A;  4K7N A;  3M3M A;  4IKH A;  4PXO A;  3GTU B;  1R26 A;  1O8X A;  3BBY A;  1V40 A;  1K3Y A;  4MJE A;  2HXK A;  3D22 A;  4YQV A;  3GN3 A;  2HRN A;  5G2Z A;  3CBU A;  1TP9 A;  1G7E A;  1PSQ A;  1THO A;  1PN0 A;  8GSS A;  2WDU A;  1EOG A;  5A4V A;  1BAY A;  4AJ7 A;  1EEM A;  2AYT A;  3P7X A;  4WET A;  3IHQ A;  3J7Y k;  3KTB A;  1PL1 A;  1O81 A;  3GH9 A;  4HS1 A;  6GSV A;  4GSN A;  1M99 A;  5H5Q A;  1VRS D;  2XBQ A;  1U87 A;  5G5F A;  3AY8 A;  2NTO A;  2V1M A;  3BOA A;  4CHS A;  3TJJ A;  1EP7 A;  2X8H A;  1GUM A;  2IFQ A;  5D9T A;  1FHE A;  2YWO A;  3ED3 A;  1OE8 A;  5B8A A;  4CY8 A;  4MH3 A;  3RHB A;  4IW9 A;  4K0G A;  2C4J A;  2CX3 A;  2ON5 A;  1GSU A;  2H75 A;  1YKC A;  2YCD A;  3DD3 A;  2BTO T;  5D96 A;  1AC1 A;  4POB A;  3FYG A;  4EE0 A;  1BYE A;  1MD4 A;  3ZVJ D;  4LLR A;  5EPF A;  1TRU A;  4MP4 A;  4KX4 A;  3FRC A;  1TK5 B;  4BL7 B;  2PVQ A;  3TKP A;  5ABR A;  1GWC A;  2BMX A;  3GKN A;  3GA4 A;  2R4V A;  4F0C A;  4OFT A;  2E2M A;  4KA0 A;  1PD2 1;  1THX A;  2DSA A;  3WGD A;  1K0B A;  5JWQ B;  3VPT A;  3W8J A;  1JZR A;  5D8I A;  1NSW A;  3U5R E;  1KTE A;  4IS0 A;  4XIH A;  5IMA A;  1XWG A;  4V2L A;  9GSS A;  3IC8 A;  1ZYQ B;  4BVX A;  2LJK A;  4WEY A;  5ECN B;  1FW1 A;  1SU9 A;  3A2X A;  1U3I A;  2OJL A;  2D2Z A;  2DKH A;  3M8N A;  2B1K A;  4FO5 A;  2HRK A;  1HNC A;  1TTZ A;  1T1V A;  2HYX A;  2OKA A;  4N11 A;  3TJF A;  4DSS B;  4QL9 A;  1URM A;  3L9U A;  5FWG A;  1TK0 B;  5DCH A;  1M2B A;  2EC4 A;  3F8U A;  4NPB A;  2B6M A;  4NXI A;  4O92 A;  3FKF A;  2QA2 A;  5E4W A;  4OD7 A;  1FB6 A;  1QQ2 A;  2C0D A;  3L4N A;  3EYT A;  2F51 A;  2IL3 A;  5IMD A;  1PKZ A;  3IC4 A;  1U88 A;  2M72 A;  1XG8 A;  2YJ7 A;  1J08 A;  2DJ2 A;  1PX7 A;  5IOW A;  4G0I A;  1K0C A;  3CXG A;  5D9X A;  2L6C A;  3I69 A;  5JWO B;  1HD2 A;  2L59 A;  5EL8 A;  1Z5Y E;  3C8E A;  5LNK e;  2PVO C;  5DBQ A;  2VLT A;  2R2J A;  3LXZ A;  3GYK A;  2F3M A;  3V1W A;  3VWV A;  1AQV A;  2GSR A;  2IMF A;  3HCZ A;  4Z2T A;  2L6D A;  2X49 A;  3FHK A;  4QL7 A;  1R7H A;  7GSS A;  2YOI A;  3KH9 A;  2LV3 A;  1ML6 A;  1AXD A;  2H0I A;  2M80 A;  1TI1 A;  5HR2 A;  2WGR A;  1ERV A;  2RLI A;  2RUF A;  3N5O A;  3DYR A;  1YEP A;  2HE3 A;  2PWJ A;  2JU5 A;  2ZCT A;  3QAV A;  4IQ1 A;  1AQX A;  1ACV A;  4X0X A;  4OO5 A;  5KOW A;  4EDY A;  4GWR A;  3FR9 A;  2DKI A;  2HLS A;  3RHC A;  4ACS A;  2LRC A;  4XCS A;  4EO3 A;  5ECK B;  3DVX A;  2GDR A;  5ID2 B;  1IYI A;  2VO4 A;  3VI7 A;  3OR5 A;  5J9C A;  3F4S A;  5CRE A;  1SYR A;  1GSE A;  2GQL A;  3E0U A;  1A24 A;  2GSS A;  2RM6 A;  2IIY A;  5G31 A;  1EP8 A;  2ZNM A;  1XWA A;  2X8C A;  2QC7 A;  3F3Q A;  1QGV A;  1S3C A;  1OC9 