3CTMA

Crystal structure of a carbonyl reductase from candida parapsilosis with anti-prelog stereo-specificity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
277
structure length
272
Chain Sequence
b'GEIESYCNKELGPLPTKAPTLSKNVLDLFSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIVQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl Reductase
publication title Crystal structure of a carbonyl reductase from Candida parapsilosis with anti-Prelog stereospecificity.
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 92
structure length 272
sequence length 277
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.-:
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ctmA00
3DMTA 2NVWA 2C5EA 3NT5A 5LDGA 5FYDA 4FD3A 1R37A 1PGJA 1I3MA 3CINA 3F1LA 1LRJA 4QXMA 1GL3A 4KOAA 4R5HA 2QRJA 4DREA 1E6UA 7ADHA 2NTNA 4QX6A 3LSYA 3GZ4A 3QWFA 4DQVA 5L53A 4WNIA 1GYPA 1YXMA 4AJHA 3H2SA 4FCCA 1FMCA 4DGSA 1NAIA 5A06A 1NR1A 1I2CA 1HTBA 1X7GA 1X1TA 3PDUA 1P74A 1ORRA 1HT0A 5HTOA 4NJMA 4R9SA 3T4XA 4HNHA 3S2FA 4BVAA 3JQGB 3KYDA 3ZV5A 4JROA 4WUVA 4J4TA 5BT9A 4DMLA 2BH9A 1RM3A 1UUFA 3MTGA 5TIIA 1PGQA 5FF9A 4BO7A 3WSVA 5IXSA 1U2DA 2Q1UA 1MV8A 3DB2A 3EHEA 2CDAA 2EXXA 3QVOA 1M2WA 3Q2KA 3KM0A 5GZ1A 3FR7A 1MXHA 1UDAA 5C7IO 1LDYA 4RF5A 3V8BA 4D7AA 3MJCA 1NHGA 4FJ0A 1RJWA 5JAZA 3GF4A 4GGPA 5JCJD 3ZNQA 1OOEA 4DLLA 2B37A 1PL7A 2CVQA 3ETEA 2TMDA 3B1KA 3OSUA 1DIHA 3RROA 3PQEA 4Y8VA 3BHIA 3ZWVA 2VHVA 5HWSA 5U1PA 3QVWA 3BMNA 1AN9A 4CUKA 1JU9A 3FI9A 2WDZA 2IZ1A 4TSKA 3Q0EA 4CQMA 1O89A 1EUCA 1P1FA 2GASA 3C1AA 4IQGA 4GL4A 1LC0A 3F6YA 3JQFC 4BS9A 3JCZA 5CPFA 1ONOA 1ZH8A 3KV3O 3RJ9A 5ADHA 3KXDA 3EMKA 4BO2A 4L8VA 3JD1A 2O7QA 5KNLA 4G5HA 1XCBA 4MKZA 2GN4A 4N5MA 3A4VA 4PLZA 1I30A 1K6IA 2PLAA 3HDYA 4BIIA 1B8UA 2YHIB 3L9XA 2R6JA 3KLPX 2WYUA 4IDEA 2Z95A 4FFMA 1EBFA 4QQRA 3PTZA 1UAYA 2C0CA 3Q1LA 3DZIA 3D5QA 4INAA 4TVOA 2X4GA 3OBBA 4TZTA 1Z7BA 4YRAA 1FDVA 3ONEA 3GAFA 2O2SA 1ZSYA 2O3QA 4BB6A 1FF9A 5GY7A 3P2OA 2BD0A 3ZHZA 3ROKA 4CM4B 4HFRA 5DBFA 2R2GA 3DTTA 4JP3A 4JQCA 4I5FA 5AXBA 5AYVA 4DVJA 1DIGA 3BHJA 2C54A 2Y1DA 1Y8RA 2P68A 4MVJE 2EW2A 2QHXA 1EQ2A 3O8QA 2DKNA 3AU9A 2VT3A 4CQLA 1VJTA 2Y66A 2J8ZA 1QLHA 2OBNA 3AOGA 3DZGA 4IDCA 3L4BA 2J5RA 4KMSA 2ZTUA 1ZCJA 5DBGA 1ARZA 3VKVA 3STHA 4XB2A 1N2SA 3K92A 5EQDA 1E3WB 1U3TA 4ZJUA 1M76A 2DVMA 3PFWO 3ZU2A 5LDHA 1HLPA 3H5NA 4IIUA 2YHUA 1E7RA 4OH1A 3VPSA 4NPCA 3PZRA 5JMWA 1JWBB 3OIFA 1IYZA 2WYWA 3UCFA 4QUKA 5TRTA 3GPDG 2C7VA 3WTCA 3DWFA 3QVXA 5J23A 1HETA 3H7AA 1BDBA 1GPJA 3JQGA 4GI2A 3OA0A 4PLHA 4JLWA 1XA0A 4G65A 3UN1A 3GLQA 3HJAA 4Q3EA 4BB5A 1XGKA 3PYXA 3EZLA 4YPOA 4L76A 3HADA 1LC3A 3AY6A 4PLVA 4WGGA 3O03A 4UUOA 2W2LD 5C7OO 4W6ZA 5HRUA 1I32A 5B37A 3AU8A 3KSZO 1JKJA 4OYRA 4LRSB 2B83A 3F3SA 4CR7A 5B4UA 4JNKA 2VWGA 3SXPA 1KC1A 2EP7A 2PKRA 2X5OA 4FFLA 2QW8A 4NR0A 2GO1A 2B4QA 2Y1OA 4IJUA 4K9DA 4EUFA 4Q9NA 3CH6A 1C3VA 3I4FA 4J43A 4WE3A 2NVUB 1P9LA 3BMCB 3N7UA 3HWRA 2R00C 3I5MA 3VDQA 3HE3A 5CEFA 4IZIA 2DPHA 1OC4A 4NFHA 9LDBA 3PJDA 3HDHA 4YQYA 3PLNA 4DTIA 5TQVA 5KJFA 4KTVE 3JQ8B 1HYEA 1Z6ZA 3RC9A 2Q1SA 4MIYA 3D7LA 1O95A 1K0UA 4B7UA 4RF3A 4BMSA 1P1JA 2HO5A 3IMFA 4CM9A 3BXXA 4PG4A 1RPNA 5L4NA 2V7PA 1GEEA 2YV2A 1PZHA 5JPIA 4DC1A 3GVCA 4R68A 1YGYA 2NSDA 3T7CA 2X0NA 2BFMA 4OSOA 4CUJA 4L4XA 3RKUA 1GYQA 3DBLB 1LU9A 3VZPA 2GZ2A 3NTRA 5BSGA 3FSRA 1K3TA 4J2OA 4PZCA 5JAQA 3BA1A 1H6DA 4J0EA 1GDHA 3O38A 2BKAA 2AMFA 3BTVA 2J3KA 3WIEA 2W2KB 5H82A 1QV7A 4L0QA 2JAHA 3WGQA 1PR9A 3PYLA 4A26A 2FPPA 3GVHA 3MOIA 4YB8A 2O4CA 4A5OA 4XYGA 4X54A 1XU7A 3GGGA 1QYVA 1KBZA 4LW8A 3ZU4A 2PY6A 4GMFA 1VSVA 1Q0QA 5DZSA 4BNHA 4DPKA 3IKTA 4A7PA 4KZPA 2EGHA 3LLVA 4MO2A 5EINA 4EITA 2OOSA 1BXKA 4EJ0A 1VKNA 3JSAA 4DPLA 1MFPA 2J5KA 5KCZA 4PLFA 4MVJG 4M8SA 2Q99A 2QIOA 4GSLA 1D1SA 4URFA 5F1PA 3L6OO 3RUDA 2I67A 3ZV6A 1PJBA 3PFFA 3EY4A 1E6WA 2XXBA 4CLRB 1GPDG 2D5AA 5BQFA 5L4SA 2JD1A 4BNUA 5C37A 4E5PA 3IJRA 5JCJA 3K9QO 2Z5LA 1XG5A 3WQRA 1HKUA 1BDMA 3ZW8A 3O4RA 3QSGA 4NBRA 1TEHA 4MIEA 5K9ZA 1HWYA 6LDHA 1MA0A 1R16A 2A9FA 1VKOA 4FQ8A 3ZWMA 4CLDA 2AG5A 4TROA 4DIFA 4E30A 3KEOA 1GCUA 1HSZA 1QYXA 3BTOA 5CPBA 2PKQO 4O1MA 1ZJZA 4CMJA 1XEAA 3CE6A 4UVGA 1OAAA 3SJ7A 2CDBA 2WWRA 4EW6A 3UOGA 3GMSA 2J5QA 5I9MA 1JAXA 4L74A 5I7EA 3VC7A 3TOZA 4WKGA 5MDHA 1BXZA 1EFLA 3A1NA 4XR4A 4OJNA 2ZCVA 1PGNA 3BMCA 4CV3A 1YL6A 1WMAA 2JAPA 1VI2A 4RVHA 1RKXA 1LBEA 3Q6IA 4P4NA 4PCVA 3UGKA 3ZWAA 3K8ZA 1AUPA 4ZRMA 4UEOA 3M1AA 5ITWA 1RWBA 1ENZA 1HE3A 1KC3A 1M75A 3RC7A 5TLSA 9LDTA 2H63A 2RH8A 4CV1A 1TXGA 1NNUA 4TVBA 4MVJH 4BNZA 3AOEA 4J1TA 1UDCA 1M6HA 3RWBA 1ENOA 4BNGA 2WSBA 1PEDA 2GGSA 4HWKA 1N7HA 1QRRA 3DC2A 4ALKA 3ULKA 2J6IA 4NH4A 1QORA 4BO1A 2UDPA 5EN4A 4MKRA 4E5MA 5H81A 3AY7A 3PEFA 5KKAA 2XXJA 5G4KB 2A94A 1ZBQA 4MVJF 3VOSA 4CM5A 4OXKA 3OIGA 3ZDFA 4BMVA 3H9GA 1DBVO 5JMPA 1C14A 1IHXA 4E2XA 1P1IA 4HBGA 5IAAA 4RQTA 2VN8A 1HLDA 4HFNA 1BVRA 3AUTA 2YY7A 3HUDA 4A03A 2OHXA 3RUAA 1LQTA 3I3OA 4NFSA 4N5LA 3NRCA 3BMQB 3ZH2A 3L07A 1YQGA 3HN2A 3PGXA 1TT5B 2I9PA 4PZDA 4XQEA 5T5QA 1BRMA 2IEDA 3OFSA 1GFSA 1HDCA 4WCFB 4IDFA 1KOLA 4OOEA 2ZQZA 1EK6A 3G3EA 