3CTMA

Crystal structure of a carbonyl reductase from candida parapsilosis with anti-prelog stereo-specificity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
277
structure length
272
Chain Sequence
GEIESYCNKELGPLPTKAPTLSKNVLDLFSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIVQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl Reductase
publication title Crystal structure of a carbonyl reductase from Candida parapsilosis with anti-Prelog stereospecificity.
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 92
structure length 272
sequence length 277
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.-:
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ctmA00
1ULSA 3FWNA 2PY6A 2H5LA 2VT3A 1I3NA 2EHDA 2V6FA 1ADBA 3FNHA 4WCFA 2VWQA 2EKQA 1XG5A 1A27A 1C1XB 3DBLA 5F1OA 3P7MA 2NVWA 2AE1A 3E9MA 3GNSA 4PN3A 1EK5A 4IS2A 3H9GA 1SOWA 6LDHA 2QG4A 5AXCA 1LSUA 2YJZA 2IRWA 1H9BA 3PQEA 3OEYA 4PLWA 3TRIA 1MG5A 1G0OA 4UEOA 2D3TA 1D1SA 2JAHA 1PGPA 1GZ3A 3ANMA 3PHGA 1J6UA 3I9KA 4CM9A 4R51A 4XRRA 1SBYA 3ADOA 3BAZA 2CZCA 2NU7A 1LU9A 1GZ6A 3F5SA 4MIEA 3DBVO 4UVIA 3GEMA 5IFLA 3NGLA 2CF6A 3OQ6A 2ZTUA 4A03A 1R16A 3BTSA 1HSZA 4U6QA 2C82A 3TPCA 2FSVA 3DWFA 1YWGO 2EG9A 3CMMA 4S3MA 1JTVA 1S6YA 3I5MA 1PS0A 3BXXA 4N54A 4BNTA 1HDRA 2VZ9A 4AL4A 2Y0CA 4YJHA 1LTHR 3PJGA 4CM3A 1PTJA 2WSBA 3VKVA 4IMRA 2X8LA 5FF9A 1SB8A 4A7PA 4OOEA 5B12A 1KERA 3ZI0A 3UAGA 1A7KA 1M75A 5DZSA 4INAA 3RCBA 3L4SO 3SJUA 2YY7A 3ETEA 2E48A 3RUCA 3JV7A 5IXSA 1JQBA 3E6AA 1H6AA 2NVBA 3K31A 1GPDG 3NYWA 1SOVA 2NSDA 4QFCA 4BNWA 1OAAA 3HN2A 2OMEA 4WLUA 4BV9A 3OIFA 3I4CA 4PVCA 1EQUA 4RPLA 3JD2A 1UDCA 4U6SA 3U9LA 4E2YA 5ICMA 3FF4A 2HRZA 1ZEMA 4XQ9A 1VSVA 2SCUA 1XIVA 5F3RA 5B37A 3D64A 4R01A 2HK9A 1NVGA 5H81A 2FPGA 3HFSA 3WQRA 4O59O 1EVZA 3ONEA 3ZU5A 2PTGA 2O3RA 3ZHBA 1Q0LA 1LEHA 4ZA2A 4D3SA 5EESA 1DAPA 3W8FA 1YGYA 4BO1A 1X14A 2O7SA 1RYEA 1CF2O 2I99A 4MKRA 5LCXA 4CMEC 2FOIA 2I3AA 3W1VA 1EUCA 3JD0A 3H9UA 4MVJG 5TGDA 5JAQA 5BNFA 4Y67A 5IXYA 1C0LA 1VJ0A 1P31A 1TT5A 1V6AA 3U4IA 4FFOA 4CQLA 9LDTA 3JQBA 3WGQA 1VPDA 4J91A 4YQZA 1BXGA 4PG7A 1T4DA 2A92A 2CVZA 3JYQA 3K5PA 1Q0HA 4M89A 3EK2A 3OJ0A 3JTMA 4YXFA 3GC6A 5I7EA 1GL3A 1UR5A 1WXDA 1QYVA 2ZTLA 4GWKA 3RUAA 1PJCA 4Y98A 3WIEA 4DREA 1EVIA 1I10A 4WJZA 4WPGA 3LQFA 2AQHA 2C5EA 2WE7A 3OM9A 3NTRA 4UVEA 3GLQA 4DC0A 2V7PA 3H8VA 4PLZA 4DPLA 5L7TA 4LCEA 2VRCA 4H3VA 2OFPA 4F45A 1YO6A 1EDZA 3B20A 5A9TA 1T26A 1P1IA 2P2SA 4XQCA 1CJCA 1Q1NA 4RVSA 3AY3A 4DBVO 3OFSA 3NDIA 3ROMA 1IHXA 3PQDA 4CMGA 1UZLA 4J9VA 5TNXA 3JQ8A 5IAAA 1Q7CA 4CQMD 1KEPA 1CDOA 1NAHA 1TT7A 3BYZA 4BNKA 3I9MA 4LISA 4NK5A 1T24A 2AEMA 5ES3A 5DCWA 3JQ6A 1B2LA 3TZ6A 2O3SA 4L8VA 5ENDA 4E5NA 4HWKA 1ARZA 2NACA 2DAPA 3TOXA 4E3ZA 2ZK7A 1C1XA 2HU2A 3JYOA 3TFOA 4NMHA 4TROA 4P4GA 5L51A 5EPOA 2GGSA 4ZHSA 1QYDA 4TWRA 5U1PA 4ALLA 4BMNA 1L7EA 3FCOA 4IJUA 3RUIA 3I4FA 1KOLA 3LDHA 2HRBA 3OETA 1SZJG 1A4IA 2HMWA 5HM8A 2VNSA 2EP7A 3ZNOA 4CJXA 4KP7A 4DRYA 3DFUA 4RDHA 4R9RA 4GGOA 4D45A 4BIIA 1ISJA 1SB9A 3S55A 4WLEA 3RU9A 4MP3A 1GTMA 1OOEA 4NJMB 3HDHA 2AG5A 2X23A 1HF3A 1T1RA 2VT2A 2NTNA 5CPFA 1I36A 2Z1NA 2DU8A 3SX2A 5COBA 4W82A 3GG2A 2GLXA 1NWHA 5EQDA 2RBEA 5ILGA 1E3LA 3C7DB 1OC4A 5L4LA 1U1IA 1YDEA 1ZSVA 2YQ5A 1DC6A 4WLVA 1DFIA 1F17A 1X13A 4KOAA 2G0TA 5DN9A 4RZIA 3ZWWA 3DTYA 4CM1A 1QR6A 5FEUA 1PIWA 3QVTA 2ET6A 1ZXBA 2QW8A 2W4QA 5G0TA 3GNTA 3RWBA 5MGBA 4J9UE 3IMFA 3LC2O 2BGKA 4BO6A 1IOLA 2WEKA 2VUSA 3CUKA 4B4VA 4UUPA 3SVTA 4N5LA 3M1LA 3PLRA 2VTDA 4Y8VA 3IS3A 2B83A 2BGLA 1EQ2A 3GGPA 3E48A 4AJ2A 4CMCA 4J7XA 4CMAA 3O9ZA 2FHSA 5JDCC 1U3TA 2WYVA 1XR3A 4RF5A 4AVYA 4DYVA 1NFQA 2HMUA 2I67A 2VYVA 4HFMA 2IZZA 4TVOA 1NVTA 3CTMA 4UEJA 4DIBA 4W9NA 4U8GA 3Q2IA 2B5WA 3BHMA 1CEQA 2BELA 3PTZA 2HJSA 2J3HA 1EFLA 2Q4EA 3DMTA 5BT9A 5KVQA 2G17A 5HS6A 2O3TA 4OXNA 4XGNA 1WPQA 1NNUA 4C7JA 3HQ4O 4NNJA 4PLHA 4ZICA 4L76A 4MP8A 4XQEA 5KKAA 5LDGA 4CLRB 4ALJA 3KSDO 3EHEA 4XKJA 4CM7A 3UH1A 3G79A 4W99A 3MEQA 3JQGB 4FGWA 3O38A 1NBOA 1KEVA 1WW8A 1Q2XA 1C0PA 3AY6A 2YHUA 1Z75A 3FSRA 4CLOB 1GUYA 4LSWA 1A9YA 2EF1A 2QRJA 3IKTA 3DZHA 5ER9A 2AHRA 4IDDA 1ZJZA 5I9LA 1HDZA 3H7AA 1ADFA 2YYYA 1GQQA 1NAIA 4CLHA 3QE3A 3C8MA 2EKLA 4BQRA 5FI3A 1WDKA 1HYHA 3PVZA 3FR7A 5JBIA 3W4IA 2EERA 2PD4A 1F12A 2ILTA 3HSKA 5CHEA 2BFMA 2CFCA 1YVEI 4CLXA 3QRWA 4MKXA 4YAKA 4L4RA 4QXMA 2LDBA 2X7HA 4RF4A 3DOCA 4DLBA 1K89A 3H2SA 3MTJA 4HBGA 2VTEA 2OZPA 2A9FA 4ND1A 4XR9A 1I33A 2DLDA 4E5KA 1N5DA 4ZQHA 4BNLA 3MCVA 4J0FA 5TX7A 1FDUA 1WDMA 3DAFA 3OIDA 3TFQA 2B0JA 3WTBA 4XYLA 2WM3A 4W7HA 3OMLA 1UP7A 3WGGA 3RQSA 1YL7A 2CDBA 4O63O 4MVJP 4LMRA 2ZJ0A 4ZD6A 1Q7GA 2Q99A 1R6DA 4ZGWA 2AQ8A 3D1LA 4BNUA 5L9AA 1ZO8A 2EJWA 3I9JA 4JP3A 4IJVA 2VOEA 4EZBA 3BMNB 2G76A 5JNLA 1ZK4A 1R15A 2GRAA 1NXQA 5A06A 5A3JA 4EI2A 1PL7A 2NLOA 1QP8A 2PH3A 1DRVA 1YBMA 3WNQA 3V1UA 3NEPX 5KKCA 2ZB7A 2CUKA 1KEWA 4FJ1A 4QECA 1HLPA 1PU2A 1BG6A 1PS9A 1T2EA 5ER6A 2O48X 1T2DA 4BVAA 1LSJA 3PGJA 5COAA 4J1TA 1VL6A 4H15A 2CD9A 3GN2A 1QYXA 3DZGA 3KM0A 3KYCB 5KTKA 1TI7A 3GUCA 2AMFA 5L4SA 2JD1A 5JCJD 4DMMA 1EUDA 1BXZA 2HCTA 3GMDA 4MVJI 4WLFA 4PLPA 