A;  1SYX A;  4O7H A;  1SD9 A;  3DIE A;  3DVW A;  3TOU A;  4YKF A;  5IPG A;  3GX0 A;  4F82 A;  4K0N A;  3GKK A;  2MYG A;  2FD3 A;  5IO0 A;  4OCF A;  4JR4 A;  2A4V A;  1SEN A;  2VL2 C;  2IMD A;  3GL5 A;  4Z2R A;  4KE3 A;  4IVF A;  2C0E A;  2X4A A;  3I9V 2;  2LJA A;  4ILF A;  1GSD A;  1HNB A;  3PGT A;  4L8E A;  1U6T A;  5L71 A;  2YWI A;  4X1U A;  3IR4 A;  1N8J A;  4I8B A;  3LJR A;  6GSX A;  4LA1 A;  4J2F A;  3FMW A;  2QA1 A;  1YY7 A;  4GST A;  2L4C A;  2FGX A;  3HVX A;  5AN1 A;  1DSB A;  3UBK A;  3ZIJ A;  4IJ3 A;  1SL2 B;  1WPI A;  1JFU A;  5DAK B;  4YAP A;  5DQY A;  3HVN A;  1K3O A;  3ISO A;  3D21 A;  1MD3 A;  2YNX A;  1LU4 A;  3M0F A;  1F3B A;  1WOU A;  3KXO A;  4K2D A;  2N5A A;  4PGT A;  3RPP A;  2HRF A;  4DSQ A;  3H93 A;  3QMX A;  4TR1 A;  2ZUP A;  1YJ6 A;  2PER A;  3L78 A;  4YAV A;  1ZGN A;  2NPB A;  3TB2 A;  5JWR B;  3RDW A;  3MAK A;  2VD0 A;  1E2Y A;  1TI3 A;  4DSR A;  1GSY A;  2KP1 A;  2LEG A;  2PN8 A;  3UIW A;  3IPZ A;  2H1D A;  1JZD A;  4TOP A;  2X99 A;  3VI5 A;  1WE0 A;  5ECS A;  2LST A;  4OFM A;  3WT1 A;  5JCU A;  4G0K A;  1Q98 A;  4JBB A;  2F8F A;  1ABA A;  1BX9 A;  4MA9 A;  2C3Q A;  2JL4 A;  4P3Y B;  1F6M C;  4QQ7 A;  17GS A;  5KN0 A;  5IQY A;  4XS4 B;  1M3J A;  3CYN A;  4ZB6 A;  1MTC A;  1A8Y A;  3CTF A;  2C8U A;  1FB0 A;  3GUS A;  4OCE A;  2YN1 A;  1ZYP A;  2P5R A;  3CMI A;  1JLV A;  14GS A;  1M7T A;  3BD2 A;  1PQN A;  2AAW A;  1I9D A;  2B5Y A;  1B4Q A;  4RUV A;  1SK2 A;  2CX4 A;  4I2T A;  3UVT A;  3QFB C;  4ZL7 A;  2VUP A;  3RPN A;  1A2M A;  11GS A;  3QDN A;  1GTB A;  2GZY A;  4K7I A;  2V32 A;  2H8L A;  2PU9 C;  4O5R A;  3P90 A;  4GSS A;  1XW6 A;  1HQO A;  1GSS A;  5IPH A;  1VF1 A;  2GQK A;  4E8H A;  5ECO B;  2R0G A;  1UA5 A;  2OAD A;  1Z6M A;  2G0F A;  4KUN A;  1X9W B;  2UZ8 A;  2R5G A;  3SWL A;  1EGR A;  4I5Q A;  3KJY A;  1M9A A;  5ELG A;  2F8A A;  4BVY B;  2VIM A;  1LJR A;  4H86 A;  1YF1 A;  1RQM A;  4GLT A;  1T8E B;  4K8M A;  3A2V A;  4F2I A;  4EKZ A;  4JRR A;  3VWU A;  4OO4 A;  2RUE A;  1MDJ A;  4NHZ A;  1AAZ A;  1OKT A;  4LMW A;  3ZFB A;  5E59 A;  1M0U A;  3IE3 A;  3C71 A;  5KN3 A;  4GRF A;  3KGK A;  5CRH A;  3TKS C;  5IM9 A;  2LJR A;  3ZVJ A;  5A4U A;  3LXT A;  4X4J A;  1DE2 A;  1GTA A;  3LQ7 A;  1TOF A;  4XHM A;  3FK8 A;  3QCP A;  1VF3 A;  6GSS A;  3D5J A;  2CVD A;  3TCO A;  3Q74 A;  5B7C A;  1RW1 A;  3LW9 A;  2B7J A;  4ZL8 A;  2R6K A;  1XVQ A;  2OBI A;  1FAA A;  1G6W A;  4KND A;  4OFN A;  5EVO A;  3TUE A;  2GTU A;  3WT2 A;  5IMC A;  3HYP A;  1M3I A;  2DJK A;  4D73 A;  3LYP A;  2OAC A;  5ECP B;  1XCC A;  3TRX A;  1IYH A;  4MJB A;  4HJ2 A;  19GS A;  1Q4J A;  3IK9 A;  2IJY A;  2X8G A;  