4IXWA 3W6UA 3TFQA 4BNWA 1ZNQO 5JCXA 5JC8A 2FN7A 3GT0A 1ZSVA 3PRJA 2C20A 2FPIA 3KSUA 5ILGA 1FXSA 1PWZA 3Q11A 3UFXA 4CMIB 1DJNA 3AI3A 2IE0A 1RYDA 4FPXA 2W2LA 1GCOA 4CV0A 2ZTMA 3ANMA 4OO3A 2O3UA 1P3DA 3EVTA 3OJFA 1XU9A 4PLWA 3PQFA 2HRBA 5BSFA 3DHNA 1H6AA 1N1GA 2OBYA 1NQ5A 3TDKA 4A0SA 2EERA 3JQAB 2RIRA 4H16A 1UP7A 2JL1A 2RH4A 3RAJA 3MZ0A 4YVFA 5A5EA 3F46A 4Z9FA 2VYND 3ROPA 2OUIA 4JCOA 3L77A 4WLNA 5TJ9A 5BSEA 4PG6A 3ZI0A 2PH5A 1UJMA 1Z45A 2CD9A 4MVJP 4W7IA 3VZRA 4FFNA 4YDRA 3WXBA 3FTNA 2NACA 5JYEA 4YT4A 2QYSA 4IJKA 5DDIP 4BNNA 4FBGA 1IPEA 1BXGA 4G2NA 2VT2A 4AJNA 2BGKA 5IZCA 3RC1A 1NFFA 3QRWA 1XWFA 3CKYA 4LN1A 2FPGA 4BV9A 5BNFA 1UR5A 4O59O 3VVCA 3ZNNA 4RVFA 4DBZA 4P22A 4MP6A 2FZEA 1AXEA 1T2DA 2BI7A 4R41A 3A06A 2I3AA 2ZTLA 4IGFA 5I7SA 3ICCA 1ISFA 2HMUA 4J91A 3W4JA 1XLTA 1H6BA 2VUTA 1T2CA 5U4QA 4AFNA 4RF4A 1G0NA 2X5JO 3K2EA 4F45A 2OORA 4RPJA 1C1XB 4J7UA 1R6DA 2V6GA 1T2AA 2FR8A 3DOCA 1U8FO 4TKLA 3GUYA 2C2XA 1PZGA 3LC7O 2GZ1A 1JDJA 4KWIA 1GQYA 1NM5A 1VM6A 3H9JA 5G4KA 3ZWXA 2AQKA 3D4NA 3ZWWA 5G0VA 3MOGA 1UXHA 3DONA 5CDSA 2JKVA 4MP3A 4UAGA 3CTMA 1GU7A 2X1HA 4NK5A 3WLFA 3C7AA 3GAZA 4J7XA 5G0WA 1TT7A 2LDBA 3K30A 3L4SO 3NGLA 1HDXA 4ALMA 3EW7A 4MJLA 2O3SA 3GZNA 4LSWA 2FZWA 4NQZA 3PHJA 3D4PA 2O3TA 4IIVA 1B7GO 2P5YA 1TT5A 1MG5A 4J2HA 1UP6A 3OJ0A 1EMDA 3H6KA 4P4GA 3GY0A 1QP8A 4EI2A 5CDGA 1WWKA 3D4OA 3OIDA 4NJMB 3WWYA 3PXXA 1TVEA 2UYYA 5DBIA 1NYTA 4J9VA 4ND4A 4Q39A 4EEZA 4S1VA 1GQQA 1ZW1A 4IGEA 3T7EA 2NNLD 4UVIA 4Z9YA 2OP0A 3OQ1A 2OMEA 2QX7A 2ZK7A 1LLQA 1E5QA 5L51A 2OGUA 1PS0A 3FPLA 2GR9A 3O9ZA 1YB5A 1B3RA 4DRYA 1V35A 2NU7A 3OETA 1NPYA 1B15A 5JDCA 3EC7A 4YAGA 4U6QA 3S1LA 4CPDA 3KTDA 5HS6A 1M66A 2DTDA 3DAPA 1GTMA 2YV1A 3UW3A 4UULA 2Y1CA 1XSEA 2HSDA 2HJSA 3FNGA 4YJHA 1O6ZA 5FI5A 1MLDA 3D0OA 4EDFA 4RLHA 3BMNB 4XB1A 2ZYDA 1Q7GA 4K1LA 1DOHA 1AE1A 2HK8A 3DAGA 3GPIA 3PJGA 4W4TA 1F8GA 3DR3A 2Q1WA 4LVCA 4CQMB 2IZZA 2BI8A 2EW8A 3NJ8A 1IULA 1WP4A 1DRWA 2VTEA 4DLBA 1SCUA 2Z1MA 2VNSA 1E5LA 1EK5A 2DUWA 3PWSA 4GKVA 1LLCA 4E5YA 3R0IA 4GWGA 3O26A 5T8KC 1HSOA 3BHMA 4J1SA 2HKIA 2WEKA 4YACA 4CR8A 2WTBA 5H83A 3INTA 7MDHA 3OM9A 1Q7CA 3VTFA 3AM4A 3ENNA 4J1NA 3SC6A 1F06A 4J1QA 5HA5A 4IQ8A 3NJ4A 4WECA 3TZ6A 3JQBC 4OQZA 1YOVA 3F4LA 4Q3BA 4I1IA 2VYVD 1SBYA 3HDQA 1Y5MA 3LT1A 5CDUA 3P5SA 4CM9D 2FY8A 5ITVA 4HX5A 1V8BA 1R15A 3ANLA 2E48A 3PLRA 3RC2A 1D7OA 4GX0A 4QTZA 4FC7A 1Y8RB 2GNAA 4O0LA 3G17A 3VHRA 4WLVA 4B4UA 2FSVA 3V5NA 4WCDA 2B36A 1I33A 2C59A 3O8QB 2P91A 4CQLB 3FF4A 4RZHA 4ALNA 1C1DA 1CIVA 2CF6A 1GZ6A 5L3ZA 4IXTA 2G76A 2X5KO 4LGVA 3ZWCA 3E82A 3ZGYA 5JSFA 4IPTA 4YJGA 3DZBA 3HSKA 3LU1A 1PQUA 3PGJA 1E77A 3QWHA 1E3SA 1ADBA 1SOVA 1ZEMA 1E3LA 5LCXA 4E5KA 3IP3A 3ETDA 4Y6SA 5B4TA 3WMWA 1A5ZA 3NX4A 4CV2A 5U9CA 2FOIA 1L1FA 4WCFC 1EBUA 3OQBA 2X22A 3DXFA 4BO5A 2Y1GA 3M2TA 5A3VA 4L75A 1PIWA 4CL8A 1GD1O 2J3JA 2Q4EA 5THQA 4ZA2A 5JDIA 1U7HA 4O6VA 4UVDA 2X58A 1LTHR 1SZJG 1UXGA 3OJOA 3ZV4A 5AOVA 5I8WA 1N9GB 3IIEA 5HM8A 2HU2A 3PK0A 3AWDA 3LF1A 4BGUA 3V2GA 1YQXA 3DDNA 2VYNA 3JD3A 2CFCA 2WJPA 5CG2A 4NBVA 2OL4A 4PN3A 4B8WA 4A2CA 4WK6A 4RPKA 1YL5A 3MTJA 3UUWA 2P4QA 3OH8A 3BTUA 4P8RA 3B1FA 1XKQA 3F4BA 3AFNA 3E03A 3LC2O 2C07A 4D0RA 4R9RA 2JFHA 1LDNA 1ZO8A 4ITUA 3TPCA 1B14A 3L0DA 4OGWA 2VOJA 4NK4A 3WICA 1K6XA 8LDHA 1AHHA 2VNAA 3FWNA 1HEUA 5G0UA 2EWMA 1AHIA 1CYDA 4WOKA 1UXJA 1BMDA 3INRA 4FJ1A 2EKLA 4CLHA 4BUCA 1IPFA 2H5LA 3SBOA 1PGOA 4OHUA 5L7YA 3ROMA 4LMPA 3TN7A 4XGIA 1ULSA 2BFOA 5F3RA 2C5AA 4XGKA 3V2HA 2YJZA 2IDZA 1PGPA 3HFGA 1KIFA 3W1VA 1E7QA 3V1TC 3IDSA 3K96A 1PS9A 5TX7A 2EKQA 3CXRA 4OL9A 3K31A 3F47A 4RJTA 3JQ9A 1F0YA 2PTGA 3GN2A 1B16A 2P5UA 1LLUA 3GR6A 1GZ4A 4WNCA 4WLUA 1KYQA 4ZQFA 3FNHA 3WQSB 3KLMX 4NJOA 5DT9A 4MDHA 3RFTA 1Q7BA 3A28A 3I9LA 4UREA 2VHXA 1G6KA 1SNYA 4PLGA 1DIAA 3IL2A 2JD2A 3AJRA 5IDYA 4R4JA 4J90A 1GEGA 3AY3A 2J3HA 2CY0A 1DIBA 3WDSA 1GR0A 2Y1FA 2X86A 3PJFA 4C7KA 4ZVVA 1DLJA 2EJWA 4JBGA 3NDJA 1J6UA 4XDYA 1MP0A 1ZJYA 4AG3A 4JGBA 1VC2A 1QG6A 4R51A 4BNXA 4DIOA 4IS3A 4XIYA 3OJEA 3OEYA 1LXCA 2AEMA 4DL9A 3FN4A 1D8AA 1Y7TA 1V0JA 3DMTC 3NEPX 5F21A 1KERA 5TSDA 3S8MA 1BSVA 3IUSA 1GAEO 3PZBA 3ANNA 4NG5A 2QG4A 4CMHA 1RM0A 3WFIA 3OP4A 4BGVA 1VE9A 1DIRA 2NADA 2G5CA 3WJAA 4Y6PA 4R1UA 2VCYA 3DAFA 4BNMA 4U0KA 3NDRA 1BVUA 3H5RA 4BMNA 1XELA 2XPCA 4QSMA 1NPDA 2AQ8A 1ZVMA 3QWAA 5JXWA 1B3BA 1OI7A 2VRCD 1WVGA 4CMCA 3NT4A 4XDZA 5ENDA 1FDUA 3WBFA 2DFDA 3QLJA 4RDIA 2NTJA 1N9GA 1YRLA 2JCVA 2YFQA 2A35A 1ZMTA 3VH3A 1IB6A 1EVJA 1SMKA 2JCXA 4FIZA 2HK7A 3GGPA 2DBVO 2HMVA 3A9WA 2VWQA 3R3SA 4PZEA 2G17A 1CETA 3VH4A 3GQVA 1J49A 1E1KA 3GGOA 5DN9A 5EJ2A 3MJSA 5A5FA 3FTPA 4TWRA 1A9YA 1LLDA 3ZCXA 3PHHA 4XQGA 1N1EA 4XQ9A 1GZ3A 3I9OA 4H7PA 3AUAA 5IDQA 3V1UA 1HDOA 1UDBA 1YJQA 1CF2O 1EDOA 1LNQA 1P45A 1U3UA 3NGXA 2Q50A 2WE8A 3D5TA 1NR7A 1QYWA 1EVIA 1YH3A 1S6YA 4I5DA 3L9WA 3VZSA 4R54A 5FWNA 1PWXA 1NTOA 3HFSA 4KDEA 3AK4A 3L6DA 3JD2A 2C7GA 3WFJA 3LYLA 3DZHA 5DP2A 3GEGA 2AEJA 1X7HA 3I6IA 3ZWPA 3RIHA 2PZMA 2ZJ0A 4OKNA 4E2WA 4XCVA 5K0ZA 5HBRA 1X7DA 4GLLA 2PNFA 1W0CA 2VYVA 3JQ9C 4RZIA 5JS6A 4NNJA 3TL2A 3ZHXA 4M54A 4QT0A 1LQUA 3G0OA 1QKIA 3U4CA 2I6TA 