1ZXLA 3Q3CA 3HG7A 3IUSA 1T4BA 1G1AA 3WSWA 3AUTA 1HEUA 3UHAA 3UKOA 5BNIA 1YL6A 3UGKA 4UVDA 4RPJA 4AJHA 3VDQA 4R5HA 3B6ZA 3INRA 1KC3A 1YB1A 3FNGA 3ZHYA 4AJ1A 3MOIA 4OAQA 1GCOA 4CM9D 1QLHA 4YJDA 4AJLA 1D3AA 4BKOA 3DQPA 5U4QA 2Y99A 1LSSA 5GZ1A 1VKOA 2O23A 4J4TA 4CV0A 2P5YA 3HDJA 1HRDA 2EW2A 5C7IO 1KVUA 3FPCA 4BKQA 1M67A 4IINA 1K0UA 1CIVA 4BO3A 3CXRA 3DMYA 2FY8A 5JO9A 1ZH8A 1YBVA 3JQDA 1G6KA 1BSVA 3Q9NA 3VH3A 2VZ8A 4K6FA 3GHYA 3AM5A 1MGOA 1ISIA 1HDYA 4CV2A 4E2WA 1UZMA 2IE0A 4IJWA 5KOIA 4XR4A 1J5PA 1MXHA 1ONPA 3CH6A 5JAIA 4CLRA 4BHTA 2J6IA 3FD8A 3U5TA 2F1KA 4ONEA 5CEEA 1RYDA 3JQGA 4YT4A 3ZN2A 4W6ZA 4JGBA 4DVJA 4E21A 3KETA 2BHLA 3RC7A 1H2BA 4CLOA 1ZKMA 1PZGA 3L9WA 4RCVA 4BNFA 2QIOA 4TKLA 1EVJA 3JQFA 2JCVA 3L6EA 4B4WA 5KVSA 2FR1A 5TIIA 2O3UA 4PCVA 4E5MA 1VRWA 3LT1A 5IDYA 1HYEA 3ROPA 2I9PA 5GZ6A 3WSVA 1E92A 3CPSA 1ISMA 2J8ZA 1P1KA 3OSUA 5CG1A 8LDHA 3A06A 3VVCA 3F9IA 3Q0EA 5AXBA 4WE3A 3ZGYA 1C1DB 3DBRB 2DVMA 1U7TA 4HFNA 4BKPA 4E6PA 3X2FA 3GVIA 1I3MA 4OSOA 3NJ4A 3DBHB 4XD2A 3AI3A 4TZKA 4WOJA 1I8TA 3GH3A 1E5QA 5A03A 3ANNA 2OP0A 5KVVA 4CR7A 2Y1DA 1Y81A 2X0IA 1K6JA 1X15A 3KHUA 3GVXA 3TWOA 3WQQA 1Y7TA 1K6XA 3LZ6A 1HETA 2O3QA 5CG2A 4R1SA 4YTEA 3WLEA 4KDFA 2GNAA 2X6TA 3EVTA 1UDAA 3UICA 3ZU3A 1YBAA 2ZCVA 3QWIA 1UDBA 2P4QA 3TZKA 1YRLA 4MKZA 4DYDA 3NT4A 1UXIA 1LA2A 1E7YA 2RIRA 3FNFA 1CERA 3PK0A 5JLAA 3OJFA 3BMNA 3OQBA 1TXGA 1UXHA 1FDVA 1WP4A 4M87A 2IEBA 4R16A 2P9CA 4IMPA 4W7IA 1HDGO 5KJCA 1GR0A 3LC1O 2Y0DA 5L4NA 3T4XA 4OKIA 4I5DA 1O6ZA 2DM6A 4PZDA 1PGQA 2IXBA 1DPGA 2IDZA 4DPKA 2VYNA 4J4HA 2HK8A 4C7KA 4UUNA 4CL3A 4OJNA 1EBUA 4OH1A 1XHLA 3KYCA 3WNVA 3RBVA 4I9NA 3PJFA 4B7XA 2O50A 3WICA 3C7CB 2BI8A 2J3IA 5H82A 4EDFA 1P9LA 1WDLA 1EVYA 1J49A 1E6WA 2H6EA 3HADA 1U2DA 5JYDA 1KS9A 1IYZA 5ADHA 3C7AA 5A5FA 2AEJA 1GAEO 4GMGA 1DSSG 3E9NA 4E33A 4KQXA 4ND2A 4BO7A 4CUKA 3VH2A 3MWEB 2AQKA 2DFDA 1PGNA 1V3VA 3LT0A 2B35A 2VHXA 4Q3DA 4ZQFA 4AG3A 4CM8B 4IZHA 5L45A 1ISFA 3BIOA 2PZMA 2ZTVA 2Z95A 4D0SA 2Q1TA 3F3SA 3MJVA 3A28A 4Z9YA 5ICSA 1U4OA 2GN8A 4L4SA 1IULA 5L53A 3RSHA 3QJ5A 4WGGA 4MVJM 3HB5X 1WNTA 3WQSB 5KNLA 4FOOA 1E3JA 3V1YA 4DIFA 3EYWA 1YB5A 4HXYA 1DFHA 1TLTA 2VHWA 3QVSA 3R1IA 2P9GA 3JSAA 4Y6PA 4UULA 4GH5A 5BNTA 1NP3A 3G49A 2JD2A 4LRSB 4WASA 3RROA 4M1QA 4GQAA 3GDGA 3ASVA 3ETGA 4IQ0A 3CINA 2P4HX 3PXXA 4LVUA 1UUFA 3INGA 3MTGA 2I5PO 1E77A 3A9WA 3VPHA 4N7RA 1RM0A 2PR2A 2FMUA 1DJNA 4EBFA 2PK3A 4PIVA 2GR9A 1FDWA 3E5MA 3FBTA 4PLFA 3QVOA 5DF1A 3EMKA 4PGFA 3JQAB 5I7SA 1T2FA 3MJEA 3RIHA 2JJYA 3VZRA 2GCGA 3Q1LA 1WAMA 1LQUA 2GUGA 3EAGA 4WKGA 3UOGA 4YRAA 4WCFC 3ZNPA 4NU6A 4ZQBA 3FI9A 3RC2A 1PQPA 3JD1A 1N7HA 2FRDA 2YZ7A 5IJZA 4D3FA 2EWMA 1O0SA 4MO2A 3VC7A 2VYVD 2Q1UA 3VPGA 2HLPA 5AYVA 3IDSA 3K8ZA 4P38A 1RJWA 4XYGA 1SEPA 1Y8QB 2A94A 3ZHXA 2DUWA 3RUFA 1RM3A 2IEDA 2CVOA 1NQOA 1C1DA 1ID1A 3DBRA 4YT8A 1NR7A 3FTNA 4E31A 2UDPA 4DQXA 1U9JA 2NTVA 2UYYA 2UUPA 3GZNB 4KMSA 1ZK2A 2HUNA 3RASA 2GN6A 1YOVB 2XXJA 1PWZA 1C3VA 1P1JA 2VZ0A 3IP1A 3HNPA 5ITVA 1DHTA 2X9VA 2B69A 2POQX 3TL2A 1U28A 2B5VA 3TZCA 4Z3KA 1C0IA 4O6VA 3ZWPA 2H63A 2I6TA 1VE9A 4ID9A 1W6UA 4BKRA 4MVJH 2FR0A 3S2IA 1HLDA 4D3DA 3VPFA 3KLPX 4FC7A 3F4LA 4HP8A 5CPBA 4IXWA 3ZWMA 2IXAA 4JN6B 3EW7A 2D8AA 2DTDA 4I5EA 4Z3DA 2DBQA 2HAEA 1G0NA 4K26A 3WGTA 4FW8A 2Q4BA 4NBVA 2Q50A 4NQZA 4IGEA 4PLYA 1PJ3A 3NAQA 1E7SA 2FPPA 3S2EA 2PA3A 2DQ4A 2I66A 2I76A 2HDHA 3FRJA 4JJFA 2TMDA 4G2NA 1E1MA 4XJSA 1ENOA 3L4BC 2PZJA 1U3WA 4TRMA 1N2SA 1P44A 1N7GA 4YACA 3RU7A 3I9NA 4CMJA 5IZCC 4F6CA 4CMHA 3IOYA 4A0SA 2X5KO 4NZ9A 5G4LA 3O26A 1N1EA 2AXQA 4IDEA 2D1YA 5G4KB 2BRUA 1R0KA 2CDAA 4YQYA 4GGPA 3KEOA 2GN4A 1B8VA 3PZRA 1PJBA 3Q6IA 3BMCB 2NU6A 4CMIB 5HBRA 1RKXA 1TA4A 2Q46A 1AHHA 5J23A 1PJ4A 1BWSA 3LYLA 4BL5A 2BGMA 3FBGA 4Q9NA 1D4FA 1FF9A 4YT2A 5K6AA 1K2WA 1EFKA 3KO8A 3KV3O 5F1KA 4CM4B 4U0JA 3WDSA 3N74A 4IQGA 1ADGA 4NBRA 1PL8A 1XA0A 2HO5A 4FN4A 5FWNA 3L6DA 2VQ3A 4R4JA 1E3WB 4BUCA 3GFGA 4DQUA 4GI2A 1FMCA 5GZ3A 2GDZA 1KETA 4BO9A 3AI1A 3JQ9A 1NVMB 3RJ5A 1TVEA 3MZ0A 2BD0A 5L3ZA 3PRJA 3QSGA 1E6UA 1ENPA 4OQYA 5IF3A 1P0CA 1ONOA 3H5AA 5EL0A 4DC1A 2J3KA 3AJRA 3R6DA 4Z0TA 1QRRA 3NJ8A 2EJVA 2WD7B 3ZNNA 4BMSA 1SPXA 2PNFA 4YJFB 2IODA 4BO5A 1EEHA 4BNMA 4XDZA 5KJ6A 1NPYA 3IUPA 4Z6KA 1LDGA 1D7OA 4L73A 1HT0A 3JQEA 3JQAA 3PGXA 2Q2QA 4FFLA 1V0JA 3VOSA 4A10A 3PI7A 1SAYA 4FFPA 2ZQYA 4AJKA 3VZQA 2XAAA 2OXIA 1BXKA 2YV1A 2NU8A 3QVWA 4TKMA 2PFGA 2V65A 5JAMA 3ZWXA 1ENZA 4E2ZA 2F00A 3BA1A 4X54A 5CDYA 1GEEA 1SCUA 2FZWA 3GFBA 5F1PA 5B4TA 3ZWAA 4CV1A 3Q2KA 1W4ZA 1LDMA 2H1SA 4XB2A 5CDUA 3D3WB 3AK4A 3AOEC 2JKVA 1YQGA 4GX0A 3CZRA 1MXFA 4IJKA 4D41A 4GX5A 3OBBA 3GZNA 3JYNA 4RZHA 2D4AA 3VH1A 3PWSA 1DIAA 2EKPA 1YOVA 3RUDA 4GLOA 2B4RO 4Y6RA 4Q39A 4IBOA 5DP1A 1DRWA 3KYDB 4A73A 3H9JA 3VKUA 1R12A 3BHIA 3F5QA 2XXBA 4CQMB 4L75A 5JCXA 3ONDA 4RVDA 3ETDA 4A2CA 2E4AA 1BRMA 4HFJA 1HDOA 1Y8RB 3HWRA 4PLVA 5CP8A 5HWSA 3RBXA 1PR3A 3W6UA 3DL2A 3AUAA 3JYLA 5HS4A 2X5JO 1IZ0A 1U4SA 1EE2A 4BNYA 2JHFA 4RVHA 3ZV5A 1YS4A 4XX0A 3PJEA 2X0NA 4I9HA 3ADPA 1GEGA 4YBZA 3KSUA 4FDAA 3T4EA 3DHEA 1BGVA 4QX6A 5JY6A 3N58A 4YRDA 3TJRA 3WGZA 2EEZA 3GA0A 4GX1A 