3ZML A;  5A5K A;  4IQA A;  1R5P A;  1DE1 A;  1BJX A;  2LTK A;  2VM2 A;  3G9B A;  2CZ3 A;  2O89 A;  2AHE A;  4XS1 A;  4HZ2 A;  4HU7 A;  4MF5 A;  3VUR A;  4MZC A;  4CDO A;  4EDZ A;  2XHF A;  1ZCP A;  5DAL A;  4KDU A;  4L0U A;  3ZTL A;  3ZLP A;  2B5E A;  5ECQ B;  4F03 A;  3QR6 A;  4ZIJ A;  5DCG A;  4ZB8 A;  1BED A;  4MPG A;  4BWS A;  3QPM A;  3PIN A;  4MK3 A;  4MMM A;  4O5U A;  4K7O A;  2CAI A;  4KAE A;  2CA8 A;  4ZIL A;  3LSZ A;  6GSU A;  3GV1 A;  3CSI A;  4K5S A;  2QKE A;  3P8W A;  4IEL A;  1PGT A;  1Z7P A;  4NV5 A;  4ECC A;  4Q5F A;  3DEX A;  4KB3 A;  3KP9 A;  2A2S A;  2L5L A;  4WR5 A;  2A2P A;  2FWF A;  2GS3 A;  3IV4 A;  4A5P A;  1GTI A;  2KOK A;  3UAP A;  3APS A;  3GFK A;  2B1L A;  2KUC A;  2JZR A;  2H30 A;  5F0G A;  1GTU A;  4JR6 A;  2C0G A;  1YKA A;  1O73 A;  3C1S A;  4NHW A;  1O85 A;  4PNF A;  2XPE A;  2V6O A;  5IMV A;  4ZB9 A;  2E2G A;  5JCW A;  4Z2U A;  4ECJ A;  3VFI A;  2GT5 A;  3GKM A;  2JAD A;  3WD6 A;  2BJX A;  1X5D A;  1QXH A;  3VWW A;  1QUW A;  5G5E A;  3LGC A;  4TKY A;  1WMJ A;  1FOV A;  5F06 A;  3TJK A;  2YAN A;  4MJA A;  2HZE B;  2RII A;  4PQ1 A;  1UVZ A;  1DUG A; 
#chains in the Genus database with same CATH homology
 3CSH A;  2H6Z A;  3GTU A;  2R37 A;  4ZBA A;  2REM A;  5FT3 A;  3TGZ A;  5IOX A;  4HOJ A;  4DEJ A;  2H72 A;  3LYK A;  4HJM A;  2OBK A;  2H1B A;  5D9W A;  2LQQ A;  3VLN A;  2LNS A;  4N0V A;  4KSM A;  2DJ3 A;  2H0H A;  1KBN A;  2XBI A;  2O7K A;  4V2N A;  2IMK A;  2FCH A;  1WP0 A;  5J4U A;  2YWN A;  4O5Q A;  2YP6 A;  2R0P A;  4G2E A;  2TRC P;  1Z7R A;  3FZ9 A;  3PH9 A;  3JCM L;  3KZQ A;  3WGX A;  4NMU A;  1PKW A;  3LWA A;  1C72 A;  4KGI A;  3QAG A;  1PMT A;  1V58 A;  1WRY A;  2GVP A;  3J7Y b;  2LNT A;  2H0G A;  3DML A;  4G9H A;  4WBR D;  3GUR A;  3EWL A;  2YPM A;  5H5S A;  1ERW A;  2L5O A;  1B4P A;  3ZMK A;  3HA9 A;  4TXV A;  3F63 A;  2CQ9 A;  1F37 A;  3ME8 A;  4K5R A;  2FWH A;  5HR3 A;  3VWX A;  4Q5R A;  5HFI A;  5EY6 A;  4USS A;  1TJD A;  1XPV A;  1XOB A;  1M2D A;  4ISD A;  3PPU A;  2VLU A;  2RM5 A;  4BL7 A;  1G6Y A;  3UMA A;  1TRS A;  4MZW A;  1NM3 A;  1TDI A;  2TRX A;  3CRU A;  5LD0 A;  2PPT A;  1K0D A;  3KMN A;  1A2L A;  4MLY A;  1JHB A;  4ICY A;  2FHE A;  4IJI A;  4YQM A;  1T3B A;  4TXO B;  4AGS A;  4GXZ A;  4PUA A;  3UAR A;  1A0R P;  1J0F A;  3QD9 A;  3RAZ A;  4WR4 A;  2HRA A;  3Q19 A;  4RQR A;  2OE3 A;  1U3A A;  2CVB A;  5KN1 A;  1EZK A;  4I2U A;  1GSF A;  1GLQ A;  1PL2 A;  1F2E A;  1B9X C;  1Z6N A;  4PUR A;  1QK8 A;  2H6Y A;  3E3E A;  4HDE A;  3KIJ A;  5IO2 A;  2NDO A;  4TR3 A;  5DDL A;  2TIR A;  4DSS A;  4POK A;  1SKR B;  2XC2 A;  4MZB A;  3UEM A;  4EVM A;  2I4A A;  1Z3E