2B35A 4C4OA 1DFHA 1U7TA 1ZK4A 3WLEA 4QFCA 1U1IA 4XIJA 3GOHA 1Z7EA 3TNLA 3F5QA 4OIMA 3SLGA 2LDXA 3SVTA 4AJLA 3B6ZA 2WYVA 4WJZA 1CJCA 2IYOA 4MP8A 5A9SB 1YVEI 2E82A 3AUUA 3C3XA 3FNFA 4YAIA 5THKA 5I7FA 4Z3KA 1GYRA 1VLLA 4ESOA 4OM8A 4E13A 3LDHA 4QFDA 1HYHA 4Z0TA 3I52A 1KVQA 4BOYA 1U3WA 2B4RO 2HK9A 3P7MA 3RSHA 3VTZA 1OC2A 1EE9A 4NBUA 3ZWNA 3OECA 2V6MA 5B1YA 4GPD1 4RQUA 4CL3A 4YJFA 1JVBA 3Q3CA 3WGIA 3GH3A 3JQDA 2P2SA 3L4BC 8ADHA 5IDWA 5IDXA 1HE2A 3F5SA 3H5AA 4XJSA 2VUSA 4MVJA 4XYLA 3HHPA 5ES3A 4BKRA 2GD1O 3SEFA 3WR5A 4EUEA 4M55A 1H6CA 2WMDA 1O5IA 4GSKA 5KVQA 3ZWYA 2YW9A 2RHCA 4YEDA 4YT8A 4XRGA 2PZKA 1I2ZA 1E7YA 3RUHA 2Q2WA 2AW5A 2FHSA 3PHLA 1I2BA 5I8ZA 4DQUA 3ITKA 4RGBA 4D44A 2FWMX 1KEPA 2Y0EA 3DEYX 1PL6A 3QWIA 1U28A 1K89A 3DOJA 4ALJA 1JVSA 1RYEA 3GN1A 2NM0A 4ROSA 4FFRA 4QEDA 4CMAA 4CM6A 3H9EO 3AM5A 1CERA 3BMOA 5FI3A 1S7CA 3DBRA 1IOLA 1UZMA 1YONA 3VPFA 4I9HA 3H65A 3UHAA 5TGDA 4BGIA 2UUPA 4IJWA 2P9EA 4IBOA 3PI7A 4HNGA 1LSUA 4OKIA 3TJRA 3B1JA 2G1UA 1YB1A 4PG8A 4QO8A 1N5DA 4HY3A 1BXGB 3U4HA 3E8XA 1R4MA 1ONNA 5GMOA 2BHLA 1MG0A 1E1MA 1XHLA 4RVGA 3OJLA 1X14A 3B20A 4RPLA 1EEHA 3GC6A 4YYZA 3KEQA 1JTVA 2Y67A 4RPGA 3PHIA 5EPOA 3RASA 1WLYA 2GN8A 2A92A 5IG2A 2HJRA 2VHWA 3ITDA 1GUYA 5B4VA 5KJEA 3EUWA 3K73O 3W4KA 2Y99A 3AI2A 1KETA 1PQPA 5JO0A 1F14A 4BO8A 4KDFA 2QRLA 3CMMA 3EGOA 4S3MA 2NQTA 2ILTA 4IINA 1V3UA 4XX0A 1A71A 2CMDA 3I6QA 1NPTO 4IDGA 1SB8A 4UVHA 2CNBA 1EVZA 3TFOA 1LDEA 3UKOA 1R4NB 2AEFA 4CMBA 5A3JA 3GEDA 5IZ4A 3CZMA 1C0IA 1CEQA 4JIGA 3WYEA 1P31A 5F5LA 5A9SA 1SEPA 4YRDA 3PWKA 4YAJA 3FPCA 3LC1O 2VZ8A 4K6FA 3I9MA 4LMRA 1P33A 1QR6A 2PD3A 3OF2A 3TRIA 1PX0A 2FMUA 3ADPA 3GZNB 3UAGA 4FS3A 5GZ3A 3FHLA 3LLSA 4F6CA 4B3JA 3RUIA 2JCYA 2YQ4A 1U8XX 1VPDA 3C1TA 3JYNA 3IAHA 4BKPA 4BNKA 3GVPA 2WM3A 3QHAA 4ALIA 5K6AA 2VRCA 3K2BA 2C29D 3GNTA 5F1KA 4JJFA 3IQDB 4MVJI 4U6SA 1YDWA 4EJ6A 1DXYA 4DIBA 4IQ0A 2HLPA 3AI1A 4P38A 4R01A 1LDGA 3WQQA 2W98A 1E3IA 3UCXA 2H9IA 1I10A 2WD7A 4NBWA 1W6UA 3KSDO 4K6CA 1YWGO 1YL7A 4U7WA 1P1RA 4DQXA 4U0JA 1LSSA 1H9AA 4LVUA 1NVMB 5CG1A 1V9LA 2YYYA 4D3FA 3MJ4A 4QECA 1IE3A 2PGLA 3QV1A 4CUZA 6ADHA 4XYBA 1RM4A 3G79A 5JAMA 1GV0A 1WDKA 1DB3A 1HZZA 4AJPA 4YJHB 4AJOA 4TQGA 1FK8A 1R0KA 4XD2A 4YWJA 1ISIA 5KVSA 4R1SA 1KEVA 4ZQGA 4FSHA 4L4SA 4KP7A 4ND2A 4ZN6A 2X9VA 1PZFA 3D64A 3S2EA 2CDCA 2AE2A 3RU9A 1DHTA 2O4UX 2F00A 3ICPA 5ENVA 3GEMA 1NWHA 2E37A 1LDBA 2DBQA 4M1QA 4ZQEA 3PPIA 1JQBA 3D1LA 2I65A 5DOVA 5TJHA 1KEWA 1ADCA 4CM8A 3DL2A 1QYCA 2DPGA 1OFGA 3FCOA 1J4AA 1K2WA 2D5CA 1WZEA 1HE4A 3CSDA 3TSCA 4FDAA 2DBZA 2GERA 4II3A 3DBHA 5TS3A 1I3KA 1T24A 3AOEC 1A7KA 3WNQA 1YOVB 1CQIA 1DRVA 1AXGA 1UXKA 2ZB4A 2Q2QA 3HNPA 4DBVO 1NQAO 1C0PA 4L4RA 4W7HA 3W8EA 4IDDA 1KVTA 1V6AA 5AXAA 5C3MA 2PGJA 4G81A 2O7SA 3LF2A 5CEJA 3GDOA 1NWCA 1R4NA 1HDZA 3DFZA 3U4IA 2Q49A 2JHFA 3UVEA 5KIAA 5EL0A 1PJ4A 3HG7A 4TMFA 3WTBA 4K26A 1SOWA 2HMWA 4GVLA 1ENYA 1XIVA 3TWOA 4J0FA 3U5TA 1ZXBA 2ZYAA 1C1DB 5L4LA 5FFFA 4AJ4A 4IMRA 3FRJA 3QP9A 1ZSNA 2DAPA 5DOZA 3TZHA 1I5RA 4MVJM 2VZ9A 2FR0A 4YJGB 2HMTA 3DQPA 5CP8A 4CMGA 4BQRA 3EZYA 5L7TA 4RVUA 2PFGA 1Y8QA 4NI5A 2W4QA 4HXYA 2IYPA 4UUPA 1WDLA 5L7WA 2EGGA 3WGOA 1PJTA 1Y81A 4TRRA 1Y9EA 2ZCUA 3TOXA 5JBIA 3GFBA 3KYCA 2D1YA 1LA2A 4CM3A 1UZLA 1XR3A 1BTOA 3ZV3A 4PFJA 3C85A 2ZJ1A 1A72A 4R3NA 2DLDA 1N8KA 4DWVA 4W9NA 3MWDB 3W8DA 3I9KA 5K6AC 2PK3A 1TLTA 2ZB7A 2HMSA 3GRKA 2OP1A 3I9JA 4RO0A 4E2ZA 3I23A 2ZIZA 1AGNA 2DFVA 5CDYA 5JE8A 4OQYA 1EDZA 4I5EA 2JFGA 3WGYA 5JY6A 4B4VA 2P9CA 1N7GA 1YKFA 1EUZA 3GDGA 4B4OA 4LCEA 4LK3A 4GX2A 1ENPA 2CUKA 4BO3A 2OXIA 1X15A 3ETGA 1NQTA 3V2UA 5CDTA 2PWZA 3N58A 4Z9XA 4L9RA 2X9NA 5FEUA 5IXYA 1D1TA 4D0SA 1YBVA 4OOFA 3JYOA 1PL8A 3GG2A 3R6DA 2DU8A 5DF1A 1B2LA 4IM7A 1ZFNA 4YJDA 2GDZA 1NFRA 1T26A 3Q9UA 5CAEA 1L7EA 2YV3A 4ZQHA 3WGGA 3JV7A 1IL0A 4M86A 4JXKA 2IODA 2VWPA 2BGLA 1LI4A 2HAEA 3FBGA 3KYBA 3E9NA 1T25A 5DP1A 3WS7A 4JBHA 2ET6A 2DUUA 3GA0A 5IZCC 4ILKA 3WJ7A 3ZHBA 4IDBA 1F17A 4M87A 1ML3A 1E1LA 2GCGA 4AL4A 4B3IA 2VUUA 4DC0A 3ADOA 3PDJA 4D79A 5A4DA 3E6AA 3M1LA 4PLPA 4AJ2A 4DLAA 1ULUA 5JY1A 1LEHA 4WLOA 1HRDA 5A1TA 3FR8A 3ZU5A 4PRKA 4D43A 1ZK3A 3GUCA 5G4LA 2DC1A 4R1TA 1QXSA 4GGOA 2HRZA 1MGOA 1NHWA 5A02A 2F1KA 4HADA 5KJ6A 3W8FA 1VSUA 4JK3A 3CPSA 3JQFA 4NBTA 5T57A 3DOOA 1VL0A 2Q46A 3PIIA 2ZYGA 3U3XA 1V3VA 2J3IA 4DPMA 2FR1A 3ONFA 3DHYA 1MX3A 1DC5A 4Z0HO 3WGZA 3T4EA 1WNTA 4IMPA 3ORFA 2PZLA 3DO5A 4BO9A 2XOXA 4GLOA 2B5VA 2IXAA 4UVEA 3K5PA 3ZWBA 1IY8A 1E3JA 3ZW9A 4JJIA 3D3WA 4FR5A 4YR9A 2Y1EA 1HXHA 3MJTA 3KRTA 4EGFA 5DCWA 3U09A 4WASA 4BNJA 3KHUA 3KO8A 2EV9A 4II2A 2FRDA 1XQ1A 1OBFO 1XYGA 2AE1A 4RF2A 3RUCA 1LDMA 3UXYA 4XWYA 3QW2A 4BQPA 1H2BA 4E21A 3VDRA 4YAKA 1WXDA 2Y0CA 1QV6A 1P44A 2EP5A 1T1SA 3IS3A 2QZ9A 5CEEA 1PJQA 4E4YA 4Y6RA 2X7HA 2RBEA 4MVJD 4D3SA 1P0CA 5ER6A 2O48X 4NZ9A 1N92A 1Q0HA 3NTOA 1NVTA 1M67A 2X6TA 4B4WA 4ONEA 3QIVA 2VZ0A 4J49A 2OFPA 5IN5A 1JA9A 1RM5A 1Z75A 1VJ1A 3RFXA 4J4HA 3IUPA 1HZJA 5EIOA 5AXCA 5KOIA 4CLEA 2I66A 4YT2A 1DPGA 4ND3A 3ASVA 3KVOA 5JDCC 2V6BA 3VH1A 1L7DA 1X1EA 4WPGA 4BO6A 2AG8A 2P9GA 4AJJA 1U4OA 3RUFA 4J4BA 4PLYA 4FOSA 1I36A 2HUNA 2V65A 