1XQ6A 5G0WA 4R3WA 3M6IA 2JAPA 1JA9A 3ENNA 2R00C 4PG8A 2RHRA 2QQ5A 3ENKA 4RQTA 2W8ZA 3K9QO 3OIGA 2NWQA 4YA6A 4NR0A 3H5RA 1LLCA 2YW9A 3TDKA 4CMBA 4GSLA 1YH3A 4FD3A 3LU1A 1IHYA 5CDGA 3SJ7A 5EMHA 5JY1A 2OP1A 2P91A 3DAGA 1R66A 5CAEA 1GYPA 3VPSA 1JWBB 1IUKA 2PH5A 3QY9A 1KC1A 3ZWNA 1Y9EA 3DFZA 1GQYA 3ZU2A 4FQ8A 4W9NC 3OJLA 4MJLA 3AUUA 3HDYA 4O1MA 5G4KA 1E7WA 3U4DA 1U7HA 2ZYDA 1JW9B 1ULUA 2YDXA 4R1UA 5COQA 5DOVA 3RFXA 3UCFA 2VOJA 4HNHA 1JDJA 2JL1A 3K73O 1FJHA 3DMTC 3WTCA 4BGUA 1O89A 2C59A 2Q1WA 1P77A 3BMCA 3VPXA 4CMIA 2XOXA 3KLMX 1ZUD1 3BTOA 4LW8A 3GDOA 3LLSA 1WMBA 3NX4A 3KTDA 4KWHA 5EQFA 3UUWA 1EMDA 1H6DA 2X86A 1KVSA 3SEFA 1NFRA 3WBFA 3WMXA 3RKRA 4CPDA 4XQGA 4J1NA 4MP6A 1JAXA 3ZWCA 4CM4A 4D79A 4E0BA 2RHCA 3UFXA 3OH8A 3WFIA 1I2CA 4NK4A 2DBVO 3NT2A 3WX0A 1GPJA 4M54A 5JMWA 2B37A 4XYMA 4FFMA 1E3WA 2FR8A 5T6BA 5JDIA 4RLSA 4BO4A 1F8FA 1YJQA 1ZZEA 4B7CA 4DL9A 5JMPA 1WVGA 1M2WA 2OHXA 4QEDA 5A9SB 2IYOA 1I3KA 3KOUA 4J49A 1QSGA 3OICA 4HV4A 3VTFA 5EJ2A 1X1EA 3N7UA 1MX3A 3EY4A 1LDEA 4KUGA 1CQIA 3D5QA 2CF5A 4DMLA 3WMWA 1ZK1A 2QYSA 4IIUA 1QYCA 4HNGA 2WD7A 2ZCUA 3BZUA 4L4XA 5CDSA 2ZIZA 1Y9AA 4XA8A 4YJFA 3VAZA 1U8FO 4BQPA 1JKIA 5GY7A 2H9IA 4RGBA 4BNZA 4RVFA 2PLAA 3GT0A 2CVQA 3RFVA 4LSMA 5CDTA 1ZJYA 3DOOA 3ZWYA 2WE8A 2VWPA 1E3SA 1YONA 5B1YA 3RC9A 3K2EA 1LBEA 4FPXA 1OZAA 4PRKA 1GV0A 1VLLA 4XRGA 1HKUA 3ICPA 5IDWA 4LVCA 3LF2A 4PZCA 2A4KA 3AUSA 2RCYA 3L77A 3OA2A 4NJMA 1H94A 1PJQA 4LMPA 2Q45A 5T8KA 4J1SA 3ITKA 3Q11A 4M55A 4WECA 8ADHA 1YL5A 2Y93A 3NDJA 4FSHA 4HUJA 1MP0A 3O8QB 3P2YA 1T2AA 2PKRA 3ITDA 4K9DA 4JP2A 4YRBA 2X0RA 4O5OA 1E0DA 2DBZA 3D3WA 4NBTA 1PEDA 5THQA 4CL8A 1RPNA 2VCYA 1LJ8A 2RAFA 4HADA 4UVGA 2J5QA 4B8ZA 2Q1SA 2HQ1A 3PIIA 2G1UA 1N8KA 1NTOA 1DLJA 3ZV3A 1KVQA 3JQ7B 4FGSA 4WOKA 3WYBA 2XF8A 1MA0A 4DA9A 2JCYA 1MFZA 4G81A 5A04A 3DHNA 3KYDA 4YPOA 1NASA 4CQMA 2C5AA 2WDZA 2WMDA 3LSYA 1KYQA 4BV8A 1HTBA 1L1FA 4K28A 2ZQZA 3U4HA 1DIBA 1WWKA 1Y8RA 2Q3EA 1N92A 2O7QA 4L74A 2DUUA 3HB4X 4WNCA 2DC1A 2BH9A 3HHPA 3A1NA 4P4LA 5MDHA 5T57A 5TSDA 1ZCJA 4RPKA 4Y6SA 4DBZA 4BGIA 1GY8A 2C7VA 2FWMX 2JFGA 1XSEA 4HFRA 4XYBA 3PHJA 4QQRA 3CEAA 4NBUA 1BTOA 3A14A 1OI7A 2C20A 1Z73A 3GN1A 4YR9A 2OOSA 4MPDA 4TMFA 4XEHA 3INTA 4BMVA 5B4UA 4AJNA 4CUJA 1ZBQA 4BNHA 4F46A 2HSDA 1R0SA 3H3JA 3P5SA 1HZJA 3PIDA 1DHRA 2E37A 1B3BA 2GZ1A 2WYUA 4IGFA 4Q3AA 4YDRA 5C37A 4U0KA 1XWFA 4D43A 4II2A 4AJOA 2QHXA 5BSHA 3FWZA 1Z7BA 1Z7EA 3OF2A 1U3UA 4B4UA 3RC1A 1A5ZA 3UXYA 4QT0A 5THKA 3S2FA 3W4KA 5L95A 3I6QA 2YDYA 4FCCA 1WZIA 4GL4A 1DAOA 4B3HA 4E12A 1LI4A 2ZYAA 4OQZA 3PYXA 4ZVVA 2PKQP 4LGVA 2X5OA 4XWYA 4EUEA 4WCFB 4JBGA 3GDFA 2BFPA 4G5HA 3L9XA 1KBZA 1LLQA 1V3TA 5LC1A 4YAGA 3SC4A 4B4OA 1NQTA 1C14A 3AFNA 5T64A 2HMTA 5DT9A 1LRLA 4BKUA 3ZDFA 2AQIA 2PKQO 1JLLA 5DBIA 5T67A 2GERA 3QA9A 2EXXA 2JHGA 4D46A 2NVUB 1LSOA 5KJ1A 2WTBA 1I2ZA 4I5GA 2I3GA 3C1OA 4OGWA 5TLSA 3VTZA 3PZBA 4QO7A 4CR8A 4JQCA 1B8PA 3WYEA 1X0XA 2RH4A 4PFJA 2NQ8A 1QMGA 1IPFA 2BI7A 2C7GA 2R2GA 1Q7BA 3QWHA 4K6CA 5JAZA 3ZH2A 1XYGA 1ZVMA 4NHEA 2W2KB 2IYPA 2X4GA 3G0OA 3WXBA 2DT5A 5TJHA 1GV1A 3B1JA 4J90A 3I23A 1SO8A 3ICCA 2O3JA 3QHAA 5A4DA 4BNNA 2QZ9A 2C07A 4R9SA 4UREA 4R1NA 2V6BA 4KQWA 4W4TA 3E82A 3JQCA 1KY5A 1IPEA 4A5OA 1V9LA 1Y6JA 2UUOA 5EERA 3WGYA 5HRUA 4EJ6A 2E82A 1QORA 3GVHA 2J3JA 1A71A 1B3RA 3KRTA 2X9GA 1KEUA 1IZ9A 2VRCD 1FDTA 4O0LA 4PLCA 4NFSA 2HK7A 1MV8A 2PZKA 3KUXA 4CODB 3SXPA 4YCAA 1HE3A 2P5UA 1WMAA 1UH5A 4IPTA 1CRWG 3NRCA 1V3UA 3BTVA 3TZHA 1M6WA 1ZMTA 3WGOA 4KZPA 3O8QA 2JCXA 1PJTA 3NTQA 1F14A 4EUFA 4IDBA 3FPLA 4GVLA 5KJEA 3JD3A 5JW6A 5FFFA 3WWYA 3ZW8A 1JWAB 1UXGA 3C1AA 1AE1A 1HL3A 4LCJA 2EIHA 1H0KA 2C29D 1T1SA 4FIZA 3ST7A 3WBBA 4BNGA 5BR7A 1X0VA 1YE3A 3QIVA 3JQ7A 1KIFA 4WCDA 4JBHA 4L0QA 1VI2A 1YB4A 2NQTA 4MIOA 1LRKA 1E5LA 4HKTA 3ZWBA 2Q49A 1I0ZA 4BGVA 3DB2A 1O9BA 4U5QA 1M76A 4AJPA 3PFWO 5A05A 2GZ3A 4J16A 2RH8A 3JQAD 3ZW9A 2XPCA 1HSOA 3ULKA 1MLDA 4PG4A 2QZZA 1YJ8A 3C85A 3GUYA 4GSKA 4CLEA 7MDHA 1AUPA 4GKVA 1PGOA 3W4JA 1E1NA 3D7LA 3DDNA 4R3NA 1PJ2A 3QLJA 4GVXA 1W0CA 1D1TA 1FXSA 1LDBA 1I30A 2ZATA 5JXWA 4FS3A 2C2XA 3I52A 1DDOA 3GVCA 4GMFA 1R4NB 4TRRA 1ISHA 4ITUA 1XQ1A 3TOZA 3G17A 3GZ4A 3SBOA 1S7CA 1E7QA 4NH4A 1WZEA 3E9QA 1K6IA 3CIFA 1VJTA 3VDRA 1J4AA 1NYTA 4J0EA 5KCZA 3EUWA 4Z0HO 4CM6A 1A7AA 4NG5A 4E32A 4PVDA 2CSUA 3STHA 1EDOA 1TEHA 2YUTA 2W2LA 3KSZO 5KVCA 4P8RA 3EVNA 3FN4A 3GAFA 1KVRA 2AW5A 3HZZA 4F3YA 1XCBA 1CETA 4R41A 1BW9B 5AXAA 3IIEA 4R5MA 3VVBA 3IKVA 1PR9A 5JCJA 2O2SA 3H2ZA 3KZVA 3E18A 1B15A 3DZJA 4UUMA 4ZJUA 4A26A 4XGIA 4BO8A 4EYEA 3MWDB 4R1TA 4CUZA 1NHWA 2OGUA 5JS6A 1MB4A 3ROKA 2YV2A 1IE3A 2GN9A 3IJPA 5DCYA 3K6JA 4H7PA 1PX0A 5A3VA 4OHUA 4EW6A 2UVDA 4EITA 3H4VA 2TMGA 4GPD1 1Z74A 3D0OA 1EUZA 3NTOA 1IL0A 2NVUA 1ZK3A 3GG9A 2D2IA 4IQ8A 4EUHA 3NGXA 1QV7A 1LDYA 3VZPA 4JXKA 1GFSA 4EEZA 1Z6ZA 4ZN6A 1PQWA 3DBHA 2FN7A 2O2YA 3IQDB 3OQ1A 3E03A 3EC7A 1QLJA 3EGOA 3IJRA 3H6KA 1B14A 4EJMA 3ABIA 4QFDA 5DCUA 2DTXA 3TQHA 3CKYA 2W2KA 5TRTA 4NDNE 4NBWA 9LDBA 5JSFA 1ML3A 1UJMA 1ADCA 3RVDA 4DTIA 2YQ4A 1PZEA 4J7CA 2FPIA 4N18A 3M2PA 3MJSA 2VUTA 1LUAA 1FDSA 2O4CA 4FJ2A 2GF2A 3OJEA 3PJDA 