A;  4HI7 A;  1USB A;  4WXT A;  4NAX A;  1H4O A;  4GQF A;  1WJK A;  2OA7 A;  4L5O A;  2K8V A;  2DJJ A;  4EXJ A;  5CYY A;  3A5W A;  1XVW A;  1A2J A;  2M46 A;  1V98 A;  3FZ4 A;  4MNN A;  4G19 A;  2LKU A;  1OAZ A;  3MNG A;  4ZXG A;  4EF0 A;  2ON7 A;  1XBS A;  1AQW A;  5INY A;  2B3S A;  4AJ8 A;  1X0R A;  3P2A A;  2OE0 A;  2C0F A;  4XRA A;  2LRN A;  5F8B A;  4E8E A;  4K1F A;  6GST A;  3TKQ A;  1ST9 A;  3CSJ A;  2YZH A;  3IDV A;  2VOC A;  3NIV A;  4NV2 A;  1XOA A;  3ZYW A;  4PUF C;  1SD8 A;  2I81 A;  2DBC A;  3HVV A;  3F6F A;  2OE1 A;  4PX1 A;  1A23 A;  3D0Z A;  3CRT A;  1ZMA A;  1EV4 A;  3KMO A;  1BG5 A;  3L9S A;  3HKR A;  2IFQ B;  1R5A A;  5LCZ A;  5H5R A;  2P0G A;  3EPT A;  3IXR A;  2L57 A;  3LG6 A;  4IP6 A;  2HNL A;  2YZU A;  18GS A;  1SL0 B;  5ID2 A;  4RI6 A;  4FIW A;  2O87 A;  4L5L A;  2KP2 A;  4KSO A;  3A5I A;  3HJM A;  1O7U A;  4F0B A;  2H1G A;  2DC5 A;  2CAQ A;  2IME A;  2WJU A;  4HU9 A;  2K9F A;  3DRN A;  5CRW A;  2DJ1 A;  1FVK A;  1FVJ A;  3Q18 A;  5CRG A;  2L4Q A;  2K6V A;  1TXX A;  1Y25 A;  4HEA 2;  2GST A;  4PNG A;  4KCE A;  2AV4 A;  4IN0 A;  3ERF A;  5B8B A;  2GLR A;  4G0L A;  1S3A A;  1I5G A;  2GSQ A;  1O8W A;  2WFC A;  2GZP A;  3GL3 A;  1A8L A;  4DVC A;  3CTG A;  3HZ4 A;  5CRD A;  2N5F A;  1ZZY A;  5D93 A;  4BA7 A;  1FO5 A;  4CW9 A;  3A2W A;  4ULX A;  4FQU A;  3U6V A;  3IAS 2;  1KEB A;  1V2A A;  4EL1 A;  3VK9 A;  1QMV A;  3HZ8 A;  1SK0 A;  1EWX A;  4BVX B;  1XIY A;  1K0O A;  1SL1 B;  5HR1 A;  3FZA A;  2HT9 A;  5FHI A;  2R0C A;  1X5E A;  4CY6 A;  2AJQ B;  2O8V B;  5HFG A;  3UJ1 A;  1T00 A;  4FYC A;  4GCI A;  5CO3 A;  5HFK A;  1VF2 A;  1EEJ A;  3HD5 A;  5D73 A;  3GNJ A;  2MBS A;  1K0N A;  5DAK A;  2VD1 A;  5ECL B;  4XTS A;  3GST A;  3M9K A;  2LQO A;  1K0M A;  3E9J B;  3EUR A;  4IP1 A;  1ZL9 A;  2NVL A;  3EVI A;  5AIV A;  5HR0 A;  5F05 A;  2HSM A;  2F9S A;  1XWC A;  4MF6 A;  1ILO A;  2WRT A;  6GSY A;  4HQZ A;  2LRT A;  1F3A A;  5ENU A;  3HDC A;  5KOX A;  4BWQ A;  3K8N A;  3WGE A;  2LUS A;  1HYU A;  2LS5 A;  2VAF A;  1TW9 A;  4ZBB A;  3MDK A;  1E6B A;  1FG4 A;  1M9B A;  1Y6E A;  4PQH A;  20GS A;  2JSY A;  2K8S A;  4WF4 A;  1MEK A;  4Q5N A;  4V1A p;  3ZFL A;  3H79 A;  2H76 A;  3W6G A;  4XS4 A;  3TKS E;  2MMN A;  5ECM B;  1H75 A;  3FR6 A;  4OWY A;  2VL2 A;  1JZO A;  3DGQ A;  3EMX A;  4IHU A;  5IIZ A;  3W8S A;  1NHO A;  1X5C A;  1GNW A;  1K0A A;  1EV9 A;  2MMA A;  2QSI A;  1OKD A;  2E7P A;  2KLX A;  4N30 A;  3EIN A;  2MMZ A;  5IMZ A;  1ON4 A;  4K6X A;  2J9H A;  1OE7 A;  3F4T A;  1SJ6 A;  3FY7 A;  5ECH B;  1A0F A;  3TJB A;  3APQ A;  3D6I A;  2I3Y A;  3G7Y A;  1UN2 A;  4Z7X A;  4XS6 A;  3F3R A;  2CZ2 A;  4K2X