4DYVA 4H15A 2YQ5A 4ND1A 4YCAA 2EF1A 3FBTA 5L9AA 4K28A 2BRUA 3UCEA 2Q45A 4ND5A 2B69A 5LC1A 3H3FA 3E5RA 1W8DA 2CVZA 5EMHA 4GX1A 4DMMA 3I83A 2X0JA 3AFMA 3IC5A 2Y68A 2ZTVA 3R1IA 3LVFO 4N18A 2FSSA 2X0IA 4KUHA 3RBXA 2ZQYA 3SJUA 1FDTA 2ZB8A 1SO8A 1R12A 3F1KA 1V3TA 2QRKA 1KY5A 1E6EA 2R00A 4CODB 4BL5A 5HS4A 1WMBA 2BMAA 4D41A 1YBAA 3CIFA 2X0RA 1Z82A 1ZXLA 4MPDA 4I9UA 2EG9A 3ASUA 5COQA 3WGTA 4E33A 1WDMA 3CZRA 4LCJA 2DBRA 1Y5RA 2BGMA 5CHEA 3GNQA 1VL8A 3BZUA 1IZ9A 2GF2A 2JHGA 3U9LA 1CDOA 3M6IA 3PWZA 1GUZA 1D4FA 1YE3A 2X9GA 3S2GA 1I01A 3ZN2A 1E7SA 1LRKA 3P19A 4GX5A 4A73A 3JQCA 1I24A 3QY9A 4HKTA 2Y93A 1U3VA 4CLOA 1NXQA 1PSDA 4YJFB 1T2FA 1NX6A 4NFYA 4WLEA 4N54A 4WLFA 4GMGA 2BFPA 2H6EA 4PVDA 3LT4A 2HQ1A 2UV8A 2RHRA 5KJCA 1DO8A 4BO4A 1ISHA 3RU7A 1BW9A 5JW6A 1DLIA 1Y1PA 3BAZA 1GV1A 2EIHA 3DTYA 4I5GA 5L95A 1H0KA 2UVDA 4XA8A 3H9UA 4AJIA 4OXYA 3AW9A 4J6FA 4XYEA 3EK2A 4Q3CA 4JN6B 4E0BA 4U5QA 2DTXA 4HFMA 3WMXA 4ZGWA 4OMUA 4YTEA 2D3TA 2JFFA 5JLAA 4B7CA 1B0AA 3IKVA 1FJHA 1M6WA 3KZVA 2UAGA 4Y67A 1EZ4A 5A9TA 5JDIC 3ENKA 4Z3DA 2D8AA 4I8XA 4NU5A 3KUXA 5JFOA 5TT1A 3BMOB 3H8VA 3QVSA 3DBRB 1MUUA 2NVBA 4C7JA 3E18A 2I76A 1E7MA 3MCVA 4RVSA 3I9NA 5IN4A 1KVUA 4MKXA 2VQ3A 5G0SA 4BNLA 4PRLA 5KJ1A 4AJEA 2YFHA 1SPXA 3K6JA 4ZU3A 4FGWA 3RBZA 1UXIA 3H4VA 3DZKA 1KS9A 1R4MB 1DC3A 1WZIA 3E48A 1E0DA 2DM6A 2H1SA 1A4IA 1G1AA 4BV8A 4E6PA 5ICSA 4U8GA 4DUPA 4DA9A 5JAIA 1OZAA 3KB6A 1J0XO 4M49A 2GZ3A 5TNXA 2NLOA 1JKIA 1PZEA 2NUAA 3DFUA 4CMKA 1X0XA 2AA3A 3UH1A 3WNVA 3IOYA 4YXFA 3GVIA 4PG7A 1UAGA 3H3JA 1Q2XA 1ZZEA 4TKMA 5JO9A 1TA4A 2EHDA 3JYLA 3RBVA 3WSWA 1EE2A 2YUTA 2W90A 3WYBA 1BG6A 2PR2A 4AICA 2BELA 4NDNE 5MGBA 1PR3A 2G0TA 5BSHA 2PH3A 5JC1A 2POQX 3GRPA 4LRTB 1LUAA 3A14A 4WOJA 4JJGA 5T67A 2BF7A 1HDRA 1LSJA 4HUJA 1ISMA 2PZJA 1H2HA 3EYWA 1NP3A 4PIVA 4PGFA 3W6ZA 2PGDA 2VOEA 2ZKLA 1A7AA 1DEHA 1A4UA 3HZZA 3PIDA 1P1HA 3GVXA 5G2OA 1BGVA 4XJTA 4R16A 5JYDA 1I3NA 4GBJA 4Z0PA 5L40A 1IZ0A 1ZK1A 2RAFA 1JWAB 2NQ8A 3QQPA 4KUEA 3QWBA 3QA9A 2YHIA 1Z74A 4XR9A 1K5HA 2Q1TA 1QSGA 2GSDA 3PJEA 1ADGA 4MINA 4E3ZA 2CSUA 4O5OA 5AQ1A 1NBOA 3JD0A 5I9LA 4XZ3A 4D46A 1IHYA 1B8PA 2IZ0A 4E12A 4BHTA 3CUKA 5C5IA 1QYDA 1ZKMA 3KOUA 1U5CA 4CM4A 5B12A 3CEAA 5F1OA 1LRLA 1VJ0A 3OA2A 1Y6JA 2GN6A 3QJ5A 1HYGA 2PD4A 3P2YA 3B70A 1JKFA 2WD7B 1CQJA 3DZFA 4IY1A 3EVNA 2O3JA 5A9RA 4HFJA 2PD6A 5T64A 1KY4A 1WW8A 3WGHA 4Y98A 1ID1A 4EBFA 2E6UX 1T4DA 2NWQA 5I7VA 3ROQA 3NKLA 2D0IA 4J16A 4GAEA 4FC6A 5G0TA 3OHSX 3PHGA 5IJZA 1DHRA 3DMYA 4FB5A 3VZQA 1DFIA 1E3WA 1UZNA 2VWHA 4BNFA 3FD8A 3NV9A 3UICA 2Y05A 3LK7A 5AVOA 4IUYA 4J3FA 4PLTA 5ILOA 3G1TA 3RUEA 2A4KA 3NUGA 3EDMA 4TRMA 3L6EA 3LQFA 4ZD6A 4YA6A 3JYPA 4OAQA 4BKOA 3NTQA 1J5PA 4D3DA 1F12A 4QO7A 1E3EA 1KVSA 2DT5A 1I0ZA 4TRJA 2E49A 3WB9A 3PYMA 1DAPA 3ZWOA 3OQ6A 3QVTA 4CLXA 5DCUA 3D3EA 2NV6A 2V6FA 1FDSA 2WE7A 4CM8B 4RCVA 1JAYA 3SX2A 4WEQA 4AJ1A 3BIOA 3GK3A 1I3LA 3WYCA 1U5AA 3VVBA 3AM3A 3TQHA 5COBA 3DBHB 3FWZA 2GN9A 3CMCO 3JQAD 4FOOA 3U4DA 1HF3A 2P4HX 1UP4A 4H3VA 3MWEB 1KEUA 1O8CA 3JD4A 3NAQA 3OEWA 3HDJA 1X13A 1LX6A 4Q3DA 2NVUA 2Q2VA 2JJYA 3LZ6A 2AQHA 1KVRA 1H9BA 4HV4A 4FFPA 2CZCA 2VTDA 4BGEA 1VL6A 3QE3A 2I99A 4NU6A 2HDHA 4E2YA 1PQWA 4YRBA 3EAGA 4PLCA 5DULA 3TZQA 3JYQA 1G0OA 4KTTE 4CMEA 3ZZNA 5ICMA 3WG9A 3VH2A 4PVCA 1P1KA 1PJLA 3JQ8A 3MJEA 4BKQA 4HP8A 1OMOA 4PG5A 3U62A 2O2YA 5KVCA 1SC6A 5EQFA 3VPHA 1Z73A 2YDXA 2WD8A 4O63O 3ONDA 2IEBA 3RKRA 1R66A 1MC4A 4ZQBA 2X8LA 5T6BA 3NT2A 2IXBA 1ISGA 1GQ2A 1Y8QB 2AQIA 3JQ7B 1O94A 2GUGA 5CFZA 3DBLA 3KYCB 3OMLA 3SC4A 1JN0A 1NFQA 5AXDA 3TZCA 3GG9A 1QMGA 4CR6A 1ZK0A 3PVZA 2FP4A 5KTKA 2W2KA 1EQUA 2NU9A 3IJPA 3VPXA 1E1NA 1QLJA 3TZKA 2O50A 4M89A 2OO5A 4F6LA 4YQZA 4IZHA 1H94A 1H93A 4JP2A 1SB9A 2ZATA 3I4CA 3WIDA 1E7WA 4JX8A 1Q1NA 3ZNOA 3VAZA 2G82A 4XYMA 4EZBA 4KUGA 4ZRNA 5ER9A 1MFZA 4R3WA 4W99A 2B4TO 3RJ5A 1DC6A 4XKJA 1DJQA 1YS4A 1F8FA 3ZU3A 3Q2IA 2BFAA 2NTVA 4IDAA 2YZ7A 1ZIDA 1DFGA 5I9NA 1JLLA 1DRUA 4CLRA 1O0SA 1XQ6A 5F5NA 4NIMA 3TL3A 3DBVO 4R69A 3AUSA 4RVDA 1BWSA 3M2PA 4AJKA 2QYTA 2XAAA 3DZJA 2NU8A 4DXHA 3SLKA 5DCYA 4B79A 4ZHSA 1U2GA 4FFOA 3GHHA 4LISA 1TI7A 4TZKA 4Z6KA 4CM7A 4KQWA 2GYYA 1WPQA 4LSMA 3WX0A 1NAHA 3H2ZA 3HQ4O 4UEJA 4RLSA 1NVGA 2PKQP 4FJ2A 4Q3NA 4FW8A 1A9ZA 3HB5X 5BNIA 1E92A 1YO6A 5COAA 5A03A 2EKPA 3V1YA 2C82A 3LT2A 1PJ2A 5KWEA 4KQXA 2O3RA 2UUOA 1MC5A 1TB4A 2PA3A 4W9NC 4NMHA 4B3HA 1SEVA 2VHYA 1FDWA 3RVDA 3GFGA 3OICA 1YBMA 3W4IA 4Q3AA 1YJ8A 4BNYA 1HDGO 3KBOA 5T8KA 3COSA 3JTMA 4RPHA 2HCTA 2I5PO 2GRAA 4CJXA 4CMEC 2JD0A 4CQMD 4BNVA 1HL3A 4NHEA 3UF0A 3PP8A 1H5QA 3GDFA 2GPTA 2QQ5A 3JQBA 3LT0A 3PQDA 3D3WB 2Z1NA 3VKUA 3VPGA 1ADFA 1ISJA 1EFKA 1X0VA 3GHYA 1C0LA 3E1KA 1U4SA 2RCYA 4BNIA 1DC4A 2EEZA 4MIOA 5BR7A 3ZHYA 1R0SA 3JQ7A 4I9NA 5BNTA 3H9QA 4F46A 1EUDA 3RFVA 1ZEJA 2D4AA 4ID9A 4RDHA 4EUHA 3I1JA 2QZZA 2CF5A 2ZB3A 2OZPA 4N7RA 4OSPA 4RL6A 2B5WA 2Q4BA 1PU2A 1A27A 5C7LO 3U0BA 1ZMOA 2TMGA 4Y9DA 4UUMA 1LSOA 1DDOA 1P0FA 1WAMA 1MB4A 4RV9A 4XQCA 3BMQA 4D45A 4D42A 1UH5A 4E31A 1DAOA 1I8TA 2DQ4A 2X23A 3ON5A 2B0JA 3G49A 2XF8A 4WCFA 1SAYA 2E4AA 1C0KA 4EEXA 1PS8A 4E5NA 1NASA 1XDWA 3ZNPA 3RQSA 