2B4QA 5DOZA 5KWEA 1SMKA 1OC2A 1PZHA 4Q3BA 1JKJA 4B8WA 5KIAA 3E5RA 3BHJA 4DWVA 3HN7A 1DC5A 3HUDA 4R69A 1NPTO 1HDCA 2P68A 3LLVA 5TJ9A 2W90A 4WUVA 3WWZA 5DULA 3RD5A 2Z5LA 1MC5A 4JX8A 5DBFA 4ALKA 4CR6A 2EGGA 1UP4A 2Y1FA 4GBJA 2FSSA 3D4PA 4BB6A 4FC6A 4IDCA 3RAJA 1EZ4A 4QO8A 1C0KA 3RKUA 5ENVA 5JC1A 5T5QA 3RBZA 3NV9A 3WJ7A 3L4BA 2PWZA 1LQTA 4RPGA 4QSMA 2OO5A 5TQVA 4WNIA 2BF7A 3ON5A 4CMEA 1HXHA 4Z9XA 5IZCA 3HE3A 4AFNA 4TVBA 4BNVA 1E7MA 3W8EA 3F1KA 4RL6A 1M66A 2R6JA 1JN0A 4LRTB 1YXMA 3D5TA 3GF4A 3GOHA 1V8BA 4GX2A 4URFA 3IL2A 1BMDA 3WGHA 4YB8A 4BOYA 1H5QA 2WJPA 3PHHA 1PZFA 3C3XA 2HJRA 3K96A 4RJTA 1T2CA 4J7UA 5F5LA 2GD1O 2VUUA 5GMOA 3GK3A 1RM5A 1QG6A 5DDIP 4ZRMA 1BDMA 1OMOA 1X7DA 3UVEA 2YHIB 5C3MA 4RVGA 4WLOA 5C7OO 5TS3A 2C2YA 2E6UX 3PP8A 4NI5A 2D5AA 3D3EA 4CM8A 3JQBC 4G65A 5G0SA 4R54A 4NIMA 3F4BA 4D0RA 1VC2A 1F0YA 3W6ZA 3S8MA 2YFQA 3LT2A 3GRKA 2CNBA 1H6BA 2PV7A 1F06A 4RORA 4JIGA 1UAGA 3DONA 4OIMA 4ILKA 4MVJF 3UW3A 2VRBA 3ZNQA 5K6AC 1QXSA 1R4NA 1ONNA 3V8BA 3U4CA 1JU9A 3DHYA 3I83A 5EINA 4BNXA 5I8ZA 4XZ3A 2Q2VA 4ESOA 3CZMA 1DBVO 2OUIA 4RF3A 3BMQB 3GMSA 1HWYA 4YVFA 2VNAA 3Q9UA 3MJCA 1RM4A 3JQ9C 4ZQEA 3ONFA 3CSDA 1HE4A 1XEAA 3ZU4A 4AJIA 4IDFA 1P74A 4E2XA 2Y05A 2WYWA 1BW9A 1O5IA 2HMVA 3NUGA 3X2EA 3V2UA 3P2OA 2ZYGA 3TL3A 1X7GA 1JAYA 4ND5A 1D8AA 2Y68A 2B36A 3GEGA 3QWFA 5ITWA 1NFFA 1QYWA 2D5CA 3DZKA 1GUZA 3LK7A 4CV3A 3DOJA 3AM4A 1NQAO 1PQUA 1CYDA 4IDAA 2FZEA 1JVSA 1R4MB 3EZYA 4EJ0A 1NR1A 3GR6A 2ZTMA 4YYZA 3G1UA 4I1IA 1Y5MA 3QVXA 4AJEA 2NU9A 3R3JA 2V6MA 1LLDA 4YJGB 4RO0A 3V1TC 3U49A 1Y8QA 1GUFA 5TT1A 4YAEA 4E5YA 2CDCA 3RUHA 1VM6A 3AOEA 1F8GA 3DO5A 4GKBA 3I1JA 3PPIA 5DP2A 1GQ2A 1M6HA 4P22A 2G82A 3IC5A 1LRJA 2JFFA 4GLLA 1GDHA 4MVJE 2D59A 2EW8A 3WJAA 4E4YA 3OP4A 5BSGA 2ZB4A 4YEDA 3PDUA 3NKLA 5JPIA 3FR8A 4MVJA 1VKNA 4WEQA 4L9RA 1DIRA 1YKFA 3B1KA 2GZ2A 3PYLA 4OMUA 1LLUA 4OXKA 3GRPA 3WB9A 3E8XA 1GU7A 2V6GA 2VHZA 1ZSYA 1XELA 1P1FA 5L40A 3DEYX 3UF0A 3H3FA 1BHSA 3LC7O 5B4VA 3U09A 4TZTA 5JYEA 5JFOA 5JDCA 4P4NA 2ZB8A 4NU5A 5F5NA 4DPMA 1E3IA 1VSUA 2X22A 1GYQA 1J0XO 2NNLD 4Q3EA 1DXYA 2BMAA 2PGLA 3GPDG 4JCOA 3SLGA 4JK3A 6ADHA 4IM7A 4Y9DA 3M1AA 1TB4A 3F47A 4WLNA 2R00A 2HMSA 1SEVA 2VHYA 4HY3A 5I9NA 1PWXA 3PHIA 1CQJA 3ROQA 4PLTA 1NM5A 3P19A 4WK6A 2PGDA 1B7GO 5DNAA 4EGFA 3RJ9A 4DLAA 1VL8A 4Q3NA 3ORFA 3DZIA 5U9CA 4MDHA 2Y1CA 4J3FA 3ZHZA 5CEJA 3QWBA 4OYRA 1MC4A 7ADHA 4M49A 3CMCO 3PWZA 3KVOA 4XYEA 1XKQA 3PHLA 4K1LA 5IDQA 1IY8A 1I3LA 4JBIA 5AXDA 3T7EA 5CEFA 4CMKA 4FR5A 2DPGA 4XIYA 2YHIA 2J5RA 5BSEA 3RUEA 4YAJA 1UZNA 2YFHA 1WLYA 1JKFA 1IB6A 2AG8A 5DBGA 3M2TA 4IS3A 4M86A 1U5AA 4BO0A 2ZKLA 1QKIA 3OHSX 5K9ZA 1LX6A 3E1KA 4J4BA 2O4UX 2B4TO 1Y5RA 3WR5A 3PFFA 3VHRA 4I5FA 3DAPA 3AOGA 4FFRA 4GWGA 4PRLA 1O8CA 2PD6A 4UAGA 1BDBA 5IDXA 2J5KA 1T25A 3ZZNA 4A27A 1PGJA 5A9RA 1K3TA 3PDJA 1B8UA 4FB5A 5AQ1A 2VYND 4XDYA 4DLLA 3WIDA 3BTUA 4JJGA 4R68A 3AFMA 3AWDA 3WFJA 2Y66A 3GEDA 1B26A 1AN9A 2ZJ1A 3DR3A 4OL9A 1GZ4A 3BMQA 5JDIC 1VJ1A 1B0AA 5LDHA 4ROSA 5L7WA 3D4NA 3WGIA 4CM5A 2VWHA 2I65A 5A1TA 4IUYA 1L7DA 3HFGA 1XU7A 3GNQA 3T7CA 3ZWVA 3HJAA 2GO1A 4OKNA 3KB6A 3VH4A 5I7VA 4RLHA 1AXGA 3IAHA 3PWKA 3GQVA 4XCVA 1GD1O 1DB3A 2IZ1A 2Y67A 1UXKA 4DUPA 1FK8A 1I32A 2A35A 4XJTA 3DTTA 5H83A 5I9MA 4UUOA 3TSCA 2W98A 5IN4A 3IP3A 4I08A 4MOWA 5HA5A 1A72A 2EV9A 2QYTA 4Q3CA 1R4MA 3AU9A 4J43A 3QW2A 4WEOA 1HE5A 4NPCA 1LDNA 5A02A 1QV6A 2IZ0A 4QTZA 4YJGA 1UXJA 1P1HA 2ZB3A 5ILOA 1GYRA 2JFHA 3QP9A 1VL0A 1I01A 1KY4A 4PG6A 4BO2A 3ZV4A 1MFPA 1I5RA 3FTPA 4KWIA 1UAYA 1BVRA 5C5IA 1AGNA 4C4OA 1I2BA 2PD3A 2X9NA 4RDIA 1X7HA 2OBNA 2BFAA 4LN1A 5T8KC 1X1TA 1UP6A 4JROA 2Z1MA 3LF1A 2WD8A 4U7WA 1PL6A 4QUKA 3RI3A 3ZCXA 1HYGA 4E30A 2UAGA 3COSA 2WWRA 3GVPA 5C7LO 1OBFO 2DTEA 1XLTA 1ZEJA 4IZIA 1XGKA 2W2LD 4LK3A 5G0VA 4N5MA 4EEXA 3QV1A 1H6CA 1HE2A 3BMOB 4KTVE 1DFGA 4BS9A 5IN5A 4MINA 1O95A 2D0IA 5JO0A 3GPIA 4PG5A 3S2GA 1E1KA 3RFTA 1NQ5A 3GGOA 3MJ4A 3GY0A 4NJOA 1N9GB 1W73A 2BKAA 2DFVA 4RPHA 3V5NA 4YWJA 3B70A 3TZQA 2PZLA 1I24A 1PJLA 3K92A 2CMDA 1MG0A 3AW9A 4IY1A 4TRNA 4CLDA 2AA3A 3ZV6A 3D4OA 5BQFA 4E13A 3O03A 5F21A 3ANLA 4FBGA 1P33A 3GAZA 2E49A 5G0UA 4S1VA 3K30A 3SLKA 3DC2A 4B3JA 3JCZA 5G2OA 3W8DA 2PGJA 3L6OO 1U2GA 3WYCA 1ZW1A 4OM8A 3H65A 4OO3A 1E1LA 4Z0PA 4BGEA 1P45A 1ZFNA 5EN4A 5CFZA 1A9ZA 3LVFO 1O94A 1H9AA 3GHHA 2Q2WA 3AI2A 3AM3A 1XDWA 1U3VA 2Y1GA 2DPHA 3TF5A 1JVBA 2X1HA 3UCXA 1PJSA 1HDXA 3DZBA 4GAEA 2DKNA 4DXHA 1AHIA 3H5NA 3QWAA 5TC4A 1DRUA 1EBFA 2X0JA 5HTOA 1MUUA 2HKIA 2X58A 1E3EA 3OA0A 3CE6A 3H9EO 1DLIA 2JD0A 2OL4A 3DBLB 4BNJA 4OXYA 5I8WA 3LT4A 2YV3A 4MIYA 1N1GA 1ISGA 3ZWOA 1KVTA 3G3EA 4BB5A 4AJ4A 1LC0A 4JNKA 3WLFA 3U3XA 2EGHA 3C24A 2BFOA 5K0ZA 2AEFA 4AICA 4FOSA 3I9LA 2NV6A 1PSDA 3A4VA 2GYYA 4YT5A 4ND3A 3UN1A 4AJJA 4XB1A 1DJQA 3JQFC 4II3A 1V35A 3C1TA 3PYMA 1LC3A 3TN7A 4OSPA 5A9SA 2Y0EA 4M8SA 1DEHA 1U5CA 3JD4A 1U8XX 3MJTA 3L07A 4DGSA 2GASA 1EK6A 5AVOA 5TT0A 1ZIDA 4TQGA 4I9UA 1K5HA 4B3IA 1R37A 1LXCA 2DBRA 1SC6A 3JYPA 3WS7A 1RWBA 5AOVA 1DC3A 5KJFA 4ALNA 4FFNA 3OJOA 4B79A 3U0BA 4YJHB 1ENYA 3OEWA 4TSKA 5JC8A 2Y1EA 1H93A 1DOHA 1BVUA 3I6IA 4H16A 1W8DA 3S1LA 