A;  2PMT A;  2PGT A;  4ZL9 A;  2WCI A;  3A3T A;  3NZN A;  2PUK C;  3H4K A;  3IK7 A;  4EC0 A;  5C00 A;  3EC3 A;  4BVY A;  1UC7 A;  1OYJ A;  1NHY A;  4IBP A;  4K9Z A;  1YF0 A;  2J23 A;  1GUL A;  4TR4 A;  3IAM 2;  2XPD A;  3VPQ A;  4XRD A;  3G7J A;  1F9M A;  2IN3 A;  5B6N A;  4FH8 A;  1OC9 B;  2G2Q A;  3SBC A;  1JZW A;  5CNW A;  4WKW A;  3F6D A;  3FEU A;  4ECI A;  4J57 E;  3RBT A;  3GHA A;  3LEF A;  3D4M A;  4ID0 A;  2HSH A;  2JAC A;  2DIY A;  2H70 A;  4YKG A;  6GSW A;  5DQS A;  1RK4 A;  3IRA A;  4KW6 A;  5ECR B;  3N9J A;  4TR0 A;  3IHG A;  3D4T A;  2HSY A;  2FUG 2;  1YDK A;  3HJO A;  1SJZ A;  1GH2 A;  3F4R A;  2ALB A;  1B9Y C;  3BJ5 A;  1B8X A;  1S3D A;  4TW5 A;  3L0H A;  1ZYN A;  2VL3 A;  3DXB A;  1LBK A;  1AIU A;  1B48 A;  2A2R A;  4LMV A;  3O6T A;  3F9U A;  2VCQ A;  4I6X A;  4PTS A;  3ZIT A;  5KEJ A;  2P31 A;  1XFL A;  4V2M A;  2JZS A;  4V1A g;  2I1U A;  3I6A A;  1SKW B;  4KCA A;  1PA3 A;  4TR1 B;  4TRX A;  5COH A;  3GSS A;  4ML6 A;  2YJH A;  2NBS A;  1R4W A;  2YV9 A;  1T4Z A;  1XWK A;  3ZRE A;  1PX6 A;  2C3N A;  1J9B A;  2O85 A;  1O6J A;  2VCW A;  3M1G A;  2WS2 A;  1TRV A;  4G10 A;  2K18 A;  4MH2 A;  10GS A;  2HI7 A;  2A4H A;  2CT6 A;  5AGY A;  2DJ0 A;  4KF9 A;  4WBJ A;  2V2G A;  4L0W A;  5J41 A;  1W4V A;  2C80 A;  3C7M A;  5KN2 A;  3TKS A;  1YQ1 A;  3TJG A;  3QAW A;  2VCT A;  1BQ7 A;  3ERG A;  3MWH A;  1GL8 A;  2PBJ A;  1TU7 A;  2FA8 A;  1ZYE A;  1VF4 A;  3O76 A;  2MBT A;  3WYW A;  2YWM A;  2FA4 A;  16GS A;  3C1R A;  4YH2 A;  3KH7 A;  1MDI A;  4I97 A;  1CQG A;  3HY2 A;  4NWY A;  3GRX A;  3L9V A;  1GP1 A;  5CAX A;  4MDC A;  1OC8 A;  5GAP D;  1V9W A;  5DJL A;  1HNA A;  3MSZ A;  5DJM A;  2WUL A;  2WZ9 A;  3BCK A;  1W89 A;  5GAN D;  4ML1 A;  1XZO A;  4AJ6 A;  2N5B A;  1YEX A;  4MCU A;  1FOH A;  3US3 A;  2GZZ A;  2C1Y A;  1SKS B;  4BPY A;  4JED A;  5F07 A;  2HZF A;  1EGO A;  2IPA A;  3FW2 A;  3EU4 A;  1K3L A;  2VM1 A;  3DKS A;  4JE1 A;  3HJP A;  1XWB A;  3LFL A;  1X9S B;  5GSS A;  4PQI A;  3H8Q A;  2MZC A;  1TKD B;  2HZE A;  2GT6 A;  3GX8 A;  3Q6O A;  2VCZ A;  3MIX A;  2VCV A;  2QGV A;  2FNO A;  2H74 A;  2V41 A;  5G1L A;  3TDG A;  1GUH A;  2C3T A;  4POL A;  4RI7 A;  5AIS A;  4RQX A;  22GS A;  1G0T A;  3KP8 A;  4LL4 B;  4X43 A;  2HFD A;  2R3X A;  1SJI A;  3QFA C;  2H71 A;  3HVS A;  3KD0 A;  2YV7 A;  3S9F A;  2H6X A;  1WIK A;  2H66 A;  4N0Z A;  3FZ5 A;  2AB6 A;  1N2A A;  2AUV A;  3IOS A;  1YZX A;  2FWE A;  4AF2 A;  1X9M B;  3KCM A;  2ES7 A;  3BCI A;  5BRT A;  5CP1 A;  3R2Q A;  2KHP A;  2P5Q A;  2H1A A;  1CQH A;  2E0Q A;  3ME7 A;  2JSZ A;  3O3T A;  3C73 A;  2DML A;  2FWG A;  1DBY A;  3APO A;  3NOF A;  3GMF A;  