4GH5A 4R5MA 5EERA 3E5MA 4A10A 5L45A 2SCUA 4XRRA 1W4ZA 3KYDB 2O23A 3WWZA 1HDYA 2AHRA 4JBIA 5TC4A 1GY8A 3F9IA 3U49A 4CMIA 4ALLA 1T4BA 4I08A 4TRNA 4W82A 3C1OA 3HB4X 2BLLA 3C8MA 1ZK2A 1JW9B 5TT0A 4A27A 3S55A 1T2EA 2YDYA 3WOHA 5DNAA 1ZUD1 3ABIA 4YBZA 4B8ZA 4J9UE 5A04A 3GNSA 3JQAA 2D59A 1CRWG 1LJ8A 3NYWA 4AVYA 3E9MA 3X2FA 1R0LA 1DSSG 3RCBA 4GVXA 2IRWA 2VHZA 3R3JA 4MOWA 3JQ6A 4KWHA 1MXFA 3N74A 2AXQA 1GADO 3C7DB 3E9QA 2D2IA 1PTJA 4OXNA 3IP1A 4XEHA 3FNEA 2VRBA 3C24A 4B7XA 1PJCA 1YDEA 4RORA 1EVYA 1U9JA 3DHEA 4DYDA 3G1UA 4XGNA 1B8VA 3C7CB 5KKCA 1K6JA 4FN4A 5TF4A 1O9BA 4FGSA 4EJMA 5GZ6A 4N5NA 4L73A 2CVOA 2NU6A 5IFLA 1GUFA 3RD5A 1YQDA 1W73A 4P4LA 3HN7A 1P77A 1PJ3A 4GKBA 4R1NA 5IF3A 1HE5A 2I3GA 3BTSA 3MJVA 4CM1A 3JQEA 2Q3EA 4GWKA 4J7CA 3S2IA 1Q0LA 2DTEA 1Y9AA 4WEOA 3BYZA 4CLOB 4E32A 2Y0DA 1D3AA 4BKUA 4ZICA 1B26A 2EJVA 3GMDA 4UUNA 1IUKA 1C1XA 4EYEA 2W8ZA 3RI3A 5KVVA 1CWUA 4IJVA 1PJSA 1BHSA 3MEQA 4YAEA 1BW9B 3Q9NA 1NQOA 4GQAA 3KETA 5JNLA 2C2YA 1T1RA 3INGA 3WBBA 3TF5A 5A05A 4BO0A 1ONPA 4IS2A 3X2EA 3ST7A 4UEKA 4F3YA 2PV7A 3NDIA 4BNTA 4YT5A 2GLXA 5EESA 1YB4A 1VRWA
chains in the Genus database with same CATH superfamily
2P11A 1D7AA 2VEDA 2XLCA 4RIEA 5FYDA 3L8YA 1R37A 4FYWA 5KTSA 3NH6A 2YS7A 2OYRA 4DSAA 1XV5A 1E6LA 5JNVA 3F8SA 1DEAA 1XAJA 3LSYA 1A5TA 2DHEA 3QWFA 1TEXA 1SUWA 2I0FA 2PQMA 2HV9A 1D1PA 2Q5LA 3ZTWA 1PJRA 4LYYA 3ITEA 1NR1A 2QE6A 3TG8A 4CEJB 4DV3B 4GOXA 1YK0A 5BSRA 2CJYA 2R6ZA 1X1TA 2WB2A 3FNIA 3L1VA 1QVVA 2WB4A 3PDUA 3FCUB 1Z6XA 3DEZA 1YCHA 4MGEA 1ORRA 2O5VA 2BMFA 3TDNA 3UENA 4NJMA 3EGXA 3LXXA 3T4XA 3MJHA 3A1UA 3RIXA 3L8DA 3KYDA 3ZV5A 3HZHA 5BN4A 1TRKA 1FLAA 3CEHA 4JROA 1ZR4A 2B4AA 3OIYA 2BH9A 3F74A 4PIMA 3L05A 3PQ2A 4P31A 4DJJA 4UTRA 2JPDA 1CY8A 1XZFA 2WU1A 4GM4A 1MRNA 4LQDA 4C9BA 3EHEA 1Y1QA 4F3NA 1I5OA 3K8YA 4D1YA 1ORHA 2ZBRA 1SZCA 2OBLA 3LRTA 3OM1A 4D80A 1FW6A 4S2UA 1RQ7A 3KM0A 3MRVA 2B5OA 4OX9B 1LDYA 4BRSA 3MUEA 3C4JA 4RF5A 5CW2A 1NQXA 3GEEA 5KS2A 1P2FA 4U5XA 3H83A 4L15A 1PF7E 1IN6A 1RJWA 2OBMA 3QKSA 2ODQA 1N2JA 1PI3A 3G8YA 1OOEA 3HYLA 4JS0A 3MQ4A 1DDGA 4QARA 4OHXA 4ZAYA 2WKPA 3EZFA 4QD3A 4BJ1A 2O8NA 3PQEA 2FWJA 2D06A 2VHVA 1YC2A 1V1RB 3WLJA 2RMKA 4FCVA 4GS5A 3T12A 1QCDA 2FOLA 2O0LA 1UFOA 3KTAA 1AN9A 4Z99A 3FA2A 1N0IA 3FCSB 2KQUA 2WDZA 2AZXA 4WCVA 2ZWVA 3L0SA 3L7AA 3Q0EA 2UZ4A 3EMBA 4CQMA 1R0CA 4G8CA 1N5RA 5SY4A 5HJ5A 1KWKA 2GLUA 4E3WA 3RB8A 4FNMA 1AX9A 4AS1A 1QRDA 1NVUQ 3R74A 1Q6YA 2HSJA 3LBAA 1H2YA 3HLKA 3W9UA 2AC2A 2R0QC 1YVUA 3CLRC 3R6WA 1GHTA 1VHTA 4LI3X 1CEYA 2BBTA 3KV3O 2QY6A 3QEMB 5EZYA 3FRIA 1T2VA 3FYUC 5ADHA 4TV8B 2I03A 4FE4A 1CUDA 2HGSA 3C3PA 1R3UA 4YI5A 1W2WB 2Z4SA 3Q7RA 5DBEX 1QP7A 4JT2A 2G9ZA 3WQBA 3ZI4A 3EUEA 4JX9A 1Y1RA 3I76A 1I30A 4PLZA 2W8BB 1K6IA 2PLAA 3UAVA 3H1FA 4UQLA 2R6JA 3DW1X 2WYUA 1BEUB 1HRKA 1HV8A 1FY2A 2B20A 2FOXA 2ZJ7A 3BM5A 3A9RA 3IQZA 4FFMA 4RSMA 5IT9A 2QTBA 5EWLA 4TVOA 3KJEA 3K0BA 1XVAA 2H57A 3B53X 1LFDB 4M0DA 1JXQA 4QUIA 1O4VA 3AVWA 1Z7BA 3LS2A 4G8DA 2V97A 4WKNA 4DIKA 4LZAA 3ZV7A 3GAFA 1N34B 3QM1A 1FF9A 1A8HA 1QUEA 2GHRA 2EL9A 4OKSA 2Q7DA 5DBFA 3ZZ1A 3CVVA 1P3JA 4MW9A 3C5VA 3CXUA 3DTTA 5FLEX 2B2XA 3D8SA 3DDZX 5AYVA 4CT0A 4D4JA 4DVJA 5KO2A 1RRFA 2W0MA 2DQZA 2X14A 2I6FA 3U1VA 4Z8YA 1HG0A 1CQJB 4EI9A 4EA8A 5KDLA 1E2HA 4WNAB 2NZVG 4NX2A 5KKNB 4U7DA 2DKNA 3AU9A 2VT3A 3DM9B 5HK9A 1J99A 3AJDA 2H1IA 4LHXA 3L4BA 2ASVA 2PGIA 4GZMA 1AM4D 1NN0A 2CHFA 1YZHA 5EWJA 2XJ9A 3CUYA 5DBGA 1NMEA 4PE5B 4UW9A 4F4HA 5JNUA 3LI2A 2O06A 1T8SA 1OFUX 5FL7D 3VTKA 3VR3A 4WZAE 1Z39A 3MB8A 4UXHA 3S1AA 3MGKA 3BJMA 4Q4JA 1FC0A 1U3TA 1SHJA 1M76A 3M70A 1QVWA 1G64A 3FFAA 2D62A 4HNRA 3A04A 3ETJA 4PEVA 2YHUA 5CLQA 4WIAA 1FQKA 4AN1A 3U81A 4LJ9A 1H4SA 1ZIXA 5JMWA 4O4JF 3TE6A 3DLPX 3U7GA 2A2ZA 3N3AC 2AVDA 2C7VA 3WTCA 5DM0A 4JZYA 1FNCA 4JV5B 2BFDB 1HETA 3AP2A 1Q0RA 3H7AA 1KEKA 3S81A 2QMUA 3OA0A 1X39A 1QO0A 1RQGA 3B3GA 4JLWA 2ZSEA 1C7IA 3EMVA 1BO6A 2ACWA 2HEIA 3HJAA 5DKFA 1NBMD 1QQ7A 1VBMA 4PYKA 1XGKA 3IP8A 1T5HX 2D3WA 4HQOA 4Q3EA 1SD1A 1YACA 4YV7A 3HADA 5BYAA 1MX9A 2DHCA 3P0IA 3JSXA 3TNYA 1IXYA 4D3ZA 3O03A 1Q3HA 4NXNB 5TPZD 3U16A 2DPMA 2ZJYA 2DMRA 3I2YX 3RS0A 3T1OA 3ZDZB 5HRUA 2H4ZA 3K9NA 2WVHA 4I4IA 3VKFA 6REQA 2NSYA 4CR7A 2QUAA 1TJ3A 4IYRA 2PS1A 2QVXX 2R87A 1IATA 1VSBA 4QUBA 3EZ7A 1H1LA 3EXG2 3HLTA 3AT1A 3DO8A 4IJUA 1R2QA 5AM2A 2QM0A 5LJIA 4RULA 2YWHA 3RAFC 4MQEA 1EFVA 4N1AA 1KDPA 2O7VA 3BKXA 4IVQA 2OGWA 1YB7A 2W6JD 1GLGA 4YJ2A 5DK6A 5TGZA 2GBIA 4H0CA 5KAPA 4C43A 1ZOPA 3HE3A 3I5AA 4IEFB 1TMYA 2F1HA 4LYEA 4NFHA 5CEFA 2WJJA 3IUBA 4PX5A 2Y27A 1MOQA 1E96A 3NETA 1TEZA 1Y4SA 3HDHA 2ZJFA 1E9RA 1BQ3A 4KTVE 1A8QA 1L4NA 1ULHA 2EG5A 1V9SA 2FZ4A 4O1HA 1X7WB 4GXRA 4C29A 2Q1SA 4CF7A 1RKUA 1O95A 1QDEA 1K0UA 1WD7A 2DWQA 3L92A 4BMXA 4ETNA 1X7ZA 3C8DA 1P1JA 2YWRA 3QU9A 4YMLA 1ESZA 3T3IA 1UM9A 1SBIA 3BXXA 4PG4A 3TW8A 4C0QC 4D02A 3FVTA 2W6OA 1Z5WA 3UW1A 2YV2A 5JS1A 5KU7A 1PZHA 3BMXA 1ESCA 2B6HA 5FA5A 5JISA 3LIIA 5IW8A 1KI6A 1U0FA 1UEIA 1OXVA 1J06A 2A9VA 2BFMA 3HGMA 3MGBA 4OSOA 4QOFA 2IPMA 1SA0B 3DBLB 4E09A 1LU9A 3ME5A 4XJVA 2W9XA 4YJ3B 5I47A 5JAQA 1XKXA 2MR6A 3OWXA 5J4HA 2BKAA 2CGEA 