3KYBA 3NT5A 5IZ4A 3KBOA 4DQVA 1YQXA 3MOGA 5IG2A 3EDMA 2P9EA 4RF2A 4Z9FA 1ZMOA 2G5CA 2QRLA 4N5NA 4F6LA 2QRKA 4PLGA 4RVUA 3DXFA 2CY0A 2LDXA 4HX5A 1CWUA 4KUHA 1GCUA 3AU8A 1YDWA 3F1LA 4RQUA 4ALIA 1YQDA 2GPTA 3AY7A 3V2HA 1A4UA 1Q0QA 3FHLA 4D7AA 3KEQA 1LNQA 3O4RA 3I3OA 3UCEA 5BSFA 1ZNQO 3F46A 3DZFA 3L0DA 4JLWA 1OFGA 3EZLA 4D42A 2NM0A 3PEFA 1HZZA 4DIOA 1AXEA 2VN8A 4I8XA 3HDQA 3U62A 5FI5A 2GSDA 4ZU3A 4ND4A 1P1RA 3PLNA 1NPDA 4BNIA 4RV9A 1E6EA 3F6YA 3WG9A 1Z45A 5I7FA 3QQPA 3BMOA 1R0LA 3R0IA 5FYDA 4B7UA 1B16A 1GADO 1NHGA 1NX6A 3K2BA 1E7RA 1TT5B 4CQLB 3R3SA 2BLLA 4KUEA 2AE2A 4ZRNA 5EIOA 2C54A 3TNLA 4NFYA 2Y1OA 3SC6A 4KDEA 1BXGB 4J2OA 3KXDA 2VHVA 4NFHA 4KTTE 1ZSNA 1N9GA 1DIHA 1ZK0A 2NUAA 4XGKA 3PQFA 4IIVA 1H2HA 1P3DA 2QX7A 5L7YA 1Y1PA 4D44A 3I9OA 1Z82A 2UV8A 2C0CA 5JE8A 3V2GA 2EP5A 4FJ0A 4IDGA 1DIGA 2NTJA 4OOFA 3B1FA 5TF4A 4YAIA 4IXTA 3VZSA 1DO8A 2FP4A 4PZEA 4UVHA 4ZQGA 1P0FA 4TRJA 3G1TA 4J1QA 3OECA 4XIJA 1XU9A 1DC4A 1SNYA 3NDRA 3ASUA 3JQ8B 3H9QA 1EE9A 1NWCA 4J6FA 4UEKA 4E5PA 4MVJD 1ORRA 1PS8A 4ALMA 3GGGA 3FNEA 2NADA 2OBYA 2OORA 5A5EA 4J2HA 4JJIA 3WOHA 2VWGA
chains in the Genus database with same CATH superfamily
1IUNA 3FKJA 1VLHA 3OG9A 1NTRA 1I3NA 4QRHA 2V6FA 1ADBA 4GNKA 4TUYF 4WCFA 5F7OA 2IW1A 3DV9A 4PNZA 1YVRA 1L4HA 3ESBA 3MRVA 3W5JA 3C3BA 1GDTA 3VBEA 1JXMA 4UPDA 4YAOA 2ZSBA 4MR7B 5DXAA 4CIBA 1SOWA 1SUBA 2QG4A 2VYQA 4IIJA 1S01A 1P7PA 3M33A 3KB8A 2XQGA 1B6RA 3PS9A 1BDJA 4PLWA 3TRIA 3WL8A 4B17A 9ATCA 5FBVB 1JG3A 4LBVA 1JXAA 5DLEA 4MVXA 1GZ3A 3T7IA 3PHGA 1UFOA 3I9KA 4KVZA 2OCGA 4RMGA 2OK8A 3T1VA 1WR8A 2EJBA 2QAGA 5FBKA 3PC6A 3Q12A 2CZCA 2NU7A 4HSEA 5GONA 1GZ6A 2H59A 2H0QA 4Q21A 2FRDC 3CE9A 1MA3A 3GFTA 3GEMA 2PUTA 3L7MA 3H2HA 4UUAA 5B4UA 1G41A 2QZPA 4ZV7A 3TPFA 4YV7A 1R16A 3HZHA 2C9YA 3ZVLA 2F48A 2C82A 3TPCA 5FBLB 4B35A 5BSKA 2BONA 1GQRA 4NCXA 3CMMA 2OAQ1 1U2ZA 3IHTA 4TKVA 1QFZA 2FEOA 5DYIA 5DYGA 2J6BA 1QB8A 2XSZA 3WGJA 1AGPA 3S1SA 2ZWPA 1GUBA 5FD8A 3Q98A 3X44A 2GUWA 4AL4A 3M7IA 2GEKA 2Y0CA 1EJBA 2I7XA 2D1SA 2BOVA 3V4SA 5JSHA 2LE0A 2QA5A 1J8DA 1ZMXA 1YV9A 4YRMA 2X8LA 1PJ8A 1SB8A 3EBOA 3F6BX 1KERA 2JLYA 3ZI0A 3UAGA 2WOJA 2UYHA 2QXYA 1FE8A 1EFRA 1FNSA 4PQEA 3NYQA 4RWEA 3B6EA 3G88A 1ULAA 1V5IA 3RF7A 1VIAA 3G6KA 2I2FA 1WA5A 2F90A 2F2TA 3E2PA 3EXIB 4P1ZA 4X44A 4CCSA 5IM4F 1H6AA 1QQ7A 5JD4A 1DO0A 4JJEA 2RMKA 1REQB 2CMFA 3CHYA 3OEEA 4NVRA 3FXAA 1SOVA 1KI6A 2NSDA 4QFCA 1QJ4A 3LPNA 5KQSA 4HX9A 1AZLA 1Q1QA 3HN2A 5J4YA 4LQCA 4TXHA 1EQUA 3JD2A 2LUOA 2YWXA 1UDCA 4U6SA 4XX0B 3IXQA 4G5OA 2HRZA 4DJFC 2ZBFA 4JBXA 1LBHA 1LD3A 3NOQA 3H5WA 2SCUA 4QUAA 3SBDA 2YIMA 1BFDA 1NW9B 2HK9A 4P08A 1D1PA 3HFSA 2GEBA 1RHMA 3N8DA 1LWNA 4PSAA 4LF7B 4IVNA 2G4VA 2FWPA 2MSWA 4GXTA 1RRGA 2KE5A 4FWTA 4DY6A 1LEHA 1UDRA 2FPLA 2AUMA 2AG0A 1WXGA 1D9ZA 1W36C 3M6FA 4R6XA 3W8FA 1NU8A 2GXUA 3UANA 1WQ4A 1UPUA 1X14A 2O7SA 3HKCA 5KTPA 1BVHA 2POCA 5LCXA 4CMEC 3KB2A 1GLVA 5DN6D 5CNJA 1R2QA 3W1VA 1W2WB 2J9GA 3H9UA 5AVRA 2Z1DA 2BM1A 4S1TA 5BNFA 5H9WA 4KREA 5J2UB 1P31A 1TT5A 4PTLA 4CQLA 9LDTA 1ZOOA 4YMLA 4YRPA 1TGVA 5E6UA 4KKVA 4LYGA 2CN1A 3NS7A 3EQ7A 2CVZA 3K5PA 4F9FA 4M88A 4OA8A 3P26A 4AU1A 2A6PA 4LGCA 3TL6A 5I7EA 2GAOA 1GL3A 1UR5A 2DFPA 1FTGA 1XXHB 3RG8A 1U90A 1G5FA 1PN3A 1PJCA 5ALNA 1I10A 1L7RA 3KIPA 4IHJF 1Q3TA 2C5EA 2VPPA 3NTRA 4BWFB 2CEAA 1AKQA 1WW3A 2CLDX 2V7PA 3GLQA 4PLZA 3THWA 3GRCA 1H2FA 2VRCA 3EULA 4H3VA 2OFPA 1I1OA 2I80A 3NBFA 3DS8A 1YO6A 1A82A 3HCRA 4LV5B 2BHTA 4U6NA 2G0NA 4M9ZA 3A6KA 2O7VA 4WNAB 2XUFA 4J3JA 4NJEA 2P4UA 1T26A 4Q18A 5KWIA 1Y3DE 3B9QA 4EJSB 4HGOA 3FVWA 1FUUA 1Q1NA 2C5FA 4RVSA 1PD0A 4YRCA 3OFSA 5EGNA 3NDIA 2JIOA 3ROMA 3W3ZB 1QU2A 3LG2A 1OB5A 4P3YA 4DQDA 3TSOA 1UZLA 4V0NA 3N59A 5JZBA 3ZZTA 5IJWA 1ID8A 5TNXA 5H80A 3D8SA 3JQ8A 3LKZA 1Z6QA 5BUSA 1TGYA 3TUZC 4JWKA 1KEPA 1ZLXA 3PUZA 521PA 4B3DA 1ZH4A 3N6VA 4GLFA 4LYFA 4PHGA 1NAHA 2PMCA 4L0CA 4OXRA 3IP5A 2AEMA 2ZS7A 5ES3A 3W5VA 2AZDA 1CJKC 3W9UA 3NJRA 5JRJA 5KIAA 1B2LA 1I7NA 4EVQA 2C00A 2PU5A 2L0XA 2QN8A 1OAOA 5ENDA 2EFHB 5FWXA 2PL5A 3HBAA 1ARZA 1LVUA 1JU3A 3TOXA 3AL2A 3JYOA 1M2OA 4C0BA 4NMHA 3OSZA 4TROA 4C7VA 1RXUA 3A1SA 4P0PB 5GOZA 4CNBA 2UVPB 1QRSA 4BMNA 4FGKA 2R44A 3R44A 3FVRA 2G08A 4KH1A 2Z8ZA 4IJUA 3LWDA 4KYIB 5TXGA 3RUIA 1KOLA 4XWAA 4JXZA 1QS0B 1T1JA 1JPVA 1Y42X 5I9SA 3OETA 4IVPA 1GTZA 1Y6ZA 4BJ1A 5K8CA 1A4IA 4LWQA 5HM8A 1XVIA 4HC4A 5F76A 2DE0X 3V7FA 3TQFA 2ZWVA 2P0EA 3UUEA 2AX4A 3AVTA 2P30A 4R9RA 3HA5A 4BIIA 4DAEA 3BX1A 1EU1A 1DG9A 1RDFA 2PUVA 3MVEA 1VMAA 3A6PC 1C1YA 3CLUC 3KEFA 3NIFB 1ZJ4A 1GTMA 5LYYA 4EUSA 3VYUB 5JS7A 2X23A 4D26A 3C70A 4UBIA 3FB4A 1IIBA 3WO0A 2DR2A 4JUDX 2VT2A 3DAYA 1I36A 3QU7A 3DDSA 5JS8A 1LK0A 3RBAA 2G7ZA 3TEMA 1AIPA 3GJ0A 3GG2A 4MW1A 2BEKA 3AXSA 1W5SA 3KTOA 3LXMA 1NWHA 4TSRA 2HJGA 3GJ8A 1EWQA 1LW6E 2G0AA 4C5BA 1T13A 3R24A 4KL8S 3UJ3X 4QOEA 2XCQA 3OQVA 1UKZA 3PENA 2ZU6A 3STTA 3NOXA 4CKZA 1OX6A 2XV1A 2V5UA 3IPXA 3LBIA 1H4TA 3UWKA 3A32A 2CHEA 4CM1A 1Z63A 5DASA 1M8FA 4IOJA 1PIWA 3GWZA 2BGIA 2VHUA 2CEKA 3QVTA 1ZXBA 2QW8A 2W4QA 5G0TA 3S6JA 2WNSA 1FVHA 2H8KA 4IYJA 2RHTA 4JI4B 2A78A 2VUSA 2WEKA 1R0BA 2X1VA 2XMDA 5PNTA 4AYWA 