2GGT A;  4N10 A;  1VGL A;  1GSQ A;  5D9V A;  2V6K A;  3ZL5 A;  4D73 B;  4HQS A;  1OVN A;  4F9Z A;  2VLV A;  1GUK A;  1T7P B;  3DWV A;  4IGJ A;  1AW9 A;  2EIR A;  1TRW A;  3ERW A;  4KDX A;  1PN9 A;  4KH7 A;  5J5N A;  2VL9 A;  3QOU A;  1QFN A;  2WB9 A;  1SK1 A;  2EIO A;  4OMV A;  3I43 A;  5B6M A;  2FLS A;  3GH6 A;  4ZBD A;  5G30 A;  1WWJ A;  3HXS A;  2Z9S A;  1Z9H A;  5AIX A;  3UOM A;  5A4W A;  2IMI A;  1GNE A;  1GLP A;  4MPF A;  5DAL B;  4YQU A;  5HQP A;  4O32 A;  13GS A;  5G1K A;  3HHV A;  5GST A;  4GTU A;  1M2A A;  3FR3 A;  4J56 E;  1JLW A;  1XW9 A;  4EIQ A;  4TN8 A;  4MF7 A;  1OC3 A;  4HUA A;  3KTL A;  5J3R A;  1PRX A;  3UVH A;  2DMM A;  1XW5 A;  4TXO A;  1AUC A;  2B5X A;  5DVB A;  3PR8 A;  5J9B A;  4EIP A;  3TRQ A;  5IMF A;  12GS A;  2B7K A;  4POM A;  3F0I A;  1ERT A;  3IA1 A;  4Q5Q A;  5BMU A;  3M9J A;  3TRP A;  3IBH A;  4LL1 B;  2MMO A;  5C04 A;  1ZOF A;  3TKR A;  2DIZ A;  1ERU A;  4KDY A;  5JCG A;  1TU8 A;  3EE2 A;  2EIQ A;  3UBL A;  2H19 A;  1KNG A;  1GRX A;  3EMP A;  1G7O A;  4FYB A;  3GKX A;  4JZQ A;  4GQC A;  1NW2 A;  3H1N A;  4GF0 A;  4WF5 A;  3ZRD A;  3KEB A;  2H73 A;  2VCX A;  4MJC A;  2X64 A;  2GQM A;  4EUY A;  4MAB A;  3EU3 A;  1T4Y A;  1MDK A;  2DLX A;  2I9H A;  3LOR A;  2FY6 A;  3UL3 A;  3G7I A;  4TVE A;  2CV4 A;  4JU5 A;  1XXU A;  1TK8 B;  5GZZ B;  2JZT A;  1EOH A;  4ECB A;  3R3E A;  5ELA A;  3ZIV A;  3TOT A;  3GIX A;  3MYD A;  4FYU A;  2H01 A;  3KM6 A;  4HZ4 A;  2CVK A;  5ECI B;  1V57 A;  3ZZX A;  2IWT A;  4K7N A;  3M3M A;  4IKH A;  4PXO A;  3GTU B;  1R26 A;  1O8X A;  3BBY A;  1V40 A;  1K3Y A;  4MJE A;  2HXK A;  3D22 A;  4YQV A;  3GN3 A;  2HRN A;  5G2Z A;  3CBU A;  1TP9 A;  1G7E A;  1PSQ A;  1THO A;  1PN0 A;  8GSS A;  2WDU A;  1EOG A;  5A4V A;  1BAY A;  4AJ7 A;  1EEM A;  2AYT A;  3P7X A;  4WET A;  3IHQ A;  3J7Y k;  3KTB A;  1PL1 A;  1O81 A;  3GH9 A;  4HS1 A;  6GSV A;  4GSN A;  1M99 A;  5H5Q A;  1VRS D;  2XBQ A;  1U87 A;  5G5F A;  3AY8 A;  2NTO A;  2V1M A;  3BOA A;  4CHS A;  3TJJ A;  1EP7 A;  2X8H A;  1GUM A;  2IFQ A;  5D9T A;  1FHE A;  2YWO A;  3ED3 A;  1OE8 A;  5B8A A;  4CY8 A;  4MH3 A;  3RHB A;  4IW9 A;  4K0G A;  2C4J A;  2CX3 A;  2ON5 A;  1GSU A;  2H75 A;  1YKC A;  2YCD A;  3DD3 A;  2BTO T;  5D96 A;  1AC1 A;  4POB A;  3FYG A;  4EE0 A;  1BYE A;  1MD4 A;  3ZVJ D;  4LLR A;  5EPF A;  1TRU A;  4MP4 A;  4KX4 A;  3FRC A;  1TK5 B;  4BL7 B;  2PVQ A;  3TKP A;  5ABR A;  1GWC A;  2BMX A;  3GKN A;  3GA4 A;  2R4V A;  4F0C A;  4OFT A;  2E2M A;  4KA0 A;  1PD2 1;  1THX A;  2DSA A;  3WGD A;  1K0B A;  5JWQ B;  3VPT A;  3W8J A;  1JZR A;  5D8I A;  1NSW A;  3U5R E;  1KTE A;  4IS0 A;  4XIH A;  5IMA A;  1XWG A;  