5BY2A 2ZPTX 3BTVA 2OM2A 1FMLA 3WWEA 2KWIA 3MA0A 4N76A 1QV7A 4L0QA 2WYOA 2NU9B 4A26A 1VLQA 2FPPA 3FXAA 3RHZA 4EOGA 3QSYA 5EQDA 4HXGA 4OK5A 4JJ6A 5LXTA 1IONA 1LBQA 1U7WA 2I2CA 3A6KA 3CZ4A 1IN7A 5KHAA 4GXQA 3GGGA 4IVNA 5JS2A 5IABA 1XD8A 1K9VF 1RYBA 1QYVA 1Z4PX 2NX2A 2AR7A 5G1PA 1ZAYA 1Q50A 1SC9A 2GK4A 4FMDB 4HGZA 4LW8A 4B7ZA 4GMFA 4CIAA 2QPOA 1VFPA 3H2YA 4DR4B 1FTNA 5JXHA 1M2KA 4PBTA 2VPQA 4LRUA 2QTCA 3KOYA 1XZGA 2IZOA 3IKTA 3V46A 4ECAA 1LW6E 1WB5A 2F8LA 2GETA 2I4LA 2X2PA 3LLVA 4HMQA 3KOZA 2QU7A 4RKRA 4YROA 4A2QA 3NHPA 4MO2A 2UXCB 5AUPB 1BXKA 3IEMA 1P0IA 3VX4A 2KS6A 5D3QA 2C96A 4ZI3A 3JSAA 3FVQA 3LLUA 2O5CA 1MFPA 4HYEA 4F3RA 1NBAA 5KCZA 1T1GA 3SHWA 1ZOOA 2BTQA 3E8SA 5JADA 4MVJG 5AJUA 2FPWA 5EE3A 1HA3A 4A6DA 3SZ3A 4GSLA 4DA7A 4V0ME 3RC8A 1IC6A 3ZXXA 5JAOA 1F5SA 3ENWA 3L6OO 4DIEA 4NL4H 1UADA 5K45A 1JLLB 4E5DA 1E6WA 4CLRB 4QDXA 4YFVA 3ET5A 1GPDG 2D5AA 3T5PA 5I3ZA 4YIHA 1QHSA 1A95A 1UWVA 1QK5A 3I37X 5C37A 4ZEOA 5D6NA 3EVZA 4K9OA 3GJXC 3EEOA 3K9QO 3WQRA 1XG5A 1HKUA 1JQ5A 1IJEA 3QSGA 4NBRA 3ZW8A 1TEHA 2HF8A 4HEA1 4GKJB 1HWYA 2AZDA 4QNNA 3SYNA 2YUIA 1KJZA 3GJTA 1XDSA 4DV2B 4OAOA 4ZKEA 3WGUA 4RYDA 3R0JA 1GA6A 2AG5A 3QVUA 2HZ7A 3KEOA 2JFNA 3BTOA 4EKGA 3A6EA 4O1MA 4CMJA 4D3YA 5LB2A 1OAAA 2H4HA 4YDSA 4V38A 1J2YA 5I9MA 1JAXA 1FTYA 1MJGM 3CJRA 2WV9A 2JVJA 5I7EA 4FS8A 3VC7A 6NULA 1QQ6A 4ENTA 3D7NA 3F6RA 3LSTA 2Z6AA 1PK8A 2HBRA 1BXZA 2F8SA 3A1NA 1EP2B 1GRRA 1DXHA 2ZSUA 4XR4A 4EX7A 4OJNA 2R86A 3BMCA 4KLCA 4ZCMA 1JQDA 2O2XA 5ALXA 1W4CA 2Q5HA 3D59A 3FCXA 1MC8A 2WT4A 4ZRMA 1CUJA 4MWTA 3ZCRA 5ALVA 3OE1A 1RLUA 2REQB 3EXEA 2OV1A 3Q7PA 4B47A 2Q6IA 3RVRA 3TQCA 3K09C 1KZHA 1FXUA 4CV1A 2OLEA 3E7WA 3DF7A 1E79D 4OFZA 3UJPA 1GRCA 1NNUA 3FAZA 1C2TA 2GA9A 3AL3A 1SCQA 5DCLA 4J1TA 4MQBA 1ENOA 1TCUA 4A2PA 2F59A 1R6AA 3H97A 3H99A 2XSZA 4HWKA 2HBZA 2FW6A 5EFOA 3I2FA 3AERB 2EBUA 3SYRA 4BO1A 2P9JA 4PGMA 1TNDA 2XXJA 2A94A 3BBPA 5LQJA 1USUA 4PAGA 4OXKA 1JILA 3OIGA 2FZCA 3IALA 3Q87B 5DIFA 4DOMA 3ZDFA 3ESYA 4YV2A 2XCOA 2LIVA 5JMPA 3IQHX 5HOEA 1KAMA 1XK6A 3HU1A 5DV9A 5DM70 5CFPA 5AP9A 4DLSA 4BJ3A 4PY2A 2PR7A 3V7UA 1J8YF 2Y77A 1Q1EA 1P61B 3DL4A 3GDWA 5CGZA 2R79A 4MW7A 1QGAA 1BMTA 2EP8A 4QXRA 1M0WA 3AH8A 4MW5A 4AC9A 3ICOA 5JQGF 2JW5A 1QIFA 3AIIA 4HFNA 1VOTA 4QBTA 2YY7A 5EP4A 1YS7A 4PTYA 4A03A 4BC1A 2AEEA 4BFYA 5K99A 2M98A 5C32A 2WY2D 2MMGA 3I3OA 10MHA 3FGOA 1N5MA 3NRCA 4F9FA 2AZMA 4HAUA 5F1YA 2P2ZA 1SQGA 3ND5A 3HN2A 3PGXA 4WINA 4F1JA 1TT5B 2ABWA 3HDVA 1CRPA 1CLUA 4XQEA 5T5QA 1W36B 4E1VA 4ISBA 1GFSA 4DUYB 3ZJUA 2PUDA 3HTXA 1ZL2A 4BFXA 4YCCA 4OOEA 1IJFA 2EYQA 3BXZA 1LS6A 3W6UA 2MINB 3SP1A 5KX5F 4F92B 3C5WP 3MW8A 1ZSVA 2SCUB 1QGOA 1KI4A 2VP3A 3W34A 4F1KA 4JJ4A 3ZW7A 3MTQA 3TQSA 4Q24A 5ILGA 1FXSA 4AN0A 2UVQA 2JJ2D 3Q9SA 1PWZA 2GTIA 2MJLA 3OZEA 5TMEA 3RE1A 4EY5A 2YN0A 1OU0A 1GL6A 3HCRA 4ZI7A 2OC9A 5F7JA 1GZUA 2BBSA 1RYDA 3BDAA 3OM8A 5DNEA 1TZBA 2NUTA 4CV0A 1RI2A 5KWVA 4YRRA 4HSEA 1CTQA 3E1GA 3QXGA 4OIFA 3EVTA 3OJFA 4ES6A 1XU9A 3FB4A 2JHPA 4MUMA 1L4HA 3PQFA 4F3TA 1H6AA 1AQNA 5EHIA 2ECQA 3JQAB 4FINA 1UP7A 2X7XA 5HXAA 3TLGA 3RAJA 3IXMA 4NKRA 1THMA 4GE3A 1XZMA 2FE4A 3ROPA 1TZJA 2OUIA 3EWIA 5IMSA 4JCOA 4KRXA 2IUTA 1N0UA 4WLNA 1OLUA 3HKCB 1KYIA 4EJSA 3ZI0A 4TTTS 2PH5A 1Z45A 4ZIRB 1D9ZA 1JMYA 1K7SN 1QWSA 4MVJP 3SQOA 3PICA 2JCBA 3CS3A 3DWEX 4YDRA 5HKOA 5ITSA 3UYKA 1U04A 1WKVA 2QYSA 1H3NA 2Z0MA 5ARDA 2WNHA 3KQSA 5DDIP 3ER6A 5KPDA 2IS6A 1FPQA 5FFNA 1L5FA 1ODLA 1X70A 3ZKWB 5IZCA 4OQQA 5C4GB 1QK4A 3UOAB 2JKZA 3S2ZA 3T34A 3QIAA 3B1YA 4LN1A 2VI5A 4BV9A 1DTEA 1V2HE 2C5HA 1UK6A 1VI6A 3IP9A 1NBHA 2IPXA 1WCIB 1W96A 1AXEA 3KKQA 4R2LA 2QGZA 5DNVA 3RTBA 1YDFA 2BI7A 2GDJA 3AVYA 1T6BY 1P0QA 1R5NA 3WLIA 2I3AA 3U3OA 2ZTLA 4IGFA 2XRFA 3IRVA 2QMEA 5D5PA 1SIWA 3THSA 5BSTA 2WG0A 4HQ6A 1KKUA 3O2JA 2Q9AA 3RODA 3T5BA 3C6KA 5ADUS 1H6BA 2JGJA 2JJ1D 4KK3A 5KZMB 1E5TA 2Z6QA 3RRBA 3O93A 3PEYA 1F6DA 2IK8A 1NP6A 2OGSA 3IOCA 4ZWNA 5H59A 2VHEA 4ZMBA 2Z2JA 1X38A 3WMEA 3ILHA 1V8PA 3M4XA 4OK6A 1OWLA 1DU4A 1JU4A 4BAZA 1A04A 2CB0A 2GB4A 2W43A 3O2SB 5AM1A 2FPRA 4CU2A 4NNOA 3MHPA 3D4NA 1KORA 3EF1A 4EFKA 2CUTA 3DTNA 3ICQB 4UBOA 3MOGA 4PQGA 3ZQ4A 2N1MA 3NQ41 1EX7A 3CURA 4RZXA 2JKVA 1PNQA 1T0PA 1FRNA 1THGA 3B7PA 2YWBA 4OJMX 3D2CA 3CTMA 3BL6A 4GMDA 5GGXA 4JI2B 1W48A 3RS5A 2X1HA 1YFKA 5DHFA 3STWA 1M7BA 2WJVA 2D2XA 3C7AA 4J7XA 1ONSA 4NCNA 4AIIA 3HPQA 4R8VA 3BH7A 2MDTA 4IIFA 1KDZA 3H8SA 1WE2A 3NGLA 4LSGA 5FNVA 1HPLA 4X91A 1ADYA 3FNQA 4GOJA 4W5WA 2O3SA 4LA4A 1S2DA 4NQZA 1QHFA 3PHJA 4XQ0A 5B58C 2DOKA 4WH0A 4RA9A 3EZ6A 4OI1A 5TQ2A 3ROGA 3CNQS 5IASA 1FNBA 4P4GA 3FLEA 2XMZA 1C8LA 2G9QA 4PHGA 2HC9A 3FRHA 1KA9H 2OHIA 3D4OA 3JVUA 3OIDA 3EGXB 2OVFA 1N57A 1SVNA 4NJMB 3PXXA 3GJYA 4IXDA 3TZEA 1NYTA 4PAWA 5DFAA 5BO5A 3UXHA 4ND4A 3CJTA 3G9TA 4MR7A 5CHYA 5DW0A 4XLTA 1ZUHA 2D5IA 4ZYVA 1E2KA 4NULA 2O5EA 1JLSA 2OP0A 2IUUA 5KHLB 1Z2PX 1H69A 3UB4A 4NH0A 3LNCA 3DTVA 3K1JA 2OGUA 3A3PA 3NB0A 4P3NA 4DZZA 4QWMA 4HOYA 1EGAA 4V3BA 4QU9A 1LTQA 1YB5A 2JHAA 3AESA 2OA0A 1FJGB 1ODIA 1B3RA 4DRYA 1UC9A 1KYVA 1VE3A 1B15A 2F1IA 3G2JA 4PCAA 2O14A 2X5NA 4BWGA 2D5BA 5J58A 5HS6A 3QKSB 