5DI9A 1V41E 3IPAA 4P6VF 3FUTA 4L4ZA 3FAKA 4HXEB 3GJSA 1V37A 2I3BA 2GJSA 1SVMA 2IWRA 3JARA 4QEZA 2D0OB 2W6ID 4MGHA 3K0AA 1RYNA 1HBJA 3D5EA 4Y8VA 3UAOA 3W9SA 3K09A 4CTNA 1EP9A 2FF7A 2GHRA 3LDFA 2QTAA 4J7XA 4NE2A 4WQMA 3TKYA 2PANA 4Q9AA 4AYXA 1YZNA 3O9ZA 2C9CA 3NALA 1N3YA 3QMMA 1CVIA 4PS1A 1U3TA 2P2YA 4X6YA 1XR3A 1RXWA 1MVNA 4KPGA 4P7BA 3N2IA 2QTNA 3QPDA 5DHQA 2AOUB 2BM9A 2HMUA 2VYVA 4O1HA 2IZZA 2MSNA 1NVTA 1Q92A 4RFVA 4TVOA 4E4TA 2I6QA 1JX6A 2NUPB 1SD2A 3LKVA 4LHXA 1T1EA 1X1RA 2P5SA 2X6QA 4W9NA 2NPIA 1DJLA 2R7KA 3AERB 5IBRA 1T5TA 4DQKA 2HJSA 2D6FA 4PSVA 3ZXIA 4D9KA 1B0PA 1IY1A 1NM5C 1BMQA 1DBPA 2VPTA 3CH7A 2NQ2C 3HU2A 3FHJA 3ILSA 4LK2A 5BT9A 2W2XA 1JQEA 2FUCA 4BN4A 3G7SA 3TD6A 3C6MA 3FMVA 2IELA 1U0RA 4L0DA 2XGGA 1W5FA 4OXNA 4UZEA 4DR3B 4XGNA 1WPQA 4MPJA 3OWHA 3NIDB 1L0BA 5DW3A 2CMGA 4L76A 1F3OA 1MAUA 2VJCA 5LDGA 4Q7LA 4LOHA 5JWHA 1FNCA 5SY4A 1NBIA 5HHTA 4EZEA 5IT0A 1PR5A 1GKKA 1GRCA 5JCPA 5KWVA 2F64A 1QCDA 1FTQA 4O4HA 3UH1A 3T8YA 3DVAA 3JQGB 4FGWA 2JJ8A 1XXHE 5DVZA 1QPBA 4Y1GA 2YHUA 4OQNA 1Z75A 1FS5A 3D0QA 1A9YA 4COKA 1HA3A 3IKTA 1TX4B 4HQFA 4KQ9A 2ZM6B 1NNEA 3VPBA 4LOKA 5DX0A 3U4QB 3LYAA 4IDDA 3PJRA 3DJYA 4CFSA 4ZYLA 3ANSA 4BZXA 1P62B 1TM1E 2P4EA 1X1QA 1ADFA 1F20A 2YYYA 1NAIA 3CKMA 4XWTA 1Z18A 4WXRA 3C8MA 2EKLA 2BCGY 2H51A 4QASA 1Y3CE 2H4YA 3R7DA 5K8IA 3U56A 3PUKA 3TQSA 5B36A 3PVZA 4QYTA 3FR7A 4HD8A 3VHLB 1F12A 3HSKA 3PF8A 2BFMA 3WISA 1Y0BA 3QRWA 1CUVA 3K53A 1XVAA 4ZWNA 1LTQA 5HDBB 4D8UA 2X7HA 2FG6C 4EHFA 3HLTA 1MB3A 2EZUA 3DOCA 3L7IA 2IKQA 2MHCA 3V97A 1IATA 4MTLA 1P4SA 2ZRJA 3HRHA 3G9UA 4RK4A 1K89A 3ZLVA 2C5GA 4UDXX 3VTKA 2W6CX 3MAAC 2CK3A 1U1EA 4XR9A 1G8KA 1UJ6A 4HF7A 1ZNZA 5HRAA 3NZEA 1L5ZA 3IR6A 5I9LA 4J0FA 5TX7A 5K0SA 3OIDA 4TT3A 4Q6BA 3MJFA 1YE5A 5EKUA 3OMLA 5HX7A 4DMCA 5J4KA 1HMYA 5F7ZA 4O63O 3QX8A 4MVJP 4UXHA 3RKSA 1WMFA 2PWPA 1X1BA 2XMCA 3HBFA 4FOPA 2LW7A 3D1LA 4RYDA 3T52A 4BNUA 4PHCA 1XTZA 3I9JA 4KO8A 1KYTA 3L8FA 3UPTA 3GPLA 2VOEA 5FTJA 1IHUA 1XHFA 1L5HA 1S2LA 3RV3A 2WWTA 5JNLA 2YJ3A 4B2YA 3GLKA 1NXQA 3PPWA 5A3JA 3JAKA 2UU9B 3JQQA 1FUIA 1LI7A 1MO2A 3BEDA 3JZDA 4TL8A 1QHHA 2MINA 4C0LA 1DRVA 1YBMA 4Q9IA 4DEVA 3LHSA 2ETXA 2ZB7A 3R4CA 5IC4A 1N2EA 1HI9A 3DTVB 1HLPA 1A8HA 4ZT3A 5EJ5A 2PA0A 4FT4A 1G1MA 5KYVA 1C1HA 1CUHA 1K08A 2E1PA 5ER6A 4G4SO 4KN8A 3ICQB 2WV7A 4BVAA 2P9BA 4X64B 2LGJA 4N40A 2XT0A 1CY2A 1ODJA 3KXLA 3L8GA 2H16A 4L5JA 1VL6A 4H15A 5JCOC 4X1OA 4ZCLA 1R6AA 3RYHA 1KOGA 3GN2A 5KYKA 4DRXB 2RHGB 1E2EA 4AZ0A 3KM0A 2FLKA 4NKRA 4ZEWA 3PXUA 3L06A 2AMFA 1J8MF 4XUCA 3U4MA 1L8XA 5AVTA 1VHQA 2VRNA 5L4SA 2D2VA 2DZDA 3G85A 3KDAA 4I99A 2HCTA 5EP4A 1L5WA 1W0JA 2KQUA 3YASA 3K0FA 4ND7A 4WLFA 1H65A 4ZPJA 1LLFA 2AF4C 4PLPA 1ZXLA 4HN2A 4L4YA 3IFSA 3WGVA 3E2IA 4DIUA 3NEYA 1U1DA 4J0IA 5EMNA 5KZMB 4QHSA 3COPA 3UHAA 5MN5A 5HGJA 2HUPA 2Q8NA 4P54A 4W1SA 3UGKA 5BNIA 4RLQA 3NR2A 5FTMA 4RU1A 2V7UA 3UAXA 4HN4B 3BZBA 2IVZA 4AJHA 3DNFA 2R1UA 3VGPA 1V26A 3L49A 4R5HA 1JFFA 1KC3A 3LJKA 3FNGA 5H70A 3ZHYA 3PU6A 1N0IA 4BVEA 1DEKA 3MOIA 4FLMA 4RTPA 4HEQA 1ONBA 4YJDA 1SUSA 2XEXA 4ZI7B 2ZKIA 3DQPA 2NXNA 1CF9A 5KTTA 5IXJA 4BC1A 2Y99A 5GZ1A 5ALLA 1PVDA 1VKOA 4YRLA 2BFEA 3AIIA 5IEBA 5IVDA 2P5YA 4TWBA 4J94A 3BK1A 1XEFA 2IYWA 1GU0A 2MYTA 3FPCA 2B8JA 4Q37A 3WAGA 3W3AD 5HCNA 3CXRA 1GOTA 3L05A 3EBPA 3BQMB 3ZHSA 2WK1A 4D8VA 1NY5A 2GAJA 3UIEA 2CBZA 3JQDA 1G6KA 4OI4A 4DA7A 1V3QE 3P0FA 2REQA 4BX9A 1FLDA 2IPOA 1C8BA 2IS4A 4W9MC 4E2WA 1PKEA 1QF9A 2PUJA 1SURA 2HQOA 1YE8A 3DUWA 4G24A 2JK0A 4IV0A 4FLEA 4PX3A 2R84A 3A9RA 2HD4A 7MHTA 2AUTA 2YX1A 1VB3A 4ZOBA 4C07A 4C2AA 1W48A 5JEDA 4HTFB 1R5BA 3ND9A 3FD8A 4AB1A 4EPYA 1O9GA 2J9XB 5IAGA 3U7FB 2XRZA 4IFIA 3OEHA 4ONEA 3LQRA 1RYFA 3OT1B 3DYIA 2Y4NA 1JIIA 3GFPA 1NI5A 3EIWA 4YT4A 5EKSA 5CB4A 2BHLA 4AZWA 4B45A 1Z6AA 4PONA 1VZ3A 3CGWA 2D0PB 2PTHA 1ZKMA 5EZYA 5BN4A 4BNFA 3RADC 2X4LA 3CFYA 4FP9A 2QZSA 5LOVA 2JCVA 1AK2A 4MW6A 3THSA 5J43A 4HPXB 5AHOA 4JS0A 4PCVA 1JEYA 1KAHA 2O1WA 4GOND 4I9GA 4L15A 1B2RA 2I9PA 3BS4A 3E81A 3ROPA 3I76A 4B80A 4C4ZA 821PA 3AH8A 1D2RA 3OSUA 3QKWA 2ONZA 4HUQA 3KJHA 2B30A 4RZSA 1VA4A 2LTAA 5I47A 1AHPA 4M21A 2XR1A 2YBDA 4I8DA 3REFA 5ENZA 1G3RA 1V16A 1NUPA 3ZGYA 4CKYA 4O25A 2EFCB 2XIJA 2Z83A 2W70A 2DVMA 2GD0A 1W5TA 2FMFA 2QRQA 4ASUD 4BKPA 3X2FA 3GVIA 3VRHA 4YYEA 1AY0A 4ILEA 1M2VB 1NXPA 2KJQA 2HWKA 4WOJA 2F17A 3QMWA 1PG5A 5DI3B 3S44A 2QV7A 4DJJA 4BVLA 1I8TA 3FBWA 3SSAA 3KUUA 5FAXA 1ULTA 1W34A 2YXDA 2ZI7A 2OP0A 5KVVA 1M2KA 3AEUA 1H69A 3N0RA 1K6JA 1X15A 3TWOA 5KUTA 5LP6B 4OUKX 1AB5A 2WG0A 4BV2A 5CG2A 4R1SA 4KE6A 4RIEA 2QTCA 4MYDA 4W8GA 2FN9A 4G0UA 3WRVA 2XUQA 4R81A 1SD1A 1N6IA 1KSGA 5BN5B 2YHSA 2XQVA 1YBAA 5C52B 1E3MA 3QWIA 4ZYXA 2XD4A 2I7DA 5FA5A 2H4HA 1YRLA 4JYMA 2GSWA 1FX0A 2VDNB 3FNFA 3L7DA 4MWEA 4RTNA 4RKFA 5JLAA 4H1WA 3Q3HA 3OJFA 3WBJA 1AF4A 1IDN1 1NP6A 2C77A 2QLJA 3BMNA 3T9DA 3LOUA 5LQRA 3SDZA 4KIUA 1FDVA 2PX5A 1KGSA 1WP4A 3GFQA 3ONNA 3OZVA 3AETA 3BFXA 3R5HA 2FPPB 4R3UC 4C04A 2PXAA 2VK4A 5K0NA 3EZ7A 4WZ6A 3LC1O 1BA2A 3P0EA 4RM3A 1XAGA 2HOQA 2AC2A 3ABSB 3PCXA 2YNMD 5CA0A 1O6ZA 3A10A 1YNSA 3DQZA 1SKUA 1JXQA 2IDZA 3EMBA 1UPTA 