4V2L A;  9GSS A;  3IC8 A;  1ZYQ B;  4BVX A;  2LJK A;  4WEY A;  5ECN B;  1FW1 A;  1SU9 A;  3A2X A;  1U3I A;  2OJL A;  2D2Z A;  2DKH A;  3M8N A;  2B1K A;  4FO5 A;  2HRK A;  1HNC A;  1TTZ A;  1T1V A;  2HYX A;  2OKA A;  4N11 A;  3TJF A;  4DSS B;  4QL9 A;  1URM A;  3L9U A;  5FWG A;  1TK0 B;  5DCH A;  1M2B A;  2EC4 A;  3F8U A;  4NPB A;  2B6M A;  4NXI A;  4O92 A;  3FKF A;  2QA2 A;  5E4W A;  4OD7 A;  1FB6 A;  1QQ2 A;  2C0D A;  3L4N A;  3EYT A;  2F51 A;  2IL3 A;  5IMD A;  1PKZ A;  3IC4 A;  1U88 A;  2M72 A;  2YJ7 A;  1J08 A;  2DJ2 A;  1PX7 A;  5IOW A;  4G0I A;  1K0C A;  3CXG A;  5D9X A;  2L6C A;  3I69 A;  5JWO B;  1HD2 A;  2L59 A;  5EL8 A;  1Z5Y E;  3C8E A;  5LNK e;  2PVO C;  5DBQ A;  2VLT A;  2R2J A;  3LXZ A;  3GYK A;  2F3M A;  3V1W A;  3VWV A;  1AQV A;  2GSR A;  2IMF A;  3HCZ A;  4Z2T A;  2L6D A;  2X49 A;  3FHK A;  4QL7 A;  1R7H A;  7GSS A;  2YOI A;  3KH9 A;  2LV3 A;  1ML6 A;  1AXD A;  2H0I A;  2M80 A;  1TI1 A;  5HR2 A;  2WGR A;  1ERV A;  2RLI A;  2RUF A;  3N5O A;  3DYR A;  1YEP A;  2HE3 A;  2PWJ A;  2JU5 A;  2ZCT A;  3QAV A;  4IQ1 A;  1AQX A;  1ACV A;  4X0X A;  4OO5 A;  5KOW A;  4EDY A;  4GWR A;  3FR9 A;  2DKI A;  2HLS A;  3RHC A;  4ACS A;  2LRC A;  4XCS A;  4EO3 A;  5ECK B;  3DVX A;  2GDR A;  5ID2 B;  1IYI A;  2VO4 A;  3VI7 A;  3OR5 A;  5J9C A;  3F4S A;  5CRE A;  1SYR A;  1GSE A;  2GQL A;  3E0U A;  1A24 A;  2GSS A;  2RM6 A;  2IIY A;  5G31 A;  1EP8 A;  2ZNM A;  1XWA A;  2X8C A;  2QC7 A;  3F3Q A;  1QGV A;  1S3C A;  1OC9 A;  1SYX A;  4O7H A;  1SD9 A;  3DIE A;  3DVW A;  3TOU A;  4YKF A;  5IPG A;  3GX0 A;  4F82 A;  4K0N A;  3GKK A;  2MYG A;  2FD3 A;  5IO0 A;  4OCF A;  4JR4 A;  2A4V A;  1SEN A;  2VL2 C;  2IMD A;  3GL5 A;  4Z2R A;  4KE3 A;  4IVF A;  2C0E A;  2X4A A;  3I9V 2;  2LJA A;  4ILF A;  1GSD A;  1HNB A;  3PGT A;  4L8E A;  1U6T A;  5L71 A;  2YWI A;  4X1U A;  3IR4 A;  1N8J A;  4I8B A;  3LJR A;  6GSX A;  4LA1 A;  4J2F A;  3FMW A;  2QA1 A;  1YY7 A;  4GST A;  2L4C A;  2FGX A;  3HVX A;  5AN1 A;  1DSB A;  3UBK A;  3ZIJ A;  4IJ3 A;  1SL2 B;  1WPI A;  1JFU A;  5DAK B;  4YAP A;  5DQY A;  1K3O A;  3ISO A;  3D21 A;  1MD3 A;  2YNX A;  1LU4 A;  3M0F A;  1F3B A;  1WOU A;  3KXO A;  4K2D A;  2N5A A;  4PGT A;  3RPP A;  2HRF A;  4DSQ A;  3H93 A;  3QMX A;  4TR1 A;  2ZUP A;  1YJ6 A;  2PER A;  3L78 A;  4YAV A;  1ZGN A;  2NPB A;  3TB2 A;  5JWR B;  3RDW A;  3MAK A;  2VD0 A;  1E2Y A;  1TI3 A;  4DSR A;  1GSY A;  2KP1 A;  2LEG A;  2PN8 A;  3UIW A;  3IPZ A;  2H1D A;  1JZD A;  4TOP A;  2X99 A;  3VI5 A;  1WE0 A;  5ECS A;  2LST A;  4OFM A;  3WT1 A;  5JCU A;  4G0K A;  1Q98 A;  4JBB A;  2F8F A;  1ABA A;  1BX9 A;  4MA9 A;  2C3Q A;  2JL4 A;  4P3Y B;  