2DTDA 1X9IA 2WM8A 4UPDA 5F35A 4MB2A 4UASA 1T1JA 1JIQA 5ELLA 4AECA 3GJ6A 4UULA 1SQ0A 3SQDA 1EINA 1SN7A 4CDGA 4M36A 1X80A 4IVPA 3TLAA 4MR8A 1XAIA 4X94A 1I2DA 3KTAB 1M1XB 4FK8A 8GPBA 3K5HA 1UWLA 3DAGA 3LM8A 5JNTA 1XTIA 1F8GA 3DR3A 2FN4A 3LUAA 4RK7A 3EEIA 4L8LA 3RS9A 4CQMB 3CUUA 2PUCA 2IZZA 3TBKA 1UPXA 1IULA 4KXFB 1H2WA 2Q3DA 1O3YA 1X1BA 4BZPA 1WHSA 1S2NA 4Z9AA 1ZVKA 2VTEA 4DLBA 1VCNA 1F2DA 4CF3A 1EK5A 3IT1A 3MC1A 5FBHA 3ETNA 2JGNA 3ZD8A 4E5YA 1SVSA 5HFJA 2DY1A 2FX3A 2FN9A 1RHKA 1HSOA 4OATA 5T8KC 3WNZA 2HKIA 2WEKA 1DDIA 3AB8A 3A3YA 5TMDA 7MDHA 1P29A 2R7AA 3INTA 3WAKA 1CDEA 3KKNA 3MWFA 1BH6A 2IV2X 3UBTA 1MV5A 1QZ3A 3VTFA 3AM4A 3ENNA 2BPOA 2ZVPX 1Q17A 4J1QA 4NYMQ 5HA5A 5E7MA 5KVAA 1XUOA 1JHDA 4ZI5A 4Z3OA 3EQZA 2GF0A 4RH1A 2C9YA 5EWLB 4KAJA 4OBXA 4XM1A 1JJIA 2XNJA 1R7RA 1M10A 2QJWA 2YOGA 3AF2A 4EIWA 3WLQA 3EHDA 2RHHA 1CY4A 3U3ZA 3HDQA 4AM8A 4COKA 3P5SA 4GDFA 2J3MA 5ED0A 3HNRA 4AN4A 3AQIA 3PEEA 4K6HA 4UFOA 1GITA 1KGDA 1UQRA 1WABA 5DYGA 4KPGA 2YC4C 3PLRA 3H0KA 1ODTC 5LOVF 1Q1GA 2NO1A 1Z3CA 4EF6A 1FQWA 5AM3A 1GUBA 4ZQCB 1CNFA 5P8WA 3TZBA 1AURA 2H8KA 2P91A 3MK31 4RTRA 4BXOA 2W6ID 1C1DA 2CF6A 3SX4A 3TM5A 1H0RA 3LP6A 1IOVA 4LGVA 3ZWCA 5EWJB 2QTLA 1G7TA 2VYCA 2ZFUA 1XJ5A 1P62B 5C80A 3UJ7A 1R1DA 2KI5A 3QPUA 4UBNA 1SOVA 1E62A 3S1AB 3VX3A 4RHCA 4OQPA 3IP3A 3T15A 4Q4JB 1Q12A 2GM3A 4BRUA 3NX4A 4PYJA 1Y9JA 4ZKDA 2IE8A 2FW8A 4WCFC 1EBUA 2M6RA 4BO5A 4ZHQA 3WKCA 3U6KA 1TU3A 1DBSA 3GEBA 3M2TA 3N39C 4CG0A 2K7FA 4L75A 1PIWA 4CL8A 4D97A 4TXNA 3AR7A 1IPHA 5THQA 1KXZA 4MK4A 1AMNA 3DLTA 4JYZA 2RK6A 2HJHA 4UVDA 4ZYYA 1FU7A 2X58A 1SZJG 5AOVA 1N9GB 2JKYA 4NS1A 4BGUA 2B7BA 5FPKA 3LDFA 1YQXA 3JD3A 3LX5A 4PN3A 2C7PA 2VAWA 4B8WA 4WK6A 2JGEA 3MTJA 4XE5A 4YRNA 3WDLA 3LECA 1JIUA 1PT6A 3B1FA 3OY2A 4UTPA 3UJNA 3MSXA 4MLPA 1U98A 6REQB 5JSYA 3AFNA 4MDFA 3BXFA 4R9RA 2QE7A 3VAYA 3LPMA 2PKXA 1ZO8A 2PSFA 4ITUA 5FWYB 1T91A 3L7JA 3TPCA 1H1LB 1W1UA 5EZ5A 5EIBD 3KZNA 4YPVA 2JFBA 5FXMA 3W5JA 4DSNA 5JJIA 4MB6A 3EEFA 4RVOA 1C8VB 4QODA 3KCNA 8LDHA 1HEUA 1QGDA 2JFYA 1ZJJA 2PCJA 3PUWA 4WOKA 1YRYE 5ERGB 3INRA 3UQZA 4A6PA 4A2WA 3TW6A 5BWOA 2NZ8A 2EKLA 4CLHA 3THXA 1TFUA 1UCFA 1BJRE 1Y34E 2CMFA 2H5LA 4KWCA 4RAQA 3SBOA 3W8RA 2QUHA 1USIA 3WYGA 3GP8A 3VKWA 1ST3A 2BUAA 4OBBA 3A0RB 4XGIA 1ULSA 2BFOA 1KYXA 2R6HA 3KU1A 4XGKA 3V2HA 2ZR0A 1RRPA 3C2QA 3C8HA 1MJGA 3HFGA 2D00A 5E7IA 3W1VA 4CTKA 1DUIA 3CXRA 3H5WA 2FDCA 4DB2A 4AKIA 2QG6A 4L50A 3TLKA 4IO0A 4B6EA 1CR2A 3F47A 4G4IA 4RJTA 5LR6A 2WJHA 2XWSA 1CUVA 1CZUA 4MYHA 1VI5A 1X7ZB 3GN2A 4E46A 3RNLA 2QL6A 1TEVA 3ML1A 1UM9B 4HNQA 4HVAA 1LBHA 4UMVA 4WLUA 3FNHA 3OX2A 4WNCA 1SXJD 3TW8B 3KLMX 4ZCIA 4MDHA 6CHYA 5A5GA 3WIVA 1DJMA 1I4DD 2JZCA 3E9CA 1KI6B 5JRJA 1UBSB 1YQQA 2PRZA 4I50A 2VHXA 3M4ZA 3P0RA 3LQRA 4G86A 4PLGA 3ZE8A 1KK0A 5KQLA 5FOSA 2JD2A 3M5CA 2FZVA 4S24A 4CGYA 4W5OA 5DTIA 3DYIA 4HWOA 5ECYA 1NDHA 1QIDA 3AY3A 3I53A 3I8XA 4ENRA 1ZR2A 2M6SA 2DHRA 1EJBA 2CMHA 5EUBA 3TIXB 1DIBA 5C53B 4RY0A 3MPUA 1SHLA 1T3LA 1S2OA 4QEKA 4ZVVA 1LD3A 3P94A 4B3BA 1TKCA 3EVCA 2WWHA 4TUYF 3PNOA 3LXMA 1U5BA 5LXTB 1JR3D 5P21A 4AG3A 3PDIA 3IA7A 4JGBA 4LF5B 1QG6A 1JPUA 4ETMA 3OPYA 4BNXA 4DIOA 1TYBE 4XIYA 1U9IA 1WQ4A 1EDBA 1LXCA 1Y9DA 2JGDA 3L8ZA 3OJEA 4URZR 4V0KA 3FN4A 3NPMA 4B32A 2UVPA 1V0JA 3ELYA 3TLMA 3UMFA 2W5UA 1KERA 3CZPA 2DKOA 5EYPA 5TSDA 3ZYCA 3CE9A 3CR3C 2X7JA 1TLFA 4NG5A 3M0EA 3UUEA 2BTQB 3WFIA 3OP4A 2Z3ZA 3PRHA 2JFVA 1DIRA 1OA1A 1QJ4A 2GD6A 1T5TA 3O31A 5CCBA 3WJAA 1R10A 4QTTB 1UFVA 1QKJA 4PGGA 4BNMA 3NDRA 2B30A 5EJ4A 3FSGA 1FUEA 1MAWA 4PQYA 1BEZA 1NW5A 1B41A 4RIHA 2XNDD 1ZVMA 1ETHA 4FEEA 4OUDA 3HZRA 2ZYIA 3KQWA 1BGWA 5FAXA 3O7WA 4UU8A 2VRCD 1C30A 3AG6A 1VHQA 4RJ2A 3NT4A 2VEOA 3WBFA 3ZLBA 4CMCA 5C8DA 4JDUA 3CRMA 3GPLA 2C7QA 1NJGA 2NTJA 4BB9A 4RHYA 2G88A 5EFZA 4KLAA 1HFWA 1BU8A 4QOHA 1YU6A 2YFQA 5LZ4A 4P3XA 2A35A 2ZROA 4GD3Q 1CHNA 4UBLA 5CYPA 3K6SA 4MDEA 4UUAA 2BKLA 1ODJA 3M9WA 3JVDA 3WYAA 1CZLA 4XDGA 5FBKA 2VWQA 4Q15A 2PSHA 1Y98A 2DGDA 1RE0A 3C45A 3GQVA 4RK5A 1E1KA 4YCJA 1C3JA 4BWVA 2VK1A 1ZX1A 1L5MA 3ADKA 4LJ8A 1RRCA 2V0CA 3L6CA 2PUWA 3Q9LA 2ZRJA 4TWRA 4X65B 1SKMA 2HW8A 3K70D 3GPBA 1A5SB 3PHHA 3T3EA 4FXPA 2PZEA 3I9OA 2BWJA 3DF9A 3IT0A 4IFIA 5TXGA 3FOWA 5IDQA 3FDIA 3U7FB 1UDBA 2AB0A 3B1ZA 3H1GA 1P45A 5M3BA 4F9GA 1NR7A 3BRQA 1QGED 1RS0A 1S6YA 4I5DA 3I5YA 1HC7A 3D2LA 3IR7A 5F51A 5IXJA 1PQ4A 3AK4A 3Q12A 2AS0A 2FZLA 3A6FA 3IHLA 3LYLA 4TT3D 3NVAA 1SIBE 4WI1A 4NYJQ 3W79A 1Z8HA 4U2EA 4CCWA 3FAKA 3I6IA 3ZWPA 3L6UA 2DHQA 2PZMA 4E2WA 4EG1A 5HBRA 1S9DA 2O20A 2VA8A 1X7DA 3AVPA 2PNFA 4GLLA 2JDIA 3PUZA 1KJ9A 4QOEA 5DO9A 2NSHA 1QDUA 3ZHXA 2FUNB 3TB4A 5K03A 4UE6A 4X71A 2V7QA 4ROTA 3G0OA 3IIIA 3U4CA 1XPOA 3PITA 3WP0A 4FNOA 1DFHA 1R6UA 4DWJA 2AMJA 4QFCA 1DBWA 3G9QA 2XUOA 1BFKA 3U5ZB 4MJ7A 2PS9A 2IH5A 4OIMA 2ZYHA 3ZDDA 3EF3A 2O07A 2QN9A 3KJXA 4AJLA 1RAAA 4L3VA 4PPQA 4XVCA 2IQ5A 4JUDX 4I1YA 2IYOA 1IWBB 4OL0A 4UE3S 4X6UA 3LXUX 2CLHB 1EXNA 1PJZA 4LE0A 4YP5A 3NC4A 3FNFA 1RACA 1XZ8A 2HY7A 4NQRA 4Z3KA 1GYRA 1WV1A 4ESOA 3FOAA 4OM8A 4IJ6A 4DIUA 4QFDA 3H1PA 1HYHA 4Z0TA 2O0MA 5IX8A 1AGRA 1NI5A 3I28A 5A4FS 1U3WA 3QNMA 