2JFPA 3BCHA 1MHPA 3FVTA 2J30A 2WWVD 3W0LB 4C7KA 4M6WB 5C32A 5AW8A 4OJNA 1ISSA 1VSTA 4OH1A 1Q77A 2GBPA 4CHGA 4Y2HA 1XUOA 4FMBB 2O50A 1TRHA 2V9ZA 3AL3A 3JAWB 4G5FA 5HK8A 1T9GR 2BI8A 2GM9A 2J3IA 4EDFA 1P9LA 3KBBA 2AFIA 5DIFA 1CR1A 1EVYA 3QELA 2WJ4A 1J49A 1E6WA 1RJ9B 1DKQA 1EGQA 2A1TR 2HWYA 2IU4A 1U9ZA 3HADA 3SC2A 2NU6B 4RZ3A 4K9LA 4V38A 3UAVA 3UAYA 3AW8A 3FRHA 3V7WA 4DKJA 2FEAA 2E4XA 4JELA 2X76A 3KHKA 3C7AA 4GBED 1NJ6A 2OXCA 2AEJA 3EVEA 4LDQA 4PSCA 1PHPA 5BYBA 3U3KA 1ND5A 1I3OA 4E33A 2FOLA 2WICA 4KQXA 5C9ZA 3LUAA 2J6CA 1VMKA 3MWEB 1OBCA 2FHPA 1PGNA 1YR7A 2KX7A 1W85B 4QUBA 1E1CA 2A0KA 2PKYX 4U7JA 2PZAA 1JHQA 3BIOA 5JD5A 3SJCA 2UUAB 2ACWA 3F3SA 3IURA 1ES9A 3UUFA 5I8PA 2FNAA 3A28A 3MJHA 5ICSA 1K98A 3FCAA 1Z07A 3HUFA 2QRNA 2QTWB 3QJ5A 3ZXUB 4BZQA 5JSZB 2IOQA 3TLEA 3HB5X 1WNTA 2ADMA 2FMHA 1RLOA 4R7ZA 3V00A 1PW5A 5LP6F 2HJ9A 2VATA 4AKIA 3KE8A 3WO1A 1YB5A 1O0CA 4DLNA 1UKVY 1TLTA 1A7JA 3LC0A 3SF8B 4BQSA 3WMRA 1GM5A 4G3XA 4J8PA 2O8FB 3TSWA 4NEGA 3LRTA 4E3WA 1QRUA 5BNTA 3LV8A 2QT1A 2FETA 3MXOA 2JD2A 4LRSB 4D02A 4M1QA 2WHQA 2RC6A 3EEBA 1USVA 5FIUA 4QGSA 5JARA 3HFJA 1IVYA 3ZDBA 1V8ZA 4IQ0A 3AF3A 3CINA 5FUMA 1LPMA 3FDFA 3MIZA 1BNCA 2ATVA 2FI1A 3MTGA 4Q9LA 4DIDA 1YZGA 2NAPA 1JDUA 2REBA 3KUCA 1VA5A 3A9WA 4LTNA 4RA9B 3G2PA 3IQGX 4ND8B 3WLRA 1Z8DA 3CVJA 3MAGA 3EGWA 1M8GA 1V1MB 2PK3A 3K9BA 4L57A 1FDWA 3E5MA 3FBTA 3ZQKA 3PTAA 4L6CA 3VNVA 3FUWA 4WY5A 1A9XA 4HO1X 4F12A 4I3GA 1U2SA 5DSXA 1SGWA 2DLNA 4U39A 1U2PA 3RIHA 2JJYA 3VZRA 2AJDA 1CY7A 3E4CA 3Q1LA 1LQUA 3WSTA 2GUGA 4WKGA 4Y2RA 1HEIA 4GECA 3UOGA 3W9BA 4GRIA 1Q20A 1MW8X 1EGVB 4RGQA 2BKUA 2HF7A 4ZQBA 2YWFA 4LDRA 1T9AA 1X38A 5AJHA 2WAYA 2FRDA 3UHFA 4HHEA 2ZBRA 1O0SA 2AG6A 4LNHA 4RM2A 3F49S 3VYRB 2PXXA 3CH5A 3BT7A 2CXHA 4PIPA 2HLPA 3VPGA 1IAVA 5ALGA 5AMXA 3TQOA 4HDMA 4ARBA 3CBGA 4XYGA 1SEPA 1E2HA 2A94A 4R2LA 3RUFA 4YNBA 1DGQA 1II9A 4ANFA 3CVOA 1OGJA 4U8HA 3EVFA 3X1KA 1TM4E 3DBRA 3K8OE 4QBKA 2GRJA 4E31A 2GKOA 3EZGA 1U9JA 4MQFA 5CX1A 2HA7A 4EF5A 2UYYA 2UUPA 3IP7A 4U2GA 3FX2A 4V39A 1E58A 4KMSA 3VC2A 3TW6A 3UO8B 4UU7A 1WXXA 1GHTA 1GL6A 1ODIA 3GUZA 4PXYA 5BWNA 2QGZA 2XXJA 1KYYA 1VJCA 3VO1A 1XF9A 5DX8A 1DHTA 3EDCA 5EMMA 4YUZA 4PBTA 3UZUA 5ITVA 5LR6A 1NXVA 3FHTA 1YD7A 2B5VA 3VXKA 1M1UA 1M2FA 1SU8A 1U8UA 2VF2A 3R0JA 5IASA 1B1CA 2IU6A 1WDWB 2PQ2A 3ZWPA 5EE3A 4EY5A 1VE9A 2M1XA 3L93A 3L8CA 4GOOD 4RDCA 5AJWA 1HLDA 3IDZA 2AOTB 4D3DA 4FKMA 5D7NA 3UHPA 5TQ0A 2PSEA 2J0EA 5D87A 3B36A 3ROTA 3GW8A 2ZJAA 1L7BA 2DUJA 4RBNA 3U5ZB 3CR7A 1Q91A 4Z3DA 1JA0A 1G0NA 4K26A 1CYEA 4NBVA 4EVIA 3ORSA 3MRSA 2VSXA 4UBLA 4D57A 3LBAA 2WG1A 5ELLA 1UL1X 2O8EA 1YTLA 4Z0NA 4C7XA 2DQ4A 4Z9BA 1Z88A 4DJ5X 4BFXA 1XA3A 4JJFA 4W1RA 1E1MA 3EGDA 1M5UA 1Z6GA 2PZJA 3NBAA 4I19A 5CAEB 1N2SA 1QGYA 4LDPA 2QTRA 4JKOA 3I9NA 4GPTA 4UM9D 5FOVA 3UMBA 2J46A 1N1DA 2NG1A 3WGUA 3IEVA 1T9CA 4LQLA 1IU9A 3OOHA 5EXXA 1N1EA 1UWCA 3DL4A 4IDEA 3BJRA 2GZRA 4DLRA 2FCAA 4BMYA 4XOUA 2A9JA 1P2GA 3A9SA 4RQAA 5K3AA 5JTTA 1U02A 2RGRA 5E1OA 2C5SA 3PZRA 5IRCD 5BWCA 5BW6B 1XN4A 4RNDB 5PGMA 1BDIA 4V3CA 3WAJA 1OZFA 2JRLA 3WP0A 1E1DA 1UK7A 4K6HA 1RBMA 4FX2A 5J23A 4MGKR 3N2GA 4Q05A 1RVDA 2XAUA 2ONJA 2ZJ4A 3V2IA 1MU0A 4PYMA 3EA0A 5KDDA 4WJLA 2IEYA 1VBMA 2C3YA 2R68A 4UOZA 4YT2A 5K6AA 1O0BA 1PJZA 3KO8A 3X2SA 3SSMA 3HABA 3WDSA 3FOZA 4ETWA 1Z4NA 1ADGA 4NBRA 2K6GA 4FN4A 1ZCZA 5FWNA 5EIBC 1K8QA 1ZI6A 3ACBA 5CR9A 2QUZA 1T36A 3L6DA 1B1AA 1V8FA 5EJ8A 4BUCA 1QDUA 2WHYA 3LUHA 4HDNB 2R65A 4MI3A 1ZGZA 2R1ZA 3MOSA 4F7DA 1GU1A 4LDAA 1DPFA 4B4KA 2IBTA 3SSOA 1NVMB 3RJ5A 3MZ0A 1M10A 2XNSA 4Y3UA 4HWTA 5L3ZA 1YZQA 4RTOA 1T5BA 3QXCA 2FWNA 4C4RA 2HBQA 3DL0A 3I9V6 1CQIB 3FPJA 1CY6A 3ZHQA 4EGSA 3R6DA 1B41A 4PCUA 4Z0TA 1QRRA 1KSJA 3ESCA 3ZNNA 3A37A 4ZO7A 4V24A 2YNMC 4GRDA 5BOSA 2W6ZA 3GXBA 4BNMA 1RQ2A 1O96B 1T0JB 2HV8A 2ZETA 3BF8A 3Q85A 2ALJA 2QMZA 4XDZA 2IYVA 3IQZA 2HDNB 3MTQA 3P2IA 1D7OA 3WKAA 1JJBA 4PC3A 2C95A 4UAUA 1R8XA 4GW3A 2CT8A 1HT0A 2RAPA 3JQEA 4QU9A 3QPAA 2J48A 3VOSA 1CXZA 1DWQA 4O1IA 3TRDA 3PI7A 5K4HA 1TC1A 2ZQYA 3VZQA 1LGYA 2DP4E 2Q4TA 2XAAA 1Z35A 3ANTA 3CU5A 1M72A 2PX4A 3QHQA 4V0RA 1FYDA 2EX0A 4ADSG 2WMNB 1ZR4A 3QVWA 4XASA 5F52A 4XSVA 2C3MA 2QU8A 2V65A 5JAMA 1ENZA 2DUMA 3LPCA 4EL5A 1XZGA 4GYWA 2IBMA 3VJKA 3WHPA 2Q6TA 4PPGA 3BA1A 4X54A 5FFMA 1SCUA 4UM5A 1M7HA 5KO2A 3R5TA 2OZLB 2YIDA 4F1WA 4ARIA 1I7PA 2J9FB 3GLVA 1R10A 4JC4A 3U2QA 5HCUA 1ZD4A 3Q2KA 2EF0A 3EQ2A 1LDMA 2H1SA 4IEFB 1UFQA 3AB7A 4TMYA 5IH7A 3ZEAA 1ZQ9A 3WKBA 1YQGA 3QLUA 1QP0A 4CQNA 2R8BA 1UMCA 4D41A 4EM6A 1L4NA 3RE1A 1TUGA 3SG0A 5ELXA 1W76A 2QOEA 3OBBA 2QS9A 3R9XB 2D4AA 3ZGXA 2HDOA 3PWSA 4LYJA 2Y3IA 1YOVA 3QF7A 1SXGA 3OZAA 3RUDA 1QCCA 4AAYA 3AEKB 2XNHA 2ZPUA 4NE7A 1DS6A 1Z4KA 4R84A 2ZYSA 4LTMA 4OLHA 1FW8A 5DYTA 3ONDA 4NXNB 2EL7A 3D7SA 2ZRAA 3AR8A 3ETDA 3OY7A 4WDQA 4A2CA 3CF2A 4E94A 1TU3A 3KKQA 4PZYA 4YC7A 1Y8RB 1MJHA 3HR7A 2H17A 3P9ZA 1KMHA 5B1EA 5IAOA 4CGZA 4JBLA 3BGOS 2WABA 2H2DA 4OUDA 2ETVA 4ATNA 4NECA 2E3JA 3WBKA 4BRUA 1IZ0A 3Q8LA 2DLCX 1A5AB 1VE1A 2A0FA 3BL8A 3OHPA 1RBYA 4ZGGA 3RU2A 4B3RB 1XDUA 1YS4A 2XCIA 1BMTA 2WWFA 3NCTA 4I9HA 4YBZA 3KSUA 1E2MA 3DHEA 