1F6M C;  4QQ7 A;  17GS A;  5KN0 A;  5IQY A;  4XS4 B;  3CYN A;  4ZB6 A;  1MTC A;  1A8Y A;  3CTF A;  2C8U A;  1FB0 A;  3GUS A;  4OCE A;  2YN1 A;  1ZYP A;  2P5R A;  3CMI A;  1JLV A;  14GS A;  1M7T A;  3BD2 A;  1PQN A;  2AAW A;  1I9D A;  2B5Y A;  1B4Q A;  4RUV A;  1SK2 A;  2CX4 A;  4I2T A;  3UVT A;  3QFB C;  4ZL7 A;  2VUP A;  3RPN A;  1A2M A;  11GS A;  3QDN A;  1GTB A;  2GZY A;  4K7I A;  2V32 A;  2H8L A;  2PU9 C;  4O5R A;  3P90 A;  4GSS A;  1XW6 A;  1HQO A;  1GSS A;  5IPH A;  1VF1 A;  2GQK A;  4E8H A;  5ECO B;  2R0G A;  1UA5 A;  2OAD A;  1Z6M A;  2G0F A;  4KUN A;  1X9W B;  2UZ8 A;  2R5G A;  3SWL A;  1EGR A;  4I5Q A;  3KJY A;  1M9A A;  5ELG A;  2F8A A;  4BVY B;  2VIM A;  1LJR A;  4H86 A;  1YF1 A;  1RQM A;  4GLT A;  1T8E B;  4K8M A;  3A2V A;  4F2I A;  4EKZ A;  4JRR A;  3VWU A;  4OO4 A;  2RUE A;  1MDJ A;  4NHZ A;  1AAZ A;  1OKT A;  4LMW A;  3ZFB A;  5E59 A;  1M0U A;  3IE3 A;  3C71 A;  5KN3 A;  4GRF A;  3KGK A;  5CRH A;  3TKS C;  5IM9 A;  2LJR A;  3ZVJ A;  5A4U A;  3LXT A;  4X4J A;  1DE2 A;  1GTA A;  3LQ7 A;  1TOF A;  4XHM A;  3FK8 A;  3QCP A;  1VF3 A;  6GSS A;  3D5J A;  2CVD A;  3TCO A;  3Q74 A;  5B7C A;  1RW1 A;  3LW9 A;  2B7J A;  4ZL8 A;  2R6K A;  1XVQ A;  2OBI A;  1FAA A;  1G6W A;  4KND A;  4OFN A;  5EVO A;  3TUE A;  2GTU A;  3WT2 A;  5IMC A;  3HYP A;  2DJK A;  4D73 A;  3LYP A;  2OAC A;  5ECP B;  1XCC A;  3TRX A;  1IYH A;  4MJB A;  4HJ2 A;  19GS A;  1Q4J A;  3IK9 A;  2IJY A;  2X8G A;  3ZML A;  5A5K A;  4IQA A;  1R5P A;  1DE1 A;  1BJX A;  2LTK A;  2VM2 A;  3G9B A;  2CZ3 A;  2O89 A;  2AHE A;  4XS1 A;  4HZ2 A;  4HU7 A;  4MF5 A;  3VUR A;  4MZC A;  4CDO A;  4EDZ A;  2XHF A;  1ZCP A;  5DAL A;  4KDU A;  4L0U A;  3ZTL A;  3ZLP A;  2B5E A;  5ECQ B;  4F03 A;  3QR6 A;  4ZIJ A;  5DCG A;  4ZB8 A;  1BED A;  4MPG A;  4BWS A;  3QPM A;  3PIN A;  4MK3 A;  4MMM A;  4O5U A;  4K7O A;  2CAI A;  4KAE A;  2CA8 A;  4ZIL A;  3LSZ A;  6GSU A;  3GV1 A;  3CSI A;  4K5S A;  2QKE A;  3P8W A;  4IEL A;  1PGT A;  1Z7P A;  4NV5 A;  4ECC A;  4Q5F A;  3DEX A;  4KB3 A;  3KP9 A;  2A2S A;  2L5L A;  4WR5 A;  2A2P A;  2FWF A;  2GS3 A;  3IV4 A;  4A5P A;  1GTI A;  2KOK A;  3UAP A;  3APS A;  3GFK A;  2B1L A;  2KUC A;  2JZR A;  2H30 A;  5F0G A;  1GTU A;  4JR6 A;  2C0G A;  1YKA A;  1O73 A;  3C1S A;  4NHW A;  1O85 A;  4PNF A;  2XPE A;  2V6O A;  5IMV A;  4ZB9 A;  2E2G A;  5JCW A;  4Z2U A;  4ECJ A;  3VFI A;  2GT5 A;  3GKM A;  2JAD A;  3WD6 A;  2BJX A;  1X5D A;  1QXH A;  3VWW A;  1QUW A;  5G5E A;  3LGC A;  4TKY A;  1WMJ A;  1FOV A;  5F06 A;  3TJK A;  2YAN A;  4MJA A;  2HZE B;  2RII A;  4PQ1 A;  1UVZ A;  1DUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...