1G2PA 2B0CA 5CLIA 3VTZA 4XOUA 4UDNA 2H4JA 1O9HA 5K4HA 3KHSA 1VMDA 4GPD1 1GN9A 4OCZA 3OPYI 1JVBA 3BPSA 3KUKA 3Q3CA 3UT5A 3YASA 2P2SA 1PHRA 2G09A 3DKPA 4IDHA 4AF6A 5IDXA 4P7KA 1TX4B 2AHOA 2GD1O 5E6SA 4MGYR 1F6BA 5JNWA 4HDMA 2NV2B 1G7CA 1O5IA 3FLMA 4GSKA 4LECA 4P32A 5IM5A 4BTVA 4RTMA 1XDUA 1OSNA 4YEDA 4XRGA 1WUIS 3W5SA 2BDUA 2FHSA 1OR8A 1HMPA 1N6NA 3HH8A 3DDWA 4N6GA 3TVTA 3QY0A 4QU5A 2IF0A 2NUTB 2PRJA 5JQGA 4RGBA 1VPVA 4WZAA 1KEPA 3EOAI 4EPTA 2Y0EA 3HCEA 1VLZA 5EI5A 3LDAA 2GN1A 1J2EA 2GWRA 4ML3A 2PHZA 4YMGA 1RYEA 2NM0A 4CMAA 4FFRA 4GOLD 4PQFA 4QEDA 5FTJA 5AVXA 3AY0A 1P6QA 2RC5A 1I2MA 3TLGB 1T1EA 5FI3A 4TT8A 4RWZA 1S7CA 3N2EA 1YONA 3HYNA 3SJCA 4LDRA 2Q0SA 3TGPA 1B6SA 1OLUB 2IOQA 1FLDA 4C1BA 2FMXA 2Q1XA 5KX5A 3GCGA 5DRTA 1XRRA 1NGSA 4HLQB 4RMJA 3ZVRA 3T7IA 4GW3A 2XZLA 3PI7A 5HKKD 1PLJA 1ZUNA 2ATXA 4I0WB 1OIVA 3OQMA 1WCXA 1PYOA 4HUQA 1Q11A 1N5DA 1POWA 3D4LA 1NNLA 4JLKA 1IB0A 1ULTA 4K9NA 4XOIA 3RRMA 1PP4A 2PMBA 1V6SA 3KR1A 1R5JA 3QLUA 1TQDA 2GZRA 4KN9S 2Z04A 4LQ4A 4DADA 1P7CA 1EWVA 3R3XA 5KHOC 2E1RA 1QYIA 4L5YA 1N9ZA 5A3QA 4OH7A 4QYMA 3GC6A 1Z16A 1P2TA 3B36A 5J2TA 1DV2A 3VU9A 5AHRA 2GN8A 3IP7A 2ZEJA 1JSCA 3MNFA 4MYTA 1NMZA 5H1YA 2HJRA 2VHWA 4FEYA 3Q8MA 2HT6A 4JMPA 1SVUA 3HWX1 3QU2A 3UXEA 2QXYA 2BGUA 1UQTA 1GNPA 1B1AA 1Y6QA 1BE0A 2NNWB 3O3MB 3Q8XB 4QXAA 4V0LA 5EIFA 3VR6A 3W4KA 3O1HB 4BO8A 2FF7A 1CW2B 1ZL0A 1WQ3A 4KDFA 3CMMA 4LTNA 4D9FA 4DNQA 1AO0A 1PJAA 2GVZC 1VGRA 3CISA 4CKBA 1D6MA 2CC2A 2RAVA 5FCDA 1XE3A 2NQTA 2ILTA 4IINA 4TGLA 1A71A 3ETHA 4Z51A 4X6XA 1CFJA 3B85A 2JH8A 3TFOA 3LKZA 1RQXA 1TW2A 1AMUA 1E2NA 2OCPA 1J0BA 1BGXT 1R4NB 2AEFA 5I4BA 2OXRA 4CMBA 1V43A 1ZWKA 4WRRA 3OTWA 1BOOA 3K0AA 1A0OA 1YZFA 2DKFA 5A9SA 4BLTA 3P9SA 1OU4A 2FPOA 2PV0A 3KJGA 3LGXA 4YAJA 4RAOA 1EPUA 1T15A 3CLVA 4ZK6A 1P4HA 3O82A 5CYFA 1XRJA 4K6FA 3CB2A 1TQ6A 1NXVA 3PF8A 4LMRA 3TSAA 1QR6A 5FNVB 1X8KA 3VUEA 4MLCA 1XP8A 1YF3A 3PSAA 1TL7C 1PX0A 2RI1A 2AOWA 3UAGA 5EQTA 4Q19A 4FS3A 5GZ3A 3HXOA 4RA9B 3GLKA 1VL2A 3CY6A 4F6CA 1RRGA 2I4MA 4EY7A 5TQ2B 3IVAA 2JCYA 2PLNA 3SZGA 3C1TA 4M2LA 4X9XA 2AG0A 1W25A 2H7VA 3DFKA 1UDRA 1XXHE 2FEOA 4UMFA 3VBEA 3GVPA 4BKPA 4DCOA 4DNOA 3FW1A 3RPEA 4HSGA 1IXRC 2B98A 2VL7A 2E2WA 4PX2A 1FUIA 4YAOA 3GNTA 2PUVA 3F6BX 5F1KA 3W2EA 3E8MA 3OCYA 5TE9A 1Y7HA 1HNNA 5KOYA 4DDTA 4AF8A 3L1UA 3B7WA 3E15A 3BGWA 2JBHA 4BBPA 1UPUA 4R01A 5B55A 3LMKA 3WQQA 2H7YA 4F2WA 2H9IA 1I10A 3KE9A 1W6UA 1L1RA 3DTVB 3HV0A 1FVHA 3QNUA 1R6TA 2B61A 1XX6A 1SJ9A 4U0JA 4U7WA 5KQMA 1LSSA 3AESB 1JLKA 1NVMB 2YYYA 3VOAA 2JEYA 5MF6A 2OVBA 2DLNA 2I6UA 5HF8A 3UK7A 4TPKA 1WSDA 4XXHA 5TV2A 3SC2B 3AIKA 5EIBC 4KR6A 3G79A 1TIKA 4X45A 2PL9A 3PQ8A 1AK1A 3LNTA 4O2BF 1HZZA 4IH4A 4QG7A 2PRKA 4GQIA 3UWMA 5E2IA 1GFIA 1I6KA 4J75A 3WLHA 2IIBA 4MR8B 3FOFC 1GGKA 4FM9A 3TS1A 3UJBA 3KVYA 3N2GA 4ZO9A 1G3RA 2GZHA 3AO0B 3ESAA 3L1JA 1FU8A 4LYDA 1TCVA 1VA5A 4DJEC 1GARA 3QVVA 1OVGA 1B0PA 4FSHA 2KX7A 3VR5A 2ZUBA 4ND2A 5BR4A 1FP2A 3RADC 2WDPA 3D64A 2ES4A 2CDCA 2AE2A 4X8MA 4UTOA 1DHTA 3GJSA 4G0VA 2F00A 2IYNA 1R0XA 4HXFB 4OQMA 1NWHA 4LQLA 1WHSB 2EKZA 5CT6A 5FHQA 2QB5A 2GNPA 3Q5EA 4JLMA 3ZD9A 1JQBA 1U7PA 4IR7A 4G8BA 2Z57A 3SSOA 4G1UC 4KXXA 5CIQA 3NYIA 1T5SA 1SXJC 3GFQA 1WO8A 3B5EA 5LKAA 3FBWA 3NONA 3U7EB 2P9YA 1OFGA 3FCOA 4G67A 4MQ5A 4U9HS 5IAGA 4I5IA 4QT4A 4IHJF 5HKAA 5I6DA 2LP4Y 4RTJA 2ZULA 3CSDA 2H16A 2W2XA 2GT1A 3JY6A 3OZXA 3VNUA 4FDAA 3ZGVA 2GERA 2EJCA 3DMPA 1XQYA 3DBHA 1ZD9A 5TS3A 4I8IA 3MS4A 5AESA 3AOEC 3MCWA 2P9QA 1TA0A 3FM9A 5KDOA 2O8BA 1DRVA 1AXGA 4MUFA 3T94A 1Z7YA 2ADOA 1SUDA 2E87A 4QSHA 3WY9A 1KMQA 2AJ8A 3W2IA 5A2QA 1QOPB 1KVTA 1U81A 1D6SA 1RNLA 1V6AA 2MOKA 2YY6A 3BWVA 2PGJA 4FLMA 2VJKA 4JB8A 5AXAA 2I1LA 3QE9Y 2VRNA 1SUFA 2JLRA 3JATA 2Q3MA 4KVFA 2C3UA 2ZAOA 3U4IA 2JHFA 1JV2B 3DVSX 4PS1A 1PJ4A 1ZQ1A 2PXXA 3KKOA 1V25A 2QUBA 4O4LF 4A1OA 1XIVA 4X1IA 3TWOA 4C5CA 2ZE7A 1LWNA 1WXFA 4BXOB 3LWDA 1C1DB 1R5OA 1JJFA 4RZ2A 1Z22A 2ZREA 3E2PA 4D82A 1B6GA 3FRJA 5EHZA 1ZSNA 2DAPA 3IHWA 5LNK1 2HREA 2WILA 2WSSA 5JLJA 3QV2A 4KFCA 3Q3IA 2HMTA 2WF9A 5ALPA 3FJYA 3D8UA 4C6RA 1V8OA 5L7TA 2VT7A 4PC6A 2PFGA 3C43A 2GK7A 4MRMA 2GAOA 3CVYA 1B23P 2HCRA 1G19A 2W4QA 4HXYA 4FKZA 2IYPA 821PA 1GM5A 2EGGA 4J0JA 3I58A 1WUJS 5DGIA 5JBIA 1HM5A 1URPA 2D13A 1UZLA 5K6TA 3ZDQA 4HYYA 3GUHA 4ZHQB 1BQ4A 1UL1X 4P80A 1TK9A 2LPMA 4R3NA 1F2VA 4KOEC 3W2TA 4DWVA 5BR8B 4TS9A 4UCWA 3H3XA 3TTVA 2QN8A 1KJWA 2OP1A 4WQMA 3I9JA 2XZOA 4E2ZA 3VNSA 3KOXA 4DMKA 4EK9A 5JCPA 1G20B 1AGNA 4JC8A 4PTLA 5CDYA 3HEAA 4M37A 3OLVA 5JE8A 3QF4A 5JY6A 4DLKA 3R76A 5KTOA 4G26A 4MV5A 1L5HA 3ILSA 1NNI1 2FQXA 2IT1A 2QX6A 3WK9A 3W5DA 4J76A 3OO1A 4EKYA 1DMRA 1ODFA 2CUKA 3C6YA 4CG2A 4YUXA 5IULC 4P34A 4OLBA 3JWPA 4QE3A 3ETGA 3V2UA 4U2BA 5IAEA 3FDFA 2X9NA 2ZTHA 3OCUA 3IQXA 5IC5A 4UMEA 3KP1A 3UHFA 5B3KA 1DOAA 2B78A 4OOFA 1MCZA 4QYTA 4D8TA 3GG2A 3D8RA 4GMXA 2P0AA 1HI9A 5DF1A 2VS1A 5DISB 3AVVA 1EHIA 1S8OA 3D7MA 1U8AA 4CFZA 1ZFNA 3PDHA 4POOA 2D1FA 5KOHA 4NYMR 7MHTA 3HJUA 4B40A 3Q9UA 5CAEA 4RTQA 2NV0A 1L7EA 3BWXA 4S1NA 4LC9A 3THXB 1K7EB 4E08A 5CB4F 2IBMA 4FU0A 2AD5A 2Q8PA 2BGLA 1LI4A 2VWPA 2WMOB 4MROA 4TMKA 4E5UA