5JV5A 4LHWA 3MJDA 4FVTA 4JLNA 1EJ0A 3WGZA 2C5HA 3GA0A 4P93A 2AC4A 4GX1A 1YQQA 4GL2A 3VX3A 1VQ1A 1ZPDA 5DCLA 3CLKA 4ALMA 1U1CA 2BMWA 2W8ZA 2NWQA 2YJGA 3OIGA 1XVUA 1LLCA 1ZYUA 2NAFA 4HH3C 4GSLA 3BXFA 2MSKA 1ZJJA 3LU1A 1F51E 4RPIA 5DNEA 5JY1A 1SG9A 4I55A 5B1HA 2P91A 1R66A 5KINB 3T7RA 3AM1A 1IUKA 4O2RA 4CF6A 3QY9A 3ZWNA 1T6NA 3SQMA 3CJRA 1DAHA 4TXLA 2AIRA 3DP9A 1Y4AE 3IEXA 3OX3A 3F9CA 3OQJA 5EIEA 1VBKA 3AUUA 3V4FA 3U4DA 1JW9B 2YDXA 4PTYA 5COQA 5DOVA 121PA 1F4PA 2I2WA 4EKYA 4BVJA 1DWUA 1TLLA 2BGNA 2JLWA 1FJHA 4I4TB 3O74A 4BGUA 1O89A 2Q1WA 4C7OB 4CMIA 2AKAB 5DLDA 1GGJA 4YI5A 1ZUD1 1XO1A 1WZUA 4RD6A 3UAZA 4BAUA 3ILHA 3KQMA 3IPRA 4K46A 3LLSA 1WMBA 2GD2A 2C0PA 4LJ8A 5EQFA 5HF9A 3U61B 3RK0A 3S99A 4YJ2A 1KVSA 3SIPA 3UOAB 1NFRA 1IEVA 3B3JA 3ML1A 4Q4JA 3W1EA 1GZ5A 4D9CA 4J1NA 2V5AA 3DB1A 4NICA 3I72A 2HIMA 4E0BA 2CNWD 1X7WA 3K5WA 3KU4A 1H1TA 3GBVA 1NI4B 1U0OC 3OH8A 5TV2A 4JEHA 4NK4A 3T0GA 3TLMA 1GPJA 1QO7A 4PM4A 3WX0A 3KOMA 1Z5GA 2AN4A 1FFYA 5JDIA 4RLSA 3DTVD 4ZHQA 2YV4A 5ICCA 3B9BA 4BO4A 3ZGVA 1E64A 1ZZEA 2WWGA 3ELYA 4O2BF 4B7CA 4DL9A 2WFLB 1JGTA 4YY3B 3DAOA 1WVGA 3QX3A 2Z43A 2IYOA 4C05A 2JI9A 5DV9A 3VR4A 4QU5A 3GUHA 4JWTA 1US8A 3C3DA 3GJRA 3R8FA 1CEXA 3BD8A 3FOAA 1MX3A 3EY4A 4MW7A 4TL7A 2WUDA 4C0SA 2KW5A 4Q1FA 3WMWA 4Q3LA 4IIUA 3E1GA 2WD7A 3C1UA 5IF9A 3EG5A 1XMPA 1GNSA 4WK4B 4YJFA 1U6KA 1UZUA 4BQPA 1JKIA 4CBVA 3FJOA 2JLSA 1VHWA 3SBEA 3X1XA 1P81A 1PR6A 4JOBA 4HGPA 2PLAA 1QP7A 1WQ1R 2C9BA 2CVQA 3UJHA 4QDUA 1WE2A 3DOOA 4BQOA 2DOKA 2A84A 2VWPA 4R83A 4F5ZA 2YOHA 3CSUA 3HV2A 4BEVA 1YR8A 1YONA 5B1YA 4LYDA 1CU1A 3R09A 2DWQA 4FPXA 2BEWA 4KNYA 2P79A 5AI4A 4AN4A 4Q4LA 4ZCTA 3NTXA 2J7PA 4WZBA 1W0KD 1Z8FA 1RFLA 5IDWA 4PZCA 4QQ8A 4UNRA 2A4KA 4GE0A 2YMLA 3U37A 3B3AA 2C7BA 4G5RA 5FLEX 2IHUA 5K8UA 1PJQA 4UQLA 2Q45A 4NTZA 3P4XA 4MI6A 2FE1A 1N75A 5B1SA 1FSZA 3V48A 4J1SA 3ITKA 3LDGA 3Q11A 4PAQA 4KXQA 1OA1A 2BF4A 4WECA 5SICE 2JGIA 1BEEA 1HTWA 1WG8A 2ERXA 4N3AA 5J59A 1AZWA 5JCOA 3KEGA 5AVSA 4QG3A 2JIPA 3ITDA 3T7JA 5FV7A 3TCXB 1D4AA 4B5KA 1GFIA 1E0DA 4NBTA 2PRZA 1NVWQ 2XZDA 2PG3A 5KYGA 2IA5A 3C98A 4UVGA 1LPNA 3BQNB 5ADVA 3LX6A 3B78A 3LY7A 4M8IA 2HQ1A 2G07A 3ZV3A 3EVAA 1DLJA 3QFRA 3B5EA 4G23A 4IX9A 4WOKA 1OU4A 3K94A 1KRHA 5DYNA 3WXMA 4E03A 2WU8A 5BW5A 1IG3A 5IBCA 4J1TC 1XLTC 4PZPA 3LUKA 2PJRA 1WMDA 4BX2A 2C5AA 2D3WA 2WMDA 5FP0A 4F04A 2JIZD 3BKWA 4KACA 4K28A 3OESA 1JDVA 1K0FA 1L9KA 3HB9A 2PX3A 3U4HA 2CHGA 1PT6A 2QIPA 2WC1A 3T9FA 4FZRA 1CR4A 2CLKB 5IH3A 3HB4X 4G1FA 3BGDA 2ZE5A 2R6HA 5BQ3A 5LQJA 1JG7A 2ZUCA 1R0WA 3KTAA 4Z1MD 1INLA 2HFJA 3I2FA 3NM4A 4H18A 4P4LA 3TAXA 4B7AA 5MDHA 3W2EA 1GNRA 3QYJA 1SUWA 4KQEA 1ZCJA 4GU5A 5TSDA 4LOIA 5C35A 1IRXA 4XDGA 4Q34A 2NW6A 1GY8A 1GVHA 1UBEA 2OG2A 4OQXA 4QKQA 3HY4A 5BV1A 3L82B 5EWMA 4FKBA 4HFRA 3ECSA 3KL2A 2NUAB 2WU3A 3CEAA 5FPSA 1OI7A 2R1VA 1QQTA 1C50A 3K0HA 2II6A 2Y27A 3GN1A 3Q1KA 2OOSA 4G8JA 1HQYE 4XEHA 1KYIA 3VBCA 1Y8CA 5E3HA 4DNPA 1SKYE 3PL5A 4G9GA 4F46A 1ZGJA 2HSDA 3EXFB 3JVIA 4KR6A 4HK4A 3O73A 1HZJA 1TEXA 1DHRA 3TVDA 1IMJA 1FX1A 5I9BA 4Q3AA 3EPKA 1ODCA 4B73A 4P58A 1LV7A 4WBNF 5GIPE 3L8HA 5K4GA 5ALVA 4U0KA 1FNNA 4OD0A 3EIFA 4FM9A 5LJLA 3VR0A 3GO4A 4B31A 4BQQA 4D43A 3WL6A 3A36A 3V3TA 3QPWA 4KHPB 1C7EA 3FWZA 5AVYA 1VG1A 2ZSUA 2GESA 1KJJA 5DMHA 1KBQA 4BCCA 4DT1B 3ELBA 3UXYA 5GV7A 3F5MA 1Z5ZA 3G8AA 1LPSA 3UWMA 2H57A 3DL7A 4FCCA 2QTLA 3ZZ1A 2PH7A 3R40A 1D03A 3BE4A 3IV7A 4D9IA 4E12A 1TUEA 1KEKA 1I2AA 2QAIA 3EIEA 3O90A 3KL4A 3AF6A 1IZ7A 2H08A 4ZVVA 4DDWA 5DTQA 3VYTB 2CLSA 1SM4A 2R6FA 4RSRA 3LSTA 1SUFA 4XWYA 4QGFA 1U65A 2DFKB 3L9XA 1KBZA 1V3TA 1YR3A 5KB3A 1KZ6A 3OCXA 2Q9CA 4I1UA 7AT1A 3L6BA 1NQTA 3BB3A 3OI7A 3R23A 4LCBA 1L5OA 2PV0A 1RXVA 2PMFA 1GWNA 3QXSA 2AQIA 3DCJA 5FPHA 4D8TA 5T67A 1KI8A 2QR5A 3FGNA 4G0NA 2PMEA 1CD5A 4C88A 1THZA 5D3MB 3BK7A 2JHGA 1Y33E 2PVPA 2NVUB 1H66A 2PPVA 3CC8A 4P5DA 4CR8A 2W11A 2ZSHA 1U8TA 3COVA 2YZ2A 3LLMA 5DLPA 2IIBA 1XZJA 4A8JB 1IPFA 1O7JA 5CIQA 2C2OA 1AQ6A 1K8RA 5JAZA 4KPUA 3THYB 4N49A 1XYGA 3TGWA 2XBLA 3M9WA 5IWCA 3I12A 1BAPA 2QD5A 4IG9A 4R40A 1B6TA 4YHHB 4S1PA 5L3QB 3KQSA 2DT5A 2PWBA 5TJHA 1VG0B 4J29A 1IIRA 3I23A 5AJYA 3MCTA 4EO7A 1FYVA 4Q47A 4ARVA 5LQCA 1SO8A 4QJ3A 3L6CA 2IS1A 2XQKA 4Y2XA 3QHAA 3L84A 5A4DA 1OUMA 1IPHA 1O97D 4UREA 4W4TA 4S1OA 4URXR 4QM7A 4TM8A 1T2UA 4LECA 2UUOA 4BKMA 3G2IA 5KMGA 2KSQA 3P0JA 4EJ6A 3BSWA 3ONWA 4GPEA 4CDRA 1IY2A 3ROZA 3ZXYA 4ARZB 1KQNA 1B3RA 4I36A 4L8WB 5H3LA 3QF4B 4KGDA 4Q1EA 2X9GA 4J0KA 3R7NA 4QQFA 1QVZA 4EG4A 4UQOA 1FDTA 4RH3A 4KV9A 1J7JA 3VZDA 4CODB 5JECA 2XMGA 2F43B 4QUGA 3FAZA 1THTA 1HE3A 3QUBA 4XIFA 1XMVA 1NW5A 3KXKA 2ZROA 3Q15C 4G67A 1V3UA 4H7KA 3FNQA 3PUWA 1CHNA 2HO4A 2P8JA 5FUXA 1BWPA 4KR7A 3N8KA 4MV3A 2F8MA 2OBMA 2QD2A 2W0SA 3O8QA 3QG5A 4NZNA 3IVMA 4INOA 4GC9A 2ORYA 1P3JA 1ZVJA 2DSTA 2O5EA 2R62A 3Q10A 3DWEX 2GVDC 4BLTA 5FFFA 3WWYA 5D5HA 1CZOA 3R5KA 5KYYB 3KWMA 1LKZA 4FIZA 1KO8A 5FWAA 3AVUA 4M0MA 1JR4A 4CF4A 2W8BA 1N2JA 2X7JA 4HOYA 1ZH6A 3LD9A 1QIGA 3VC3A 2CE2X 1MBZA 1VI2A 4MIOA 4WY2A 1LRKA 3NH9A 4HKTA 5ALIA 5L6MB 2PH1A 4U5QA 4LXGA 2GWHA 3HMKA 3TW8A 4AJPA 5B64A 3D8UA 3EXHB 2OCLA